4NSTA

Crystal structure of human cdk12/cyclin k in complex with adp-aluminum fluoride
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
331
structure length
322
Chain Sequence
ESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cyclin-dependent kinase 12
publication title The structure and substrate specificity of human Cdk12/Cyclin K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transcription
total genus 98
structure length 322
sequence length 331
chains with identical sequence C
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2013-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4nstA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4nstA01
4J53A 4I6FA 1KE8A 4O81A 4F99A 5DLSA 3FMNA 4RX9A 4X2KA 3LFAA 4ACHA 1FVVA 2W4KA 5HGIA 1WVWA 1WAKA 3OMVA 4I41A 4IB0A 4IX5A 4XS2A 5EI2A 3PP0A 3ZC5A 2JKOA 5CSXA 5JN2A 1CM8A 1YVJA 1XH9A 2Y0AA 4YLJA 2XM8A 4PRJA 4U45A 5CU0A 4IM2A 4L45A 5D9HA 3AOXA 3W55A 5AP7A 1J3HA 2PWLA 3E7VA 3G0EA 1Q24A 4DA5A 3AC4A 5DYJA 4EKKA 3OW3A 5EM7A 3F66A 1YDTE 2XBJA 3FBVA 2H96A 2CNUA 1PXPA 3VW6A 4RVTA 4DFXE 3PJ3A 3O96A 3HV5A 4BWKA 2CHLA 3ULIA 3LJ1A 2ZDTA 3MV5A 4RJ8A 4O82A 3EFJA 3MJ1A 3AXWA 4ZTLA 5HNBA 3R8VA 2PUPA 5B2LA 5TE0A 5DRBA 2C6LA 3QC9A 4AT5A 5CENA 4YZ9A 3OCGA 3GEQA 4HGSA 3DJ5A 3N51A 4QTCA 3RINA 2B53A 1R39A 3QALE 4FVRA 4O2ZA 4II5A 5AR8A 4ZJVA 5DFPA 5LVMA 3EQDA 4PMTA 3ZZWA 3RHKA 3ZO2A 5JZNA 4NWMA 3EN4A 2V22A 4G31A 3QZGA 4Z9LA 3VUIA 4M0ZA 5IA4A 2W7XA 5TO8A 5KKRC 4GT5A 4QP4A 5DN3A 4U3YA 3DAEA 2JKMA 4J71A 4D28A 3QQFA 3GUBA 5ETCA 4USFA 3NYNA 3UC3A 1GIIA 4UWYA 4IAKA 4ALVA 1P4FA 1ZWSA 3DNEA 2YHVA 4XP2A 4YHFA 3ZHPC 3SKCA 4MEDA 4I0RA 5CXZA 3A2CA 3GCUA 3WF9A 2OXXA 4O6LA 2WTKB 4QMPA 4ZMFA 2BRGA 4BDIA 5HZNA 4G9CA 4GSBA 2VTQA 3JPVA 3LXKA 3NGAA 3E8NA 5C03A 5T68A 4HYUA 4KKEA 5L8JA 4QPAA 4PP9A 3TZMA 5HTIA 4FUYA 3ANQA 4NFNA 2PZ5A 4PY1A 1J7LA 4RIYA 4RC4A 4GT4A 1G5SA 1ZAOA 2C4GA 5FWKK 4LRKA 2Y7JA 4PMSA 3MGYA 3NAYA 4CEGA 3PWYA 4E8AA 4XLVA 3MJ2A 2YDIA 2C0TA 4DYMA 1H1QA 2PVLA 1BYGA 3JS2A 4DGMA 3ZZEA 4U40A 1OITA 2HZNA 3FE3A 3Q96A 3ZRMA 2DS1A 4FEUA 3Q4UA 5IQGA 2IW8A 4EWQA 4X0MA 4AT3A 4L3JA 4L6QA 5EQEA 2GHGA 1WBWA 3DXNA 5CX9A 1CMKE 3DQWA 4FSZA 4BIEA 3EN7A 1JSVA 4F9CA 2BAKA 3MFSA 2J0LA 3R21A 4Y85A 1Q99A 3D83A 1WBOA 2J50A 3PWDA 3U6JA 2G2FA 4I5PA 2PVKA 2Y9QA 5LCJA 4F08A 3JUHA 2ONLA 1XKKA 5DEYA 2C68A 3PXQA 2XK4A 2GNGA 5DIAA 4O86A 3L8SA 4EH3A 3NVKI 3HRBA 3F6XA 5HBHA 3OEFX 4IWQA 3UYTA 4FKVA 4UBAA 4CQEA 3KRRA 4ZSEA 4S32A 2QO2A 3NZ0A 2X9EA 3B2WA 4IX6A 3LFNA 4RFMA 1SZMA 3D5WA 4QP6A 3R1NA 2RG6A 4RG0A 2HZ0A 3LLTA 5EHOA 3V5PA 3MH2A 4I23A 4RX8A 3DDQA 1SNXA 4OUCA 4JBOA 5C9CA 1CDKA 4EC8A 2UZWE 2BKKA 4ZP5A 2WD1A 4FIGA 4LL5A 4L52A 5A46A 1BX6A 5FUTA 2HK5A 4IAFA 2WTIA 4FT5A 5CF4A 3IDPA 3QTWA 4KBCA 3EZRA 4Y73A 2XKEA 1KSWA 3P08A 3LFSA 4FTOA 2FGIA 3KRJA 3JXWA 3PXKA 1GNGA 3OF0A 2XCHA 3UYSA 2GCDA 4F63A 3P4KA 2QOCA 3WF8A 3ZEWA 4DT8A 2XYNA 4XEYA 5CU2A 4L53A 2UZOA 5DHJA 5H2UA 5CEMA 4W8DA 3KXGA 2F49A 2PUUA 3P78A 4O0VA 3KCFA 4FKPA 5HICA 2BDFA 4P7EA 2VO6A 2X39A 3U4WA 1FMOE 5ACKA 4F70A 4RA5A 3R9DA 3AD5A 2VTLA 2C6MA 3W33A 4AUAA 1M52A 3PTGA 4KRCA 5A6NA 4CTBA 3R8MA 2CMWA 4QYYA 3E3BX 4C4JA 3FYJX 1FQ1B 2X6EA 3I5ZA 3ZLXA 5JFVA 1K9AA 3PA5A 3WARA 5KMMA 3IW5A 4YR8A 3PLAE 4JNWA 4TN6A 4KABA 4M69A 3UVPA 3DDPA 1CKJA 1PW2A 2IZUA 4FTLA 3R7YA 3ROCA 5H8BA 1PHKA 3PJ2A 2V7AA 4TPTA 1OL2A 5LVLA 5JGDA 2KULA 5E9EA 3M11A 1UNLA 1R0EA 2Q0NA 2YCSA 3QXPA 3GC9A 4TYHB 2PUIA 3NPCA 4MXXA 4BGQA 4NW6A 4OAUC 3GFWA 4GIIA 3AD4A 3LCSA 5HESA 4ZSGA 3RCDA 3RVGA 1JKKA 3A8WA 4CFUA 2GTMA 2OJFE 4R78A 1VZOA 4FV0A 4XBRA 3W32A 2F2UA 4FKGA 4I93A 5I3OA 2OH0E 4C4HA 1PXNA 4I0TA 3HRFA 4QO9A 5E92A 4X6QC 4CT1A 1XH6A 4FTQA 4KAOA 5F94A 3BELA 3PG1A 2UZEA 4JG6A 5AUWA 3VS0A 4CFFA 1H0WA 4DTBA 2Y4IB 1OECA 4XG7A 2Z02A 4ID7A 4AW0A 3QQUA 1GZOA 3W2QA 3O8PA 5C4KA 4DITA 3A61A 4E4LA 4FVQA 2QHMA 4GS6A 4PL5A 3FZOA 2PVJA 5E90A 2YM3A 3TNIA 2R64A 3ORIA 2YLEA 4LG4A 3UOLA 3BU6A 4YGAA 1NXKA 3C4CA 4DFBA 3NIEA 1YKRA 3PE1A 5J9LA 3PRIA 3W10A 3FZTA 4UMPA 1QCFA 5DNRA 3NS9A 2VO3A 2OIBA 3BHYA 4IZYA 1FINA 2O63A 4O0TA 3FKLA 4FA2A 1U5QA 3KGAA 5LQFA 4MXZA 5IUIA 4IANA 2WU6A 3MS9A 5IH4A 2WTVA 3D9VA 2YITA 3C0IA 1KUTA 2F7ZE 3EN5A 5D12A 4FX3A 3IGGA 3W2CA 4FTJA 4G3EA 1O6KA 2R4BA 4BI1A 3S4QA 3D2IA 3FMEA 4XG9A 3F3WA 3GI3A 3NRMA 4RVKA 4DINA 3P7BA 4G3GA 2QOIA 3IO7A 5AIKA 3M42A 3RHXA 5A54A 1NVQA 3TCPA 4QPSA 4EYMA 5FP6A 3GOPA 4I24A 4ENXA 2VX3A 4FKSA 4NIFA 4DFUA 3SRVA 3VNTA 3LLAA 5GIPE 2R3PA 3RAWA 4NH1A 4DEBA 4JLCA 4N57A 3NNUA 4MKCA 4DGLC 4B9DA 4EQUA 1SVHA 2HW6A 2AC3A 1Y8GA 4IADA 5H9BA 2I0EA 3O7LD 3FLYA 1H00A 4A4OA 5IQIA 2RIOA 3QU0A 2BVAA 3DBQA 3G6HA 3EHAA 5DGZA 4K77A 5CF8A 1ZY5A 2VX0A 5IDNA 4UMTA 5M4IA 1H08A 3MYGA 1ZYSA 3MDYA 1Z57A 1VEBA 5AJQA 2PVRA 3ROYA 2CGVA 4XOZA 2ITYA 3Q2JA 2B52A 2QU5A 2WKMA 1V0OA 3GU7A 3ORLA 5CU3A 4GCJA 4BCFA 3OEZA 4P5QA 3VS6A 3KY2A 4P90A 2X81A 3OXIA 4KD1A 2ITOA 3IG7A 1J7IA 1Q41A 3PUPA 5HG7A 3I7CA 4JDHA 2JIIA 3HKOA 2RF9A 4FT0A 1JLUE 2JFMA 3EYGA 5IMEA 4RIXA 4M8TA 4FV3A 3UVRA 3VC4A 4MXAA 3RZBA 4DC2A 3QYZA 3PSBA 4U79A 4YLLA 3BU3A 5GHVA 4BF2A 3ZH8A 5JQ8A 3SXRA 2P55A 5FEQA 3LFCA 4EHVA 2IPXA 4RLLA 2XB7A 4CV9A 4HVGA 2XK7A 4P2KA 5AUZA 1OIUA 4QP3A 3OOGA 3LIJA 1WBVA 4FEWA 3BV3A 3ZSGA 2YZLA 4PTEA 2VX1A 3QL8A 2QKWB 3ZCLA 3U51A 1Q97A 3FMHA 4UWCA 1I44A 2EXMA 4BGGA 3UPZA 4FOCA 4IB3A 2I7QA 5CS6A 3O2MA 3VHEA 2CJMA 3DFCB 4MAOA 2VTSA 4QMUA 4O7RA 4MTAA 2JKQA 4W9WA 4FV8A 4EZ7A 1OUKA 3R7EA 1NY3A 3TUDA 3LCOA 1GIJA 4L46A 4QTAA 1A48A 4F4PA 5JK3A 4U8ZA 4ORKA 5BYLA 4FTUA 2YIQA 3PXFA 3O8UA 2OXYA 5TF9A 3VUTA 2C5YA 2WNTA 1Q8TA 4OW8A 3SOCA 1OIYA 4FIHA 4CRSA 4DF3A 2BAJA 3DKCA 3CPBA 3IONA 4GYIA 4J96A 4QQCA 3ZEPA 2J5EA 4IWPA 2JDTA 4JR3A 3RNIA 3TV6A 4HVSA 3EOCA 2PUNA 3BLQA 5HU9A 2VTHA 4XG6A 4PNIA 2B7AA 3RP9A 4MD9E 2HAKA 4YURA 1NA7A 3CGFA 3MIYA 3S2PA 2FSMX 4BWXA 4CSVA 5IEVA 3CBLA 2HXQA 3EWHA 2OSCA 4U44A 3VBXA 1X8BA 1M7NA 2BZKB 4IFCA 4K11A 4EK8A 2W5AA 4QMOA 4UMRA 3FMJA 4UZHA 4NU1A 2C6IA 2BRNA 4HCUA 1PKGA 4BDFA 1Y91A 4I4EA 2OG8A 5A4EA 3ZRKA 4YHTA 2FYSA 3PVWA 4G5JA 3DAKA 5IQHA 1J1BA 1Q8ZA 2WTJA 1L8TA 5KMNA 1R0PA 2YCFA 5ETIA 3DK3A 3SXSA 3IKAA 3A60A 4X2GA 5T3QA 3E64A 2UZNA 4ZTQA 4K18A 2WMXA 4QTDA 3FC2A 1UV5A 2J0JA 3K3JA 2OFVA 2WGJA 4IZ5A 2YCRA 4KKHA 3WE4A 1UNGA 3CIKA 4I20A 4LGDA 4OTFA 4UY9A 3ZXZA 4W4YA 4D2PA 1W0XC 3UOJA 4H1MA 3UNJA 3BLHA 2YM6A 4EONA 4E4XA 3FXZA 5ANGA 2GTNA 5HG8A 3VS3A 4EZ3A 2QOLA 2C3KA 3ZLSA 3UNZA 2J51A 2UW5A 3MPTA 4V0GA 4WG3A 2P0CA 4F6UA 3CC6A 2YIXA 4Q9SA 3ZUVA 5KZ0A 3OXZA 4PDPA 3N4VA 2ERZE 2PVNA 3LCKA 2YERA 3M1SA 4ITHA 4USEA 2XCKA 4I5CA 4E6CA 3BEAA 4L3LA 2OFUA 4E7WA 4DEAA 4O91A 4YZMA 4JBPA 4RGJA 4RVMA 2WOUA 2X2MA 3V04A 3VF9A 3QRIA 2DWBA 4LV8A 4M3QA 5HHWA 1P4OA 4C4IA 4E26A 2JGZA 2YWPA 2G9XA 1Y6BA 2B0QA 3FKOA 4TW9A 5AP1A 4ZK5A 1PXLA 4DBXA 3QTIA 1AD5A 3WI6A 2WEVA 4R5SA 3RM6A 5IEYA 2ETMA 4NM7A 3TNHA 3G6GA 2C47A 5HO8A 3C5IA 4PWNA 3UMXA 2WMVA 3F88A 2XIYA 2DYLA 2A0CX 3FC1X 3JVRA 4FVPA 3BYUA 2X9FA 3QRTA 4X2NA 1GOLA 2HW7A 5HVYA 3G5DA 5B0XA 2G01A 3EFLA 2A4LA 1P14A 4KIQA 5CI7A 4IAYA 2XNOA 3UMWA 2V62A 1ATPE 4F0IA 4WRGA 3PP1A 1DI8A 3NYXA 1RQQA 3P9JA 1M2RA 2GHMA 3BZ3A 1ZYDA 3QRJA 3QKLA 4L3PA 4ZJJA 4C4EA 5I5ZA 5IPJA 3LMHA 2C6KA 1HCKA 3PPZA 5EQPA 2W1GA 3F3VA 4ZXTA 2BZHB 4WT6A 3CJFA 5EYDA 3RZFA 2BFXA 3FI3A 2UW4A 3VJOA 2A1AB 3IECA 4XBUA 3ANRA 3ZBFA 3F7WA 4R1VA 3NYVA 4GU9A 4IVAA 3VS7A 2W99B 3H0ZA 4AGCA 3LKMA 2YABA 3QYWA 3BRBA 2GNJA 3OXTA 3F9NA 4EQMA 1TQIA 5M55A 2C30A 3GENA 5KMJA 4IC7A 3D5XA 1WBTA 5IKWA 4BL1A 4KBKA 4BCNA 2WMWA 1PXJA 4QMXA 2EU9A 2I40A 5FXRA 1UWHA 5J9YA 4W9XA 3U55A 2VWBA 2Y6MA 4I5MA 2C5XA 4F9WA 4FKOA 5EW8A 2PZPA 3F3UA 3UIXA 4F7SA 3FXXA 3DZOA 3PA3A 3GC0A 1WVYA 2W17A 2C3IB 2PVFA 3QKMA 4GJ3A 4XNEA 2B9JA 4OTGA 4APPA 4CZYB 1SVGA 3FLZA 1J91A 5F9EA 5IH5A 4FL1A 1NW1A 4H58A 3Q6UA 4FKWA 4MYGA 4NFMA 4EJNA 2KTYA 1PMNA 3R9OA 4C57A 5LMBA 3R71A 1YI3A 3PJ1A 4LGHA 4M67A 4EH2A 4R1YA 3QZIA 4KNBA 3PVBA 5CSVA 2UUEA 3DBDA 2V5QA 4BDJA 4D5KA 2X4ZA 4ALUA 1XO2B 3ZO3A 2E2BA 2CKPA 4C33A 5IA0A 4X3FA 4JJRA 3DFAA 3OBGA 3PZHA 3QGYA 3BE2A 2O5KA 4OBPA 4OTWA 1WMKA 3WYXA 4JRNA 3ORZA 1AGWA 4A9YA 3F5XA 1H28A 1Q3DA 5ETAA 1R1WA 3WZUA 5E8YA 2F7EE 1W7HA 5I9WA 5EFQA 3TXOA 2R9SA 5D11A 5HKMA 3C0HA 2B9IA 4G17A 3C51A 4XP0A 5B2KA 4ARKA 3FMMA 4KA3A 3R83A 1MQ4A 5A4TA 3PVGA 4S34A 4FG7A 2J0IA 1FGIA 3GU8A 5FXSA 3HVCA 5EW3A 3C4WA 3KF4A 4FNXA 5AWMA 3IOKA 1MRYA 2E9UA 3D14A 3R7UA 1ZMWA 3LOKA 3V5LA 4CZTA 3DGKA 4AE9A 3PG3A 2GS7A 3Q53A 3TKHA 2BRBA 5K4JA 1GZNA 3MH3A 4XH6A 5F4NA 5L6OA 2OH4A 3Q9YA 4RJ7A 4NKSA 4HNIA 4G3DA 4IQ6A 5EOBA 3L1SA 4IXPA 4MNFA 1YI4A 3AMAA 2X7FA 3HEGA 3VUDA 2PE1A 2G15A 4ZIMA 2X0GA 3BEGA 1LPUA 2CLQA 5EHLA 4AZSA 3MTFA 4OT6A 5I9VA 3R9RA 3EFWA 3ZO4A 4YJOA 1IG1A 1SVEA 3HRCA 2Q83A 1KE7A 3GQLA 3I4BA 2VTIA 5HO7A 4K33A 4FTCA 3SG8A 2UW9A 3SC1A 4FEVA 2C5NA 5CY3A 3GCVA 3R04A 4WO5A 2JBOA 2R7IA 5LVPA 3W16A 2PPQA 4JAIA 2BR1A 3O50A 4FC0A 4DE4A 1H4LA 4PQNA 4HVHA 3FJQE 5EI6A 1JPAA 3L9MA 4WOVA 4KWPA 3VF8A 5ANJA 2REIA 3W18A 3CQEA 4FI1A 3ITZA 3LFFA 4FMQA 3OWLA 3WF5A 3QCQA 3UO6A 4C4GA 3VBWA 3COMA 5CU4A 5TKDA 4LOPA 4FSYA 4XYFA 4L7SA 1B39A 3L8VA 4I21A 4U6RA 3BX5A 4RIYB 3FHIA 1E1XA 4K6ZA 4LOOA 2YDKA 4AN2A 5H8GA 1CSNA 3VS5A 3WZKA 2GDOA 4EK3A 5ANEA 1PJKA 2A2AA 2BIYA 2QU6A 3OVVA 4RIWB 4FTAA 5DA3A 4BCGA 3QD2B 3Q3BA 3QTQA 2QHNA 3UGCA 3DOGA 5HEZA 4HVDA 4S2ZA 1H1PA 5AP4A 1ZYCA 3EH9A 1XH8A 4I1ZA 4NK9A 2IW6A 1ZRZA 3QCXA 4WSQA 3MSSA 3NUAA 4E5WA 2JBPA 1EH4A 4XV3A 3LQ3A 3POOA 3DBEA 4D2SA 3O8TA 2QONA 4R5YA 2BDJA 1YRPA 4XV2A 3LM0A 4QD6A 2XMYA 4QQJA 3RJCA 2A19B 2QOKA 4O0YA 2WMBA 4IWOA 4FR4A 1IR3A 2ONLC 3OZ6A 3LVPA 3BV2A 3ORKA 4YO6A 2UW6A 3RAKA 4G5PA 4TXCA 4KSQA 4U0IA 2RFEA 4RQKA 4C61A 5CEKA 4LRMA 4F1TA 5CZHA 5BX0A 3ZS5A 5IUGA 4CT2A 4ZLYA 5IQBA 5AM6A 4V04A 3S00A 1QPCA 2WXVA 4F9YA 1JWHA 3QHRA 2H6DA 2JAVA 3HV4A 4OBOA 4O7TA 4ZLOA 2Z7RA 3GVUA 1APME 3LZBA 3W2OA 2R0IA 4OTDA 2HCKA 2IZTA 4OBQA 3PSCA 4W8EA 4A07A 4AX8A 3ORMA 3NEWA 2IG7A 4YTIA 4G6LA 2XM9A 4IE9A 1OL7A 4NUSA 3R30A 4EL9A 3VBYA 1U59A 2NP8A 2BHEA 3EKKA 3Q4TA 4QP2A 3AC1A 5AV0A 4HCVA 4GK2A 4QMQA 4EK6A 5C1QB 5KKRB 4HGLA 3L8PA 4LUEA 4RFYA 1DM2A 5JMSA 5M09A 4ERKA 4QMZA 4BBEA 5FD2A 3R1SA 3V8SA 5AR2A 4EKLA 3HP2A 4D4VA 5GJGA 3WIGA 3ZC6A 4CLJA 2GQRA 2XJ1A 1V0BA 4FNZA 2I0VA 3HDMA 4PPBA 3TNPC 2OLCA 5CASA 1XHAA 3R7VA 4GJ2A 3TIZA 3U6HA 4A4XA 4AOJA 2OF4A 2GU8A 4TYJA 2JEDA 5L2WA 1SMHA 3QTUA 5AR5A 4GUEA 3NLBA 5AAGA 3KN5A 4PMMA 4YJQA 5F1ZA 3SLSA 4D9UA 4G3CA 5ETFA 4D55A 4O0UA 1H24A 2R7BA 3KEXA 3ENHA 3NCZA 4PF4A 4A7CA 4YJPA 5ITAA 2UV2A 3FLSA 3ZLWA 5CVGA 1IAJA 4FSNA 2G1TA 3ZTXA 3E8DA 4ZSJA 5E4HA 4IVCA 2C3LA 3EQFA 4M69B 1JVPP 4BKYA 5JKGA 2ZVAA 4U81A 3A7IA 3CY2A 3CTJA 4R3PA 2WTCA 1ZOHA 3PSDA 4EYJA 4FTTA 4YZDA 4HOKA 4ZJIA 1GIHA 5L2TA 3VUMA 3Q4CA 4J52A 4R3CA 5JZJA 4AGUA 4F6SA 4ITIA 4EOPA 3R01A 3DAJA 1BI8A 2PMNX 2IJMA 3C0GA 3FDNA 4DLIA 5JGAA 4PDYA 2CGXA 4MK0A 3TACA 3ZUTA 2R0UA 4YJTA 4AGWA 2HZIA 4BC6A 3K5UA 2C69A 4EOJA 4YNOA 2PMIA 2YM8A 5FM3A 1H1SA 4YPSA 3GB2A 5M07A 3MVJA 4AA0A 1Q4LA 2OGVA 3LFBA 1YQJA 3FY2A 4L7FA 4R6VA 4YSMA 4AXAA 5BVKA 3ACJA 3MY0A 1OKWA 1H01A 5M51A 3OD6X 4JR7A 4R7IA 3EL7A 4OTQA 3WYYA 4KIOA 3AT3A 4BCMA 4ZSLA 4F9BA 5AA8A 5IH6A 3QF9A 5L8KA 1RW8A 3FQSA 2BZJA 4GVJA 2NRUA 5C27A 4TZRA 4PTGA 3F5GA 2OIQA 2O3PA 5EYCA 5AV1A 4EORA 5A6OA 3HA6A 3Q9XA 2PE0A 3HV6A 3PIXA 4RBLA 5KZIA 5LCKA 4NJ3A 2OZAB 4O7LA 3OY1A 1BLXA 5J5TA 3P5KA 4U42A 2DQ7X 2XIZA 2CN5A 4PDSA 4IJPA 2PSQA 5L3AA 4UWBA 5HI2A 2YN8A 4RJ6A 3GXLA 4GRBA 3MN3A 1JKSA 1PXIA 4Y95A 1MRVA 5D7VA 4EK5A 3AG9A 4MBIA 2QVSE 2OO8X 4R3RA 4KIPA 3KVWA 2X6DA 3FI4A 3GFEA 3QFVA 4WSYA 3DXPA 4CYIA 3F3TA 4N6YA 4RX5A 2CPKE 1R3CA 2QOFA 2ITPA 2VWVA 4FTNA 2YLFA 4M15A 4Z7HA 4FODA 5HLPA 3COHA 3VQHA 3GNIB 5C26A 4AN9A 3E8CA 3BQCA 4FSWA 4YHJA 2ITTA 5CQWA 1ZMVA 1QPDA 1P5EA 3H0YA 3MPMA 3GT8A 2YM5A 2XA4A 4NZWB 4NIFB 4V05A 3SRVB 2W5BA 4QMWA 5FTGA 5DT0A 2F7XE 5AR3A 3P79A 3LFQA 3HZTA 4I4FA 5EG3A 4X2FA 4D0XA 4FNYA 2V7OA 1LEZA 2XUUA 1KE9A 3U6IA 4GYGA 1XH7A 4FEXA 2Z60A 4Y8DA 4EH5A 3KA0A 5BVOA 1STCE 5AX3A 1SYKA 1LP4A 3LPBA 4OLIA 4DCEA 2IWIA 5AP0A 1MUOA 2YDJA 4BDEA 3OCBA 1M2PA 4GG7A 4H3BA 4U7ZA 1JQHA 2R2PA 3MY1A 4QT1A 4AA5A 2X7OA 5L4QA 4ZTSA 4B7TA 5HVJA 3THBA 3HMIA 1XH5A 3V8TA 2R3MA 2Z2WA 4D0WA 5KNJA 4IX4A 1W98A 3H10A 4C38A 4YSJA 4UYNA 3R6XA 1W8CA 2VWIA 4JI9A 2QD9A 2PYWA 5CVHA 3ZSHA 3TV7A 1PMEA 5EM8A 4O7VA 4CQGA 3KL8A 5ACBC 4NM0A 2W06A 4QMMA 3JYAA 4LRJA 4CVAA 1BL6A 4QMVA 4CFXA 4IEBA 2CCHA 2FH9A 3R63A 4WKQA 3BYOA 4XUFA 4BTJA 4FGBA 4RIXB 4K8AA 4RFZA 4FG9A 4H05A 2GMXA 4MHAA 5J7HA 3P86A 1KOBA 1PXKA 4JQ7A 5KO1A 3Q5IA 1Y8YA 3BYVA 3HP5A 3DTCA 1FBNA 3LHJA 1PXOA 4WUNA 2J9MA 3OWPA 3ZLYA 3UO4A 2XNBA 3AT2A 2C1AA 4C35A 4D2TA 3TI1A 4EOOA 5DOSA 1ZOGA 4CMTA 2W9FB 4C2WA 5BUIA 5BVFA 4Q2AA 5CEIA 3WOWA 4K2RA 4A4LA 2UW8A 3V6RA 4C59A 5A14A 5FXQA 3DK7A 2WMSA 4NTTA 3VO3A 2BILB 5DR6A 5CU6A 4C4FA 3FL5A 2WMRA 5FBOA 4NW5A 4AFEA 4ANLA 4CGAA 5IEXA 4XV9A 5K9IA 2CKQA 5AAEA 3MPAA 3U9CA 2JIUA 3HMOA 3V5JA 4ZLZA 4ZTRA 2UW0A 3Q9ZA 4IH8A 1WCCA 2PE2A 4EOMA 5JRQA 2VTNA 1L3RE 3E8EA 3O17A 1XR1A 3SV0A 5B7VA 4DEDA 3NW7A 3R2BA 2R5TA 2QC6A 3EKNA 3LW0A 4NKAA 4UV0A 1OZ1A 3KKVA 4ZS0A 3ZFYA 4BYJA 4IWDA 2ETKA 3Q60A 4WNMA 5DH3A 5H3QA 5J5SA 2PZIA 4Z3VA 5AV3A 4AE6A 1JKLA 4I6HA 5EM5A 4BB4A 4ZTMA 1PRYA 3ERKA 2EXCX 3LMGA 4J99A 3HUCA 2H9VA 2BAQA 4GVAA 2OJ9A 4O1OA 5CI6A 5C8NA 5LWMA 3SAYA 4DN5A 5FLFA 2JIVA 1PYEA 4YJRA 3QTRA 4BDBA 4CG9A 2VTPA 3FMLA 2J90A 2AC5A 4ONAA 4FZ7A 4C3FA 3NX8A 1OIRA 2CGUA 4XRJA 3GCSA 3MH0A 3MFUA 2QG7A 2UW3A 5I9XA 2JDRA 3CJGA 3H30A 4AZTA 4C3RA 4QOXA 4U97A 2ITXA 5GZ9A 4JDJA 3OC1A 3PJCA 3AD6A 4RMZA 2FO0A 3T3VA 2VWUA 3K2LA 4HVIA 4WRSA 4FV7A 4EZ5A 2EB3A 2R3LA 2PVHA 4PPCA 2IVTA 3FLQA 5K3YA 3BWFA 1UA2A 4FSMA 2QOQA 2C0OA 5HE2A 4KBAA 2QR7A 3GU6A 3QX4A 4K0YA 4RC3A 4BIDA 5HG5A 3EQPA 2HY0A 4EOSA 4QQTA 4FKQA 2QI8A 5DE2A 4ZZNA 3GCPA 2HYYA 4AOIA 5BVWA 4KS8A 3NVMB 2EWAA 5LMAA 1BMKA 2RGPA 1Q62A 2YAAA 4E20A 4F9AA 5GJFA 4FKIA 3F69A 4CKJA 2WB8A 4ACDA 4CYJA 3KRWA 2OJJA 3UP2A 4MQ1A 5I9YA 3DKFA 4NM3A 3UBDA 5AP5A 4DGGA 4RSSA 1WBNA 3ZDUA 1Q8WA 1YI6A 5HIBA 4XCUA 2QOHA 4AZEA 2IO6A 3LXNA 1PMUA 1HCLA 5L6WL 4BCOA 3Q9WA 4X21A 3QAME 4PUZA 5IA1A 4TYIA 4E4MA 4UXQA 4BZDA 4U41A 1VYWA 1G3NA 3E62A 4JX3A 4FZDB 5HO6A 5EDQA 2C5VA 1AQ1A 4JIAA 3TIYA 4EH7A 1NVSA 4FT9A 5M53A 2C6OA 3NUNA 3UZPA 4KRDA 4PL4A 3UOKA 3JR1A 1UU3A 2JDOA 2W4JA 3QLGA 4D58A 3W2RA 4LOQA 5TOZA 1REKA 4D1ZA 2QOBA 4HPUE 4CFWA 2WELA 5AUTA 3TV4A 2OI4X 1GJOA 3RNYA 2GS6A 3OWKA 4JAJA 3GCQA 4XX9A 4NSTA 4WHZA 5CAVA 3CXWA 5M4UA 5AFVA 3CTQA 2XH5A 4FIJA 3MFTA 3NIZA 3W2SA 4KB8A 3IDBA 4RQVA 3SX9A 2OICA 4BI2A 4BZNA 5IQCA 3MY5A 3TZ8A 2YAKA 3KXZA 2QKRA 3OT3A 4O0WA 3HA8A 1YXUA 3FQHA 3RAIA 5IU2A 2OZOA 2WZJA 5E8TA 3PVUA 4ZEGA 4JG8A 4PV0A 3PLSA 4PL3A 4EC9A 3A7HA 5CANA 5JFWA 1VJYA 3AC8A 4IVBA 5DRDA 2XNGA 2IW9A 4LV5A 4GKHA 4BVUA 2F4JA 3CGOA 2PTKA 4B4LA 5HLNA 4YJVA 4TYEA 5CF5A 4IAAA 3D94A 3DBFA 3DA6A 3G2FA 3KXXA 5AV4A 2PY3A 4J8NA 3FMKA 1OKVA 2O64A 3PPJA 3R9NA 3IGOA 4IM0A 3HL7A 3DZQA 3MVMA 4J95A 4D2RA 3E88A 4IZAA 2UZLA 4JQEA 1QL6A 3ATSA 3OT8A 1SNUA 2GFCA 3CCNA 3QX2A 4QYEA 1TKIA 2JITA 4PDOA 1S9JA 4BDKA 3G0FA 4WIHA 1XBCA 1KE6A 1Q3WA 3BGZA 3UQGA 4ANQA 5JT2A 3MA6A 4AACA 3P0MA 2OK1A 3F61A 3FWQA 3TL8A 1YXSA 3BGQA 5JFSA 4WNKA 3IW6A 3UZRA 1ZY4A 4H1JA 4O38A 4G6NA 4BHNA 4IM3A 3K3IA 3HMMA 1Q61A 2GS2A 5EYMA 1XQZA 2OKRA 2W1ZA 3I5NA 1A9UA 4QP1A 3VJNA 3WZJA 3PY1A 2EVAA 4NTSA 5JH6A 2XK6A 3C4FA 4RC2A 5CALA 4NCTA 5BQ0A 3GP0A 4QMNA 4BGHA 5IF1A 3L8XA 5GIOE 5HIEA 3FZRA 3MW1A 2W96B 2XYUA 2PHKA 1URCA 4YLKA 5A3XA 2YWVA 3CKXA 4X3FC 4ENYA 4YTCA 2GSFA 4UB7A 2UVXA 4X3FB 2Q0BA 4S33A 3ET7A 2LGCA 3HNGA 3UO5A 2BTRA 5E8VA 4KIKA 1H1RA 5TT7A 2BRMA 4D1XA 2CCIA 5GJDA 5LJJA 3HMPA 4FV4A 4G2FA 3KULA 4ACCA 3QZFA 4BCHA 3JVSA 2ZM4A 1SM2A 3QQHA 5CT7A 4FBXA 3AGLA 3UODA 4A9TA 4IW0A 4I6QA 5HLWA 3WBLA 3K5VA 5A4LA 4DGOA 2A27A 3QQGA 5C8MA 5KBQA 3H9FA 2C1BA 1ZZ2A 3UG2A 2BHHA 4EJ7A 5HCZA 3PDTA 4WA9A 5IQEA 1B6CB 2VRXA 3P7CA 5FRIA 3Q2MA 4BBMA 3LAUA 4N70A 3BI6A 3F2NA 3OTUA 4BKJA 3BYMA 3EQCA 4W4WA 3GBZA 3ZBXA 1FOTA 3RWQA 4TTHB 5G1XA 2PZYA 3QHWA 2ZMCA 3R7GA 3TUCA 5IUHA 5LMKA 2J4ZA 1OBGA 1M17A 4FOBA 4ZZOA 3MH1A 3RALA 4O7YA 4AW1A 2GQGA 2XIXA 3B2TA 4QNYA 5KHXA 4LQMA 4U3ZA 1Z5MA 3UDBA 5K0XA 4YJNA 2ITVA 3RAHA 5GZ8A 5C01A 4EOKA 4O27B 4BCQA 4F7NA 1OM1A 3I0QA 4B8MA 3LCDA 3FHRA 4F64A 3LMIA 4XG3A 3UE4A 3UQCA 3KMWA 5DVRA 3PY0A 3ORNA 4FG8A 5AIRA 3CE3A 3NW5A 5AV2A 4LGGA 3LCTA 3DB6A 3U9NA 1ZLTA 4CV8A 4EH9A 4LI5A 3IS5A 3FYKX 2VTJA 4I22A 3DB8A 1W82A 2P3GX 3CQWA 3I7BA 4EK4A 2H8HA 4EEVA 3D5VA 4QP8A 5EHYA 4QYGA 4RIOA 4G9RA 5EH0A 2XEYA 4M68A 4Z7GA 3TNQB 3QD4A 4GU6A 1H0VA 3BHTA 3ACKA 4DT9A 2ZB0A 3RKBA 5BYYA 4WG4A 4RX7A 1PKDA 3PZEA 3BCEA 3QQJA 4AP7A 2ITWA 4NJDA 4JDIA 5HD4A 3T3UA 5E8XA 1RE8A 4IVDA 3DKOA 4JDKA 4DG3E 3UC4A 4B99A 2WFYA 4BRXA 2XBAA 4QMSA 4AAAA 4MNEB 5BUJA 3REPA 4FV5A 5J95A 1W83A 4PTCA 4ANSA 2YM4A 3DT1A 3ORXA 3OBJA 5DR9A 4ZOGA 3QXOA 2IN6A 3U4UA 4QMTA 1ZMUA 2BPMA 5EKOA 1JBPE 3PFQA 3HAMA 4AQCA 3ZUUA 4AZWA 4TRLA 3KF7A 4YO4A 4OTIA 5KE0A 2R3QA 3O0GA 3EJ1A 3KC3A 5EDRA 4DBNA 5IZFA 3BQRA 3LJ0A 2WTWA 3D7TA 4WNOA 1U54A 3V5TA 4BTKA 3VBVA 5HTBA 3UG1A 3TG1A 4FTRA 2QG5A 1U5RA 4F7LA 3A7JA 1LEWA 2YIWA 2YIYA 1IEPA 3QC4A 4KINA 4ZY6A 5EM6A 5CLPA 2CGWA 5ANKA 2JDSA 5GNKA 2FB8A 3F5PA 3R7IA 5E7RA 3UVQA 3VVHA 5ANDA 3LQ5A 3OS3A 3SVVA 2W1EA 2FSLX 4OR5A 3NDMA 2Y8OA 3VUGA 4V01A 4RZVA 2HELA 3VBQA 5J79A 1YWVA 5IG1A 3KXNA 5HOAA 4MQ2A 2B9FA 5FEDA 5M06A 4FZ6A 2CNQA 2VNYA 3BWJA 3R1YA 4XHKB 3WE8A 3R0TA 4OGRA 1FVRA 2ZV2A 3OHTA 3UJGA 4BDAA 4M12A 2ERKA 1OL6A 3L9NA 4BICA 5E1SA 4RLKA 4MH7A 3GC8A 4QP7A 3DS6A 5KUPA 3V8WA 4EHZA 4EBWA 5GZAA 4EH6A 3NAXA 4DEIA 2GFSA 5LARA 3DBCA 4TT7A 3F2RA 4QMYA 4KSPA 2XJ0A 2ZJWA 4HZSA 2R3JA 3QQKA 4E5AX 3IDCA 3VQUA 4ZTHA 3UNKA 4TWOA 4EOQA 4YP8A 4AGDA 2ITUA 4BDCA 5HORA 2DUVA 4D4SA 3NUXA 3ALOA 4TWPA 3Q6WA 3A4OX 3C1XA 4ANOA 1ND4A 5DBXA 2EB2A 1K2PA 2FA2A 2X8DA 4YUQA 3F3ZA 1KE5A 5KMKA 1JKTA 2BDWA 4ZTNA 1UU9A 4CXAA 1MQBA 4GV1A 3AQVA 1JSUA 4ASXA 2WU7A 2B55A 2OU7A 3MWUA 5H8EA 3ZSIA 4ANBA 4JXFA 3Q5ZA 3UIMA 2BUJA 1F3MC 4DH1A 4F1MA 3C5UA 1ZYLA 4DAWA 3OTVA 3P7AA 1DAYA 1KV1A 3FSKA 1U46A 2YEXA 3ULZA 3HUBA 2WHBA 3COIA 4FKUA 3W8QA 1H07A 4MXOA 4ACMA 3O71A 4GFMA 3NYOA 4MVFA 4NM5A 4AZFA 1VR2A 3ZXTA 1DS5A 4MD7E 3BHHA 3MIAA 4O84A 1IA8A 2UZDA 2WIPA 3QWJA 4FKJA 4GG5A 5IDPA 4TWNA 3SDJA 3H9RA 5BYZA 3SA0A 5LVOA 3V5WA 4LMUA 3WILA 3AMYA 3QRUA 4EWHA 5CSPA 2VTRA 2XNPA 2R3NA 3PE2A 3PRFA 4AZVA 3HX4A 3FQEA 4CMUA 5IQAA 3NSZA 4GT3A 1T45A 3R8PA 3E87A 4JBVA 4DCAA 1BUHA 3E3PA 4H3QA 5CZIA 4EQCA 2OIDA 4E6QA 3KFAA 4IC8A 5CSHA 3FZ1A 4O7ZA 1YHVA 3FV8A 1GZ8A 3KVXA 2HWOA 3MB7A 2JAMA 1YXVA 2B9HA 2FUMA 5JFXA 2W5HA 3BBWA 4FK3A 2OF2A 1BI7A 4BCIA 4FT3A 5JQ5A 3ZM9A 3VHKA 2VV9A 2QO7A 2E9VA 4GUBA 3HECA 3T8OA 3ZMMA 5M4FA 4GW8A 2VGPA 4APCA 4LYNA 3HMNA 4WNPA 3D15A 4C62A 4B8LA 4FE2A 4YC3A 5GINE 3RTPA 3RPYA 5KX8A 1F5QA 1OGUA 4GK3A 4IX3A 4DTAA 4FV6A 4DFNA 4DEHA 1O9UA 2ZV8A 4YZCA 2BZIB 2AUHA 4RJ3A 4YZNA 4BTMA 5DT4A 4MXYA 1YOJA 3C13A 3IW8A 4FSQA 4L68A 4IDVA 1YWRA 5D1JA 4EH4A 2ZAZA 3QKKA 3WZEA 1OL5A 3KRXA 3O23A 1R78A 4XJ0A 3N4TA 1OL1A 4DH8A 3MBLA 3MB6A 4NL0A 5HVKA 3CSVA 4OAVB 4MXCA 5FBNC 4L44A 3RK5A 1CKPA 1B38A 2YZAA 2BALA 3UOHA 5DMZA 4N6ZA 4AF3A 4FSTA 5CVFA 3ATTA 2VD5A 4BBFA 1QPJA 2R3KA 2HY81 3F7ZA 2WTKC 5CEPA 4IHPA 4CZUA 1TVOA 3EFKA 4C2VA 4N0SA 3CP9A 5AP6A 3DV3A 3FPMA 4MX9A 1OB3A 2UZBA 2ZOQA 5E8WA 3QUEA 2VO7A 2QLUA 3W1FA 2RFNA 3KQ7A 3QQLA 4K1BA 5I9UA 5BVEA 2YCQA 4YNEA 3FY0A 4E73A 3BIZA 1XWSA 2HOGA 3AC5A 4JS8A 4R8QA 2GNLA 4Y5HA 4C0TA 4IZ7A 2W1HA 5AX9A 3U87A 3VULA 1Y57A 3PY3A 4MBLA 1KOAA 4RIWA 4Y46A 4C02A 4GFOA 4BFMA 5F95A 3RPVA 4ASDA 5M57A 3R7OA 4F09A 1NVRA 3IK3A 4MBJA 4CCUA 2BCJA 2R3IA 3C4XA 1YDSE 2VGOA 2YJRA 3OY3A 1BL7A 3AT4A 4BN1A 3LJ2A 1V0PA 2B54A 2F9GA 3POZA 4RVLA 2FVDA 1ZARA 2CDZA 4RWJA 2VNWA 4EHGA 5CAUA 3R8UA 2GHLA 1OPKA 3GGFA 4AFJA 3R8LA 3PIYA 4BCJA 4GKIA 2XNNA 2XVDA 3FI2A 3SW7A 5JSMA 3HYHA 3CEKA 2ZB1A 4D4RA 4D9TA 4KKGA 4FICA 4CMOA 2RL5A 4BCKA 3EN9A 3M2WA 4R7BA 5DG5A 3DPKA 3SHEA 5AM7A 3LFDA 3EZVA 2P2HA 5J1VA 4CRLA 5C4LA 2W1CA 3ZFXA 5KBRA 4O0SA 1Q8UA 2CN8A 3O7LB 1A06A 3UIBA 2W1FA 2C6DA 2PMLX 3NNVA 1PYXA 3I0OA 4DLJA 3QUDA 3RPRA 4WBBB 3D4QA 1OMWA 1OPLA 1Q5KA 1JNKA 5BNJA 3Q32A 5LXMA 4YPDA 2PVMA 3NWWA 4QTEA 3FL4A 4LMNA 5D7AA 4QTBA 4ZS4A 1V1KA 5D10A 4BHZA 5HQ0A 3C7QA 3LXLA 4XV1A 3V5QA 3NUYA 3PA4A 1WFCA 2VAGA 5EKNA 1YHWA 3IOPA 3KK8A 4IMYA 1UKIA 1YXXA 4O96A 5AP3A 1KV2A 4C7TA 5KHWA 4BY9E 3A8XA 3Q04A 1GY3A 3JY0A 4FF8A 4W4VA 4X3JA 5L2QA 3C4ZA 3RPSA 4NT4A 4G3FA 3L9PA 1YDRE 3NNWA 4I5HA 3BHUA 2UZVA 4O0RA 5G6VA 2JDVA 3VW8A 4MF0A 4M13A 4XG4A 5CWZA 4L8MA 5DPVA 2YIRA 4E5BA 3FMDA 3ORTA 3TUBA 5CEQA 2LAVA 4Q5HA 3BYSA 3TJCA 3I6UA 5IQDA 2QLQA 3O51A 4MWHA 3S3IA 5AP2A 3QA8A 2QO9A 2JLDA 1FGKA 1UU7A 2AYPA 4AN3A 5BVDA 5J1WA 5I9ZA 4XLIA 3FZPA 3GQIA 4BYIA 4E3CA 3UTOA 1PXMA 5JRSA 4CKRA 3EYHA 4J1RA 4CLIA 2IZSA 3JY9A 4U80A 3E93A 2I6LA 2SRCA 4XG2A 5EI8A 3I79A 4FZFB 5HE3A 3TKIA 2YFXA 3VUKA 2XNEA 4CFVA 4JOAA 2OJGA 3T9IA 3KXHA 3WZDA 5F20A 4M0YA 2VO0A 3ZO1A 2WTDA 3VIDA 1PF8A 4O6EA 2FSOX 5BVNA 3FXWA 4EOIA 4JL9A 3SW4A 4FV9A 3UZTA 3AC2A 3FAAA 4D2WA 5DWRA 5FDPA 2X2LA 1K3AA 4ZY4A 4HYSA 1H1WA 4BTFA 3V51A 2ZMDA 3ETAA 3NUUA 5BMMA 2OJIA 3C4EA 3DNDA 3IW7A 4CFMA 3ZYAA 3PXRA 3R8ZA 3A99A 3ZU7A 2G2IA 3MA3A 4E93A 3QLFA 4XMOA 3ZM4A 3D0EA 5JEBA 2WIHA 2PU8A 2VN9A 4ITJA 3TEIA 1JAMA 1ZOEA 2JKKA 3ALNA 1DAWA 3BLRA 4XG8A 3SOAA 3NUPA 4BDHA 2GPHA 5TR6A 2WPAA 4HNFA 1RDQE 2Y4IC 4USDA 4AT4A 1ZYJA 3KXMA 3OW4A 4Z55A 3W2PA 4FIEA 1PMVA 5ANOA 4CNHA 4Y83A 2RKUA 1YHSA 5E8ZA 3F82A 1Z9XA 4O7WA 4HGTA 2WAJA 4LFIA 3S0OA 4TNDA 1E1VA 2B1PA 3OCTA 4YBJA 1YW2A 2PVYA 5HCYA 2OZAA 2YACA 5IQFA 3TJDA 1H26A 2WQNA 2PZRA 2CNVA 4FK6A 4B6LA 2HXLA 3RMFA 3ORPA 3UQFA 2VTMA 3A7GA 3VAPA 4PNKA 4ZAUA 4QQ5A 3EIDA 4PPAA 3D7ZA 4RZWA 4AS0A 2PL0A 2R3FA 4M7IA 2P2IA 2VTTA 5CNOA 1OKYA 2RFSA 3UP7A 4X6RA 2ITNA 3LE6A 4D5HA 3II5A 4MCVA 2W1DA 1CKIA 3TTIA 5KMOA 3VRYA 5K0KA 4BZOA 3QUPA 3S1HA 4O7NA 2ESMA 2J7TA 4AOTA 5J9ZA 3ODYX 4DFZE 4U43A 4N4SA 4FKLA 4PMPA 4YTFA 4IJ9A 3DTWA 3R2YA 4L9IA 2YA9A 5EYKA 3CPCA 3NNXA 4XRLA 3D5UA 5CYIA 2QCSA 5AADA 2R3OA 4HGEA 2H34A 1S9IA 5CXHA 4P4CA 5LVNA 4X7QA 5HNIX 4Y72A 2P33A 1IASA 2Z8CA 5FEEA 3EQBA 4FKTA 3EN6A 3EB0A 3QWKA 1P2AA 1M2QA 4YC6A 4UMUA 3WIKA 1IA9A 4DEEA 1BKXA 4QP9A 2WQMA 3R02A 5KCVA 2X2KA 2XKFA 4TWCA 3TT0A 3EQRA 3QCSA 4M84A 4J98A 2QNJA 4ALWA 1M14A 4CTCA 3KCKA 2YISA 4O21A 5HE1A 4EUTA 4YTHA 3N9XA 1CTPE 2IVVA 4FT7A 4WG5A 5HCXA 1GAGA 2XK8A 2RFDA 4FKRA 3DY7A 4DH5A 4TYHA 2BTSA 2XRUA 3RWPA 5CAQA 3CTHA 2C5OA 5M4CA 5EQYA 4UEUA 4PP7A 4I3ZA 4GEOA 5CSWA 3TZ9A 2NNWB 3PYYA 4FYNA 4L01A 2PMOX 3AMBA 4A06A 2GNIA 4M97A 4UALA 3U54A 1ZXEA 2XRWA 5DT3A 3VN9A 2V0DA 4AG8A 4CKIA 3KK9A 5KMIA 3RM7A 3G15A 3BE9A 4V0GB 3DXQA 4M66A 4F7JA 4IB1A 5L6PA 4O7SA 4KS7A 1TQMA 3L9LA 3KMUA 5FM2A 2R3HA 3DQXA 4A9SA 4B0GA 4EUUA 3IQ7A 2VTOA 2XK3A 3IW4A 4EH8A 5L2IA 4NCTC 2XS0A 1MRUA 4J97A 2XZSA 3CS9A 3ZFMA 3VBTA 5ANIA 3OP5A 4FUXA 1WBSA 5EDPA 1E9HA 1XH4A 4I94A 3OUNB 4O2PA 4U5JA 5E1EA 4IFGA 1YWNA 3R00A 4HYHA 1XBBA 3I60A 4ANMA 4D2VA 2R3RA 1JSTA 2I0YA 3BPRA 2O8YA 4IDTA 3EQIA 1FVTA 1UKHA 3FUPA 4CG8A 3QBNA 3TDWA 3R22A 2XKCA 2W05A 4ASEA 2Z7LA 4RRVA 3DJ6A 3F5UA 3COKA 3RI1A 5C8KA 4KIKB 4OT5A 4UMQA 4JG7A 4DFLA 1ERKA 2WQEA 4F65A 4A9RA 2Z7SA 3KULB 2HENA 3Q52A 2C0IA 3VWAA 3I1AA 3Q4ZA 1OIQA 3ELJA 5A4CA 5AMNA 3RGFA 2CKOA 4FZAB 5HD7A 3E92A 3W8LA 2X8EA 4ASZA 5CAOA 2J6MA 2WO6A 2YJSA 3A62A 3QZHA 3WF7A 3QTSA 3FKNA 2RSVA 4ZSAA 3HAVA 1T46A 3WF6A 1FMKA 1FPUA 3DKGA 4JRVA 1M7QA 3FZSA 3HV7A 3H4JA 3S95A 4AA4A 4F1OA 2CLXA 4U9AA 4DH7A 3ZRLA 3TN8A 4O22A 4YJSA 2WQOA 5LMKC 4YMJA 5BUEA 4YJUA 3OROA 5DI1A 4Q5EA 1KWPA 5FQDC 1IAHA 4S30A 2QR8A 4JBQA 2UW7A 4E6AA 5IISA 1RJBA 3TTJA 2C6TA 3DJ7A 3I6WA 3EQGA 3H3CA 3RK7A 2RG5A 3MFRA 4TKSA 1TQPA 3QCYA 4MF1A 4BCPA 4BI0A 2QQ7A 2FSTX 5HBJA 2BKZA 4R77A 4OTPA 3P23A 4UZDA 3FSFA 2ACXA 2C6EA 2G2HA 1OI9A 2J0MB 4LM5A 3R9HA 3ZOSA 3BU5A 3QD0A 3E5AA 4ZY5A 5AR7A 2WMTA 4C37A 3KU2A 2VTAA 5K5XA 1OPJA 4QPMA 4HZRA 3NW6A 1YOMA 5AR4A 2BMCA 4EI4A 2NO3A 5E91A 4FL2A 4AW5A 3IPHA 3TDVA 5EW9A 3V3VA 4FV2A 3RK9A 2ITQA 1YXTA 4L43A 4AWIA 5M08A 1OVEA 2E9OA 1QMZA 5LOHA 1I09A 5HTCA 4H36A 4RWIA 2VZ6A 4BKZA 3QRKA 2X4FA 2XP2A 3LQ8A 4ANNA 2XIRA 4KUJA 1UVRA 2BIKB 3H9OA 3A4PA 4JIKA 1UNHA 3KB7A 4X2JA 1OBDA 1QPEA 4AU8A 5CT0A 5CTPA 4EBVA 4LUDA 2ZV7A 5I3RA 1HOWA 2UVYA 4ERWA 4NEUA 4FYOA 4H39A 4IAIA 5AUYA 4QMLA 3B8RA 4JX7A 2QURA 2YM7A 4F0FA 4PX6A 5BMSA 2BRHA 2PK9A 3BBTB 3QA0A 4RT7A 3U8WA 4A9UA 3GC7A 3N4UA 3DU8A 3GOKA 2EXEA 3R73A 3CY3A 2ZV9A 3VRZA 4DGNA 2Y4PA 3EL8A 3ZONA 4GMYA 4D4YA 3OUKA 3D7TB 1U54B 4G1WA 4QYFA 4C8BA 2VUWA 4BIBA 5CEOA 2B4SB 4J7BA 5CAPA 4IIRA 4IBMA 2VWZA 3TWJA 1GZKA 3DLZA 2WOTA 5AUXA 3GU5A 4GK4A 3SGCA 2ZYBA 4FNWA 1WBPA 2OXDA 3ENMA 5A9UA 5L8LA 3ODZX 5IMXA 3BGPA 4FEQA 2F2CB 4FSUA 4TNBA 5EOLA 4FTMA 3QTXA 3QTZA 5B2MA 2XJ2A 4FTIA 2ZM1A 5J7BA 1PY5A 3EQHA 2IZRA 5CNNA 3TKUA 2JC6A 3V01A 3K54A 2E9PA 3UPXA 1O6LA 4I6BA 3RBWA 2XK9A 3G9NA 2HWPA 2XF0A 1W84A 4NYEA 1LR4A 2ETRA 3BHVA 3MVHA 4FSRA 1F0QA 5J8IA 4AW2A 4QRCA 3AGMA 3SD0A 4C34A 3R28A 3FLWA 3VS4A 3RPOA 4YU2A 2J0KA 3VUHA 4DTKA 5DR2A 2UZUE 4Y5QA 2P4IA 4GIHA 4XOYA 3SQQA 4XP3A 4MWIA 5HNGA 4F6WA 3UIUA 2VWXA 1JOWB 2J2IB 5FG8A 4CFNA 4G34A 2GNHA 4QNAA 4ZMEA 3PPKA 2E9NA 2NRYA 3TZ7A 1H8FA 4BDDA 1WZYA 3OFMA 5FTQA 5AUVA 4Q9ZA 4BWPA 5HU3A 3MI9A 4LL0A 2WEIA 3B8QA 2WQBA 3FLNC 5CQUA 3NMUF 4IACA 4DH3A 4G6OA 3GU4A 3LFEA 2V55A 3C50A 4I0SA 5AAFA 5T6KA 5D41A 1Q8YA 2VU3A 5JGBA 4R7HA 4FL3A 1O6YA 4H3PA 4WD5A 3KN6A 4MD8E 4C58A 4D1SA 2UZTA 4HCTA 1OKZA 2HZ4A 4RJ4A 1UWJA 2OWBA 3NCGA 2I0HA 3CR0A 3PXZA 4E1ZA 3KRLA 2Y6OA 4RWKA 4GH2A 2ITZA 2W0JA 5FP5A 3BKBA 1OUYA 3VS2A 3HGKA 2W1IA 4C36A 4QYHA 4JT3A 5ICPA 2QODA 3A7FA 3CKWA 3C9WA 2GNFA 3LXPA 1U4DA 5HG9A 3VS1A 4GFGA 4RWLA 5FGKA 2ZM3A 1G8AA 4DHFA 4J8MA 4FV1A 1J7UA 4BDGA 5FTOA 4FTKA 4ACGA 1LUFA 5M44A 3E7OA 3I81A 4L00A 2I1MA 3FEGA 4FIFA 2XIKA 4JQ8A 2C3JA 4CCBA 3QGWA 1XJDA 4IAZA 4UXLA 2OW3A 5DEWA 5IA5A 4E4NA 3OWJA 5FDXA 1IRKA 4RJ5A 5HX8A 3NUSA 3OCSA 3OG7A 4TL0A 5AA9A 1NT2A 1G8SA 3HDNA 3KMMA 1Y6AA 1H27A 4OTHA 3G51A 4E6DA 2O65A 4UN0C 3PIZA 3QD3A 1VYZA 2JFLA 2W9ZB 2EUFB 4TY1A 5HIDA 1J1CA 4IB5A 4OTRA 4Z16A 3FI8A 4C3PA 5E8SA 2UVZA 2X1NA 2ZDUA 3DLSA 5IA2A 5K4IA 2J5FA 4EHEA 3EMGA 3G33A 1XBAA 5CF6A 3SG9A 4DFYA 3CQUA 3PJ8A 5LWNA 5A4QA 3AC3A 3RCJA 4FIIA 2X8IA 4DEGA 4RPVA 3MESA 2Z7QA 2IVUA 2O0UA 4DG2E 4DG0E 4O83A 3TNWA 5I4NA 4YC8A 3P1AA 5I0BA 4HJOA 2VWYA 1REJA 3ID6C 5HBEA 1MP8A 3R1QA 3CLYA 5HE0A 2R3GA 4CD0A 4W4XA 3FPQA 2O2UA 2X7GA 4RA4A 4UX9A 3LM5A 1H25A 5M56A 1URWA 2XEZA 4L67A 3PXYA 3OOMA 2WMAA 5E8UA 2WMUA 2HIWA 4BR3A 2F57A 4G16A 1UU8A 3G9LX 3HV3A 4O1PA 3T9TA 4FGRA 4YZBA 4I92A 4ZZMA 5AEPA 2CSNA 2GQSA 4O0XA 3MVLA 4TYGA 3CD8A 3NR9A 5J87A 4P5ZA 4L42A 2IVSA 2XNMA 4M14A 3TM0A 2BFYA 1WVXA 1ZZLA 3DCVA 2JD5A 1YOLA 2CKEA 3DK6A 1DI9A 4HYIA 3HLLA 2XKDA 3MTLA 5EK7A 4WUAA 3ZDIA 3V6SA 4HW7A 4K9YA 5HX6A 5IA3A 2BROA 3E63A 2NPQA 4EOLA 5AUUA 5L2SA 4GL9A 5KMLA 4WBOA 2OBJA 2W4OA 5BPYA 5K5NA 3F2AA 4HPTE 3SXFA 2QOOA 2PULA 3KREA 3CD3A 4MNEA 4YBKA 4F0GA 2WMQA 2VWWA 3D2KA 4UYAA 3G90X 4JVGA 4S31A
chains in the Genus database with same CATH superfamily
4J53A 4I6FA 1KE8A 4O81A 4F99A 5DLSA 3W0SA 3FMNA 4RX9A 4X2KA 3LFAA 4ACHA 1FVVA 2W4KA 5HGIA 1WVWA 1WAKA 3OMVA 4I41A 4IB0A 4IX5A 4XS2A 5EI2A 3PP0A 3ZC5A 2JKOA 5CSXA 5JN2A 1CM8A 1YVJA 1XH9A 2Y0AA 4YLJA 2XM8A 4O4FA 4PRJA 4U45A 5CU0A 2IEWA 4IM2A 4L45A 5D9HA 3AOXA 3W55A 5AP7A 1J3HA 2PWLA 3E7VA 3G0EA 1Q24A 4DA5A 3AC4A 5DYJA 4EKKA 3OW3A 5EM7A 3F66A 1YDTE 2XBJA 3FBVA 2H96A 2CNUA 1PXPA 3VW6A 4RVTA 4DFXE 3PJ3A 3O96A 3HV5A 4BWKA 2CHLA 3ULIA 3LJ1A 2ZDTA 3MV5A 4RJ8A 4O82A 3EFJA 3MJ1A 3AXWA 4ZTLA 5HNBA 3R8VA 2PUPA 5B2LA 5TE0A 5DRBA 2C6LA 3QC9A 4AT5A 5CENA 4YZ9A 3OCGA 3GEQA 4HGSA 3DJ5A 3N51A 4QTCA 3RINA 2B53A 1R39A 3QALE 4FVRA 4O2ZA 4II5A 5AR8A 4ZJVA 5DFPA 5LVMA 3EQDA 4PMTA 3ZZWA 3RHKA 3ZO2A 5JZNA 4NWMA 3EN4A 2V22A 4G31A 3QZGA 4Z9LA 3VUIA 4M0ZA 5IA4A 2W7XA 5TO8A 5KKRC 4GT5A 4QP4A 5DN3A 4U3YA 3DAEA 2JKMA 4J71A 4D28A 3QQFA 3GUBA 5ETCA 4USFA 3NYNA 3UC3A 1GIIA 4UWYA 4IAKA 4ALVA 1P4FA 1ZWSA 3DNEA 2YHVA 4XP2A 4YHFA 3ZHPC 3SKCA 4MEDA 4I0RA 5CXZA 3A2CA 3GCUA 3WF9A 2OXXA 4O6LA 2WTKB 4QMPA 4ZMFA 2BRGA 4BDIA 5HZNA 4G9CA 4GSBA 2VTQA 3JPVA 3LXKA 3NGAA 3E8NA 5C03A 5T68A 4HYUA 4KKEA 5L8JA 4QPAA 4PP9A 3TZMA 5HTIA 4FUYA 3ANQA 4NFNA 2PZ5A 4PY1A 1J7LA 4RIYA 4RC4A 4GT4A 1G5SA 1ZAOA 2C4GA 5FWKK 4LRKA 2Y7JA 4PMSA 3MGYA 3NAYA 4CEGA 3PWYA 4E8AA 4XLVA 3MJ2A 2YDIA 2C0TA 4DYMA 1H1QA 2PVLA 1BYGA 3JS2A 4DGMA 3ZZEA 4U40A 1OITA 2HZNA 3FE3A 3Q96A 3ZRMA 2DS1A 4FEUA 3Q4UA 5IQGA 2IW8A 4EWQA 4X0MA 4AT3A 4L3JA 4L6QA 5EQEA 2GHGA 1WBWA 3DXNA 5CX9A 1CMKE 3DQWA 4FSZA 4BIEA 3EN7A 1JSVA 4F9CA 2BAKA 3MFSA 2J0LA 3R21A 4Y85A 1Q99A 3D83A 1WBOA 2J50A 3PWDA 3U6JA 2G2FA 4I5PA 2PVKA 2Y9QA 5LCJA 4F08A 3JUHA 2ONLA 1XKKA 5DEYA 2C68A 3PXQA 2XK4A 2GNGA 5DIAA 4O86A 3L8SA 4EH3A 3NVKI 3HRBA 3F6XA 5HBHA 3OEFX 4IWQA 3UYTA 4FKVA 4UBAA 4CQEA 3KRRA 4ZSEA 4S32A 2QO2A 3NZ0A 2X9EA 3B2WA 4IX6A 3LFNA 4RFMA 1SZMA 3D5WA 4QP6A 3R1NA 2RG6A 4RG0A 2HZ0A 3LLTA 5EHOA 3V5PA 3MH2A 4I23A 4RX8A 3DDQA 1SNXA 4OUCA 4JBOA 5C9CA 1CDKA 4EC8A 2UZWE 2BKKA 4ZP5A 2WD1A 4FIGA 4LL5A 4L52A 5A46A 1BX6A 5FUTA 2HK5A 4IAFA 2WTIA 4FT5A 5CF4A 3IDPA 3QTWA 4KBCA 3EZRA 4Y73A 2XKEA 1KSWA 3P08A 3LFSA 4FTOA 2FGIA 3KRJA 3JXWA 3PXKA 1GNGA 3OF0A 2XCHA 3UYSA 2GCDA 4F63A 3P4KA 2QOCA 3WF8A 3ZEWA 4DT8A 2XYNA 4XEYA 5CU2A 4L53A 2UZOA 5DHJA 5H2UA 5CEMA 4W8DA 1OGYA 3KXGA 3NFFB 2F49A 2PUUA 3P78A 4O0VA 3KCFA 4FKPA 5HICA 2BDFA 4P7EA 2VO6A 2X39A 3U4WA 1FMOE 4O4DA 5ACKA 4F70A 4RA5A 3R9DA 3AD5A 2VTLA 2C6MA 3W33A 4AUAA 1M52A 3PTGA 4KRCA 5A6NA 4CTBA 3R8MA 2CMWA 4QYYA 3E3BX 4C4JA 3FYJX 1FQ1B 2X6EA 3I5ZA 3ZLXA 5JFVA 1K9AA 3PA5A 3WARA 5KMMA 3IW5A 4YR8A 3PLAE 4JNWA 4TN6A 4KABA 4M69A 3UVPA 3DDPA 1CKJA 1PW2A 2IZUA 4FTLA 3R7YA 3ROCA 5H8BA 1PHKA 3PJ2A 2V7AA 4TPTA 1OL2A 5LVLA 5JGDA 2KULA 5E9EA 3M11A 1UNLA 1R0EA 2Q0NA 2YCSA 3QXPA 3GC9A 4TYHB 2PUIA 3NPCA 4MXXA 4BGQA 4NW6A 4OAUC 3GFWA 4GIIA 3AD4A 3LCSA 5HESA 4ZSGA 3RCDA 3RVGA 1JKKA 3A8WA 4CFUA 2GTMA 2OJFE 4R78A 1VZOA 4FV0A 4XBRA 3W32A 2F2UA 4FKGA 4I93A 5I3OA 2OH0E 4C4HA 1PXNA 4I0TA 3HRFA 4QO9A 5E92A 4X6QC 4CT1A 1XH6A 4FTQA 4KAOA 5F94A 3BELA 3PG1A 2UZEA 4JG6A 5AUWA 3VS0A 4CFFA 1H0WA 4DTBA 2Y4IB 1OECA 4XG7A 2Z02A 4ID7A 4AW0A 3QQUA 1GZOA 3W2QA 3O8PA 5C4KA 4DITA 3A61A 4E4LA 4FVQA 2QHMA 4GS6A 4PL5A 3FZOA 2PVJA 5E90A 2YM3A 3TNIA 2R64A 3ORIA 2YLEA 4LG4A 3UOLA 3BU6A 4YGAA 1NXKA 3C4CA 4DFBA 3NIEA 1YKRA 3PE1A 5J9LA 3PRIA 3W10A 3FZTA 4UMPA 1QCFA 5DNRA 3NS9A 2VO3A 2OIBA 3BHYA 4IZYA 1FINA 2O63A 4O0TA 3FKLA 4FA2A 1U5QA 3KGAA 5LQFA 4MXZA 5IUIA 1G8JA 4IANA 2WU6A 3MS9A 5IH4A 2WTVA 3D9VA 2XAMA 2YITA 3C0IA 1KUTA 2F7ZE 3EN5A 5D12A 4FX3A 3IGGA 3W2CA 4FTJA 4G3EA 1O6KA 2R4BA 4BI1A 3S4QA 3D2IA 3FMEA 4XG9A 3F3WA 3GI3A 3NRMA 4RVKA 4DINA 3P7BA 4G3GA 2QOIA 3IO7A 5AIKA 3M42A 3RHXA 5A54A 1NVQA 3TCPA 4QPSA 4EYMA 5FP6A 3GOPA 4I24A 4ENXA 2VX3A 4FKSA 4NIFA 4DFUA 3SRVA 3VNTA 3LLAA 5GIPE 2R3PA 3RAWA 4NH1A 4DEBA 4JLCA 4N57A 3NNUA 4MKCA 4DGLC 4B9DA 4EQUA 1SVHA 2HW6A 1ST0A 2AC3A 1Y8GA 4IADA 5H9BA 2I0EA 3O7LD 3FLYA 1H00A 4A4OA 5IQIA 2RIOA 3QU0A 2BVAA 3DBQA 3G6HA 3EHAA 5DGZA 4K77A 5CF8A 1ZY5A 2VX0A 5IDNA 4UMTA 5M4IA 1H08A 3MYGA 1ZYSA 3MDYA 1Z57A 1VEBA 5AJQA 2PVRA 3ROYA 2CGVA 4XOZA 2ITYA 3Q2JA 2B52A 2QU5A 2WKMA 1V0OA 3GU7A 3ORLA 5CU3A 4GCJA 4BCFA 3OEZA 4O4CA 4P5QA 3VS6A 3KY2A 4P90A 2X81A 3OXIA 4KD1A 2ITOA 3IG7A 1J7IA 1Q41A 3PUPA 3ML1A 5HG7A 3I7CA 4JDHA 2JIIA 3HKOA 2RF9A 4FT0A 1JLUE 2JFMA 3EYGA 5IMEA 4RIXA 4M8TA 4FV3A 3UVRA 3VC4A 4MXAA 3RZBA 4DC2A 3QYZA 3PSBA 4U79A 4YLLA 3BU3A 5GHVA 4BF2A 3ZH8A 5JQ8A 3SXRA 2P55A 5FEQA 3LFCA 4EHVA 2IPXA 4RLLA 2XB7A 4CV9A 4HVGA 2XK7A 4P2KA 5AUZA 1OIUA 4QP3A 3OOGA 3LIJA 1WBVA 4FEWA 3BV3A 3BL7A 3ZSGA 2YZLA 4PTEA 2VX1A 3QL8A 2QKWB 3ZCLA 3U51A 1Q97A 3FMHA 4UWCA 1I44A 2EXMA 4BGGA 3UPZA 4FOCA 4IB3A 2I7QA 5CS6A 3O2MA 3VHEA 2CJMA 3DFCB 4MAOA 2VTSA 4QMUA 4O7RA 4MTAA 2JKQA 4W9WA 4FV8A 4EZ7A 1OUKA 3R7EA 1NY3A 3TUDA 3LCOA 1GIJA 4L46A 4QTAA 1A48A 4F4PA 5JK3A 4U8ZA 4ORKA 5BYLA 4FTUA 2YIQA 3PXFA 3O8UA 2OXYA 5TF9A 3VUTA 2C5YA 2WNTA 1Q8TA 4OW8A 3SOCA 1OIYA 4FIHA 4CRSA 4DF3A 2BAJA 3DKCA 3CPBA 3IONA 4GYIA 4J96A 4QQCA 3ZEPA 2J5EA 4IWPA 2JDTA 4JR3A 3RNIA 3TV6A 4HVSA 3EOCA 2PUNA 3BLQA 5HU9A 2VTHA 4XG6A 4PNIA 2B7AA 3RP9A 4MD9E 2HAKA 4YURA 1NA7A 3CGFA 3MIYA 3S2PA 2FSMX 4BWXA 4CSVA 5IEVA 3CBLA 2HXQA 3EWHA 2OSCA 4U44A 3VBXA 1X8BA 1M7NA 2BZKB 4IFCA 4K11A 4EK8A 2W5AA 4QMOA 4UMRA 3FMJA 4UZHA 4NU1A 2C6IA 2BRNA 4HCUA 1PKGA 4BDFA 1Y91A 4I4EA 2OG8A 5A4EA 3ZRKA 4YHTA 2FYSA 3PVWA 4G5JA 3DAKA 5IQHA 1J1BA 1Q8ZA 2WTJA 1L8TA 5KMNA 1R0PA 2YCFA 5ETIA 3DK3A 3SXSA 3IKAA 3A60A 4X2GA 5T3QA 3E64A 2UZNA 2X0QA 4ZTQA 4K18A 2WMXA 4QTDA 3FC2A 1UV5A 2J0JA 3K3JA 2OFVA 2WGJA 4IZ5A 2YCRA 4KKHA 3WE4A 1UNGA 3CIKA 4I20A 4LGDA 4OTFA 4UY9A 3ZXZA 4W4YA 4D2PA 1W0XC 3UOJA 4H1MA 3UNJA 3BLHA 2YM6A 4EONA 4E4XA 3FXZA 5ANGA 2GTNA 5HG8A 3VS3A 4EZ3A 2QOLA 2C3KA 3ZLSA 3UNZA 2J51A 2UW5A 3MPTA 4V0GA 4WG3A 2P0CA 4F6UA 3CC6A 2YIXA 4Q9SA 3ZUVA 5KZ0A 3OXZA 4PDPA 3N4VA 2ERZE 2PVNA 3LCKA 2YERA 3M1SA 4ITHA 4USEA 2XCKA 4I5CA 4E6CA 3BEAA 4L3LA 2OFUA 4E7WA 4DEAA 4O91A 4YZMA 4JBPA 4RGJA 4RVMA 2WOUA 2X2MA 3V04A 3VF9A 3QRIA 2DWBA 4LV8A 4M3QA 5HHWA 1P4OA 4C4IA 4E26A 2JGZA 4QEBA 2YWPA 2G9XA 1Y6BA 1TZDA 2B0QA 3FKOA 4TW9A 5AP1A 4ZK5A 1PXLA 4DBXA 3QTIA 1AD5A 3WI6A 2WEVA 4R5SA 3RM6A 5IEYA 2ETMA 4NM7A 3TNHA 3G6GA 2C47A 5HO8A 3C5IA 4PWNA 3UMXA 2WMVA 3F88A 2XIYA 2DYLA 2A0CX 3FC1X 3JVRA 4FVPA 3BYUA 2X9FA 3QRTA 4X2NA 1GOLA 2HW7A 5HVYA 3G5DA 5B0XA 2G01A 3EFLA 2A4LA 1P14A 4KIQA 5CI7A 4IAYA 2XNOA 3UMWA 2V62A 1ATPE 4F0IA 4WRGA 3PP1A 1DI8A 3NYXA 1RQQA 3P9JA 1M2RA 2GHMA 3BZ3A 1ZYDA 3QRJA 3QKLA 4L3PA 4ZJJA 4C4EA 5I5ZA 5IPJA 3LMHA 2C6KA 1HCKA 3PPZA 5EQPA 2W1GA 3F3VA 4ZXTA 2BZHB 4WT6A 3CJFA 5EYDA 3RZFA 2BFXA 3FI3A 2UW4A 3VJOA 2A1AB 3IECA 4XBUA 3ANRA 3ZBFA 3F7WA 4R1VA 3NYVA 4GU9A 4IVAA 3VS7A 2W99B 3H0ZA 4AGCA 3LKMA 2YABA 3QYWA 3BRBA 2GNJA 3OXTA 3F9NA 4EQMA 1TQIA 3KIOC 5M55A 2C30A 3GENA 5KMJA 4IC7A 3D5XA 1WBTA 5IKWA 4BL1A 4KBKA 4BCNA 2WMWA 1PXJA 4QMXA 2EU9A 2I40A 5FXRA 1UWHA 5J9YA 4W9XA 3U55A 2VWBA 2Y6MA 4I5MA 2C5XA 4F9WA 4FKOA 5EW8A 2PZPA 3F3UA 3UIXA 4F7SA 3FXXA 3DZOA 3PA3A 3GC0A 1WVYA 2W17A 2C3IB 2PVFA 3QKMA 4GJ3A 4XNEA 2B9JA 4OTGA 4APPA 4CZYB 1SVGA 3FLZA 1J91A 5F9EA 5IH5A 4FL1A 1NW1A 4H58A 3Q6UA 4FKWA 3AKKA 4MYGA 4NFMA 4EJNA 2KTYA 1PMNA 3R9OA 4C57A 5LMBA 3R71A 1YI3A 3PJ1A 4LGHA 4M67A 4EH2A 4R1YA 3QZIA 4KNBA 3PVBA 5CSVA 2UUEA 3DBDA 2V5QA 4BDJA 4D5KA 2X4ZA 4ALUA 1XO2B 3ZO3A 2E2BA 2CKPA 4C33A 5IA0A 4X3FA 4JJRA 3DFAA 3OBGA 3PZHA 3QGYA 3BE2A 2O5KA 4OBPA 4OTWA 1WMKA 3WYXA 4JRNA 3ORZA 1AGWA 4A9YA 3F5XA 1H28A 1Q3DA 5ETAA 1R1WA 3WZUA 1W2FA 5E8YA 2F7EE 1W7HA 5I9WA 5EFQA 3TXOA 2R9SA 5D11A 4BJJA 5HKMA 3C0HA 2B9IA 4G17A 3C51A 4XP0A 5B2KA 4ARKA 3FMMA 4KA3A 3R83A 1MQ4A 5A4TA 3PVGA 4S34A 4FG7A 2J0IA 1FGIA 3GU8A 5FXSA 3HVCA 5EW3A 3C4WA 3KF4A 4FNXA 5AWMA 3IOKA 2X0OA 1MRYA 2E9UA 3D14A 3R7UA 1ZMWA 3LOKA 3V5LA 4CZTA 3DGKA 4AE9A 3PG3A 5BV3A 2GS7A 3Q53A 3TKHA 2BRBA 5K4JA 1GZNA 3MH3A 4XH6A 5F4NA 5L6OA 2OH4A 3Q9YA 4RJ7A 4NKSA 4HNIA 4G3DA 4IQ6A 5EOBA 3L1SA 4IXPA 4MNFA 1YI4A 3AMAA 2X7FA 3HEGA 3VUDA 2PE1A 2G15A 4ZIMA 2X0GA 3BEGA 1LPUA 2CLQA 5EHLA 4AZSA 3MTFA 4OT6A 5I9VA 3R9RA 3EFWA 3ZO4A 4YJOA 1IG1A 1SVEA 3HRCA 2Q83A 1KE7A 3GQLA 3I4BA 2VTIA 5HO7A 4K33A 4FTCA 3SG8A 2UW9A 3SC1A 4FEVA 2C5NA 5CY3A 3GCVA 3R04A 4WO5A 2JBOA 2R7IA 5LVPA 4FRFA 3W16A 4JAIA 2PPQA 2BR1A 3O50A 4FC0A 4DE4A 1H4LA 4PQNA 4HVHA 3FJQE 5EI6A 1JPAA 3L9MA 4WOVA 4KWPA 3VF8A 5ANJA 2REIA 2XARA 3W18A 3CQEA 4FI1A 3ITZA 3LFFA 4FMQA 3OWLA 3WF5A 3QCQA 3UO6A 4C4GA 3VBWA 3COMA 5CU4A 5TKDA 4LOPA 4FSYA 4XYFA 4L7SA 1B39A 3L8VA 4I21A 4U6RA 3BX5A 4RIYB 3FHIA 1E1XA 4K6ZA 4LOOA 2YDKA 4AN2A 5H8GA 1CSNA 3VS5A 3WZKA 2GDOA 4EK3A 5ANEA 1PJKA 2A2AA 2BIYA 2QU6A 3OVVA 4RIWB 4FTAA 5DA3A 4BCGA 3QD2B 3Q3BA 3QTQA 2QHNA 3UGCA 3DOGA 5HEZA 4HVDA 4S2ZA 1H1PA 5AP4A 1ZYCA 3EH9A 1XH8A 4I1ZA 4NK9A 2IW6A 1ZRZA 3QCXA 4WSQA 1IA9A 3MSSA 3NUAA 4E5WA 2JBPA 1EH4A 4XV3A 3LQ3A 3POOA 3DBEA 4D2SA 3O8TA 2QONA 4R5YA 2BDJA 1YRPA 4XV2A 3LM0A 4QD6A 2XMYA 4QQJA 3RJCA 2A19B 2XANA 2QOKA 4O0YA 2WMBA 4IWOA 4FR4A 1IR3A 2ONLC 3OZ6A 3LVPA 3BV2A 3ORKA 4YO6A 2UW6A 3RAKA 4G5PA 4TXCA 4KSQA 4U0IA 2RFEA 4RQKA 4C61A 5CEKA 4LRMA 4F1TA 5CZHA 5BX0A 3ZS5A 5IUGA 4CT2A 4ZLYA 5IQBA 5AM6A 4V04A 3S00A 1QPCA 2WXVA 4F9YA 1JWHA 3QHRA 2H6DA 2JAVA 3HV4A 4OBOA 4O7TA 4ZLOA 2Z7RA 3GVUA 1APME 3LZBA 3W2OA 2R0IA 4OTDA 2HCKA 2IZTA 4OBQA 3PSCA 4W8EA 4A07A 4AX8A 3ORMA 3NEWA 2IG7A 4YTIA 4G6LA 2XM9A 4IE9A 1OL7A 4NUSA 3R30A 4EL9A 3VBYA 1U59A 2NP8A 2BHEA 3EKKA 3Q4TA 4QP2A 3AC1A 5AV0A 4HCVA 4GK2A 4QMQA 4EK6A 5C1QB 5KKRB 4HGLA 3L8PA 4LUEA 4RFYA 1DM2A 5JMSA 5M09A 4ERKA 4QMZA 4BBEA 5FD2A 3R1SA 3V8SA 5AR2A 4EKLA 3HP2A 4D4VA 5GJGA 3WIGA 3ZC6A 4CLJA 2GQRA 2XJ1A 1V0BA 4FNZA 2I0VA 3HDMA 4PPBA 3TNPC 2OLCA 5CASA 1XHAA 3R7VA 4GJ2A 3TIZA 3U6HA 4A4XA 4AOJA 2OF4A 2GU8A 4TYJA 2JEDA 5L2WA 1SMHA 3QTUA 5AR5A 4GUEA 3NLBA 5AAGA 3KN5A 4PMMA 4YJQA 5F1ZA 3SLSA 4D9UA 4G3CA 5ETFA 4D55A 4O0UA 1H24A 2R7BA 3KEXA 3ENHA 3NCZA 4PF4A 4A7CA 4YJPA 5ITAA 2UV2A 3FLSA 3ZLWA 5CVGA 1IAJA 4FSNA 2G1TA 3ZTXA 3E8DA 4ZSJA 5E4HA 4IVCA 2C3LA 3EQFA 4M69B 1JVPP 4BKYA 5JKGA 2ZVAA 4U81A 3A7IA 3CY2A 3CTJA 4R3PA 2WTCA 1ZOHA 3PSDA 4EYJA 4FTTA 4YZDA 4HOKA 4ZJIA 1GIHA 5L2TA 3VUMA 3Q4CA 4J52A 4R3CA 5JZJA 4AGUA 2AEGA 4F6SA 4ITIA 4EOPA 3R01A 3DAJA 4O4EA 1BI8A 2PMNX 2IJMA 3C0GA 3FDNA 4DLIA 5JGAA 4PDYA 2CGXA 4MK0A 3TACA 3ZUTA 4LDTA 2R0UA 4YJTA 4AGWA 2HZIA 4BC6A 3K5UA 2C69A 4EOJA 4YNOA 2PMIA 2YM8A 5FM3A 1H1SA 4YPSA 3GB2A 5M07A 3MVJA 4AA0A 1Q4LA 2OGVA 3LFBA 1YQJA 3FY2A 4L7FA 4R6VA 4YSMA 4AXAA 5BVKA 3ACJA 3MY0A 1OKWA 1H01A 5M51A 3OD6X 4JR7A 4R7IA 3EL7A 4OTQA 3WYYA 4KIOA 3AT3A 4BCMA 4ZSLA 4F9BA 5AA8A 5IH6A 3QF9A 5L8KA 1RW8A 3FQSA 2BZJA 4GVJA 2NRUA 5C27A 4TZRA 4PTGA 3F5GA 2OIQA 2O3PA 5EYCA 5AV1A 4EORA 5A6OA 3HA6A 3Q9XA 2PE0A 3HV6A 3PIXA 4RBLA 5KZIA 5LCKA 4NJ3A 2OZAB 4O7LA 3OY1A 1BLXA 5J5TA 3P5KA 4U42A 2DQ7X 2XIZA 2CN5A 4PDSA 4IJPA 2PSQA 5L3AA 4UWBA 5HI2A 2YN8A 4RJ6A 3GXLA 4GRBA 3MN3A 1JKSA 1PXIA 4Y95A 1MRVA 5D7VA 4EK5A 3AG9A 4MBIA 2QVSE 2OO8X 4R3RA 4KIPA 3KVWA 2X6DA 3FI4A 4LV7A 3GFEA 3QFVA 4WSYA 3DXPA 4CYIA 3F3TA 4N6YA 4RX5A 2CPKE 1R3CA 2QOFA 2ITPA 2VWVA 4FTNA 2YLFA 4M15A 4Z7HA 4FODA 5HLPA 3COHA 3VQHA 3GNIB 5C26A 4AN9A 3E8CA 3BQCA 4FSWA 4YHJA 2ITTA 5CQWA 1ZMVA 1QPDA 1P5EA 3H0YA 3MPMA 3GT8A 2YM5A 2XA4A 4NZWB 4NIFB 4V05A 3SRVB 2W5BA 4QMWA 5FTGA 5DT0A 2F7XE 5AR3A 3P79A 3LFQA 3HZTA 4I4FA 5EG3A 4X2FA 4D0XA 4FNYA 2V7OA 1LEZA 2XUUA 1KE9A 3U6IA 4GYGA 1XH7A 4FEXA 2Z60A 4Y8DA 4EH5A 3KA0A 4AXCA 5BVOA 1STCE 5AX3A 1SYKA 1LP4A 3LPBA 4OLIA 4DCEA 2IWIA 5AP0A 1MUOA 2YDJA 4BDEA 3OCBA 1M2PA 4GG7A 4H3BA 4U7ZA 1JQHA 2R2PA 3MY1A 4QT1A 4AA5A 2X7OA 5L4QA 4ZTSA 4B7TA 5HVJA 3THBA 3HMIA 1XH5A 3V8TA 2R3MA 2Z2WA 4D0WA 5KNJA 4IX4A 4AXDA 1W98A 3H10A 4C38A 4YSJA 4UYNA 3R6XA 1W8CA 2VWIA 4JI9A 2QD9A 2PYWA 5CVHA 3ZSHA 3TV7A 1PMEA 5EM8A 4O7VA 4CQGA 3KL8A 5ACBC 4NM0A 2W06A 4QMMA 3JYAA 4LRJA 4CVAA 1BL6A 4QMVA 4CFXA 4IEBA 2CCHA 2FH9A 3R63A 4WKQA 3BYOA 4XUFA 4BTJA 4FGBA 4RIXB 4K8AA 4RFZA 4FG9A 3BL9A 4H05A 2GMXA 4MHAA 5J7HA 3P86A 1KOBA 1PXKA 4JQ7A 5KO1A 3Q5IA 1Y8YA 3BYVA 3HP5A 3DTCA 3UDZA 1FBNA 3LHJA 1PXOA 4WUNA 2J9MA 3OWPA 3ZLYA 3UO4A 2XNBA 3AT2A 2C1AA 4C35A 4D2TA 3TI1A 4EOOA 5DOSA 1ZOGA 4CMTA 2W9FB 4C2WA 5BUIA 5BVFA 3NFGB 4Q2AA 5CEIA 3WOWA 4K2RA 4A4LA 2UW8A 3V6RA 4C59A 5A14A 5FXQA 3DK7A 2WMSA 4NTTA 3VO3A 2BILB 5DR6A 5CU6A 4C4FA 3FL5A 2WMRA 5FBOA 4NW5A 4AFEA 4ANLA 4CGAA 5IEXA 4XV9A 5K9IA 2CKQA 5AAEA 3MPAA 3U9CA 2JIUA 3HMOA 3V5JA 4ZLZA 4ZTRA 2UW0A 3Q9ZA 4IH8A 1WCCA 2PE2A 4EOMA 5JRQA 2VTNA 1L3RE 3E8EA 3O17A 1XR1A 3SV0A 5B7VA 4DEDA 3NW7A 3R2BA 2R5TA 2QC6A 3EKNA 3LW0A 4NKAA 3AKJA 4UV0A 1OZ1A 3KKVA 4ZS0A 3ZFYA 4BYJA 4IWDA 2ETKA 3Q60A 4WNMA 5DH3A 5H3QA 5J5SA 2PZIA 4Z3VA 5AV3A 4AE6A 1JKLA 4I6HA 5EM5A 4BB4A 4ZTMA 1PRYA 3ERKA 2EXCX 3LMGA 4J99A 3HUCA 2H9VA 2BAQA 4GVAA 2OJ9A 4O1OA 5CI6A 5C8NA 5LWMA 3SAYA 4DN5A 5FLFA 2JIVA 1PYEA 4YJRA 3QTRA 4BDBA 4CG9A 2VTPA 3FMLA 2J90A 2AC5A 4ONAA 4FZ7A 4C3FA 3NX8A 1OIRA 2CGUA 4XRJA 3GCSA 3MH0A 3MFUA 2QG7A 2UW3A 5I9XA 2JDRA 3CJGA 3H30A 4AZTA 4C3RA 4QOXA 4U97A 2ITXA 5GZ9A 4JDJA 3OC1A 3PJCA 3AD6A 4RMZA 2FO0A 3T3VA 2VWUA 3K2LA 4HVIA 4WRSA 4FV7A 4EZ5A 2EB3A 2R3LA 2PVHA 4PPCA 2IVTA 3FLQA 5K3YA 3BWFA 1UA2A 4FSMA 2QOQA 2C0OA 5HE2A 4KBAA 2QR7A 3GU6A 3QX4A 4K0YA 4RC3A 4BIDA 5HG5A 3EQPA 2HY0A 4EOSA 4QQTA 4FKQA 2QI8A 5DE2A 4ZZNA 3GCPA 2HYYA 4AOIA 5BVWA 4KS8A 3NVMB 2EWAA 5LMAA 1BMKA 2RGPA 1Q62A 2YAAA 4E20A 4F9AA 5GJFA 4FKIA 3F69A 4CKJA 2WB8A 4ACDA 4CYJA 3KRWA 2OJJA 3UP2A 4MQ1A 5I9YA 3DKFA 4NM3A 3UBDA 5AP5A 4DGGA 4RSSA 1WBNA 3ZDUA 1Q8WA 1YI6A 5HIBA 4XCUA 2QOHA 4AZEA 2IO6A 3LXNA 1PMUA 1HCLA 5L6WL 4BCOA 3Q9WA 4X21A 3QAME 4PUZA 5IA1A 4TYIA 4E4MA 4UXQA 4BZDA 4U41A 1VYWA 1G3NA 3E62A 4JX3A 4FZDB 5HO6A 5EDQA 2C5VA 1AQ1A 4JIAA 3TIYA 4EH7A 1NVSA