4NSTA

Crystal structure of human cdk12/cyclin k in complex with adp-aluminum fluoride
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
331
structure length
322
Chain Sequence
ESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transcription
molecule keywords Cyclin-dependent kinase 12
publication title The structure and substrate specificity of human Cdk12/Cyclin K.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 322
sequence length 331
chains with identical sequence C
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2013-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4nstA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4nstA01
5IA5A 4MNEA 1VYWA 4QMXA 5C1QB 4MNEB 3DQXA 2BDWA 4BBEA 5JFWA 5A14A 1OL6A 2XF0A 4IDTA 5DGZA 3LE6A 4CFWA 5I0BA 2OO8X 4FIGA 5AADA 3UOLA 2WEVA 3PTGA 2BZJA 2CKOA 4OT6A 4WIHA 2VWXA 2ONLC 2WQBA 2XYNA 3FMHA 2YAKA 4JQ7A 2PWLA 3D14A 3NNWA 5D1JA 4D5HA 3VBYA 1JKKA 2UW8A 1IASA 5HIDA 4PDYA 4FIEA 1FGKA 3RAHA 5TKDA 3G15A 2W1EA 3PSBA 3AD5A 5EFQA 4ENYA 3N4TA 3S95A 3RBWA 3RWPA 3LQ8A 2GNIA 5KO1A 2GSFA 4LOPA 2IVSA 3LMHA 4A9SA 4EHGA 2W1DA 2XIXA 3I60A 3EN9A 4NK9A 4BDFA 2F49A 3R21A 4BDCA 3ZO1A 1UU9A 2PSQA 3P1AA 1GIIA 3KRWA 5F1ZA 1ZYLA 1T45A 3NGAA 5EW9A 5HZNA 2RFDA 3Q5ZA 2JBOA 1L8TA 1OL7A 3E8CA 3IDPA 5GZAA 1QL6A 4ASDA 2IO6A 4LFIA 2XYUA 3QRUA 4RRVA 3BHYA 5CXZA 4ZK5A 3R2BA 2C6LA 1JLUE 3PXZA 4ZSJA 3Q04A 1TQIA 4APPA 4MBIA 4AS0A 4AFEA 1YXXA 3VBWA 2BKZA 4L01A 4FK3A 5F20A 4RGJA 5HESA 3TUCA 3JR1A 3GC0A 3BLRA 1KV2A 1S9JA 3ZLSA 2J0IA 4MXXA 4RC4A 4U40A 5ACBC 2XM9A 3A7JA 3IS5A 3O8PA 3QD4A 2QOCA 4M67A 2EUFB 2YM3A 4FZ6A 3AT4A 4MAOA 4C0TA 4DA5A 5AEPA 2BRHA 2J50A 3QLFA 4I5CA 4OTRA 3FQEA 3SRVB 3R7VA 2QODA 4FIFA 2WU6A 4TW9A 5M55A 4OAUC 4BCOA 2JFLA 3G0EA 3QX4A 3COIA 2VGPA 3ZRKA 2OZOA 4L42A 4PPBA 4ITJA 3TDVA 1V0OA 4PP9A 3NZ0A 3VHEA 2O63A 5LJJA 2YWPA 3BIZA 3RNIA 1WFCA 1CKIA 2YJRA 4AW2A 4CKRA 2YIXA 1PKDA 1YHVA 2GQGA 3UOJA 3IW7A 3UOKA 2GTNA 3NYXA 3IONA 3EN7A 4FTRA 3DKCA 1H01A 2H9VA 2RF9A 3NCGA 1H00A 2W5HA 4Y46A 5CSXA 5CEIA 4J71A 4A06A 1JSVA 2O2UA 5AP7A 4DE4A 2NRYA 4AE6A 4CFMA 1YDRE 5CEMA 3O7LB 4P7EA 3JUHA 2JITA 5FD2A 4ZXTA 3ZZWA 2C6MA 3GCVA 3HL7A 5DHJA 4GVJA 3A4OX 1UNLA 3MPTA 4CVAA 4XOZA 4JBPA 4O0SA 2I0YA 2Y0AA 4W8EA 4ALWA 2OJJA 3R02A 1Z5MA 5DH3A 4YBJA 3A7GA 4MD9E 4I1ZA 1OITA 5GJFA 4F99A 2R2PA 4X3JA 3POOA 3BV3A 5CZIA 3RAIA 2IZRA 4APCA 4I24A 3BYSA 2ITOA 4K8AA 4QP6A 5HCZA 3R7UA 3PJ8A 2B9JA 3K3JA 5HX8A 3QA0A 3P79A 3NCZA 3UODA 1ZOGA 1PMVA 2OWBA 4YJTA 2WTWA 3Q60A 4ZTQA 4O2ZA 4MWHA 3P78A 2C5XA 5HG5A 4WBOA 5AV1A 4U6RA 3SW4A 2QKWB 5C9CA 3CJFA 3EL7A 4D4VA 3SAYA 4JBQA 4HGEA 5HBEA 1K2PA 5LVLA 3UG2A 4NM3A 4ZZMA 2QOLA 4AT3A 3W2SA 4BCFA 2IZUA 5J8IA 1U54A 4Z7HA 3CY3A 1U54B 5CS6A 1QMZA 1Y91A 2R3MA 4M15A 4KINA 3A8WA 1LR4A 2HIWA 5ANEA 2YM4A 4FTUA 3ZRMA 4B7TA 2X6EA 3QTSA 3PJ1A 4LYNA 3EQIA 2UW3A 3QU0A 4IZYA 3SX9A 2YERA 3WOWA 1FQ1B 4ASEA 3W18A 2XIZA 3QZGA 3VUTA 3EYHA 1JAMA 4G6LA 2C0TA 2HCKA 4RMZA 4GKHA 1CKJA 1OB3A 2WQOA 1A06A 2OG8A 4OAVB 4A9TA 3CQWA 4RIXA 3QUPA 1XH6A 3BCEA 4H39A 3NUYA 3F5PA 5EQEA 2R3LA 3I5ZA 4BI0A 4ZLOA 2XKDA 3T9TA 1AD5A 3HMNA 4O0XA 5M4IA 3TCPA 2J9MA 3G2FA 3FKNA 3HZTA 5HIBA 5CI7A 3FXWA 5CX9A 3RZFA 3KA0A 3WI6A 4GG7A 5KNJA 2IVTA 2Y6MA 1JQHA 4WG4A 2CHLA 4I5MA 4C3RA 3OMVA 3BEAA 5K4IA 3ZC5A 4FKWA 1E1XA 2WQNA 2ZDUA 4YP8A 3DTCA 4M68A 2BAQA 5KBQA 3OTVA 1UWHA 4IAFA 2NRUA 3TZ7A 4FV7A 2JAMA 3QXOA 2REIA 1JNKA 3RVGA 3ZFMA 1P4OA 4C33A 2WTCA 2W9FB 3IPHA 4UX9A 2DS1A 2JIIA 1J1BA 3OZ6A 3V5TA 4BY9E 4K33A 1Q62A 3RGFA 2EXCX 2XK9A 4A9UA 3LFEA 2ZMCA 3P23A 3BU6A 5AP2A 3DBDA 2GMXA 3VNTA 2HZIA 3GT8A 4DBXA 1TQPA 4PDOA 3VHKA 1CTPE 4IZ5A 3SOAA 1JKSA 4FKIA 2ZOQA 4OR5A 3VBTA 4DGGA 4IAYA 2UZUE 4PMSA 5AUVA 4USFA 5ITAA 4HOKA 2RFEA 3Q5IA 4FV3A 3RHXA 3WE8A 4DCEA 3LHJA 2P3GX 4FKQA 4RFMA 2HW7A 1B39A 4FOBA 4O83A 2ACXA 3DOGA 2QD9A 3SGCA 4AACA 3AMBA 4AW0A 2XH5A 2R3PA 4KIPA 3SG8A 1S9IA 2HW6A 3HP5A 3U9NA 5HNIX 3ZLYA 4D4YA 3KL8A 4J53A 3VC4A 1E1VA 4EC9A 1JSTA 2VTSA 4KBAA 2X0GA 2VWBA 1DAYA 3RCDA 2B1PA 3PZEA 1URWA 2OF4A 3OBGA 1H0WA 3R1SA 4PPCA 4FTMA 3W32A 3ZMMA 3R73A 4WO5A 5D10A 3RAWA 4WOVA 3GC8A 1WVWA 2RSVA 3NW6A 5CU3A 4DG3E 5FUTA 2QHNA 2R3KA 4LQMA 4BB4A 4FT3A 4BGGA 4WKQA 2JIVA 2OIBA 5G6VA 1W8CA 4YO6A 5IQCA 2XNMA 5IH4A 3B8RA 1IR3A 4V0GB 2VV9A 3GGFA 3C5IA 2W1FA 5DEYA 1WZYA 1FGIA 3I1AA 3HV7A 2WQMA 3LQ5A 5LVPA 2G9XA 3CE3A 3FI3A 3HAVA 4IM0A 2UV2A 4D2TA 1BL7A 4DG2E 4MXAA 3DBQA 4HPUE 4CGAA 5J9YA 1YWVA 1ZYSA 4I0RA 3ULZA 3OY1A 2PVFA 5EM7A 4PDPA 2YACA 5K5XA 5C8KA 3VULA 1G8SA 5K5NA 3CIKA 5DE2A 3ZUVA 4FVPA 3BGZA 3UNZA 5KMLA 2XJ2A 3FC1X 4TN6A 2GU8A 3KXMA 3QQFA 2JDSA 3UBDA 3R0TA 1I09A 4WA9A 4EH9A 3AC3A 3U54A 3GU7A 1H1RA 3C13A 4HNFA 4FT9A 3P4KA 2OW3A 3ELJA 3C0IA 2F7XE 4RJ7A 5M09A 4MQ1A 5CVFA 3RPRA 3H30A 2NPQA 3D0EA 2QNJA 1Q8WA 3EIDA 2VO0A 5EHOA 4IAZA 3TZ8A 4E7WA 4I41A 2WB8A 5HI2A 3TV4A 3E64A 2C6EA 4U81A 5BVOA 4XYFA 5IUHA 3CD8A 4XP2A 3E88A 5HG7A 4FSZA 4CKJA 4JRVA 4IQ6A 1BL6A 2J51A 3PUPA 5LMBA 4PTCA 3UNKA 4GT3A 5EOBA 5JEBA 3QUDA 2O3PA 1NW1A 3MB6A 5EM6A 1H1QA 1M52A 2CCHA 3FYKX 1OI9A 2GFCA 3FAAA 5FQDC 3RPSA 5IMEA 4K6ZA 1WMKA 4NM5A 4EK6A 3VRYA 3HYHA 1M14A 4ANQA 2RG6A 3F66A 2OKRA 1LEWA 3LM0A 3UIMA 3NYNA 1LEZA 5BVKA 2YM8A 4UY9A 5CLPA 3IW5A 3PG3A 4RX9A 5JQ8A 2F2UA 3FI4A 3ODYX 2ZAZA 4LL0A 4FEQA 3MPMA 4GS6A 5L8LA 3O51A 4QYYA 5EQYA 3UQGA 4YSJA 3P08A 4UMRA 4AOTA 3CJGA 4CFVA 3OHTA 4AA4A 4ACGA 2O65A 3KF7A 2WFYA 5BYYA 2ITXA 5CF8A 2WKMA 4YZ9A 3ZBXA 3DXQA 5ANJA 3H9OA 4DTKA 5CAQA 2HWOA 3R30A 3TG1A 4P2KA 2BHEA 5EQPA 2PVMA 3F3VA 2CNVA 3OOMA 5IQEA 2P0CA 1A9UA 2R7IA 4EONA 4C4JA 3TM0A 4E5AX 3CP9A 5DN3A 2ITPA 4DINA 2XJ1A 3DFAA 4TXCA 2OU7A 2ITQA 5AX9A 3COKA 5AMNA 4FL1A 4H36A 3RWQA 5B7VA 3R8ZA 5HG8A 4L45A 3OXIA 4QRCA 5BUJA 5IQDA 4BCIA 4E6DA 4GUEA 4M66A 4NH1A 3PVBA 4GUBA 2JKKA 4U0IA 4DFUA 4C2WA 4HPTE 3R01A 3SD0A 3R8MA 4F7SA 4O0WA 4R5YA 5ETCA 4FE2A 2RGPA 3UE4A 1W7HA 2G01A 2JEDA 3QA8A 4F08A 2XNPA 1P5EA 1Q41A 4Z55A 4QT1A 3MIAA 4E5BA 4L67A 4AOJA 3QYWA 2GHGA 4ZSLA 3TWJA 2Y4PA 3DV3A 5CEKA 3PPZA 2OXDA 4AFJA 4D4SA 3QWKA 3QKLA 1YOJA 3HUBA 1UU3A 1JKLA 2AC3A 2HK5A 3NEWA 4MHAA 4OTPA 4CLJA 5E4HA 4OUCA 4JXFA 1OL5A 4BTMA 3P5KA 2SRCA 4JQEA 4K11A 3MB7A 3ZO2A 5HU3A 1JSUA 1RQQA 2O64A 3F7ZA 3NX8A 4M8TA 2R3OA 1WBNA 4ZS0A 3G9LX 5HOAA 4I22A 3KULA 4IFGA 4YC3A 4QNAA 3NIZA 4W4VA 5LCKA 4DT9A 2YDKA 1SVEA 3DNEA 5LWMA 3DB8A 3AMAA 1YDSE 3UGCA 2HY81 3V5WA 4YLLA 4E6CA 3O7LD 2JLDA 3E8DA 3RM6A 3A7HA 4KB8A 4UMUA 3SXRA 4DEHA 2NO3A 3NVMB 4YJNA 3LFAA 3S0OA 3ZC6A 3W2QA 2VGOA 4MTAA 5AP3A 2HZ0A 2W9ZB 4Q9ZA 2YDJA 3I5NA 3I4BA 3UMXA 4ASXA 4YGAA 3OCTA 1TKIA 4LGGA 4FSTA 4LOOA 4EOSA 5FBOA 2C1BA 3RK5A 1FPUA 3KCFA 4BDBA 3PIXA 3S2PA 4R1YA 2OXXA 4NFNA 4X2FA 3TKHA 3KRLA 3V04A 5KHXA 2B7AA 2F57A 2P2HA 3LCSA 3Q9WA 4I0SA 4RQKA 3UPZA 4EHEA 3QRTA 4JQ8A 3OW4A 2Z7LA 2XEZA 3WYYA 3ORKA 3ET7A 2ZB0A 4TTHB 5I3RA 3OUKA 3P7AA 2BILB 4L53A 4CT2A 3WIKA 4QQTA 4RJ4A 4CRSA 5HGIA 1M17A 4IJPA 4U7ZA 4FTJA 4LGHA 4ZTMA 4MXOA 5BQ0A 5DOSA 5M51A 2OZAB 3FKLA 4MEDA 4PPAA 2WIPA 3UO6A 2CKQA 3NUAA 4F0FA 2GS6A 3TN8A 1YI4A 5AP5A 1WVXA 3R9OA 3ZXZA 1OIRA 2PL0A 3DLZA 5GIPE 2PZYA 2VNWA 3KF4A 2GHLA 3P86A 2XKEA 2GPHA 4RVKA 3R00A 2A2AA 2VTOA 3O50A 5HCYA 3K3IA 2Z8CA 3CTJA 5DMZA 3B2WA 3DDQA 4NTTA 5EYKA 4IIRA 2YM5A 3UNJA 2CNQA 2YM6A 1R0EA 4L44A 4NUSA 3C4CA 2B54A 3G90X 4DC2A 2H6DA 3E3PA 2OF2A 5DLSA 3FXZA 1R0PA 3EN6A 4TYEA 2C3LA 4UWCA 4DH1A 3GU4A 3ZHPC 4H3PA 3FC2A 1PXIA 3FZOA 3BWFA 5L2SA 1H8FA 3NAXA 1JWHA 3MV5A 4DEBA 2QC6A 1F0QA 5BMSA 1IA8A 3ODZX 4JVGA 2UZLA 2YDIA 5B0XA 1SM2A 4HYSA 4BICA 2XBAA 2G2IA 5CSPA 4EK8A 4PNIA 3CTHA 3FV8A 4XG7A 5I9XA 3AD6A 4C37A 5IDPA 5IQFA 5I9ZA 5I3OA 4ZEGA 3ZBFA 2PVNA 3ERKA 4JDKA 4QMZA 5CZHA 4ANNA 3VRZA 4YUQA 5ANGA 2J90A 3LXLA 4GCJA 4OGRA 2YIRA 1OL2A 5HD7A 3QZHA 5BYLA 3GP0A 3R9RA 2PHKA 4C3FA 1PMEA 3ZZEA 4AN2A 3PRIA 2XIRA 3B8QA 3QTRA 4WUAA 3VS4A 5A4LA 2GQRA 4C2VA 2J6MA 5AAEA 5KMOA 3PWYA 1QPCA 4CQEA 3R71A 2BIKB 5CAVA 3E63A 4IAAA 5DYJA 3TJDA 3PZHA 4QQCA 4WRGA 3DU8A 3MGYA 4BI1A 3QLGA 4HJOA 2F7ZE 4LRKA 2JGZA 2PVKA 2YLFA 4FI1A 4FV5A 4D2PA 3IECA 4W4YA 3T3VA 3NUPA 4AE9A 4YHJA 3D94A 2VD5A 2YCSA 4LG4A 3V3VA 4O86A 3EQGA 4BR3A 4U97A 3VQHA 3W2OA 2G2FA 2R3IA 1LP4A 1PKGA 3RALA 4ALVA 2C6TA 3PXKA 3R28A 4YJSA 4RSSA 3UVPA 4AN3A 5F94A 3DZOA 3DB6A 4G5JA 5I9WA 3ORNA 4O82A 3PRFA 3NUNA 3OF0A 1UA2A 3WYXA 2V7AA 4AZVA 4RIWA 2E9OA 4J7BA 1J1CA 3U9CA 4MXYA 4CNHA 4GK3A 3VAPA 5HVKA 2JKQA 4O6EA 5K9IA 2DWBA 4KNBA 4W4XA 4AQCA 4DG0E 5HTCA 5J7BA 4O7SA 4BCNA 2PU8A 4D2VA 4Y5HA 5DG5A 1PXPA 1XO2B 4R77A 1DI9A 5FXQA 1J7UA 2RG5A 2LGCA 4HVIA 3AT3A 5GHVA 3NVKI 1BLXA 4J96A 2BAJA 4X2JA 3NYVA 3CKXA 3O71A 4N70A 4CKIA 2J4ZA 3D9VA 3EFLA 4CG8A 4FTNA 2C6OA 4ZOGA 4QPAA 5KE0A 5M06A 3OCBA 5H9BA 2DUVA 3DPKA 4IVCA 1MQBA 3I6UA 5CYIA 3QD3A 5IUGA 3LJ0A 5HBHA 5H8EA 4IB1A 4BGHA 3BHHA 2BZIB 4MK0A 3TL8A 4QMYA 5E90A 2QU5A 3MW1A 1CKPA 4PMTA 3Q9ZA 4M12A 4RZVA 5DA3A 3UYTA 5LMAA 2WELA 4BRXA 2GHMA 2QR7A 3IQ7A 3TJCA 4AXAA 3AC2A 4JL9A 3PDTA 2V62A 1Z57A 3VUDA 4AW5A 3MBLA 3GEQA 4UALA 3TIZA 1VJYA 2ZMDA 4YJQA 1BKXA 5BVWA 3FZ1A 3V51A 1V0PA 5L4QA 5FM3A 3PIYA 1J3HA 4FEUA 1Q97A 1ZZ2A 4W4WA 3DBEA 3ULIA 4JDHA 1SYKA 3NAYA 5E8SA 5F95A 5E91A 3OCSA 4G3GA 3KB7A 1GAGA 4W9XA 2C3JA 4F4PA 3QTUA 4JR3A 3NUXA 3VF8A 2QVSE 3RHKA 2J0MB 4IEBA 4FX3A 3VJNA 4BHNA 4EZ3A 2E9PA 4IX5A 4DLJA 4CZUA 3NNXA 2QOBA 1U4DA 4CD0A 5A4QA 5LOHA 2W1GA 3NMUF 2YCRA 3SDJA 2WTDA 3G9NA 4BTFA 3IKAA 1Q3WA 3S4QA 3C5UA 1M2PA 3LXPA 4L46A 4AZWA 2CNUA 3MS9A 4FL2A 4E1ZA 5JFSA 3E8EA 2J7TA 1YOLA 1URCA 4EYMA 5HORA 2C5OA 4CFUA 3Q9XA 4D28A 4RWJA 3TT0A 4UN0C 2C5NA 2XNGA 3NW7A 4DFYA 2G2HA 3ZFYA 4MBLA 3BQCA 3V01A 4HVHA 4A4OA 1ATPE 4TKSA 4OLIA 4BN1A 4F63A 5A9UA 4BI2A 2JD5A 4LUEA 4C02A 5F9EA 2HY0A 2UVZA 2WNTA 2Y7JA 3F69A 3ZTXA 3ACKA 3F3WA 4BCJA 5HU9A 4Y72A 2G15A 4FYNA 2YIYA 4RQVA 5EW8A 3R7YA 1UV5A 4JX3A 4MD7E 4S30A 4AX8A 3QRJA 3EKKA 3BGPA 4XP0A 4EHZA 3RPYA 4LOQA 4A4LA 4D1SA 2WMQA 2PVHA 2I1MA 4F1MA 3VQUA 2QQ7A 2YITA 1PF8A 4E73A 5HQ0A 2UW9A 3FPQA 2Q0NA 5CQWA 1Q99A 2XNNA 4YZMA 4PUZA 3GENA 5HE3A 4YSMA 1Y8GA 2O5KA 4B0GA 4EOKA 1OGUA 4TWOA 2H96A 4X6RA 4IMYA 3UZPA 4FV6A 3M2WA 4C58A 3I7CA 3FLZA 1KE8A 4L7FA 4CMUA 3ZS5A 3OXZA 2WHBA 4FIHA 4EYJA 1MQ4A 5J5TA 4BZOA 3A99A 5BVFA 4IADA 5FTGA 3VS5A 4XMOA 5HCXA 1B6CB 3PA5A 4H58A 3ZRLA 2BZHB 2GNJA 4X3FA 4EOLA 2PUNA 4X3FB 3A2CA 4D0XA 5C26A 3S00A 2YIWA 4QMWA 4NYEA 4O27B 4QPSA 2B9IA 5CEOA 4IM3A 3M11A 2Y4IB 3O8TA 5TE0A 4FGRA 4IB0A 3VUIA 1XWSA 5LCJA 3CGOA 2CN8A 4F9YA 2BMCA 3FKOA 2QU6A 2VWUA 2X4ZA 5AP1A 3SRVA 1OIYA 3U4WA 4BDJA 3HEGA 3I79A 5CF4A 1HOWA 2VX1A 5FP5A 4UWBA 2OFUA 3MH1A 4FUYA 4Y73A 5EKOA 3FL4A 2BKKA 4AA5A 1BI8A 4G5PA 5CAPA 2BR1A 3C4WA 1YHWA 3VS1A 4J98A 1M7NA 2BDFA 2BVAA 4KBKA 2WQEA 5GINE 2G1TA 2JAVA 3KK8A 2WXVA 4E3CA 4F70A 3AMYA 4CLIA 1Q8YA 4YBKA 3ZO3A 1FVTA 1H08A 5AR4A 4PNKA 4C61A 4S2ZA 3QTWA 1PXOA 2Z60A 4IE9A 3V8WA 3MWUA 2ITUA 1TQMA 1KSWA 2WTJA 5AUZA 2WPAA 3LFDA 2FSLX 3MH3A 4M84A 3GOKA 4FV0A 1OKZA 4FSUA 3UYSA 2R3RA 5A6NA 4RLKA 2EU9A 2CCIA 4O7NA 1OL1A 2E9NA 3LPBA 2XM8A 4NU1A 3QTXA 3ATSA 2QO7A 4YNOA 4MXZA 1UKHA 4UMTA 4BCQA 2UUEA 4I5HA 1Q3DA 4MKCA 5DNRA 4BC6A 3ALNA 4AGWA 1MUOA 1OKYA 2C0IA 4R7BA 2CSNA 2R64A 5AV0A 3D4QA 3KXHA 3EOCA 4BKZA 4C7TA 2BRNA 3EN4A 4FKPA 4ID7A 2C69A 4F0IA 5L3AA 2Y9QA 1JPAA 2C4GA 4MBJA 5KKRC 4FZDB 5IF1A 3A61A 4I5PA 2XCKA 4IH8A 4IDVA 4IC7A 4L7SA 3NPCA 4XX9A 3C1XA 2WMVA 3Q4ZA 4BIEA 3SG9A 2WMRA 4C38A 4QMMA 4UYNA 2PVJA 5JT2A 3MA3A 2OLCA 2R0UA 4RBLA 3IK3A 5T3QA 3S1HA 4CMTA 5CT0A 1PXJA 3C0HA 3ZO4A 4GIHA 5CT7A 4YZNA 5CEQA 3VS0A 2RL5A 4GFMA 2CDZA 1Q4LA 4DYMA 4EH3A 5LXMA 3KY2A 4L6QA 3PXQA 4QTCA 4PDSA 3ZONA 4Z3VA 5AAFA 4DF3A 2FSTX 1GIJA 3DXNA 4QO9A 2Q0BA 2C68A 3CBLA 3L9NA 1NXKA 4ZY4A 3BU5A 3SOCA 3WF6A 4ZP5A 4M13A 3ZFXA 4HCUA 3HVCA 3CXWA 3THBA 3W2CA 3TV7A 2ETRA 5HHWA 4GU9A 1MRVA 1ZYJA 5AR5A 4EC8A 3FSFA 2FYSA 4FTTA 2FA2A 4R7IA 2JBPA 4BCHA 4YTCA 4PL5A 5GJGA 3N4UA 4OT5A 3KXXA 4TRLA 3F5XA 4JNWA 1ZY4A 2BTSA 5FXSA 3WF8A 3I0OA 2GTMA 3O2MA 4E20A 4XLIA 3CD3A 3KU2A 4TYJA 3OWPA 3TNPC 3ZCLA 3U87A 2EWAA 3E93A 4E4MA 2W96B 5L6WL 3GU5A 4U41A 4IX6A 3ROCA 4ZSAA 2X8EA 3I6WA 3UVQA 2VZ6A 1XKKA 1CM8A 2BRGA 3JS2A 4PL3A 5BYZA 1CSNA 3C50A 3GQLA 4C4FA 4FNXA 3VUGA 5BVNA 5IQAA 3SA0A 4IBMA 3W8QA 1P14A 2R3GA 3ZM9A 4O0TA 4D9UA 5IA0A 3MH0A 5CASA 2W4OA 4EL9A 5TOZA 3RK9A 3LQ3A 2WU7A 3BRBA 5DT3A 4AGCA 4IAKA 2WZJA 3FZSA 4FYOA 3D2KA 5CXHA 5IU2A 5KZ0A 3U8WA 4ZY5A 3F6XA 4XG3A 3BV2A 3HV4A 2XKFA 5IISA 4FNYA 3BLHA 5AUXA 5IKWA 2IPXA 3EHAA 3WE4A 4ZSGA 3TXOA 3NNUA 2XP2A 1K9AA 5BMMA 2QR8A 4FSYA 2LAVA 4BFMA 2EVAA 4KABA 1NVQA 4O7WA 5JGBA 3HMMA 3NYOA 2I0VA 1OBDA 1J7IA 3TTIA 1GZKA 1M2QA 1XBBA 2H8HA 1F5QA 2X9FA 3QBNA 4KWPA 3PY1A 4CCBA 5ETIA 2HELA 3LLAA 5HE2A 3OTUA 1YXVA 4GJ3A 4BDDA 5EOLA 4HZRA 2OH4A 4C4IA 4E93A 2ZV8A 3ORZA 2GNHA 4I93A 3ZLXA 4ENXA 2OSCA 4E4LA 2EXMA 3ANRA 2R3HA 3MY0A 4R6VA 5M57A 1R78A 4D5KA 3QRIA 4UV0A 3AXWA 2W05A 3L1SA 4LI5A 4MF1A 4BCGA 1XH9A 2OBJA 4Q9SA 3REPA 4C36A 5ETAA 4O2PA 4EUUA 4N6YA 4WNMA 3DKOA 4UBAA 3UG1A 3VS2A 5IEVA 5J7HA 3DK7A 3ORPA 1MP8A 3EKNA 3HLLA 3EZVA 3ORIA 4HGTA 3BPRA 2VTIA 4M97A 4OTQA 3VWAA 3ZH8A 3PJ3A 2X7GA 4QP3A 4R8QA 4TWNA 4WNOA 4V0GA 2BRMA 1PXKA 2X39A 4KS7A 5FWKK 4YR8A 4GEOA 2PZPA 3GUBA 5K4JA 2W0JA 4ZLZA 1P4FA 3ETAA 2C5VA 5CQUA 1SVHA 4U3YA 4I21A 4JOAA 1CDKA 4E6QA 2QLUA 3D2IA 4AT4A 4D2WA 3DTWA 5HG9A 3WIGA 2FSOX 4YPDA 1GIHA 2I0HA 3NW5A 4GG5A 5C27A 2C6DA 2ITVA 3PSCA 4J95A 3BI6A 4ZTLA 4FKVA 5E7RA 2Z7RA 5IA2A 4U5JA 4YURA 4OW8A 4BDEA 2F2CB 1QCFA 4F7LA 5CNOA 4OBOA 3EQHA 3MJ1A 4U3ZA 4PTGA 2A4LA 1J91A 2V7OA 4O0UA 2VWZA 5BVDA 3CLYA 4FSWA 4QMQA 4ZJVA 4GK4A 5H2UA 3C4FA 5EHYA 4R1VA 4W8DA 4RIOA 1H24A 4O7ZA 3MPAA 5JRSA 5AM6A 4EOMA 3EL8A 1XHAA 4EH4A 4IFCA 2W99B 4QMSA 3PSDA 4CZYB 3EZRA 5FEQA 3RPVA 3WZDA 2XUUA 4YC6A 1R1WA 5HIEA 3FDNA 2EB3A 4RIYB 4JIKA 2HENA 3Q96A 3Q4TA 4KAOA 4JDJA 5I9VA 2VRXA 3QTIA 4KKHA 2BFYA 3PFQA 4OBPA 1UU7A 3A4PA 3QGYA 2A0CX 2XS0A 3C0GA 3IGGA 2IZSA 4ITIA 4O96A 1PHKA 3BBWA 1YW2A 1IAHA 2YAAA 3AC4A 2XBJA 3LFBA 4YJUA 3E7VA 3RZBA 4DFXE 4CTCA 2B9FA 2NNWB 3LKMA 2CLXA 4RZWA 5IA3A 3QQHA 4BIDA 1W84A 4FSNA 5IQIA 4G3DA 3CGFA 4C4EA 5LARA 5L8KA 4GH2A 2YN8A 3DBCA 2C3KA 2X81A 2BDJA 4ANLA 4JAJA 3H10A 3O17A 4F9WA 3L8XA 2CLQA 4XH6A 3UC4A 5L6PA 1KUTA 4PY1A 4UZDA 4KIKB 4JBVA 3LLTA 4F09A 1H0VA 4TT7A 4JS8A 3MVJA 4NCTC 4BTKA 1O6YA 3CQEA 5G1XA 1BX6A 4BDHA 4YZCA 5DEWA 3MYGA 4U42A 3D83A 2BPMA 5I9UA 4S34A 3OWJA 5CAUA 4QYFA 4QYHA 4G9RA 4W9WA 5LVNA 3RKBA 1BI7A 1WBPA 3FEGA 2UZWE 4O7VA 4RVTA 4B8MA 4TYHA 3U6IA 4D4RA 4TYHB 5ICPA 1UNGA 2F7EE 3OVVA 5FEEA 4DCAA 2XK8A 3PA4A 4A07A 3EYGA 5KX8A 1WBTA 1H1SA 3COMA 4I4FA 4EEVA 3IO7A 4NIFB 5IG1A 4EJNA 3A7FA 4V01A 2Q83A 3JVSA 4CEGA 5HLNA 3C4EA 2W5AA 4AU8A 3IOKA 3VUMA 4AWIA 3CPCA 4DEAA 1O6LA 2BZKB 2ZJWA 2P55A 2IJMA 4UWYA 4EHVA 4NKSA 3LXNA 5CU2A 5C4KA 3LFQA 3ENMA 5FTOA 4MVFA 4O0YA 4F0GA 5JN2A 3FHIA 2PVYA 4IHPA 4E4NA 4M3QA 1W98A 3AG9A 4FKRA 1H28A 2XNOA 5TT7A 4QQJA 4DTAA 3EH9A 3UDBA 4RA4A 4E4XA 4NTSA 3GCPA 4DFNA 3ZEPA 1ZMVA 4RX7A 4FBXA 5HNBA 5LVOA 3QRKA 2VWWA 4Z7GA 5DIAA 4IX4A 4Y83A 4FTAA 3R7OA 3GCUA 3QD0A 5FXRA 4O1PA 5IA1A 4NL0A 2YEXA 4FT5A 4K0YA 4WUNA 4XUFA 3VO3A 1XQZA 4ASZA 5EYCA 1H25A 3OROA 5GNKA 3F3UA 4G9CA 1SNUA 5M08A 4UEUA 4ERWA 3PY0A 4BL1A 5IPJA 1G8AA 4XG6A 3LW0A 5IDNA 4WG3A 2IW6A 5JFXA 1YWNA 4EUTA 4FG9A 3A7IA 4ANOA 3TIYA 4HGSA 4IZ7A 4FKTA 4CZTA 3MH2A 5BUIA 2QG7A 3V8TA 1Q8TA 3NUUA 2QI8A 5EW3A 4MX9A 2Z7SA 5C8MA 3ENHA 4UMPA 4X21A 2PVRA 3KREA 3A60A 5BUEA 3QFVA 4X2NA 2VTTA 4FV4A 3LCKA 4FIIA 3ALOA 3D5VA 4Q5HA 1XH8A 4H05A 2E2BA 4GKIA 3AC5A 4GSBA 4LV8A 3L8VA 4HYUA 3QC4A 1GZ8A 5AM7A 2W17A 3MFSA 4EOIA 3ZSHA 1G5SA 5C4LA 5E8VA 4L8MA 1DI8A 3R7EA 2FUMA 2QCSA 3W2PA 1KE5A 2E9UA 3OC1A 5D11A 4FF8A 1Z9XA 3QKKA 3QWJA 3TDWA 2W1HA 4USEA 4R78A 3WZKA 4ITHA 4XV1A 4ZY6A 2VWIA 3EWHA 4I3ZA 1ZMWA 4CV8A 2OZAA 4JG6A 5KMNA 4ZMEA 5F4NA 3COHA 2CN5A 3FZPA 5LQFA 1X8BA 2FVDA 3R1NA 5E1EA 4Z16A 3U6JA 4G1WA 3R63A 3PXRA 2IW8A 3ZSGA 3EB0A 3DKFA 3EFJA 5L2TA 4A7CA 2JKMA 4WSQA 3C7QA 4O0RA 3UO4A 4IVDA 2XCHA 4TWPA 2VTAA 4M0YA 3HECA 3FL5A 3PLSA 4FR4A 4L3LA 2CPKE 1H1PA 4I6QA 4YJPA 4YHFA 4TPTA 4GFOA 4G2FA 4JBOA 4U9AA 2GDOA 5JFVA 3C9WA 2UVYA 5EDQA 2IVUA 3MDYA 5GZ9A 3UOHA 2QONA 5CSHA 4E5WA 4P90A 4XP3A 3HDNA 1FINA 5DVRA 4KSPA 1A48A 2CGUA 1UU8A 5K0XA 2OJ9A 3TUDA 4IWDA 4EK4A 3BX5A 2UZVA 1F3MC 1O9UA 3DBFA 1ZYCA 4GYGA 3OW3A 3E92A 1OKWA 3IGOA 4XOYA 2QO2A 4OTWA 3BE9A 5E8XA 4N4SA 4ZTHA 2ITZA 3FBVA 1SZMA 3PXFA 4UXLA 4NCTA 4BHZA 4TZRA 5CWZA 3CEKA 3Q52A 3WF9A 5KMJA 4V04A 1FMKA 2W7XA 4CMOA 4F65A 3FYJX 5H8BA 4FV8A 5GZ8A 3UQFA 5EI6A 2VO6A 3CR0A 3IDCA 5AUYA 3VS6A 5JH6A 3PPJA 2C1AA 2OJGA 4KIQA 4C3PA 4DFLA 3FLWA 3UO5A 3EJ1A 2C6KA 4CFFA 5BVEA 2JIUA 3FMNA 3LM5A 4M69B 3FUPA 3BYUA 3K5VA 4OTIA 4B8LA 1JKTA 3ZOSA 4AG8A 2V22A 1NVSA 5AA8A 2XB7A 4L9IA 4ERKA 3PE2A 5CEPA 1OECA 3LFFA 4G31A 3ZUUA 3C51A 3DAJA 4FL3A 5AAGA 4FK6A 5J1VA 2Y8OA 3OT3A 1ZY5A 3KMWA 2QOHA 4CSVA 1W83A 2C5YA 2UW7A 4BDGA 4DH7A 4L00A 2IWIA 3FLSA 4U80A 4EI4A 5CANA 1ZRZA 1IRKA 3OBJA 3W2RA 3OEZA 3NIEA 3CPBA 4AW1A 2X2MA 5JRQA 3OOGA 4G34A 3MY5A 4PL4A 4YZDA 1NY3A 4M7IA 4BKJA 5HTIA 2XA4A 1JOWB 4FZ7A 4EORA 5IH5A 3FE3A 1IEPA 4I6BA 4X3FC 4ZMFA 3ZXTA 3HMOA 4PF4A 5KMKA 2XK3A 3RMFA 4F6WA 5IZFA 2OJFE 2VTQA 5C8NA 3JXWA 3QQGA 5FTQA 2X9EA 2Y4IC 2EXEA 2PE2A 3LFCA 3VBQA 5A4CA 4TYGA 5CVGA 5FLFA 4QTEA 5CALA 1G3NA 2JFMA 3IW4A 3QQKA 4CYIA 4J52A 4RVLA 2FH9A 4FIJA 1Y8YA 2VWYA 3ZUTA 4FZAB 1ZWSA 2VX3A 3BE2A 5EKNA 4XCUA 3FZRA 4D55A 5IMXA 1ZAOA 3BELA 4FKGA 3UIUA 3F2NA 5E1SA 3GNIB 4QQ5A 5DT0A 1H26A 3MSSA 3TNHA 4TYIA 3ACJA 2J2IB 3RNYA 5CTPA 3VIDA 3KCKA 3OWKA 2R3QA 4O7TA 4RC2A 2PYWA 5TO8A 3HGKA 4F1OA 4C8BA 4PRJA 3ZLWA 4DAWA 5HO7A 3ORXA 3DFCB 4HYHA 1VEBA 4QMUA 3AOXA 5L2QA 3AT2A 2CKEA 2W06A 2O8YA 1KOBA 5EG3A 3QCXA 4DEGA 5HKMA 3CTQA 4QNYA 2PY3A 2XKCA 3FMEA 3F88A 4GYIA 4EH2A 2CMWA 4G16A 1UWJA 3TNWA 2B53A 2VN9A 4LM5A 1BYGA 3FLNC 3ITZA 4B6LA 4FG7A 3V5QA 4YO4A 5GIOE 2DQ7X 2OGVA 2I40A 3MFUA 1OM1A 2GNGA 4R3CA 1H1WA 4Z9LA 4XRJA 4DBNA 3GXLA 3ROYA 4NJ3A 1KWPA 3KXGA 4FNWA 4KSQA 4EKLA 4X6QC 3F5UA 1H4LA 5JZJA 5K0KA 4J97A 2R0IA 3TEIA 2HWPA 2WD1A 4YJRA 5AX3A 2YM7A 3LCDA 1NVRA 4FC0A 3WF7A 3P7CA 1ZOHA 4C57A 4EWHA 4FKJA 2YCQA 3ORTA 2VU3A 1U5RA 5BX0A 4N0SA 4KD1A 2QURA 3L8SA 4IXPA 3BBTB 1ZLTA 4PQNA 2C6IA 2CGWA 2VTMA 4C4GA 1U5QA 3KN6A 3MA6A 2PMNX 1TVOA 3QQJA 3GC7A 1IG1A 4FV9A 3TACA 3R1YA 3DXPA 2ETKA 3CKWA 4FMQA 5AR2A 3WILA 4F64A 2GNFA 4FUXA 3PG1A 3R6XA 4GV1A 4IJ9A 4EOJA 3P9JA 2ZB1A 4E26A 1PMNA 1WBOA 3KMUA 1OBGA 5KBRA 1LUFA 2WEIA 4BBMA 4BIBA 1I44A 2A19B 2ITNA 3BU3A 3MFTA 3L9MA 4QYGA 3UMWA 3VVHA 4L3JA 3A62A 3JPVA 4NSTA 2FSMX 1ZZLA 3LZBA 2X6DA 3E62A 2VTPA 3LXKA 4NFMA 3MVMA 4U43A 5D7VA 1Q24A 3W16A 5J95A 4GJ2A 3GBZA 4LL5A 3MVLA 4NM0A 1O6KA 2PE0A 4D1XA 2QOQA 4KS8A 3L8PA 2W5BA 1OPJA 3FXXA 1RW8A 3H4JA 4QPMA 1H27A 4XV3A 1YHSA 4BCKA 4FTCA 2H34A 5AWMA 1GY3A 4ACHA 2B55A 4N6ZA 1OUYA 5EI8A 2A1AB 1Q61A 3KN5A 4JLCA 1XR1A 3OFMA 4DHFA 5CU0A 3LOKA 2CJMA 2PUPA 3TZMA 2QO9A 2VUWA 4WBBB 3AGLA 1R3CA 3SHEA 4BCPA 3UPXA 2UZDA 4RFZA 3D7ZA 3G33A 2UW6A 3FY2A 3G0FA 3GU8A 2WMSA 4BWKA 4ANBA 4IVBA 4DT8A 4CT1A 2WTKB 3NSZA 4JT3A 4RX8A 4ZTSA 4LV5A 1XH5A 3CCNA 3N9XA 4TY1A 1XBCA 4O22A 3LFSA 2WMTA 4B99A 4TWCA 5M4FA 4PMPA 5AP6A 3QCQA 5CI6A 3HRCA 4QP1A 3KRRA 2JDRA 3OXTA 3OT8A 4I6HA 4AGDA 2AYPA 4CFXA 4D2RA 3CS9A 5B2MA 5IEYA 2Z02A 4DFZE 5L2IA 4I0TA 4FOCA 2AC5A 3W55A 3ZDIA 4J8NA 3D7TA 4O7LA 2BCJA 3D7TB 2AUHA 2YFXA 3L9LA 4GMYA 2WOTA 4RVMA 4HVDA 3QF9A 4GK2A 5M56A 2WMBA 4WHZA 5AP4A 5KUPA 3QKMA 3ZDUA 5I4NA 3GCSA 3RM7A 3W33A 4IVAA 2J5EA 3EQDA 2ZV2A 3EQBA 2V0DA 3UJGA 4MD8E 2DYLA 2X7FA 3EQRA 4BWPA 2R3JA 3OG7A 4UXQA 3R83A 4RJ5A 3BKBA 3TKIA 2J0LA 5T6KA 3AD4A 3QCSA 4EK3A 4LMNA 5DR9A 4GRBA 4QYEA 4UZHA 4CCUA 3DQWA 4I23A 4IB3A 4J1RA 3UIXA 1YQJA 2V5QA 4FG8A 2VO7A 3K5UA 4FVRA 4JRNA 4NT4A 3MFRA 5HVJA 2UW5A 3LMGA 5CSWA 1YI6A 3SLSA 2VNYA 3H9FA 5DRBA 3QUEA 4DTBA 4CFNA 4ALUA 2WO6A 3FHRA 4AT5A 3FPMA 4RJ3A 1PXMA 3KFAA 2WMXA 4WNKA 2XK6A 3Q9YA 4HGLA 1FVRA 1GZOA 4XS2A 5EYMA 3TTJA 3NR9A 2F4JA 3S3IA 5B2LA 3D5UA 4DN5A 3VN9A 4FV1A 2ZV9A 4Y8DA 4FVQA 2F9GA 5DFPA 3BYVA 1Q8ZA 3DT1A 4K9YA 4D2SA 4EOPA 4X2GA 3FWQA 1M7QA 3MIYA 4RC3A 4FTOA 4GU6A 3HV6A 2P4IA 5I9YA 3HNGA 2GS2A 2BALA 4ACMA 1PMUA 5TR6A 4E8AA 4GT5A 4I20A 5EK7A 4HW7A 2HAKA 1K3AA 4U8ZA 3KK9A 5EM8A 2YZAA 4FSRA 3UIBA 2X8IA 1Y6BA 2PZRA 5AR8A 5IEXA 4I6FA 5M4CA 1EH4A 1U59A 5J1WA 5DWRA 4IB5A 3ZYAA 3VUHA 4AUAA 4PP7A 2IN6A 3LCOA 4JAIA 2XZSA 3PPKA 4C4HA 2PZIA 4RFYA 3KGAA 2R9SA 1KE7A 4QP7A 3U6HA 4NZWB 5HE0A 2XNEA 4YLJA 3L9PA 4DH5A 4DEEA 2BHHA 4LRJA 5ANKA 4EH6A 3LJ2A 4GL9A 4FT7A 5AR3A 3VUKA 1ZOEA 3QYZA 4BWXA 3TZ9A 2ITWA 5CNNA 2ESMA 2VTRA 4D58A 4BZDA 3KMMA 3QGWA 4EWQA 5CU6A 1BMKA 3GVUA 4XLVA 4YLKA 1SMHA 1ZMUA 5E8TA 5FG8A 2IW9A 1NA7A 2OI4X 1T46A 1VZOA 4MNFA 4OTDA 1Q8UA 4QMNA 2I6LA 2RFSA 3SQQA 1YOMA 5HO8A 3WARA 5L2WA 4F6SA 3EQCA 3F7WA 3CQUA 3AGMA 4QMOA 4RIXB 4IC8A 1OPKA 5B2KA 2IG7A 1FMOE 2ONLA 2OFVA 2HXQA 2W1ZA 3O96A 3R8LA 4FTQA 5DI1A 3PLAE 1AGWA 5CENA 4G3FA 1FBNA 4GT4A 2Z2WA 4UYAA 3FMDA 3FLYA 3PJCA 4WRSA 4S33A 5H3QA 5BNJA 2YISA 1UVRA 2JDOA 5M44A 3SVVA 3O23A 4XG2A 3IW6A 3D5XA 4IACA 4BCMA 1J7LA 4F7JA 3K54A 4HCVA 3BLQA 3Q4UA 2RIOA 5M07A 3G5DA 1ND4A 2CKPA 5JGDA 3KVXA 1JBPE 2J0KA 4QTDA 3BGQA 4RWIA 2GS7A 4JI9A 3DKGA 3F9NA 3QQLA 2JC6A 2FGIA 2R4BA 3ZM4A 5CVHA 2XVDA 1GOLA 5JQ5A 2WTVA 4P4CA 5HNGA 4AOIA 4QTBA 5FM2A 2QG5A 3Q32A 1PJKA 4B4LA 3RPOA 4ZSEA 4FODA 2BROA 3GC9A 1OPLA 4FKOA 3W10A 4JX7A 4FEXA 2PZ5A 3GQIA 3OCGA 5ETFA 4FGBA 3VW6A 4ZLYA 2OIDA 5AR7A 5M53A 2JDVA 1KV1A 3RI1A 4RPVA 3BHVA 4BYJA 4UB7A 5AP0A 3OD6X 4GIIA 3TKUA 1BUHA 4EZ5A 2Y6OA 2X4FA 5HBJA 3G51A 3FMJA 2ZM1A 2OJIA 1CMKE 4BDKA 4DGNA 1ERKA 3I81A 2UZTA 3MN3A 2IZTA 1YXUA 4K2RA 4XHKB 1YI3A 3PP0A 5DBXA 4CQGA 4AZFA 3SXSA 5AV3A 5EHLA 3F2AA 1WBWA 4ZJIA 3TI1A 5M4UA 2UZNA 3QTQA 5JK3A 1V0BA 4WSYA 3V5PA 2R3FA 2HZ4A 3OEFX 4U79A 2WGJA 3GCQA 3SV0A 1H07A 4EH5A 5A54A 1OUKA 3OP5A 3QALE 4FZFB 2ZV7A 3N51A 4QOXA 2RKUA 3R7GA 2ZVAA 3DZQA 3HMPA 4RLLA 4O91A 3CSVA 3KRXA 5ANDA 2X7OA 5E8WA 3KXZA 5J87A 3JVRA 3SW7A 2WMAA 2W4KA 4JR7A 4DFBA 3EMGA 1FOTA 3QD2B 3F3TA 4TNBA 3FI8A 4NM7A 3C4XA 3HA6A 3DK3A 3DK6A 2PMIA 3BZ3A 4G3CA 5D12A 2HYYA 3HRFA 3Q3BA 5D7AA 4EQCA 4FA2A 3TUBA 3BHUA 2WMUA 3DAKA 3DDPA 5KKRB 3MTLA 2C47A 2UZBA 2XEYA 3NNVA 1HCLA 1REJA 4RIYA 3GFEA 1P2AA 3PVWA 4I94A 1B38A 4JJRA 3FZTA 3NS9A 5E8YA 4G17A 4CXAA 2YZLA 2J0JA 2GCDA 3U4UA 1ZXEA 3GOPA 3VJOA 4ANSA 3FLQA 2W4JA 3G6GA 4R3RA 3DJ5A 3O8UA 3Q53A 4NKAA 5EYDA 4H3QA 4DEDA 3UZRA 4WT6A 1OIQA 4L68A 1XH4A 4FV2A 4DGOA 3IDBA 4CRLA 4KKGA 5TF9A 1L3RE 2UZOA 3Q6UA 4ZJJA 2Z7QA 2KULA 4ZTNA 3R2YA 4D1ZA 4ANMA 4AZTA 2FB8A 2UW0A 3VBXA 2YWVA 3W1FA 5CY3A 3PJ2A 2EB2A 5BPYA 2QLQA 2I7QA 2W1IA 4O81A 2PVLA 5KZIA 4IW0A 1APME 3QC9A 2ITTA 4D0WA 4XV9A 5AV4A 4KUJA 1VR2A 2B9HA 3ANQA 4KIKA 4QP9A 4YU2A 5AIKA 1Q5KA 5HD4A 3BHTA 5A6OA 1R39A 3CC6A 5I5ZA 5JKGA 4AZEA 3PXYA 4H3BA 4O1OA 1WVYA 2ERKA 4Q2AA 3UZTA 3ATTA 4FTLA 3HMIA 4PTEA 4YC8A 3H0ZA 4NW5A 4ACDA 4E6AA 2OICA 4YTFA 4MQ2A 5J9ZA 4ORKA 3K2LA 4FSMA 3DS6A 3FMKA 3II5A 4PWNA 4DH3A 5ANIA 5DR6A 4YPSA 4YJVA 3QCYA 3H9RA 3KRJA 3PYYA 2XJ0A 4JIAA 4QP4A 4EQMA 1GJOA 1QPJA 4NIFA 5KMMA 5LWNA 1PRYA 3U51A 4BDAA 3OUNB 5IQBA 1ZYDA 4HVGA 3Q2MA 4PV0A 4NJDA 3HDMA 4U44A 4FEVA 3WZJA 2KTYA 1VYZA 3DJ6A 5CSVA 3R9HA 3DAEA 4EOQA 2BAKA 3OS3A 2W1CA 1UKIA 3PWDA 4YJOA 4I92A 2X1NA 2ZDTA 3SXFA 3FQSA 3ID6C 4IX3A 4QMPA 3QHWA 4YTIA 1DM2A 4BZNA 4CTBA 3PP1A 4G3EA 2QOKA 2GNLA 3D5WA 3ZSIA 2HOGA 2YHVA 1PXNA 4R5SA 3UTOA 3JY9A 4JG8A 4RA5A 5JZNA 2R7BA 4MF0A 2GQSA 4A9YA 3TV6A 4O7RA 3Q4CA 3KQ7A 1PY5A 3FJQE 5ANOA 4A4XA 4ZAUA 5AJQA 4OTGA 1MRYA 1YXSA 4O0VA 4RT7A 1DAWA 4S31A 3FMMA 5HE1A 3PA3A 3BYMA 3MTFA 3V5LA 1W82A 4EBVA 1RJBA 3QQUA 5FDPA 4RWLA 4R3PA 3DNDA 3WZUA 3KULB 2C3IB 3GFWA 3R8UA 4EK5A 3HA8A 3Q2JA 3NRMA 1LPUA 4RWKA 2YJSA 2BRBA 4RJ6A 3FY0A 1KE9A 4YNEA 1Y57A 3JY0A 4IWQA 5IA4A 4DEIA 3MY1A 5H8GA 3QXPA 4P5QA 4FKUA 4KRDA 4GVAA 3G6HA 4M14A 5L8JA 3O0GA 3E7OA 1RE8A 1XH7A 4LUDA 1YDTE 5HLPA 1DS5A 2RFNA 3PE1A 3BQRA 2R5TA 3DLSA 4HNIA 4EH7A 3EQPA 4II5A 2VO3A 3E8NA 2PMLX 3HX4A 3F5GA 5E8UA 1OMWA 3HV3A 4F9CA 1W0XC 1WAKA 3UP7A 4HVSA 2OH0E 3HUCA 5EDRA 1QPDA 1JVPP 2XK4A 4O38A 2VTNA 4FEWA 2YA9A 1GZNA 1M2RA 5C03A 3T9IA 4XEYA 4B9DA 4ZS4A 3Q6WA 4JG7A 4O6LA 3P0MA 4P5ZA 5LMKC 1XJDA 4IM2A 3NLBA 1PYXA 5JSMA 5DRDA 3VBVA 3R22A 3VS7A 1OIUA 3W8LA 2BIYA 4AGUA 1IA9A 3QZIA 5HICA 2PE1A 3LVPA 4K1BA 4WD5A 4X2KA 1OKVA 4ZTRA 3EFKA 3EQFA 4Y5QA 5DT4A 3UC3A 5CAOA 2BFXA 1HCKA 3ZU7A 2PUIA 4MWIA 4TNDA 3V6RA 4J8MA 4PX6A 4EZ7A 3TNQB 5HO6A 3HRBA 4MYGA 5A4EA 3NDMA 1YVJA 4FT0A 4Q5EA 3ZEWA 3KVWA 3R04A 3D15A 5AIRA 4ZZOA 3MJ2A 4FKSA 3A8XA 4MXCA 5T68A 2QOOA 3LCTA 3AC8A 3LAUA 2FO0A 2XRWA 4XG8A 5EI2A 5GJDA 3T3UA 3V6SA 4DGMA 4BYIA 5JGAA 2ITYA 4ZIMA 3SC1A 4TL0A 4LMUA 3ORMA 4F9AA 4GW8A 3F3ZA 4LRMA 4M0ZA 3VF9A 4GFGA 4XG9A 4NW6A 3RP9A 2PMOX 4YHTA 5E8ZA 4OTHA 5KMIA 3CY2A 1YRPA 4EOOA 5HX6A 2YLEA 3IG7A 2VTLA 3BEGA 4QMTA 4BVUA 5AFVA 3GU6A 1GNGA 2IVVA 2J5FA 2WOUA 3FMLA 2QKRA 3IOPA 4M69A 3RCJA 3ORLA 4FKLA 4PMMA 4AN9A 3FI2A 5KCVA 4OTFA 1YXTA 3N4VA 4ZZNA 3C4ZA 5FEDA 5AUTA 4R7HA 1E9HA 3R8PA 3RJCA 1WBVA 3QZFA 4XG4A 3UVRA 1Y6AA 2WAJA 5FP6A 3T8OA 1REKA 4S32A 5AUUA 5IUIA 3KKVA 4CV9A 2A27A 3I7BA 3MVHA 3E3BX 3RAKA 4CG9A 4I4EA 5AUWA 4FSQA 4O84A 3KC3A 2UW4A 3MI9A 1SNXA 1OVEA 2WMWA 5CU4A 4RG0A 2PPQA 3DY7A 3P7BA 2ETMA 3E87A 4NEUA 2WTKC 4BKYA 2WIHA 3V8SA 2BUJA 2P2IA 3WBLA 4J99A 1U46A 3M42A 2QOIA 3QAME 2V55A 4XJ0A 4X7QA 2OXYA 3R7IA 4V05A 2E9VA 3I0QA 1STCE 3DGKA 5AV2A 3AQVA 4L43A 4FNZA 4X0MA 4YZBA 5HVYA 5HTBA 4WNPA 1WCCA 4KRCA 2HZNA 1V1KA 4HZSA 2PTKA 5FRIA 4HCTA 3F61A 5A46A 2PULA 3VW8A 2ZM4A 1PYEA 2GFSA 3DA6A 2PK9A 3OWLA 1UNHA 1PW2A 1FVVA 2O0UA 2BTRA 2B0QA 4O21A 3B2TA 3QX2A 5C01A 5K3YA 3IW8A 3R8VA 1YKRA 4QP8A 3KEXA 2ERZE 3QHRA 4KIOA 4K77A 2YCFA 2WTIA 4KA3A 4XRLA 4AF3A 4EH8A 4JDIA 4AZSA 4A9RA 4L3PA 3EN5A 3PVUA 4BTJA 2B52A 4RIWB 2VTJA 2CGXA 5EM5A 1AQ1A 4RJ8A 4G6OA 4NWMA 3DCVA 4AP7A 5IQGA 2QHMA 3JYAA 4QTAA 2ZM3A 3RINA 2OIQA 4F9BA 1KOAA 5D41A 4AA0A 3H3CA 3LMIA 3UP2A 2XK7A 2PUUA 4FTIA 2XIYA 4EBWA 5FGKA 4U45A 4F1TA 2I0EA 3HV5A 4C34A 3QL8A 3WZEA 4D9TA 4KKEA 5IH6A 5L6OA 2VTHA 1RDQE 2XMYA 1OZ1A 2CGVA 2HXLA 4BGQA 4WG5A 4YTHA 5HEZA 4C35A 4MH7A 1QPEA 2YABA 3R1QA 4USDA 4ACCA 2B4SB 4O7YA 4EJ7A 4YMJA 3AC1A 4Y85A 3RK7A 4UMQA 3OY3A 5A3XA 4CYJA 2XNBA 4IWPA 3E5AA 1PXLA 2QOFA 5EDPA 4H1JA 5DR2A 4BDIA 4C62A 5LMKA 1KE6A 2X2LA 3UQCA 4XBUA 4EQUA 5HLWA 3VS3A 5J5SA 3PY3A 2VAGA 4HYIA 4K18A 3U55A 5A4TA 4N57A 4LGDA 5D9HA 4DH8A 3NWWA 3PIZA 3WF5A 4XV2A 3M1SA 1WBSA 4H1MA 4XBRA 1XBAA 4BF2A 2YIQA 2UZEA 2XIKA 4KBCA 3R9DA 3V5JA 1ZARA 2UVXA 4IAIA 2JDTA 4DITA 1IAJA 5FDXA 5ACKA 4G6NA 3QTZA 2R3NA 2VX0A 2X8DA 3HKOA 4L52A 4C59A 5J79A 3MESA 5AA9A 2JKOA 3SKCA 4OBQA 5IQHA 4BBFA 3LIJA 4IANA 4ONAA 4FTKA 5FBNC 4FICA 3GB2A 2X2KA 4DGLC 4RX5A 1NT2A 2XRUA 4XNEA 4EKKA 5JMSA 3GI3A 3F2RA 2C30A 2C0OA 3HAMA 3F82A 2P33A 4DLIA 4IWOA 3H0YA 3NUSA 3HP2A 3POZA 4QMLA 3BWJA 4MCVA 5LVMA 3KXNA 3TNIA 4AAAA 3BYOA 3FQHA 4ARKA 5CF6A 4QMVA 1SVGA 4Y95A 4QP2A 3LJ1A 3RTPA 4F7NA 5E9EA 3LFNA 4F6UA 5KHWA 5E92A 5EH0A 4QD6A 5DPVA 5J9LA 2VWVA 2NP8A 3DJ7A 3EFWA 1MRUA 1YWRA 3R9NA 5CF5A 2OK1A 2ZYBA 3FSKA 4IZAA 3PVGA
chains in the Genus database with same CATH superfamily
5IA5A 4MNEA 1VYWA 4QMXA 5C1QB 4MNEB 3DQXA 2BDWA 4BBEA 5JFWA 5A14A 1OL6A 2XF0A 4IDTA 5DGZA 3LE6A 4CFWA 5I0BA 2OO8X 4FIGA 5AADA 3UOLA 2WEVA 3PTGA 2BZJA 2CKOA 4OT6A 4WIHA 2VWXA 2ONLC 2WQBA 2XYNA 3FMHA 2YAKA 4JQ7A 4AXEA 2PWLA 3D14A 3NNWA 5D1JA 4D5HA 3VBYA 1JKKA 2UW8A 1IASA 5HIDA 4PDYA 4FIEA 1FGKA 3RAHA 5TKDA 3G15A 2W1EA 3PSBA 3AD5A 5EFQA 4ENYA 3N4TA 3S95A 3RBWA 3RWPA 3LQ8A 2GNIA 5KO1A 2GSFA 4LOPA 2IVSA 3LMHA 4A9SA 4EHGA 2W1DA 2XIXA 3I60A 3EN9A 4NK9A 4BDFA 2F49A 3R21A 4BDCA 3ZO1A 1UU9A 2PSQA 3P1AA 1GIIA 3KRWA 5F1ZA 1ZYLA 1T45A 3NGAA 5EW9A 5HZNA 2RFDA 3Q5ZA 2JBOA 1L8TA 1OL7A 3E8CA 3IDPA 5GZAA 1QL6A 4ASDA 2IO6A 4LFIA 2XYUA 3QRUA 4RRVA 3BHYA 5CXZA 4ZK5A 3R2BA 2C6LA 1JLUE 3PXZA 4ZSJA 3Q04A 1TQIA 4APPA 4MBIA 4AS0A 4AFEA 1YXXA 3VBWA 2BKZA 4L01A 4FK3A 5F20A 4RGJA 5HESA 3TUCA 3JR1A 3GC0A 3BLRA 1KV2A 1S9JA 3ZLSA 2J0IA 4MXXA 4RC4A 4U40A 5ACBC 2XM9A 3A7JA 3IS5A 3O8PA 3QD4A 2QOCA 4M67A 2EUFB 2YM3A 4FZ6A 3AT4A 4MAOA 4C0TA 4DA5A 5AEPA 2BRHA 2J50A 3QLFA 4I5CA 4OTRA 3FQEA 3SRVB 3R7VA 2QODA 4FIFA 2WU6A 4TW9A 5M55A 4OAUC 4BCOA 4AXCA 2JFLA 3G0EA 3QX4A 3COIA 2VGPA 3ZRKA 2OZOA 4L42A 4PPBA 4ITJA 3TDVA 1V0OA 4PP9A 3NZ0A 3VHEA 2O63A 5LJJA 2YWPA 3BIZA 3RNIA 1WFCA 1CKIA 2YJRA 4AW2A 4CKRA 2YIXA 1PKDA 1YHVA 2GQGA 3UOJA 3IW7A 3UOKA 2GTNA 3NYXA 3IONA 3EN7A 4FTRA 3DKCA 1H01A 2H9VA 2RF9A 3NCGA 1H00A 2W5HA 4Y46A 5CSXA 5CEIA 4J71A 4A06A 1JSVA 2O2UA 5AP7A 4DE4A 2NRYA 4AE6A 4CFMA 1YDRE 5CEMA 3O7LB 4P7EA 3JUHA 2JITA 5FD2A 4ZXTA 3ZZWA 2C6MA 3GCVA 3HL7A 5DHJA 4GVJA 3A4OX 1UNLA 3MPTA 4CVAA 4XOZA 4JBPA 4O0SA 2I0YA 2Y0AA 4W8EA 4ALWA 2OJJA 3R02A 1Z5MA 5DH3A 4YBJA 3A7GA 4MD9E 4I1ZA 1OITA 5GJFA 4F99A 2R2PA 4X3JA 3POOA 3BV3A 5CZIA 3RAIA 2IZRA 4APCA 4I24A 3BYSA 2ITOA 4K8AA 4QP6A 5HCZA 3R7UA 3PJ8A 2B9JA 3K3JA 5HX8A 3QA0A 3P79A 3NCZA 3UODA 1ZOGA 1PMVA 2OWBA 4YJTA 2WTWA 3Q60A 4ZTQA 4O2ZA 1G8JA 4MWHA 3P78A 2C5XA 5HG5A 4WBOA 5AV1A 4U6RA 3SW4A 4DHJA 2QKWB 5C9CA 3CJFA 3EL7A 4D4VA 3SAYA 4JBQA 4HGEA 5HBEA 1K2PA 5LVLA 3UG2A 4NM3A 4ZZMA 2QOLA 4AT3A 3W2SA 4BCFA 2IZUA 5J8IA 1U54A 4Z7HA 3CY3A 3NFFB 1U54B 5CS6A 1QMZA 1Y91A 2R3MA 4M15A 4KINA 3A8WA 1LR4A 2HIWA 5ANEA 2YM4A 4FTUA 3ZRMA 4B7TA 2X6EA 3QTSA 3PJ1A 4LYNA 3EQIA 2UW3A 3QU0A 4IZYA 3SX9A 2YERA 3WOWA 1FQ1B 4ASEA 3W18A 2XIZA 3QZGA 3VUTA 3EYHA 1JAMA 4G6LA 2C0TA 2HCKA 4RMZA 4GKHA 1CKJA 1OB3A 2WQOA 4FJVA 1A06A 2OG8A 4OAVB 4A9TA 3CQWA 4RIXA 3QUPA 1XH6A 3BCEA 4H39A 3NUYA 3F5PA 5EQEA 2R3LA 3I5ZA 4BI0A 4ZLOA 2XKDA 3T9TA 1AD5A 3HMNA 4O0XA 5M4IA 3TCPA 2J9MA 3G2FA 3FKNA 3HZTA 5HIBA 5CI7A 3FXWA 5CX9A 3RZFA 3KA0A 3WI6A 3W0QA 4GG7A 5KNJA 2IVTA 2Y6MA 1JQHA 4WG4A 2CHLA 4I5MA 4C3RA 3OMVA 3BEAA 5K4IA 3ZC5A 4FKWA 1E1XA 2WQNA 2ZDUA 4YP8A 3DTCA 4M68A 2BAQA 5KBQA 3OTVA 1UWHA 4IAFA 2NRUA 3TZ7A 4FV7A 2JAMA 3QXOA 2REIA 1JNKA 3RVGA 3ZFMA 1P4OA 4C33A 2WTCA 2W9FB 3IPHA 4UX9A 2DS1A 2JIIA 1J1BA 3OZ6A 3V5TA 4BY9E 4K33A 1Q62A 3RGFA 2EXCX 2XK9A 4A9UA 3LFEA 4BJJB 2ZMCA 3P23A 3BU6A 5AP2A 3DBDA 2GMXA 3VNTA 2HZIA 3GT8A 4DBXA 1TQPA 4PDOA 3VHKA 1CTPE 4IZ5A 3SOAA 1JKSA 4FKIA 2ZOQA 4OR5A 3VBTA 4DGGA 4IAYA 2UZUE 4PMSA 5AUVA 4USFA 5ITAA 4HOKA 2RFEA 3Q5IA 4FV3A 3RHXA 3WE8A 4DCEA 3LHJA 2P3GX 4FKQA 4RFMA 2HW7A 1B39A 4FOBA 4O83A 2ACXA 3DOGA 2QD9A 3SGCA 4AACA 3AMBA 4AW0A 2XH5A 2R3PA 4KIPA 3SG8A 1S9IA 2HW6A 3HP5A 3U9NA 5HNIX 3ZLYA 4D4YA 3KL8A 4J53A 3VC4A 1E1VA 4EC9A 1JSTA 2VTSA 4KBAA 2X0GA 2VWBA 1DAYA 3RCDA 2B1PA 3PZEA 1URWA 2OF4A 3OBGA 1H0WA 3R1SA 4PPCA 4FTMA 3W32A 3ZMMA 3R73A 4WO5A 5D10A 3RAWA 4WOVA 3GC8A 1WVWA 2RSVA 3NW6A 5CU3A 4DG3E 5FUTA 2QHNA 2R3KA 4LQMA 4BB4A 4FT3A 4BGGA 4WKQA 2JIVA 2OIBA 5G6VA 1W8CA 4YO6A 5IQCA 2XNMA 5IH4A 3B8RA 1IR3A 4V0GB 2VV9A 3GGFA 3C5IA 2W1FA 5DEYA 1WZYA 1FGIA 3I1AA 3HV7A 2WQMA 3LQ5A 5LVPA 2G9XA 3CE3A 3FI3A 3HAVA 4IM0A 2UV2A 4D2TA 1BL7A 4DG2E 4MXAA 3DBQA 4HPUE 4CGAA 5J9YA 1YWVA 1ZYSA 4I0RA 3ULZA 3OY1A 2PVFA 5EM7A 4PDPA 2YACA 5K5XA 5C8KA 3VULA 1G8SA 5K5NA 3CIKA 5DE2A 3ZUVA 4FVPA 3BGZA 3UNZA 5KMLA 2XJ2A 3FC1X 4TN6A 2GU8A 3KXMA 3QQFA 2JDSA 3UBDA 3R0TA 1I09A 4WA9A 4EH9A 3AC3A 3U54A 3GU7A 1H1RA 3C13A 4HNFA 4FT9A 3P4KA 2OW3A 3ELJA 3C0IA 2F7XE 4RJ7A 5M09A 4MQ1A 5CVFA 3RPRA 3H30A 2NPQA 3D0EA 2QNJA 1Q8WA 3EIDA 2VO0A 5EHOA 4IAZA 3TZ8A 4E7WA 4I41A 2WB8A 5HI2A 3TV4A 3E64A 2C6EA 4U81A 5BVOA 4XYFA 5IUHA 3CD8A 4XP2A 3E88A 5HG7A 4FSZA 4CKJA 4JRVA 4IQ6A 1BL6A 2J51A 3PUPA 5LMBA 4PTCA 3UNKA 4GT3A 5EOBA 5JEBA 3QUDA 2O3PA 1NW1A 3MB6A 5EM6A 1H1QA 1M52A 2CCHA 3FYKX 1OI9A 2GFCA 3FAAA 5FQDC 3RPSA 5IMEA 4K6ZA 1WMKA 4NM5A 4EK6A 3VRYA 3HYHA 1M14A 4ANQA 2RG6A 3F66A 2OKRA 1LEWA 3LM0A 3UIMA 3NYNA 1LEZA 5BVKA 2YM8A 4UY9A 5CLPA 3IW5A 3PG3A 4RX9A 5JQ8A 2F2UA 3FI4A 3ODYX 2ZAZA 4LL0A 4FEQA 3MPMA 4GS6A 5L8LA 3O51A 4QYYA 5EQYA 3UQGA 4YSJA 3P08A 4UMRA 4AOTA 3CJGA 4CFVA 4QDEA 3OHTA 4AA4A 4ACGA 1TFFA 2O65A 3KF7A 2WFYA 5BYYA 2ITXA 5CF8A 2WKMA 4FRFA 4YZ9A 3ZBXA 3AKKA 3DXQA 5ANJA 3H9OA 4DTKA 5CAQA 2HWOA 3R30A 3W0SA 3TG1A 4P2KA 2BHEA 5EQPA 2PVMA 3F3VA 2CNVA 3OOMA 5IQEA 2P0CA 1A9UA 2R7IA 4EONA 4C4JA 3TM0A 4E5AX 3CP9A 5DN3A 2ITPA 4DINA 2XJ1A 3DFAA 4TXCA 2OU7A 2ITQA 5AX9A 3COKA 5AMNA 4FL1A 4F78A 4H36A 3RWQA 5B7VA 3R8ZA 5HG8A 4L45A 3OXIA 4QRCA 5BUJA 5IQDA 4BCIA 4E6DA 4GUEA 3AKJA 4M66A 4NH1A 3PVBA 4GUBA 2JKKA 4U0IA 4DFUA 4C2WA 4HPTE 3R01A 3SD0A 3R8MA 4F7SA 4O0WA 4R5YA 5ETCA 4FE2A 2RGPA 3UE4A 1W7HA 2G01A 2JEDA 3QA8A 4F08A 2XNPA 1P5EA 1Q41A 4Z55A 4QT1A 3MIAA 4E5BA 4L67A 4AOJA 3QYWA 2GHGA 4O4DA 4ZSLA 3TWJA 2Y4PA 3DV3A 5CEKA 3PPZA 2OXDA 4AFJA 4D4SA 3QWKA 3QKLA 1YOJA 3HUBA 1UU3A 1JKLA 2AC3A 2HK5A 3NEWA 4MHAA 4OTPA 4CLJA 5E4HA 4OUCA 4JXFA 1OL5A 4BTMA 3P5KA 2SRCA 4JQEA 4K11A 3MB7A 3ZO2A 5HU3A 1JSUA 1RQQA 2O64A 3F7ZA 3NX8A 4M8TA 2R3OA 1WBNA 4ZS0A 3G9LX 5HOAA 4I22A 2XAMA 3KULA 4IFGA 4YC3A 4MUQA 4QNAA 3NIZA 4W4VA 5LCKA 4DT9A 2YDKA 1SVEA 3DNEA 5LWMA 3DB8A 3AMAA 1YDSE 3UGCA 2HY81 3V5WA 4YLLA 4E6CA 4O4CA 3O7LD 2JLDA 3E8DA 3RM6A 3A7HA 4KB8A 4UMUA 3SXRA 4DEHA 2NO3A 3NVMB 4YJNA 3LFAA 3S0OA 3ZC6A 3W2QA 2VGOA 4MTAA 5AP3A 2HZ0A 2W9ZB 4Q9ZA 2YDJA 3I5NA 3I4BA 3UMXA 4ASXA 4YGAA 3OCTA 1TKIA 4LGGA 4FSTA 4LOOA 4EOSA 5FBOA 2C1BA 3RK5A 1FPUA 3KCFA 4BDBA 3PIXA 3S2PA 4R1YA 2OXXA 4NFNA 4X2FA 3TKHA 3KRLA 3V04A 5KHXA 2B7AA 2F57A 2P2HA 3LCSA 3Q9WA 4I0SA 4RQKA 3UPZA 4EHEA 3QRTA 4JQ8A 3OW4A 2Z7LA 2XEZA 3WYYA 3ORKA 3ET7A 2ZB0A 4TTHB 5I3RA 3OUKA 3P7AA 2BILB 4L53A 4CT2A 4DHZA 3WIKA 4QQTA 3P5JC 4RJ4A 4CRSA 5HGIA 1M17A 4IJPA 4U7ZA 4FTJA 4LGHA 4ZTMA 4MXOA 5BQ0A 5DOSA 5M51A 2OZAB 3FKLA 4MEDA 4PPAA 2WIPA 3UO6A 2CKQA 3NUAA 4F0FA 2GS6A 3TN8A 1YI4A 5AP5A 1WVXA 3R9OA 3ZXZA 1OIRA 2PL0A 3DLZA 5GIPE 2PZYA 2VNWA 3KF4A 2GHLA 3P86A 2XKEA 2GPHA 4RVKA 4O4BB 3R00A 2A2AA 2VTOA 3O50A 5HCYA 3K3IA 2Z8CA 3CTJA 5DMZA 3B2WA 3DDQA 4NTTA 5EYKA 4IIRA 2YM5A 3UNJA 2CNQA 2YM6A 1R0EA 4L44A 4NUSA 3C4CA 2B54A 1VLRA 3G90X 4DC2A 2H6DA 3E3PA 2OF2A 5DLSA 3FXZA 1R0PA 3EN6A 4TYEA 2C3LA 4UWCA 4DH1A 3GU4A 3ZHPC 4H3PA 3FC2A 1PXIA 3FZOA 3BWFA 5L2SA 1H8FA 3NAXA 1JWHA 3MV5A 4DEBA 2QC6A 1F0QA 5BMSA 1IA8A 3ODZX 3PFYA 4JVGA 2UZLA 2YDIA 5B0XA 1SM2A 4HYSA 4BICA 2XBAA 2G2IA 5CSPA 4EK8A 4PNIA 3CTHA 3FV8A 4XG7A 5I9XA 3AD6A 4C37A 5IDPA 3UDSA 5IQFA 5I9ZA 5I3OA 4ZEGA 3ZBFA 2PVNA 3ERKA 4JDKA 4QMZA 5CZHA 4ANNA 3VRZA 4YUQA 5ANGA 2J90A 3LXLA 4GCJA 4OGRA 2YIRA 1OL2A 5HD7A 3QZHA 5BYLA 3GP0A 3R9RA 2PHKA 4C3FA 1PMEA 3ZZEA 4AN2A 3PRIA 2XIRA 3B8QA 3QTRA 4WUAA 3VS4A 5A4LA 2GQRA 4C2VA 2J6MA 5AAEA 5KMOA 3PWYA 2AEGA 1QPCA 4CQEA 2NYAA 3R71A 2BIKB 5CAVA 3E63A 4IAAA 5DYJA 3TJDA 3PZHA 4QQCA 4WRGA 3DU8A 3MGYA 4BI1A 3QLGA 4HJOA 2F7ZE 4LRKA 2JGZA 2PVKA 2YLFA 4FI1A 4FV5A 4D2PA 3IECA 4W4YA 3T3VA 3NUPA 4AE9A 4YHJA 4LV7A 3D94A 2VD5A 2YCSA 4LG4A 3V3VA 4O86A 3EQGA 4BR3A 4U97A 3VQHA 3W2OA 2G2FA 2R3IA 1LP4A 1PKGA 3RALA 4ALVA 2C6TA 3PXKA 3R28A 4YJSA 4RSSA 3UVPA 4AN3A 5F94A 3DZOA 3DB6A 4G5JA 5I9WA 3ORNA 4O82A 3PRFA 3NUNA 3OF0A 1UA2A 3WYXA 2V7AA 4AZVA 4RIWA 2E9OA 4J7BA 1J1CA 3U9CA 4MXYA 4CNHA 4GK3A 3VAPA 5HVKA 2JKQA 4O6EA 5K9IA 2DWBA 4KNBA 4W4XA 4AQCA 4I6LA 4DG0E 5HTCA 5J7BA 4O7SA 4BCNA 2PU8A 4D2VA 4Y5HA 5DG5A 1PXPA 1XO2B 4R77A 1DI9A 5FXQA 4AQKA 1J7UA 2RG5A 2LGCA 4HVIA 3AT3A 5GHVA 3NVKI 1BLXA 4J96A 2BAJA 4X2JA 3NYVA 3CKXA 3O71A 4N70A 2X0OA 4CKIA 2J4ZA 3D9VA 3EFLA 4CG8A 4FTNA 2C6OA 4ZOGA 4QPAA 5KE0A 5M06A 3OCBA 5H9BA 2DUVA 3DPKA 2XARA 4IVCA 1MQBA 3I6UA 5CYIA 3QD3A 5IUGA 3LJ0A 5HBHA 5H8EA 4IB1A 4BGHA 3BHHA 2BZIB 4MK0A 3TL8A 4QMYA 5E90A 2QU5A 3MW1A 1CKPA 4PMTA 3Q9ZA 4M12A 4RZVA 5DA3A 3UYTA 5LMAA 2WELA 4BRXA 2GHMA 2QR7A 3IQ7A 3TJCA 4AXAA 3AC2A 4JL9A 1XMLA 3PDTA 2V62A 1Z57A 3VUDA 4AW5A 4DDGA 3MBLA 3GEQA 4UALA 3TIZA 1VJYA 2ZMDA 4YJQA 1BKXA 5BVWA 3FZ1A 3V51A 1V0PA 5L4QA 5FM3A 3PIYA 1J3HA 4FEUA 1Q97A 1ZZ2A 4W4WA 3DBEA 3ULIA 4JDHA 1SYKA 3NAYA 5E8SA 5F95A 5E91A 3OCSA 4G3GA 3KB7A 1GAGA 4W9XA 2C3JA 4F4PA 3QTUA 4JR3A 3NUXA 3VF8A 2QVSE 3RHKA 2J0MB 4IEBA 4FX3A 3VJNA 4BHNA 4EZ3A 2E9PA 4IX5A 3AKLA 4DLJA 4CZUA 3NNXA 2QOBA 1U4DA 4CD0A 5A4QA 5LOHA 2W1GA 3NMUF 2YCRA 3SDJA 2WTDA 3G9NA 4BTFA 3IKAA 1Q3WA 3S4QA 3C5UA 1M2PA 3LXPA 4L46A 4AZWA 2CNUA 3MS9A 4FL2A 4E1ZA 5JFSA 3E8EA 2J7TA 1YOLA 1URCA 4EYMA 5HORA 2C5OA 4CFUA 3Q9XA 4D28A 4RWJA 3TT0A 4UN0C 2C5NA 2XNGA 3NW7A 4DFYA 2G2HA 3ZFYA 4MBLA 3BQCA 3V01A 4HVHA 3BLAA 4A4OA 1ATPE 4TKSA 4OLIA 4BN1A 4F63A 5A9UA 4BI2A 2JD5A 4LUEA 4C02A 5F9EA 2HY0A 2UVZA 2WNTA 2Y7JA 3F69A 3ZTXA 3ACKA 3F3WA 4BCJA 5HU9A 4Y72A 2G15A 4FYNA 2YIYA 4RQVA 5EW8A 3R7YA 1UV5A 4JX3A 4MD7E 4S30A 4AX8A 3QRJA 3EKKA 3BGPA 4XP0A 4EHZA 3RPYA 4LOQA 4A4LA 4D1SA 2WMQA 2PVHA 2I1MA 4F1MA 3VQUA 2QQ7A 2YITA 1PF8A 4E73A 5HQ0A 2UW9A 3FPQA 2Q0NA 5CQWA 1Q99A 3ML1A 2XNNA 4YZMA 4PUZA 3GENA 5HE3A 4YSMA 1Y8GA 2O5KA 4B0GA 4EOKA 1OGUA 4TWOA 2H96A 4X6RA 4IMYA 3UZPA 4FV6A 3M2WA 4C58A 3I7CA 3FLZA 1KE8A 4L7FA 4CMUA 3ZS5A 3OXZA 2WHBA 4FIHA 4EYJA 1MQ4A 5J5TA 4BZOA 3A99A 5BVFA 4IADA 5FTGA 3VS5A 4XMOA 5HCXA 1B6CB 3PA5A 4H58A 3ZRLA 2BZHB 2GNJA 4X3FA 4EOLA 2PUNA 4X3FB 3A2CA 4D0XA 5C26A 3S00A 2YIWA 4QMWA 4NYEA 4O27B 4QPSA 2B9IA 5CEOA 4IM3A 3M11A 2Y4IB 3O8TA 5TE0A 4FGRA 4IB0A 3VUIA 1XWSA 5LCJA 3CGOA 2CN8A 4F9YA 2BMCA 3FKOA 2QU6A 2VWUA 2X4ZA 5AP1A 3SRVA 1OIYA 3U4WA 4BDJA 3HEGA 3I79A 5CF4A 1HOWA 2VX1A 5FP5A 4UWBA 2OFUA 3MH1A 4FUYA 4Y73A 5EKOA 3FL4A 2BKKA 4AA5A 1BI8A 4G5PA 5CAPA 2BR1A 3C4WA 1YHWA 3VS1A 4J98A 1M7NA 2BDFA 2BVAA 4KBKA 2WQEA 5GINE 2G1TA 2JAVA 3KK8A 3UDTA 2WXVA 4E3CA 4F70A 3AMYA 4CLIA 1Q8YA 4YBKA 3ZO3A 1FVTA 1H08A 5AR4A 4PNKA 4C61A 4S2ZA 3QTWA 1PXOA 2Z60A 4IE9A 3V8WA 1G8KA 3MWUA 2ITUA 1TQMA 1KSWA 2WTJA 5AUZA 2WPAA 3LFDA 2FSLX 3MH3A 4M84A 3GOKA 4FV0A 1OKZA 4FSUA 3UYSA 2R3RA 5A6NA 4RLKA 2EU9A 2CCIA 4O7NA 1OL1A 2E9NA 3LPBA 2XM8A 4NU1A 3QTXA 3ATSA 2QO7A 4YNOA 4MXZA 1UKHA 4UMTA 4BCQA 2UUEA 4I5HA 1Q3DA 3VONA 4MKCA 5DNRA 4BC6A 3ALNA 4AGWA 1MUOA 1OKYA 2C0IA 4R7BA 2CSNA 2R64A 5AV0A 3D4QA 3KXHA 3EOCA 4BKZA 4C7TA 2BRNA 3EN4A 4FKPA 4ID7A 2C69A 4F0IA 5L3AA 2Y9QA 1JPAA 2C4GA 4MBJA 5KKRC 4FZDB 5IF1A 3A61A 4I5PA 2XCKA 4IH8A 4IDVA 4IC7A 4L7SA 3NPCA 4XX9A 3C1XA 2WMVA 3Q4ZA 4BIEA 3SG9A 2WMRA 4C38A 4QMMA 4UYNA 2PVJA 5JT2A 3MA3A 2OLCA 2R0UA 4RBLA 3UDZA 3IK3A 5T3QA 3S1HA 4CMTA 5CT0A 1PXJA 3C0HA 3ZO4A 4GIHA 5CT7A 4YZNA 5CEQA 3VS0A 2RL5A 4GFMA 2CDZA 1Q4LA 4DYMA 4EH3A 5LXMA 3KY2A 4L6QA 2XALA 3PXQA 4QTCA 4PDSA 3ZONA 4Z3VA 5AAFA 4DF3A 2FSTX 1GIJA 3DXNA 4QO9A 2Q0BA 2C68A 3CBLA 3L9NA 1NXKA 4ZY4A 3BU5A 3SOCA 3WF6A 4ZP5A 4M13A 3ZFXA 4HCUA 3HVCA 3CXWA 3THBA 3W2CA 3TV7A 2ETRA 5HHWA 4GU9A 1MRVA 1ZYJA 5AR5A 4EC8A 3FSFA 2FYSA 4FTTA 2FA2A 4R7IA 2JBPA 4BCHA 4YTCA 4PL5A 5GJGA 3N4UA 4OT5A 3KXXA 4TRLA 3F5XA 4JNWA 1ZY4A 2BTSA 5FXSA 3WF8A 3I0OA 2GTMA 3O2MA 4E20A 4XLIA 3CD3A 3KU2A 4TYJA 3OWPA 3TNPC 3ZCLA 3U87A 2EWAA 3E93A 4E4MA 2W96B 5L6WL 3GU5A 4U41A 4IX6A 3ROCA 4ZSAA 2X8EA 3I6WA 3UVQA 2VZ6A 1XKKA 3NFGB 1CM8A 2BRGA 3JS2A 4PL3A 5BYZA 1CSNA 3C50A 3GQLA 4C4FA 4FNXA 3VUGA 5BVNA 5IQAA 3SA0A 4IBMA 3W8QA 1P14A 2R3GA 3ZM9A 4BJJA 4O0TA 4D9UA 5IA0A 3MH0A 5CASA 2W4OA 4EL9A 5TOZA 3RK9A 3LQ3A 2WU7A 3BRBA 5DT3A 4AGCA 4IAKA 2WZJA 3FZSA 4FYOA 3D2KA 5CXHA 5IU2A 5KZ0A 3U8WA 4ZY5A 3F6XA 4XG3A 3BV2A 3HV4A 2XKFA 5IISA 4FNYA 3BLHA 5AUXA 5IKWA 2IPXA 3EHAA 3WE4A 4ZSGA 3TXOA 3NNUA 2XP2A 1K9AA 5BMMA 2QR8A 4FSYA 2LAVA 4BFMA 2EVAA 4KABA 1NVQA 4O7WA 5JGBA 3HMMA 3NYOA 2I0VA 1OBDA 1J7IA 3TTIA 1GZKA 1M2QA 1XBBA 2H8HA 1F5QA 2X9FA 3QBNA 4KWPA 3PY1A 4CCBA 5ETIA 2HELA 3LLAA 5HE2A 3OTUA 1YXVA 4GJ3A 4BDDA 5EOLA 4HZRA 2OH4A 4C4IA 4E93A 2ZV8A 3ORZA 2GNHA 4I93A 3ZLXA 4DDIA 4ENXA 2OSCA 4E4LA 2EXMA 3ANRA 2R3HA 3MY0A 4R6VA 5M57A 1R78A 4D5KA 3QRIA 4UV0A 3AXWA 2W05A 3L1SA 4LI5A 4MF1A 4BCGA 1XH9A 2OBJA 4Q9SA 3REPA 4C36A 5ETAA 4O2PA 4EUUA 4N6YA 4WNMA 3W0PA 3DKOA 4UBAA 3UG1A 3VS2A 5IEVA 5J7HA 3DK7A 3ORPA 1MP8A 3EKNA 3HLLA 3EZVA 3ORIA 4HGTA 3BPRA 2VTIA 4M97A 4OTQA 3VWAA 3ZH8A 3PJ3A 2X7GA 4QP3A 4R8QA 4TWNA 4WNOA 4V0GA 2BRMA 1PXKA 2X39A 4KS7A 5FWKK 4YR8A 4GEOA 2PZPA 3GUBA 5K4JA 2W0JA 4ZLZA 1P4FA 3ETAA 2C5VA 5CQUA 1SVHA 4U3YA 4I21A 1ST0A 4JOAA 1CDKA 4E6QA 2QLUA 3D2IA 4AT4A 4D2WA 3DTWA 5HG9A 3WIGA 2FSOX 4YPDA 1GIHA 2I0HA 3NW5A 4GG5A 5C27A 2C6DA 2ITVA 3PSCA 4J95A 4LDTA 3BI6A 4ZTLA 4FKVA 5E7RA 2Z7RA 5IA2A 4U5JA 4YURA 4OW8A 4BDEA 2F2CB 1QCFA 4F7LA 5CNOA 4OBOA 3EQHA 3MJ1A 4U3ZA 4JMQA 4PTGA 2A4LA 1J91A 2V7OA 4O0UA 2VWZA 5BVDA 3CLYA 4FSWA 4QMQA 4ZJVA 4GK4A 5H2UA 3C4FA 5EHYA 4R1VA 4W8DA 4RIOA 1H24A 4O7ZA 3MPAA 5JRSA 5AM6A 4EOMA 3EL8A 1XHAA 4EH4A 4IFCA 2W99B 4QMSA 3PSDA 4CZYB 3EZRA 5FEQA 3RPVA 3WZDA 2XUUA 4YC6A 1R1WA 5HIEA 3FDNA 2EB3A 4RIYB 4JIKA 2HENA 3Q96A 3Q4TA 4KAOA 4JDJA 5I9VA 2VRXA 3QTIA 4KKHA 2BFYA 3PFQA 4OBPA 1UU7A 3A4PA 3QGYA 2A0CX 2XS0A 3C0GA 3IGGA 2IZSA 4ITIA 4O96A 1PHKA 3BBWA 1YW2A 1IAHA 2YAAA 3AC4A 2XBJA 3LFBA 4YJUA 3E7VA 3RZBA 4DFXE 4CTCA 2B9FA 2NNWB 3LKMA 2CLXA 4RZWA 5IA3A 3QQHA 4BIDA 1W84A 4FSNA 5IQIA 4G3DA 3CGFA 4C4EA 5LARA 5L8KA 4GH2A 2YN8A 3DBCA 2C3KA 2X81A 2BDJA 4ANLA 4JAJA 3H10A 3O17A 4F9WA 2XAOA