3QGWA

Crystal structure of itk kinase bound to an inhibitor
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
261
structure length
244
Chain Sequence
IDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIKEGSMSEDDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery and structure-activity relationship of 3-aminopyrid-2-ones as potent and selective interleukin-2 inducible T-cell kinase (Itk) inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase ITK/TSK
total genus 74
structure length 244
sequence length 261
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3qgwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3qgwA01
3W2SA 2X7GA 4Q9SA 2ITQA 4RVTA 4PDYA 2PMIA 3ROYA 1YXTA 2IZSA 4NFMA 3H0YA 2ERKA 4OTRA 2QR7A 3P86A 3MBLA 2WIHA 2BALA 1H4LA 2XP2A 2PSQA 3LFSA 3PXRA 4FYNA 4L3JA 3NDMA 1S9JA 2G9XA 2WMXA 4FV1A 5DR2A 4O38A 2YJSA 4V0GB 1MP8A 3Q5IA 4YLLA 1HOWA 3E7OA 4LM5A 3KXHA 5ANEA 3NUSA 3DV3A 2NRUA 3U87A 3M2WA 2XJ1A 3T9IA 3KMUA 3Q2MA 3UNJA 3IG7A 5KMIA 5L4QA 4C37A 4GT3A 4ZLYA 3C51A 4AOJA 2J9MA 5AA8A 3V5JA 3ANQA 5D10A 4E7WA 3QTWA 4YO6A 4GV1A 4YURA 4IB5A 5AUYA 1H01A 4PNIA 4ZMFA 5L6OA 5HVYA 1Q8YA 3HP5A 2X2KA 4QO9A 4PV0A 3DLSA 3TV4A 2F9GA 2XK3A 1QPCA 4FZFB 4LMUA 4DFNA 1H08A 3CTQA 3CSVA 2QOQA 4DFUA 2FVDA 5HOAA 4AFEA 3KQ7A 3A8WA 3QBNA 1E9HA 4CNHA 5B0XA 1YKRA 4EYJA 3FMDA 3ZM4A 4DFYA 2VTRA 2WTCA 1G3NA 3MJ2A 4EOMA 3EFLA 4FSNA 4FA2A 2F57A 4P2KA 1CTPE 1JBPE 4LRMA 4GS6A 3MPAA 4BCGA 4A4OA 3VULA 4DC2A 1Q5KA 1GNGA 4RMZA 5EOBA 3MWUA 1FGIA 4EH9A 5CSVA 3AD4A 2X9EA 5HBHA 4QNAA 3UO5A 5FM2A 4MXAA 5AR4A 4WBBB 2OO8X 2O8YA 2CPKE 2XK9A 3EYGA 4JT3A 3DK7A 3KULA 3SOAA 4F9CA 4GW8A 4PTGA 4TPTA 4P5QA 3DAJA 2XJ2A 3MSSA 4RIWB 4E93A 5IDNA 4BDAA 5L8KA 2R3PA 3QZFA 5CAVA 3NRMA 4QMQA 2ZB0A 4N6YA 3TNHA 3NX8A 4OTIA 3TUDA 3WZJA 3V3VA 3MFUA 3NW7A 4BDFA 2BAKA 2PMLX 3KXMA 4O7SA 3TIYA 3FXZA 2BIKB 4PPCA 4YJUA 5L6PA 3HDNA 4RJ4A 4OUCA 1ZMUA 4ASDA 4X2GA 3KF7A 2EWAA 2OG8A 4XRJA 4AU8A 5KMKA 1R0PA 3ODYX 4IWDA 2QKRA 5EG3A 4XOYA 3W33A 2YM4A 3HYHA 4C8BA 4M15A 5CI6A 5H8EA 4O7RA 3KCKA 4A07A 3LOKA 1KWPA 3R9RA 3MY5A 5HORA 1XKKA 3RCJA 1H25A 2HZNA 1BI8A 3P5KA 5EW8A 4ANOA 1H0WA 3UQCA 5J5SA 5E8WA 3QALE 5J9YA 4MD7E 3Q04A 2WTVA 3EQDA 4AQCA 5JZNA 4E6CA 4U5JA 3R7YA 4BICA 3LXNA 2R7BA 4XG8A 3UOKA 2HZ0A 2XKDA 3R9OA 3PZHA 4AA4A 5AP4A 5AEPA 4O6EA 2QLQA 3H10A 4UMQA 5GJGA 4BCMA 2IW6A 5CT7A 5HEZA 1VYZA 4TYIA 3VS6A 1GIIA 3VUHA 4OTDA 4E20A 5LMKC 4EZ5A 2F7EE 4H1MA 4YJSA 1YDTE 3CJFA 1GY3A 4IVDA 2UV2A 1OL5A 4UZDA 4BWXA 2GQRA 4MH7A 2G2IA 2GHGA 4GJ2A 4PF4A 4W4VA 4CYJA 4EORA 1NT2A 4ALWA 4C4GA 3Q6WA 3WI6A 4YSMA 3FDNA 3MIYA 4FGBA 3ALNA 5JZJA 1BI7A 1OUYA 4J71A 1YHVA 5LMKA 5TE0A 2FH9A 1J7UA 3FQSA 4X3JA 5HLPA 4C33A 2ZJWA 4KBKA 5KO1A 2C1AA 3CC6A 3NMUF 1NVQA 4G3DA 5EK7A 4E6DA 3QHWA 5HBJA 5CEOA 4ENXA 1MUOA 3TCPA 5IZFA 3L8XA 4ZSJA 4QMTA 4Y5HA 5I5ZA 4O7TA 2SRCA 3LXLA 4NL0A 2R0IA 4WNMA 4YJVA 5CASA 4BDJA 4M0ZA 3ULIA 1J3HA 1F0QA 2QG7A 4YHTA 4RJ8A 5CF6A 4JBPA 2P55A 4U9AA 5FEEA 3JR1A 3D94A 3WF5A 1ZOHA 3FHIA 3VUGA 3DCVA 4BZOA 3D7TA 5DNRA 2EB2A 4U7ZA 2W9ZB 1PXJA 2ZYBA 3I79A 3OW3A 4FF8A 5EYDA 2HY81 4BDIA 4DG0E 4ASXA 2VTTA 3LCOA 5DR6A 3VS5A 2BRBA 4S32A 1P14A 2WMVA 4RFZA 3BHHA 3ZO4A 5EW3A 1PXIA 2FSMX 4HGTA 4IQ6A 5FTQA 3IDCA 4FNXA 4C4FA 2BHHA 4IHPA 1ZARA 4I92A 3PSCA 1J1BA 5IUGA 1K9AA 3FLSA 5D11A 3CE3A 5L8JA 2W1HA 4ZJVA 4L46A 2JLDA 4K1BA 3C7QA 4DITA 3AC5A 5BYYA 4X6QC 4BKYA 3Q6UA 5FDXA 3W2QA 3ZLXA 4P7EA 3Q9XA 3WYXA 3VS4A 5BVKA 4V04A 2WU7A 4F63A 4I6FA 3FSKA 1B39A 3GFWA 3OCBA 4KRDA 3FL5A 3IW8A 4MQ2A 3KK8A 2WQBA 4RIWA 3QLFA 3QC9A 4MAOA 4U45A 3ZO3A 5HU3A 5JK3A 2ZV2A 3CJGA 4EHVA 4EH3A 4ZP5A 3NW6A 3O23A 3QF9A 4RQVA 5AAFA 3UC4A 3VQUA 4PNKA 2HY0A 2YWPA 4CXAA 4BRXA 4ZY6A 3WZDA 2R3LA 4YJOA 4RT7A 3FBVA 4AF3A 5K0XA 4IX4A 4AXAA 2C3IB 4LYNA 5C4KA 5M51A 2WEIA 3DZOA 5EDQA 4YZDA 3I5ZA 2F7ZE 3G51A 4O0RA 2BZJA 5IUIA 1P4FA 4GYIA 1WBOA 2QOFA 3A61A 4QMLA 5AFVA 3KRLA 3KFAA 4BCJA 3R7VA 1URWA 3FV8A 2YM5A 3KEXA 2UW7A 4IAZA 3FKNA 4FEQA 5DMZA 2AC5A 5EDPA 4BZDA 3QUDA 2ITWA 2VTAA 3UIMA 3DY7A 5A46A 4KUJA 3EJ1A 3P7BA 4AGDA 2GNLA 2X81A 2YM8A 3AD6A 3GBZA 2W96B 4F64A 4G2FA 3NNXA 3QCYA 2XIXA 3H9OA 3L8VA 4AZFA 4EHEA 1M7QA 4KINA 2Y7JA 3WZUA 1R3CA 4RGJA 4DHFA 1YXXA 4G3GA 4O81A 4EK5A 3CTJA 4S30A 3LFAA 4HJOA 4PL4A 3RI1A 4XRLA 1VEBA 4D1XA 4JLCA 5CX9A 4QQCA 4AA0A 5BPYA 3GGFA 3PG3A 3MIAA 4RJ6A 1IA9A 2WTDA 4JNWA 3S4QA 1IAHA 4ITHA 5DEWA 4J95A 2HK5A 3FUPA 4GIIA 4H36A 4XMOA 5DE2A 5K3YA 4KKEA 2RFSA 2WMWA 3SDJA 4O7WA 2WELA 3S3IA 2ZDUA 3O8PA 3CR0A 1OM1A 4I93A 4CMUA 4O21A 3FXWA 3FZPA 5AR8A 5CU0A 3QKMA 1S9IA 2QOHA 3MVJA 1W7HA 3F5XA 3GCUA 4CCBA 2UUEA 3FI3A 3DBQA 3P7AA 2JKQA 4EI4A 3OTUA 4BIBA 2XK8A 2IN6A 2OZOA 4D5KA 3RPVA 1R78A 1PW2A 4U41A 5KZ0A 3T9TA 1YOJA 4IJPA 5AX3A 5JSMA 4R1YA 5E8TA 5ETAA 4WG4A 4PPAA 3MI9A 4G3CA 4G1WA 4JXFA 2CGWA 3FXXA 4BHNA 5AUXA 3CCNA 3RK7A 4WUNA 5JFVA 4FKPA 4I5MA 1ZZLA 4MK0A 4RWLA 4CV9A 2XKEA 3I1AA 3IOPA 4YGAA 1FVRA 3SKCA 4ANLA 4X3FB 3FJQE 3HL7A 5M06A 2C6KA 4FNYA 4IJ9A 3DGKA 2QG5A 4FTAA 1BMKA 5CAUA 3TACA 3KMWA 4DFLA 3EFWA 5EW9A 3OG7A 4EEVA 3E8CA 5CZHA 4P4CA 1WBPA 4FKSA 4FODA 2JGZA 4BBFA 5M53A 1BUHA 2OBJA 3NUYA 4IDTA 1H00A 4OTQA 4AZTA 3V04A 3AT3A 4FTOA 4D2RA 1SM2A 4KSPA 4PY1A 4Y5QA 2NNWB 3V5TA 2HXQA 3R2BA 1M14A 2YDKA 1Y57A 5CSHA 5C27A 3RK9A 4AX8A 5M4IA 3GVUA 4FV7A 3I6WA 3S0OA 4JJRA 4RVMA 4AE9A 3N4UA 2BKKA 4G6LA 3UIXA 2C0IA 4FT0A 5CF4A 4RVLA 2FB8A 4IAIA 3LLTA 3ORMA 2RFDA 4QPAA 3RHXA 4X2JA 4B7TA 2OJIA 5BUJA 1JOWB 3OFMA 4J52A 4UZHA 4XHKB 4C3PA 5T6KA 5KMLA 2XNBA 2CHLA 2I0YA 5A4LA 2X4ZA 2BDWA 4DFZE 3PJ2A 5KE0A 4EK4A 5C26A 4N70A 5IF1A 4HZSA 2VO7A 4WSYA 4PUZA 1W83A 4IX6A 3GENA 3E7VA 4TRLA 5GJFA 1WZYA 4C38A 4CFWA 4BI1A 2O2UA 4DEGA 2P2IA 4KBAA 2A4LA 2ZB1A 2RIOA 2VTMA 3QQFA 3C4EA 2CKEA 3NWWA 1YOMA 4QYEA 4GK2A 3MDYA 3C0GA 4H39A 4HPTE 5AP6A 5HVJA 2YLFA 5HCYA 2QQ7A 4A9RA 5BUIA 5H8GA 5KCVA 3TDWA 2EVAA 2F49A 2PZRA 3R1SA 4XBUA 3Q9ZA 4ASEA 2W7XA 3R21A 4RRVA 2GHMA 5IQBA 3EQCA 4HYHA 5EH0A 5KBRA 4EQUA 1W82A 5E4HA 3K3IA 3SC1A 3DQXA 3I7CA 5CSWA 4BCPA 3CTHA 5IQHA 3AC2A 3HA8A 3KXZA 3D14A 4UXQA 1Q8UA 2ZDTA 3LCKA 4ZSGA 1YXSA 4MHAA 5K4IA 4FIIA 1ZYJA 5C01A 4OBPA 2HOGA 2J5FA 4PMTA 2BFYA 5AR3A 5BVOA 4YC8A 3MB6A 2O0UA 4RX9A 3UE4A 4WT6A 2OICA 3OUKA 4FUYA 3FL4A 3GC7A 3CS9A 4CMTA 4E8AA 2QD9A 3QTZA 4JDIA 2HYYA 4O1OA 5ANDA 4Z16A 3KK9A 1FMOE 2W4KA 3NZ0A 4H3QA 4D5HA 4LV8A 1OL2A 1DAYA 1E1XA 4YNOA 2IWIA 3BYMA 4XP3A 3OCTA 2C6DA 4F9AA 4Z7GA 2E2BA 3MVMA 4TY1A 3WILA 4XLVA 1QPDA 4F9WA 2XKFA 5IA4A 1PHKA 2FO0A 3DT1A 1PXMA 3MFTA 4RFMA 4YTIA 4UMRA 4IZAA 5IQFA 3QTQA 4O86A 1UNGA 2YHVA 2WMTA 3L9NA 5E8UA 4D2PA 1OB3A 3FZTA 3HX4A 4FSQA 4RIXA 1Y6AA 2ZV8A 1HCKA 5JEBA 2PHKA 3FZOA 3EQBA 4YBJA 2B53A 4QPMA 4RQKA 3SAYA 4EOSA 2PMNX 4TT7A 3U55A 1IA8A 2QOCA 3MH2A 1ZMVA 4DLIA 3A99A 3IW5A 3NEWA 3HV7A 5AV0A 1XHAA 4FX3A 3R0TA 4GU6A 2GDOA 4QD6A 3S2PA 3ZRLA 2REIA 4KIOA 1T46A 3QTUA 2JBPA 4BVUA 2UZEA 3WF8A 2PUNA 2RKUA 1YVJA 5GINE 4MNEB 4EQMA 3WZKA 4EWHA 2F2UA 3MH3A 4DEEA 3V5QA 5KZIA 2BUJA 4JDJA 3O8TA 5IU2A 4C59A 5LVOA 5I9ZA 3HUBA 1PYEA 2VZ6A 4D55A 3FLWA 4RX8A 2OGVA 2YJRA 4GIHA 1J91A 4QT1A 2BRHA 2WIPA 3CIKA 2OJJA 4I5CA 2JKOA 3LLAA 2XJ0A 3F5GA 4BBMA 5AP1A 1OKWA 2F7XE 4I3ZA 3H30A 4W4XA 4BCQA 2W99B 4LG4A 4RJ7A 4XG7A 1OIYA 5DT0A 3II5A 2X1NA 3LM5A 3ORKA 5HE1A 5JFSA 4EONA 3HP2A 4I5PA 2WQNA 4ZTHA 3MPMA 1H0VA 3FQEA 3ZZEA 3QWKA 3NIEA 3R1NA 3Q5ZA 3TTJA 4ZTNA 5I9XA 2WQEA 3QUPA 3T3UA 2R3RA 2PZPA 5FBNC 2XMYA 3UZRA 2VWIA 4I4FA 3HV4A 4OTPA 4DGNA 3E63A 1URCA 1UKHA 4M67A 4FKVA 5HE3A 4F6WA 2JD5A 2JIVA 4TZRA 4E26A 3FY0A 1PXLA 1YI3A 4J96A 4QQ5A 4C3FA 4C4HA 4BIEA 4CKRA 2R3OA 4FIJA 4LQMA 3OWPA 5LARA 2ZMDA 2PVKA 3WBLA 2PZIA 4BYJA 3LFEA 4KBCA 5A54A 3GP0A 2WB8A 3DB8A 4G17A 2R64A 4HYUA 3TXOA 2I0EA 3BQRA 4ACHA 4FKGA 4QTBA 3QLGA 4CFXA 2JDOA 2CN5A 2ZOQA 2R2PA 2OF4A 2XUUA 5KMNA 1I09A 4UWCA 3RAHA 3TM0A 3A62A 2C5XA 3EN9A 3TZMA 3QL8A 4DA5A 3PE1A 4QMPA 4DAWA 3BWFA 2DQ7X 2NP8A 2UZDA 5DLSA 3RMFA 4XP0A 4XG9A 4NUSA 4FTRA 5FXQA 3E93A 4F7LA 4W4WA 2B1PA 4R5YA 4UXLA 1PJKA 4LMNA 4IZYA 4FEWA 1OL6A 3OROA 3QA8A 5D41A 4F08A 3UTOA 2AYPA 4F1OA 3ZHPC 1YWNA 1B38A 1KOAA 1Y91A 2FSTX 3HLLA 3PXZA 3AMBA 5J8IA 3LCSA 4FGRA 4ASZA 4ANNA 2QODA 1ZYLA 3KL8A 3MA3A 5DA3A 3TN8A 4BC6A 4RLLA 3MJ1A 1LEWA 2ZM3A 4EOKA 3BLHA 3PLSA 3R7EA 3VC4A 4Q9ZA 2PZ5A 3H9FA 3MS9A 4Q5HA 2QLUA 3CY3A 5D12A 5H8BA 2B54A 5K5XA 4L01A 4M8TA 4AN3A 4G34A 3OOGA 2OIQA 3O7LD 2Z7QA 4ZIMA 4BWKA 5E90A 2E9PA 3PUPA 1P2AA 2R3QA 4KKGA 4TXCA 4CQEA 5CEQA 3QKLA 3HMIA 5HVKA 1UWJA 1Y6BA 1FGKA 3BE9A 3F7ZA 3PJCA 4D58A 2QO7A 3ENHA 2BAQA 2PUIA 5FXRA 2WXVA 4R7BA 3TKIA 4DH1A 5CNNA 2FUMA 2YFXA 4CRSA 3O50A 2XM9A 3FI8A 2Z8CA 4A06A 3N4VA 3RM6A 4RSSA 2QOIA 4C7TA 3KN5A 4FKJA 4R77A 2EB3A 4HYSA 4HCTA 1ND4A 4GH2A 3SHEA 4TYHA 3ZBXA 1O6KA 3PE2A 5AUZA 4D2VA 4XOZA 3F5UA 4LGGA 1P5EA 3PVGA 5HG9A 5CZIA 3EFJA 4AFJA 5KMMA 5EM8A 4A9YA 3DDQA 5DH3A 2J0MB 3D7ZA 3EQGA 3V5PA 3BZ3A 5J9LA 2XIRA 5C4LA 3LFNA 4TYGA 3COMA 3CLYA 1OZ1A 3DK3A 4N6ZA 4U0IA 3T8OA 3OMVA 3TKUA 4EOIA 5JGAA 2IG7A 4KIKB 4YHFA 1J7IA 2X7FA 1U5QA 4JR7A 3DBCA 5T68A 1W0XC 2XS0A 3Q52A 4GFMA 5DEYA 3UOHA 3L9MA 5M56A 4V0GA 3WE4A 3EKNA 3NPCA 1PY5A 4LUDA 2RL5A 4QNYA 3GC0A 3HMNA 4A4LA 5CWZA 2YM6A 5EI2A 2P4IA 1M2QA 1Z9XA 5DT4A 3AXWA 1OGUA 4QQJA 5IA5A 5DYJA 5DG5A 4HGSA 5A4CA 2X7OA 4E4XA 4LOOA 5IA0A 1ZOEA 5EKOA 4H1JA 2VTSA 1YOLA 2EUFB 2XRWA 4ITJA 3E8EA 4LGDA 4R6VA 3AQVA 4NZWB 4BIDA 5CENA 3RAKA 2BTSA 3E5AA 2I0VA 4E5BA 4MNFA 1U54B 1Q62A 3DKOA 3EB0A 3GU8A 4IB0A 5K4JA 3SV0A 3C0HA 3P08A 3R6XA 4H05A 3IECA 2HAKA 5ACBC 5KUPA 2Z02A 1MQBA 2IW9A 3P0MA 4I6HA 3V8SA 3VF8A 5L2SA 3B8QA 2YACA 4AGCA 3JY9A 2O5KA 3IK3A 5AR7A 3CD3A 3NCGA 2VGPA 5JN2A 1O6LA 4EZ7A 3FZSA 1CKIA 2PY3A 3GEQA 4GCJA 4JDHA 1K3AA 3EQHA 3DA6A 5BVDA 1Q8TA 3ORZA 2X6EA 2HELA 2BZKB 3ZFYA 4DH3A 2OLCA 3EIDA 2EXEA 2YAAA 3BV3A 3OEFX 4I0TA 4I20A 2BMCA 2WTKC 2XVDA 3BIZA 4FZ7A 3QZHA 4FZDB 4BDEA 3W8LA 3LFFA 3OXIA 2GFSA 4YJPA 1NXKA 3GQLA 3ZLWA 2Z7LA 4Y95A 2BDJA 4QTDA 3IPHA 4D28A 3C4XA 3QTSA 4UY9A 1V1KA 4WNPA 1H1SA 1O9UA 1BLXA 4O7VA 4A7CA 4JI9A 1J1CA 3D0EA 2Q0BA 5F9EA 3FLZA 2FSLX 1ZY4A 3P78A 3QRTA 2W4JA 3E8DA 4ONAA 4ARKA 4AT4A 3VAPA 2GNGA 3HMPA 2UW6A 4F7NA 1OKZA 3UNZA 1APME 1R39A 3SW7A 2C1BA 4WG5A 3FMLA 2BFXA 2B9FA 3C9WA 4I0SA 3OTVA 4FKLA 1WBVA 2OJGA 2ITZA 2JKKA 3ET7A 4XP2A 3UO4A 4OBOA 4HNIA 1RDQE 4FV6A 4C02A 1STCE 2C6LA 3MVLA 3MV5A 4KAOA 3VF9A 2YCFA 4RC2A 5AV4A 2C6OA 3O71A 3TZ9A 1UNLA 3A4OX 1T45A 2OI4X 2RFNA 4JQ7A 2JIIA 5L6WL 2QU5A 2QOKA 3TL8A 3FZ1A 3OHTA 3KRXA 4ID7A 3NYNA 4O0WA 4IVBA 5EYCA 2Y4IC 3ZXZA 2UW3A 3LMIA 5I0BA 3PYYA 3JS2A 2B52A 3G90X 4M12A 4YPSA 2BRMA 4S33A 4F1MA 4BCKA 1PMEA 2WMQA 4EK6A 5LMAA 1F5QA 3LQ3A 5TOZA 3VS0A 2HCKA 1CKPA 2UZOA 4RBLA 4CKIA 3JY0A 4F0GA 4K9YA 3UJGA 1CSNA 4M66A 1YWRA 4HPUE 3FMJA 4YZ9A 5CU4A 3FZRA 1R0EA 2XZSA 1YWVA 4PP9A 3ZLYA 4R3PA 3NYXA 4AA5A 5EQYA 3LJ0A 4L00A 4GK4A 4CFNA 5IQIA 2C0TA 3NUNA 1FOTA 2OWBA 3R7GA 3CPBA 4BR3A 3MYGA 4D2WA 1Q3DA 3KREA 4G3FA 4IAAA 2XNOA 4IC8A 5DRBA 5HCZA 5HI2A 4L8MA 4EKLA 3B2WA 4J8NA 5LQFA 2YERA 3C0IA 4FTMA 1UWHA 4WBOA 2OZAB 3L9LA 1ERKA 2XK4A 3QD4A 3NLBA 5FWKK 5J1VA 5BX0A 3HAVA 2PVMA 2QVSE 2G2HA 4PMSA 2CKOA 3Q4UA 5DIAA 4EJ7A 4IVCA 4RIXB 4BDCA 2GNFA 2Y4PA 4NT4A 3UPZA 3G6HA 3JUHA 1OPKA 3VWAA 4O7ZA 5FXSA 4R1VA 3ID6C 2VWBA 3HEGA 5ANGA 5HNGA 4JR3A 3ZUVA 1Q99A 2PZYA 4DH7A 3D15A 2GPHA 2H9VA 4CG9A 4IX5A 1YI4A 4FR4A 1WBTA 3QGWA 2W1EA 3G15A 4GEOA 4M69B 1YDSE 2BROA 4ZS0A 2VWWA 5IISA 3SA0A 4TW9A 2QO9A 2OW3A 3OD6X 4GFGA 5CAOA 3TV6A 3FI2A 2VU3A 4L3LA 3EQPA 5DFPA 3PRFA 3AC4A 3I0QA 3OW4A 3D5WA 5E8SA 4O84A 2UW4A 3TT0A 4MTAA 3RP9A 3R8UA 3BYOA 3KVWA 4RWIA 4NKAA 1WAKA 3O51A 1YI6A 3FC2A 4BDKA 4BDGA 3H3CA 2PVLA 5FP6A 5B7VA 3BE2A 1GJOA 3DAKA 3IW4A 4MYGA 1LEZA 4QP7A 5LJJA 2KULA 1GZNA 3UYSA 4ZSAA 2R9SA 4G6OA 1JKSA 4AGUA 3L9PA 1TVOA 4JX7A 4L68A 3ZEWA 4C61A 3C5UA 1Q41A 3RPRA 1OUKA 5HE2A 2VWZA 4MBJA 3UIUA 5ANKA 4O83A 3QTRA 4ALUA 3C4CA 2NPQA 2YCSA 4XYFA 3RINA 3ORLA 4APPA 4S34A 4NW6A 3ZTXA 3QYWA 3BKBA 3OEZA 3EN4A 3MGYA 3ORIA 3DTCA 4JAJA 2WMUA 4JG7A 3DXQA 4NJDA 5AV2A 3SXRA 4ITIA 3F3ZA 5FRIA 5EM6A 4WO5A 4H3PA 5HO6A 4BWPA 2BHEA 4FV4A 3I81A 4WKQA 5FTGA 3D9VA 2HW7A 1OL1A 3FMKA 4HCVA 4AZSA 4B99A 3G33A 4IXPA 2JAVA 3QXPA 5IQEA 3RJCA 3ORPA 2GTMA 2HXLA 3E3PA 4YZNA 3UOLA 4B0GA 3Q4ZA 4FKQA 4OTHA 5M57A 1Q8ZA 5CAQA 3WOWA 5E91A 4DBXA 4MX9A 3QRKA 2ITNA 4IZ7A 5B2LA 4EK3A 2ITOA 1WCCA 3UVPA 3PVBA 3Q60A 3QAME 4FL1A 4NM0A 3JYAA 3FQHA 1UU3A 2C3KA 3VBXA 4YMJA 2V7AA 2IVSA 3B2TA 3FHRA 3POZA 4K6ZA 4KKHA 3LFQA 4MQ1A 5FD2A 3UBDA 3V8WA 3MB7A 2NO3A 3GU5A 3PVUA 5IEYA 2C6EA 4UX9A 3GCVA 2Y6MA 5AMNA 3M42A 2PMOX 3NNUA 4JRNA 4FSMA 4D4VA 4NM7A 3IW7A 4UV0A 5M44A 4D4RA 5CSPA 2CN8A 5CTPA 4EH6A 2B0QA 2WNTA 3W2CA 4GT5A 4G16A 3M1SA 2H96A 3HUCA 3DDPA 3HAMA 2GQGA 4DH5A 3FEGA 3FC1X 4PTEA 2CGUA 2C30A 4O2ZA 5KX8A 5JQ5A 1BYGA 1YHWA 2VTHA 3UG1A 5J9ZA 3KULB 3F88A 3WARA 5C8NA 5CSXA 1JVPP 4PDOA 4CQGA 2PUPA 4EL9A 3RALA 4OAUC 4FE2A 5DOSA 2J4ZA 3ACKA 4ZY5A 3UZTA 3F7WA 4XNEA 3ANRA 3UZPA 3Q2JA 3SXSA 3D83A 3PXYA 3DTWA 1QPJA 5AIRA 4DYMA 3BLRA 2J0IA 4G6NA 4M68A 3EQRA 3U4UA 2PULA 3LZBA 2Q83A 4RX7A 4FSRA 1ZXEA 3IONA 4KB8A 4U42A 2VN9A 3UPXA 4C62A 3QZGA 2OKRA 2CNVA 4L44A 3UP2A 4XLIA 3TJDA 1H1WA 3G0EA 3AC3A 3W2RA 3BLQA 2CGVA 3NNVA 4PQNA 4QRCA 4N4SA 3ZS5A 4BYIA 4F9BA 3U9NA 5CQWA 4BKJA 4MD8E 2QURA 2WTKB 4UMPA 4KWPA 1OKVA 4S31A 4F7JA 3FY2A 1SVHA 5JMSA 4QYGA 5ANIA 3FPMA 2GFCA 5IH5A 4AOTA 3R04A 5EFQA 3EYHA 4FKTA 1NVRA 1YXUA 4R78A 4O1PA 3CY2A 3BWJA 2HZIA 4UBAA 4DEHA 4U40A 3V6SA 3ORTA 1W98A 3AT2A 3LM0A 4YNEA 3ROCA 4FNZA 4FSYA 3PJ1A 3ACJA 4ZSLA 1FVTA 5ICPA 1GAGA 4JBVA 2UW5A 3TZ8A 4UN0C 4IADA 2VO3A 1Q61A 3R00A 3GCSA 2CLQA 4BI2A 4FL3A 2C47A 5CALA 3AC1A 3FYJX 3PSBA 4NJ3A 4GKHA 2CCHA 5ANJA 4CRLA 2CSNA 3G2FA 4BTJA 1XH9A 4BDDA 2O63A 2E9NA 4F09A 4FIGA 3GUBA 2YITA 1PMVA 2ESMA 3KMMA 2C6IA 4AOIA 3AGMA 3WE8A 3LHJA 4HVGA 1JKKA 4BGGA 2OXXA 4C2WA 3EOCA 1SVEA 3CPCA 5C03A 4EC9A 1WVWA 3HVCA 3TG1A 4RC4A 3GC9A 5E92A 3F2AA 4F6UA 4YO4A 5D7VA 4BBEA 2UW8A 4MBLA 3F69A 3VHEA 4CTBA 4MXOA 4ZXTA 4JQEA 1P4OA 2UZNA 1ZOGA 3Q4TA 4FIHA 5E8ZA 4YBKA 4A9TA 2W5BA 3W18A 3QGYA 4MD9E 3TV7A 3QFVA 2OIBA 2XEZA 1REKA 3R1QA 4K33A 2J0JA 3K5UA 4M0YA 4LL5A 3OCGA 4RG0A 4TWCA 3A7IA 3REPA 3R30A 1TQIA 2P3GX 2VX3A 1JKLA 4YP8A 4U6RA 2VNYA 5AP2A 1I44A 4TKSA 3NVKI 3GT8A 3V01A 4DGGA 4FL2A 4WNOA 1AGWA 2E9VA 5F95A 2WEVA 3DKCA 4JG8A 4FKOA 5GZ9A 1U59A 5BMMA 2CNQA 4G3EA 4CLJA 3NNWA 3D7TB 3L1SA 5GIOE 1KOBA 1LUFA 1XBBA 3F5PA 1AQ1A 1UNHA 3BHYA 3FLQA 4PPBA 4IAKA 5HLWA 4HVSA 1SNUA 2ETMA 3UO6A 2QHMA 4GRBA 4GUEA 1ZRZA 5DGZA 3VS7A 2H6DA 4EUTA 4LOPA 5GIPE 2Y4IB 4PX6A 5HICA 1BKXA 3PY0A 1ZMWA 2GNJA 3C50A 3WF6A 4DBNA 2AUHA 2C68A 3SRVA 4C4JA 4U3ZA 3ULZA 5AA9A 4KIKA 4YTHA 3B8RA 5AV3A 5EQPA 2QKWB 4BF2A 5TT7A 3RHKA 1KSWA 4YZCA 5LXMA 3Q3BA 4L52A 1ZZ2A 2I40A 3QD0A 5I9UA 2A1AB 3DZQA 3GU4A 2W9FB 1BL6A 5DR9A 4FTNA 3QA0A 1DM2A 4C2VA 2OXYA 4C57A 3GFEA 3WIKA 4EOOA 3OCSA 4DCAA 3PY3A 3MVHA 4FV0A 3I4BA 3BEGA 2JDRA 2FA2A 3RM7A 2G1TA 2PWLA 3DFAA 1OIQA 2RFEA 4Y46A 5HD4A 3BU5A 4HNFA 5AP3A 4GVJA 1NY3A 4WG3A 4BTKA 3ZDIA 3LE6A 3ZRMA 5GNKA 5J87A 1RE8A 3FMHA 4FT3A 3U6JA 4ZTRA 3BHTA 4QP1A 2WOUA 1GZOA 3KA0A 1XH8A 3P9JA 3LQ8A 3PP0A 4MNEA 4X3FC 4AP7A 5AWMA 2W17A 4O0SA 4L42A 4DEIA 4EOQA 5B2MA 3RPOA 1UU9A 4QOXA 2J90A 3QD3A 4XCUA 4ENYA 2AC3A 5JKGA 3PWYA 2XEYA 4M97A 3R8LA 3CKWA 3HMOA 3PTGA 2Z2WA 4QPSA 4C4EA 3A7GA 3HA6A 5IDPA 4MXYA 2J2IB 1XJDA 2C4GA 5CEMA 3C1XA 4KD1A 3KGAA 4RZVA 3LFDA 3LIJA 4E4LA 2C69A 2JIUA 4JVGA 4MXXA 2YWVA 3NW5A 4UEUA 3VBTA 4Y73A 2XRUA 3R9HA 5I9VA 4QYYA 4E4MA 3R83A 1L3RE 4L45A 4UB7A 5TKDA 1IR3A 2ITXA 2X2LA 4ZSEA 5IMEA 3DS6A 4JOAA 4GJ3A 4XJ0A 5HE0A 1H1PA 4UYNA 5A14A 1VYWA 5EYMA 5TF9A 4BDHA 4X7QA 3LW0A 3Q9WA 4N57A 3TUCA 4FSZA 4RLKA 3IDBA 4LL0A 2R3MA 4U97A 3KY2A 2XNEA 4HVIA 4WNKA 3OUNB 5HIDA 4G9RA 1PXOA 4Q5EA 2A2AA 3ZLSA 4D9TA 4YJQA 4QQTA 3PPZA 4ZZOA 4EHGA 1KE9A 5AUTA 4V01A 3R63A 4I24A 5M4UA 4TTHB 2Y0AA 1GOLA 3E88A 3THBA 5A3XA 4D2SA 5AAGA 4EH5A 3RVGA 4HYIA 3GI3A 4IACA 5F94A 5H9BA 3IQ7A 2WQMA 2O3PA 1V0OA 5IH6A 1RJBA 4Y72A 3SG9A 3PLAE 4O7YA 4P90A 4BTMA 4XG3A 4FEUA 5JFXA 4J99A 4USDA 4NTTA 4WD5A 3LCTA 4FV3A 2HZ4A 4M7IA 2GHLA 4F65A 5JRSA 5KHWA 3GU6A 4HGEA 3CBLA 4L3PA 4K8AA 4OR5A 3UDBA 1SYKA 4FZ6A 3KXGA 5J5TA 3ORXA 5HLNA 2JEDA 4FTUA 3I6UA 3MTFA 2W1IA 3DQWA 4RJ5A 4BKZA 5HTCA 3NUXA 4IW0A 2WFYA 5IQAA 1REJA 4LI5A 4ZMEA 3D2IA 2WPAA 4KS7A 1PMUA 5CU2A 3NUPA 4CSVA 4OTFA 3VO3A 2YZAA 3AOXA 1Q8WA 4HGLA 4L9IA 3VN9A 2ITUA 4BGHA 3V6RA 1Y8GA 4X2FA 5CVGA 3QCXA 4I41A 4ZTMA 2VO6A 4JBOA 4IMYA 1ZAOA 4EWQA 2J6MA 4WHZA 3EL7A 1G8AA 3OY1A 5LCKA 4ACDA 5IEXA 2CDZA 2G15A 1OIUA 4BHZA 5HO8A 1PMNA 5H3QA 5I9YA 3PIZA 4R7HA 2I7QA 4W8EA 2C5VA 3WIGA 3EN5A 1M52A 2CJMA 5HKMA 3ZU7A 2QOLA 3W2PA 4CFFA 4F9YA 3PP1A 3SGCA 3OXTA 4MVFA 1QPEA 5TO8A 4CYIA 4UMUA 5AP0A 3UQFA 4ANSA 1DI9A 5ETFA 2Z7RA 3R71A 5AX9A 4GL9A 4DTBA 5CEKA 3IDPA 3ETAA 4MEDA 4X6RA 2CKPA 2EXCX 2VTIA 3UC3A 3R2YA 5E8YA 4AS0A 3DKGA 3D4QA 3QYZA 3SW4A 1H24A 2OSCA 1TQMA 4EOJA 4PP7A 3FMEA 2IJMA 3NUAA 3DU8A 1OKYA 3QKKA 3R8PA 4FKIA 2OFVA 1MRVA 4W8DA 3KVXA 4BY9E 4JL9A 3N51A 1QCFA 3UMXA 4BCNA 2BILB 4O0TA 3NSZA 5CNOA 2W5HA 3NS9A 4FC0A 4WUAA 4Z3VA 2OJ9A 3MFSA 4OT6A 4EOLA 4F1TA 4M69A 3EHAA 1NW1A 4WOVA 4MWHA 4W4YA 1W8CA 3CQUA 1KV2A 2CKQA 2ERZE 3BRBA 3DAEA 4I1ZA 4YC6A 5ACKA 3QRJA 4NCTC 4B4LA 1MRYA 4B8LA 4O7LA 3F2RA 2YIWA 3PJ8A 1OIRA 4BI0A 4FIFA 3GNIB 4FG9A 4CZYB 1FMKA 4AN9A 5L2TA 5BNJA 3QXOA 3VVHA 5DI1A 5KKRB 4FOCA 3PDTA 4NSTA 2XA4A 4AGWA 5E8VA 4FEXA 5CQUA 5T3QA 4P5ZA 3DOGA 2BDFA 3G0FA 1OI9A 3JVRA 4YC3A 3VBWA 4D4SA 4F99A 5BVFA 5J7BA 1SNXA 4WIHA 4L7SA 3RBWA 1G5SA 3OY3A 5AM6A 1M2PA 4R7IA 1JWHA 3TKHA 1SVGA 5EM5A 5KBQA 2F2CB 5IEVA 4NCTA 1OVEA 3TI1A 4WSQA 5HD7A 4JIAA 3Q96A 4APCA 3MW1A 5K9IA 5L2IA 4OTGA 4ZLZA 3WF7A 2PE0A 5CYIA 2ETRA 3MPTA 4RWJA 5FEDA 2WMSA 4AT5A 4J98A 4Z9LA 2YIRA 4X2NA 5AM7A 1WVXA 3HKOA 5DHJA 3HV5A 3S00A 1IEPA 3BYVA 1XH5A 3GC8A 1H07A 2OH4A 4IWPA 3ZSGA 1NVSA 4DEAA 3OF0A 5KMOA 1L8TA 4IBMA 3IS5A 4RIOA 5LMBA 4FNWA 2X9FA 2W1GA 1ZYDA 2QOBA 3KRJA 4I6QA 1SZMA 3DBEA 3O7LB 1H28A 3DJ7A 2C5YA 2PVYA 3FLYA 3KN6A 4FYOA 4JAIA 4IE9A 1PF8A 4XX9A 5FBOA 3W1FA 3SVVA 3I0OA 4FT5A 2J0KA 2YM3A 3ZO1A 4ZS4A 3A8XA 4NWMA 1XH6A 3FE3A 4U8ZA 3LJ1A 2WHBA 4FT7A 3EQFA 5CS6A 2ETKA 3SQQA 1WBWA 5LCJA 2ZM4A 1XR1A 4GVAA 3FI4A 3I7BA 4AZVA 1UVRA 3D5XA 3U54A 2EXMA 4DTAA 2ZV7A 2OXDA 3EL8A 3IO7A 2OF2A 3ZUUA 3PSDA 4FOBA 5HCXA 3RNYA 3R7OA 3E3BX 2XK7A 5LWNA 2PVHA 4NFNA 3V5WA 5JFWA 3V5LA 4ZJJA 4D4YA 4GKIA 3VUMA 1YXVA 2R3JA 2WMBA 5AP7A 2QCSA 4B6LA 1QL6A 4YLJA 5CT0A 4HVDA 4I5HA 3OC1A 4JIKA 5GZAA 5C8MA 2B4SB 4LRKA 4IIRA 3SX9A 5FDPA 2WU6A 4FSUA 4CCUA 4QP2A 1W84A 2I6LA 2JBOA 4CZTA 1UV5A 4K18A 3HRCA 3PA4A 4DLJA 1OBDA 3ATTA 3RNIA 4FKRA 3GB2A 4TNBA 3W2OA 4BCOA 2ONLC 2R3KA 1JKTA 4H3BA 2IVUA 4FTKA 4C35A 5I4NA 3VW6A 3BCEA 4PMMA 2IW8A 5HG8A 1ATPE 1V0PA 3QQHA 4O0XA 5AUUA 2ACXA 2XNGA 3I60A 3POOA 4KSQA 1VR2A 4CT2A 3W16A 4TYEA 1FBNA 1SMHA 4AG8A 2JITA 4AUAA 2W05A 5EQEA 4R8QA 4BN1A 3BGZA 4C3RA 1B6CB 3PVWA 5IUHA 2O64A 1GIJA 4Q2AA 2XIKA 4XV9A 3VRYA 5CEIA 4YTFA 1OBGA 2GCDA 3U51A 5HU9A 2VNWA 3MH0A 5GHVA 4DN5A 5IQCA 2V7OA 3ORNA 5EM7A 4FV2A 3RGFA 4K77A 3F3UA 4IX3A 2J51A 3DLZA 4MKCA 1ZWSA 3HRFA 3C13A 1FINA 3W10A 4M14A 2R3HA 4HVHA 3O96A 3BU3A 4Z7HA 2ZMCA 5FLFA 4U81A 5CEPA 1LPUA 3QZIA 2LAVA 3GU7A 5HX8A 3NYVA 3TNPC 3BGPA 3DK6A 5HTBA 2PE1A 2GQSA 2WAJA 5BYLA 3FPQA 3GCQA 2JDSA 4I22A 4E4NA 3RPSA 3QC4A 2CCIA 4FV8A 4C4IA 1PYXA 3E87A 4NIFB 3LXKA 4NU1A 3V51A 3VUKA 4E6AA 3BHUA 4JDKA 1IASA 4YSJA 3QQGA 3PXQA 4U80A 4LUEA 4MBIA 1Z5MA 4M13A 2GS6A 4IAYA 5FM3A 5HNBA 4CKJA 4QMVA 4CG8A 2VGOA 3P79A 3F82A 3W32A 3PA3A 3R01A 4E1ZA 3UMWA 1O6YA 4DTKA 4TYHB 3TDVA 5CXHA 4U3YA 3SOCA 4FEVA 2R3FA 2RG5A 3EQIA 2X2MA 3O0GA 5FUTA 4GG7A 1Q97A 1Y8YA 3BQCA 3F61A 3Q32A 4AACA 3OOMA 5IA1A 4NEUA 2XF0A 3ZEPA 3KU2A 5K5NA 3BBWA 4YUQA 1HCLA 3F66A 4ORKA 5HBEA 4OAVB 3EZVA 2BZHB 1IRKA 3P7CA 2HW6A 2J0LA 3IGOA 4RFYA 2I0HA 3R28A 4A4XA 2BZIB 4GUBA 1DI8A 5M07A 4UWBA 2ZV9A 1U5RA 2IZRA 3R7IA 2YDIA 4DINA 4O6LA 4R3CA 5IKWA 2H34A 3UQGA 4EK8A 5AV1A 3A60A 3MH1A 5JGDA 3D5UA 4FKUA 4D2TA 2EU9A 4X0MA 3D2KA 5FP5A 2DWBA 3VUDA 1DAWA 2QHNA 4AZEA 4F0FA 3UNKA 3CGOA 2G01A 4D0WA 2WZJA 3E62A 3SRVB 1E1VA 4BGQA 4II5A 3CEKA 3K54A 4HOKA 4L67A 4AZWA 1WVYA 2WMAA 3UVRA 1H8FA 3ZXTA 5TR6A 3PA5A 5DVRA 3TEIA 2A27A 2OK1A 3I5NA 3QWJA 4GU9A 3TIZA 4GT4A 2XCKA 4CD0A 3Q53A 5JH6A 2JDVA 1WMKA 2WOTA 2QO2A 3VS2A 4CV8A 3DJ6A 2PTKA 3C4ZA 3PPKA 2Y6OA 2P33A 2VO0A 4IM3A 2OIDA 4O82A 4YU2A 5BYZA 2WMRA 1KE5A 3CD8A 3E64A 2V5QA 2VWUA 2F4JA 2WTIA 5HTIA 5LOHA 3PXKA 4ZZMA 5L3AA 3UODA 1JAMA 4FMQA 2YIYA 2XNPA 3PJ3A 2YCRA 4IDVA 2W1CA 1XWSA 4AW2A 3RTPA 4YHJA 1Z57A 2J7TA 5L8LA 4BTFA 2IZUA 4DG3E 2FSOX 3ZONA 2ITYA 2XIZA 3F9NA 4YJRA 5D1JA 5G6VA 4BFMA 3ELJA 5AAEA 3KB7A 3WZEA 4RA4A 3N9XA 2OU7A 3HNGA 5HG7A 3GOKA 3OVVA 4QMSA 4GMYA 2OH0E 4OW8A 3DBDA 4LFIA 2IZTA 2YIQA 4J7BA 2YN8A 4NK9A 3U6IA 3SXFA 4I0RA 3VBVA 1TKIA 3AGLA 2BPMA 3L8PA 2X0GA 3ZYAA 2YAKA 2C5OA 4JBQA 3AMAA 4RX5A 3PWDA 2C0OA 5CU6A 2VTNA 1GZ8A 3ZM9A 1DS5A 5H2UA 4CLIA 3ZFXA 4FTLA 4L6QA 1GIHA 3R02A 4D1ZA 3NIZA 1CM8A 3QHRA 4EH7A 2B55A 3OBJA 3MY0A 1IG1A 3F3VA 3C4FA 1PKGA 5A4QA 4XG2A 2C3JA 3IW6A 4EBWA 3CQWA 2YEXA 5L2WA 3BGQA 5BVWA 4GK3A 4ZZNA 5E1EA 5CU3A 1RQQA 2X4FA 3S1HA 1JSTA 4Y8DA 4U79A 5D9HA 4BB4A 4QTAA 5BVEA 2CNUA 4CFUA 4XUFA 4DG2E 2PUUA 5IA3A 2UZTA 4KIPA 2VV9A 3IKAA 3K5VA 3LFCA 3PIXA 4FV9A 3C4WA 4G31A 4BCIA 4CFMA 3PG1A 4EUUA 2VWVA 3ALOA 3HV3A 4NKSA 3VNTA 3TUBA 2B9IA 3QQJA 4QMOA 4RC3A 4TWOA 5FQDC 5M55A 2X6DA 4XH6A 4USFA 3ZMMA 2BCJA 4DGMA 4WRSA 3ITZA 3W8QA 1XQZA 2WQOA 3GCPA 4FTCA 4X2KA 5CAPA 1ZY5A 3KC3A 4D1SA 3MESA 3QRIA 2XCHA 4DGLC 2BRNA 3VHKA 4ZJIA 4IB3A 4NM5A 3TZ7A 3P1AA 4ANBA 5IQGA 4IWQA 3L8SA 3LXPA 3QD2B 5AJQA 3U4WA 5G1XA 4G5PA 1FVVA 4QP3A 4XG4A 2R4BA 4FICA 4I21A 3MN3A 3CKXA 2LGCA 1XBAA 1A06A 4AW1A 4BCFA 2IO6A 5BQ0A 5L2QA 3VQHA 1YQJA 1VJYA 4OT5A 5A9UA 5DRDA 4MCVA 4FZAB 4UYAA 4DFBA 2QNJA 2UZLA 2R7IA 5F1ZA 4BL1A 3ODZX 5IQDA 2YDJA 4TWNA 1CKJA 4MF1A 5DBXA 4ZEGA 3NAXA 4EH4A 3FMMA 3LVPA 4FTQA 5EKNA 4QP8A 5F4NA 2JC6A 2UZVA 3QQKA 3BX5A 5AADA 5E7RA 3BU6A 4X21A 2FYSA 4TYJA 3VJNA 3U8WA 2UZWE 4FG7A 5EOLA 5J95A 4JQ8A 4A9SA 3LKMA 3JVSA 1CDKA 4GYGA 2W5AA 3FSFA 4IC7A 3GOPA 4KIQA 5A6NA 3E8NA 2IVTA 2DYLA 2W1ZA 3AC8A 4L7FA 3QX4A 3IOKA 4ACGA 4J53A 4E5AX 2VTOA 1QMZA 2R3IA 4WRGA 3BV2A 2JDTA 3DNDA 3C5IA 1YRPA 3OP5A 3NVMB 1M7NA 3OXZA 2E9UA 3CGFA 4TNDA 5BUEA 4MWIA 3K2LA 2UVZA 4FTIA 3NAYA 4BCHA 3JPVA 3EN6A 3R73A 3DNEA 4IFCA 5J79A 5M09A 2X39A 4A9UA 5IPJA 3ZUTA 1JSVA 2X8EA 3ZH8A 3F6XA 1RW8A 4TN6A 2VD5A 1U54A 1F3MC 2O65A 4YJTA 5HGIA 4FKWA 2PE2A 3MTLA 2WKMA 5EHOA 5AUWA 4RIYA 1OITA 4DT9A 3EMGA 2VTLA 2R3NA 5KNJA 2YZLA 5C1QB 4C34A 4IM0A 4ANQA 4PRJA 2I1MA 3UIBA 3HRBA 3FWQA 3O8UA 2HWOA 4OGRA 3M11A 4J97A 4XBRA 3FMNA 4EZ3A 4HW7A 1WBNA 5EYKA 4EBVA 5LVNA 5M4CA 2CMWA 4DT8A 2XKCA 1UU7A 3U6HA 1YW2A 5HG5A 4RZWA 2ZAZA 3KCFA 3G9LX 4QP9A 2GS7A 1MQ4A 5ANOA 2CGXA 4YPDA 1YDRE 3RWPA 1KV1A 4PDSA 5LVPA 5AIKA 4C58A 5I3RA 3S95A 3G9NA 4ERKA 4AW0A 5FTOA 4JRVA 2C5NA 2GNIA 3RK5A 4AT3A 4DH8A 3OWJA 4O0UA 4QMZA 1MRUA 3HDMA 4H58A 4WA9A 1Q24A 4QP6A 4CEGA 5EHYA 5B2KA 4EH8A 2UZBA 3AT4A 2DUVA 3UVQA 5HESA 4F4PA 1WFCA 5J1WA 2V55A 4ZOGA 3LFBA 3MA6A 2E9OA 3F3WA 4ACMA 3QQLA 2PU8A 4ACCA 3ZC5A 5HHWA 2W0JA 4DGOA 4PMPA 4UMTA 5EHLA 1TQPA 2UVYA 1AD5A 4QYFA 3R9DA 4OLIA 3NR9A 3UOJA 3UG2A 5IMXA 5ETIA 4QTEA 1PKDA 3DFCB 3FAAA 4FVPA 1ZLTA 3HECA 4RWKA 3SLSA 2ITTA 1R1WA 5E1SA 3DKFA 4PTCA 5EI6A 5AR2A 3PFQA 3OWLA 4O2PA 3ZSIA 1U46A 4C0TA 3WF9A 5BMSA 3OZ6A 3DXNA 3VRZA 4KABA 5AR5A 5E8XA 5LWMA 1GZKA 2XNMA 4B9DA 4NTSA 4GFOA 2VWYA 3LJ2A 2UW9A 3BBTB 5CI7A 5CF8A 1OMWA 3QCQA 4DF3A 2XM8A 2V62A 3COIA 3LQ5A 5HIBA 4J8MA 3ZO2A 2J5EA 5HZNA 3PY1A 3T3VA 1Q3WA 4GG5A 5IG1A 3EZRA 1OECA 3OBGA 2YABA 4FSTA 1JPAA 2BAJA 3R8VA 4IANA 4QTCA 4BDBA 4EH2A 1ZYCA 1BX6A 2H8HA 3A4PA 3FKLA 3KF4A 1PXPA 1M17A 3O2MA 1JSUA 5GJDA 2GU8A 3RAWA 3SG8A 3CXWA 3R7UA 2VAGA 4O27B 3FYKX 2ZM1A 2QU6A 4LV5A 5CXZA 1H1QA 3NGAA 5C8KA 4QMWA 1H26A 4Y83A 4ALVA 2YA9A 2C6TA 2OZAA 4XEYA 3FKOA 4KS8A 4IZ5A 2YIXA 4AE6A 2VTQA 2YLEA 4YR8A 3EWHA 3BYUA 2Z60A 3JXWA 1PXNA 3HV6A 5M08A 4ZTSA 3U9CA 2JKMA 3QTIA 4V05A 4IWOA 5K0KA 4K11A 4ZAUA 5J7HA 2HWPA 4O91A 5KHXA 5DN3A 4ERWA 2A0CX 3QTXA 3HMMA 2PVNA 5JRQA 1UA2A 5FEQA 5CANA 3A7FA 2CLXA 2J50A 2V22A 3PZEA 3Q4CA 2Y8OA 4TWPA 5D7AA 3R8ZA 3RZBA 2XB7A 4CTCA 4DE4A 2WGJA 5JQ8A 3QX2A 3COHA 2A19B 4DFXE 5HQ0A 1UKIA 4YZMA 4O0YA 4R5SA 4GSBA 3DJ5A 4UWYA 1V0BA 5CVFA 2PVFA 4NW5A 3HGKA 1OL7A 2B9HA 2PK9A 1K2PA 2XH5A 4ZTQA 3KKVA 3VUIA 4CZUA 4JS8A 4YZBA 2XBJA 5C9CA 4QMNA 4RIYB 2KTYA 5IA2A 2BTRA 5HX6A 2R5TA 3ZC6A 3IGGA 2DS1A 3ENMA 4LGHA 1JQHA 1KE6A 2RSVA 3NYOA 1BL7A 4CFVA 3BPRA 2GS2A 3ZBFA 2PYWA 3OWKA 3H0ZA 4IB1A 4PDPA 4E3CA 3OT8A 4MXCA 3VIDA 2GTNA 3O17A 3KXNA 3RPYA 4B8MA 4O22A 4RPVA 4RVKA 4U43A 1XO2B 3COKA 3ERKA 2GSFA 4NM3A 2HIWA 3PRIA 5BVNA 4NIFA 5FG8A 5EDRA 3KRWA 3QUEA 1WBSA 3BI6A 3G6GA 4HCUA 3TNWA 2GNHA 2IPXA 2XK6A 4RA5A 1OPLA 4FK6A 2GMXA 4FUXA 2VWXA 3QRUA 3GXLA 3VUTA 4D0XA 3N4TA 3BHVA 3LCDA 4E5WA 3R22A 2X8IA 5KKRC 2VTJA 2ITPA 3CQEA 3LPBA 2C6MA 2R0UA 4FTTA 5LVLA 3RCDA 5JGBA 4XV2A 5DT3A 2QR8A 3LMGA 2G2FA 3MFRA 2W4OA 3OS3A 2OJFE 4FSWA 4K0YA 4K2RA 3A7JA 5GZ8A 2Q0NA 3RWQA 3UP7A 4DEDA 4E6QA 2UVXA 3ZOSA 3VW8A 2RGPA 2QONA 3D5VA 4D9UA 1H1RA 4EJNA 5A4TA 3DPKA 4G9CA 3TNIA 4IAFA 4CGAA 4PL5A 4W9WA 2XYNA 1A48A 2IVVA 4RJ3A 4YJNA 3ZCLA 4I23A 5AUVA 3K3JA 1VZOA 4NH1A 5DWRA 1IAJA 2OFUA 3KRRA 4U44A 4AN2A 1PRYA 5AP5A 4W9XA 4BZNA 4YTCA 3VJOA 2QI8A 4CMOA 2ZVAA 3DBFA 3EKKA 2VUWA 5HIEA 4O96A 4FVQA 2PVJA 3ZZWA 2JAMA 4EKKA 5A4EA 4LOQA 3DXPA 4LRJA 4FVRA 4R3RA 2JFLA 3GQIA 2UW0A 4QMMA 3P4KA 3A7HA 2WO6A 4I94A 3EH9A 4YLKA 5A6OA 3UGCA 2BKZA 4M3QA 3TWJA 2JFMA 1H27A 2V0DA 4FT9A 4ANMA 4KRCA 3AG9A 3TJCA 3ZRKA 2NRYA 3LMHA 4S2ZA 3EN7A 1NA7A 4JG6A 2Z7SA 4EYMA 4MF0A 4J1RA 2XIYA 2B7AA 4L53A 1J7LA 4I4EA 2YISA 4KNBA 2ITVA 1G8SA 3Q9YA 3VBQA 3R1YA 3RZFA 2ONLA 2QOOA 4USEA 4PL3A 1X8BA 3FLNC 5FGKA 2WD1A 2XBAA 3QU0A 3TTIA 4ZY4A 5IH4A 4E73A 5M4FA 2BVAA 1XBCA 2C3LA 2W1DA 4M84A 4IH8A 4O0VA 4FK3A 3CP9A 4OTWA 3QQUA 3V8TA 3EFKA 5LVMA 2RF9A 5ITAA 1UU8A 2YM7A 2WTWA 1EH4A 3ZSHA 4QMUA 4N0SA 2VX0A 3W55A 4HZRA 2QC6A 4XG6A 4FBXA 2XYUA 4XS2A 3RKBA 4EHZA 4QP4A 1XH4A 2W1FA 1ZYSA 3ATSA 3H4JA 3LAUA 5CY3A 4Z55A 3TNQB 2VX1A 4QMYA 2VTPA 3KXXA 3NCZA 5F20A 2B9JA 3VS1A 5HNIX 1JLUE 4G5JA 2HENA 4IM2A 3ZDUA 4F6SA 4FTJA 3R9NA 2YCQA 4FG8A 4EOPA 4FV5A 4IVAA 4FIEA 3WYYA 2X8DA 2P2HA 4QYHA 1JNKA 4OBQA 5EI8A 4KA3A 4EQCA 5E9EA 4F0IA 3HZTA 3PXFA 4O7NA 2PPQA 3OT3A 2BRGA 1KUTA 4XV1A 3BELA 3RAIA 5JT2A 4PWNA 1KE8A 4XV3A 3F2NA 4ZK5A 4JX3A 4ZTLA 4AAAA 1U4DA 4Y85A 5I9WA 4DCEA 3NUUA 4FI1A 2UZUE 3VBYA 4AWIA 2P0CA 4TL0A 4IFGA 2PL0A 4MXZA 5HO7A 1FPUA 4CT1A 1LP4A 4QMXA 4DEBA 5CF5A 5I3OA 3E92A 1KE7A 2FGIA 5ETCA 4NYEA 1OPJA 2BIYA 2W06A 2XNNA 3DB6A 3H9RA 3PPJA 3SD0A 4F7SA 4I6BA 3BYSA 5CVHA 3F3TA 4EC8A 1FQ1B 3A2CA 4L43A 4C36A 1A9UA 3AD5A 3G5DA 4X3FA 4UALA 1XH7A 1CMKE 3P23A 3PIYA 5CLPA 4AW5A 5KMJA 3QCSA 2R3GA 4CVAA 2VRXA 1YHSA 3MY1A 2RG6A 5DPVA 3R8MA 4ZLOA 3VS3A 4IEBA 3ZFMA 3UYTA 1LR4A 2BR1A 3BEAA 1Q4LA 1M2RA 3AMYA 2PVRA 1PXKA 2Y9QA 4F70A 2WTJA
chains in the Genus database with same CATH superfamily
3W2SA 2X7GA 4Q9SA 2ITQA 4RVTA 4PDYA 2PMIA 3ROYA 1YXTA 2IZSA 4NFMA 1XMLA 3H0YA 2ERKA 4OTRA 2QR7A 4LDTA 3P86A 3MBLA 2WIHA 2BALA 1H4LA 2XP2A 2PSQA 3LFSA 3PXRA 4FYNA 4L3JA 3NDMA 1S9JA 2G9XA 2WMXA 4FV1A 5DR2A 4O38A 2YJSA 4V0GB 1MP8A 3Q5IA 4YLLA 1HOWA 3E7OA 4LM5A 3KXHA 5ANEA 3NUSA 3DV3A 2NRUA 3U87A 3M2WA 3UDZA 2XJ1A 3T9IA 3KMUA 3Q2MA 3UNJA 3IG7A 5KMIA 5L4QA 4C37A 4GT3A 4ZLYA 3C51A 4AOJA 2J9MA 5AA8A 3V5JA 4QDEA 3ANQA 2X0OA 5D10A 4E7WA 3QTWA 4YO6A 4GV1A 4YURA 4IB5A 5AUYA 1H01A 4PNIA 4ZMFA 5L6OA 5HVYA 1Q8YA 3HP5A 2X2KA 4QO9A 4PV0A 3DLSA 3TV4A 2F9GA 2XK3A 1QPCA 4FZFB 4LMUA 4DFNA 1H08A 3CTQA 3CSVA 2QOQA 4DFUA 2FVDA 5HOAA 4AFEA 3KQ7A 3A8WA 3QBNA 1E9HA 4CNHA 5B0XA 1YKRA 4EYJA 3FMDA 3ZM4A 4DFYA 2VTRA 2WTCA 1G3NA 3MJ2A 4EOMA 3EFLA 4FSNA 4FA2A 2F57A 4P2KA 1CTPE 1JBPE 4LRMA 4GS6A 3MPAA 4BCGA 4A4OA 3VULA 4DC2A 1Q5KA 1GNGA 4RMZA 5EOBA 3MWUA 1FGIA 4EH9A 5CSVA 3AD4A 2X9EA 5HBHA 4QNAA 3UO5A 5FM2A 4MXAA 5AR4A 4WBBB 2OO8X 2O8YA 2CPKE 2XK9A 3EYGA 4JT3A 3DK7A 3KULA 3SOAA 4F9CA 4GW8A 4PTGA 4TPTA 4P5QA 3DAJA 2XJ2A 3MSSA 4RIWB 4E93A 5IDNA 4BDAA 5L8KA 2R3PA 3QZFA 5CAVA 3NRMA 4QMQA 2ZB0A 4N6YA 3TNHA 3NX8A 4OTIA 3TUDA 3WZJA 3V3VA 3MFUA 3NW7A 4BDFA 2BAKA 3BLAA 2PMLX 3KXMA 4O7SA 3TIYA 3FXZA 2BIKB 4PPCA 4YJUA 5L6PA 3HDNA 4RJ4A 4OUCA 1ZMUA 4ASDA 4X2GA 3KF7A 2EWAA 2OG8A 4XRJA 4AU8A 5KMKA 1R0PA 3ODYX 4IWDA 2QKRA 5EG3A 4XOYA 3W33A 2YM4A 3HYHA 4C8BA 4M15A 5CI6A 5H8EA 4O7RA 3KCKA 4A07A 3LOKA 1KWPA 3R9RA 3MY5A 5HORA 1XKKA 3RCJA 1H25A 2HZNA 1BI8A 3P5KA 5EW8A 4ANOA 1H0WA 3UQCA 5J5SA 5E8WA 3AKLA 3QALE 5J9YA 4MD7E 3Q04A 2WTVA 3EQDA 4AQCA 5JZNA 4E6CA 4U5JA 3R7YA 4BICA 3LXNA 2R7BA 4XG8A 3UOKA 2HZ0A 2XKDA 3R9OA 3PZHA 4AA4A 5AP4A 5AEPA 4O6EA 2QLQA 3H10A 4UMQA 5GJGA 4BCMA 2IW6A 5CT7A 5HEZA 1VYZA 4TYIA 3VS6A 1GIIA 3VUHA 4OTDA 2ZFYA 4E20A 5LMKC 4EZ5A 2F7EE 4H1MA 4YJSA 1YDTE 4O4DA 3CJFA 1GY3A 4IVDA 2UV2A 1OL5A 4UZDA 4BWXA 2GQRA 4MH7A 2G2IA 2GHGA 4GJ2A 4PF4A 4W4VA 4CYJA 4EORA 1NT2A 4ALWA 4C4GA 3Q6WA 3WI6A 4YSMA 3FDNA 3MIYA 4FGBA 3ALNA 5JZJA 1BI7A 1OUYA 4J71A 1YHVA 5LMKA 5TE0A 2FH9A 1J7UA 3FQSA 4X3JA 5HLPA 4C33A 2ZJWA 4KBKA 5KO1A 2C1AA 3CC6A 3NMUF 1NVQA 4G3DA 5EK7A 4E6DA 3QHWA 5HBJA 5CEOA 4ENXA 1MUOA 3TCPA 5IZFA 3L8XA 4ZSJA 4QMTA 4Y5HA 5I5ZA 4O7TA 2SRCA 3LXLA 4NL0A 2R0IA 4WNMA 4YJVA 5CASA 4BDJA 4M0ZA 3ULIA 1J3HA 1F0QA 2QG7A 4YHTA 4RJ8A 5CF6A 4JBPA 2P55A 4U9AA 5FEEA 3JR1A 3D94A 3WF5A 1ZOHA 3FHIA 3VUGA 3DCVA 4BZOA 3D7TA 5DNRA 2EB2A 4U7ZA 2W9ZB 1PXJA 2ZYBA 3I79A 3OW3A 4FF8A 5EYDA 2HY81 4BDIA 4DG0E 4ASXA 2VTTA 3LCOA 5DR6A 3VS5A 2BRBA 4S32A 1P14A 2WMVA 4RFZA 3BHHA 3ZO4A 5EW3A 1PXIA 2FSMX 4HGTA 4IQ6A 5FTQA 3IDCA 4FNXA 4C4FA 2BHHA 4IHPA 1ZARA 4I92A 3PSCA 1J1BA 5IUGA 1K9AA 3FLSA 5D11A 3CE3A 5L8JA 2W1HA 4ZJVA 4L46A 2JLDA 4K1BA 3C7QA 4DITA 3AC5A 5BYYA 4X6QC 4BKYA 3Q6UA 5FDXA 3W2QA 3ML1A 3ZLXA 4P7EA 3Q9XA 3WYXA 3VS4A 5BVKA 4V04A 2WU7A 4F63A 4I6FA 3FSKA 1B39A 3GFWA 3OCBA 4KRDA 3FL5A 3IW8A 4MQ2A 3KK8A 2WQBA 4RIWA 3QLFA 3QC9A 4MAOA 4U45A 3ZO3A 5HU3A 5JK3A 2ZV2A 3CJGA 4EHVA 4EH3A 4ZP5A 3NW6A 3O23A 3QF9A 4RQVA 5AAFA 3UC4A 3VQUA 4PNKA 2HY0A 2YWPA 4CXAA 4BRXA 4ZY6A 3WZDA 2R3LA 4YJOA 4RT7A 3FBVA 4AF3A 5K0XA 3UDTA 4IX4A 4AXAA 2C3IB 4LYNA 5C4KA 5M51A 2WEIA 3DZOA 5EDQA 4YZDA 3I5ZA 2F7ZE 3G51A 4O0RA 2BZJA 5IUIA 1P4FA 4GYIA 1WBOA 2QOFA 3A61A 4QMLA 5AFVA 3KRLA 3KFAA 4O4EA 4BCJA 3R7VA 1URWA 3FV8A 2YM5A 3KEXA 3W0QA 2UW7A 4IAZA 3FKNA 4FEQA 5DMZA 5BV3A 2AC5A 5EDPA 4BZDA 3QUDA 2ITWA 2VTAA 3UIMA 3DY7A 5A46A 4KUJA 3EJ1A 3P7BA 4AGDA 2GNLA 2X81A 2YM8A 3AD6A 3GBZA 2W96B 4F64A 4G2FA 3NNXA 3QCYA 2XIXA 3H9OA 3L8VA 4AZFA 4EHEA 1M7QA 4KINA 2Y7JA 3WZUA 1R3CA 4RGJA 4DHFA 1YXXA 4G3GA 4O81A 4EK5A 3CTJA 4S30A 3LFAA 4HJOA 4PL4A 3RI1A 4XRLA 1VEBA 4D1XA 4JLCA 5CX9A 4QQCA 4AA0A 5BPYA 4AXFA 3GGFA 3PG3A 3MIAA 4RJ6A 1IA9A 2WTDA 4JNWA 3S4QA 1IAHA 4ITHA 5DEWA 4J95A 2HK5A 3FUPA 4GIIA 4H36A 4XMOA 5DE2A 5K3YA 4KKEA 2RFSA 2WMWA 3SDJA 4O7WA 2WELA 3S3IA 2ZDUA 3O8PA 3CR0A 1OM1A 4I93A 4CMUA 4O21A 3FXWA 3FZPA 5AR8A 5CU0A 3QKMA 1S9IA 2QOHA 3MVJA 1W7HA 3F5XA 3GCUA 4CCBA 2UUEA 3FI3A 3DBQA 3P7AA 2JKQA 4EI4A 3OTUA 4BIBA 2XK8A 2IN6A 2OZOA 4D5KA 3RPVA 1R78A 1PW2A 4U41A 5KZ0A 3T9TA 1YOJA 4IJPA 5AX3A 5JSMA 4R1YA 5E8TA 5ETAA 4WG4A 4PPAA 3MI9A 4G3CA 4G1WA 4JXFA 2CGWA 3FXXA 4BHNA 5AUXA 3CCNA 3RK7A 4WUNA 2XALA 5JFVA 4FKPA 4I5MA 1ZZLA 4MK0A 4RWLA 4CV9A 2XKEA 3I1AA 3IOPA 4YGAA 1FVRA 3SKCA 4ANLA 4X3FB 3FJQE 3HL7A 5M06A 2C6KA 4FNYA 4IJ9A 3DGKA 2QG5A 4FTAA 1BMKA 5CAUA 3TACA 3KMWA 4DFLA 3EFWA 5EW9A 3OG7A 4EEVA 3E8CA 5CZHA 4P4CA 1WBPA 4FKSA 4FODA 2JGZA 4BBFA 5M53A 1BUHA 4DHZA 2OBJA 3NUYA 4IDTA 1H00A 4OTQA 4AZTA 3V04A 1W2DA 3AT3A 4FTOA 4D2RA 1SM2A 4KSPA 4PY1A 4Y5QA 2NNWB 3V5TA 2HXQA 3R2BA 1M14A 2YDKA 1Y57A 5CSHA 5C27A 3RK9A 4AX8A 5M4IA 3GVUA 4FV7A 3I6WA 3S0OA 4JJRA 4RVMA 4AE9A 3N4UA 2BKKA 4G6LA 3UIXA 2C0IA 4FT0A 5CF4A 4RVLA 2FB8A 4IAIA 3LLTA 3ORMA 2RFDA 4QPAA 3RHXA 4X2JA 4B7TA 2OJIA 5BUJA 1JOWB 3OFMA 4J52A 4UZHA 4XHKB 4C3PA 5T6KA 5KMLA 2XNBA 2CHLA 2I0YA 5A4LA 2X4ZA 2BDWA 4DFZE 3PJ2A 5KE0A 4EK4A 5C26A 4N70A 5IF1A 4HZSA 2VO7A 4WSYA 4PUZA 1W83A 4IX6A 3GENA 3E7VA 4TRLA 5GJFA 1WZYA 4C38A 4CFWA 4BI1A 2O2UA 4DEGA 2P2IA 4KBAA 2A4LA 2ZB1A 2RIOA 2VTMA 3QQFA 3C4EA 2CKEA 3NWWA 1YOMA 4QYEA 4GK2A 3MDYA 3C0GA 4H39A 4HPTE 5AP6A 5HVJA 2YLFA 5HCYA 2QQ7A 4A9RA 5BUIA 5H8GA 5KCVA 3TDWA 2EVAA 2F49A 2PZRA 3R1SA 4XBUA 3Q9ZA 4ASEA 2W7XA 3R21A 4RRVA 2GHMA 5IQBA 3EQCA 4HYHA 5EH0A 5KBRA 4EQUA 1W82A 5E4HA 3K3IA 3SC1A 3DQXA 3I7CA 5CSWA 4BCPA 3CTHA 5IQHA 3AC2A 3HA8A 3KXZA 3D14A 4UXQA 1Q8UA 2ZDTA 3LCKA 4ZSGA 1YXSA 4MHAA 5K4IA 4FIIA 1ZYJA 5C01A 4OBPA 2HOGA 2J5FA 4PMTA 2BFYA 5AR3A 5BVOA 3NFGB 4YC8A 3MB6A 2O0UA 4RX9A 3UE4A 4WT6A 2OICA 3OUKA 4FUYA 3FL4A 3GC7A 3CS9A 4CMTA 4E8AA 2QD9A 3QTZA 3AKKA 4JDIA 2HYYA 4O1OA 5ANDA 4Z16A 3KK9A 1FMOE 2W4KA 3NZ0A 4H3QA 4D5HA 4LV8A 1OL2A 1DAYA 1E1XA 4YNOA 2IWIA 3BYMA 4XP3A 3OCTA 2C6DA 4F9AA 4Z7GA 2E2BA 3MVMA 4TY1A 3WILA 4XLVA 1QPDA 4F9WA 2XKFA 5IA4A 1PHKA 2FO0A 3DT1A 1PXMA 3MFTA 4RFMA 4YTIA 4UMRA 4IZAA 5IQFA 3QTQA 4O86A 1UNGA 2YHVA 2WMTA 3L9NA 5E8UA 4D2PA 1OB3A 3FZTA 3HX4A 4FSQA 4RIXA 1Y6AA 2ZV8A 1HCKA 5JEBA 2PHKA 3FZOA 3EQBA 4YBJA 2B53A 4QPMA 4RQKA 3SAYA 4EOSA 2PMNX 4TT7A 3U55A 1IA8A 2QOCA 3MH2A 1ZMVA 4DLIA 3A99A 3IW5A 3NEWA 3HV7A 5AV0A 1XHAA 4FX3A 3R0TA 4GU6A 2GDOA 4QD6A 3S2PA 3ZRLA 1TZDA 2REIA 4KIOA 1T46A 3QTUA 2JBPA 4BVUA 2UZEA 3WF8A 2PUNA 2RKUA 1YVJA 5GINE 4MNEB 4EQMA 3WZKA 4EWHA 1OGYA 2F2UA 3MH3A 4DEEA 3V5QA 5KZIA 2BUJA 4JDJA 3O8TA 5IU2A 4C59A 5LVOA 5I9ZA 3HUBA 1PYEA 2VZ6A 4D55A 3FLWA 4RX8A 2OGVA 2YJRA 4GIHA 1J91A 4QT1A 2BRHA 2WIPA 3CIKA 2OJJA 4I5CA 2JKOA 3LLAA 2XJ0A 3F5GA 4BBMA 5AP1A 1OKWA 2F7XE 4I3ZA 3H30A 4W4XA 4BCQA 2W99B 4LG4A 4RJ7A 4XG7A 1OIYA 5DT0A 3II5A 2X1NA 3LM5A 3ORKA 5HE1A 5JFSA 4EONA 3HP2A 4I5PA 2WQNA 4ZTHA 3MPMA 1H0VA 3FQEA 3ZZEA 3QWKA 3NIEA 3R1NA 3Q5ZA 3TTJA 4ZTNA 5I9XA 2WQEA 3QUPA 3T3UA 2R3RA 2PZPA 5FBNC 2XMYA 3UZRA 2VWIA 4I4FA 3HV4A 4OTPA 4DGNA 3VONA 3E63A 1URCA 1UKHA 4M67A 4FKVA 5HE3A 4F6WA 2JD5A 2JIVA 4TZRA 4E26A 3FY0A 1PXLA 1YI3A 4J96A 4QQ5A 4C3FA 4C4HA 4BIEA 4CKRA 2R3OA 4FIJA 4LQMA 3OWPA 5LARA 2ZMDA 2PVKA 3WBLA 2PZIA 4BYJA 3LFEA 4KBCA 5A54A 3GP0A 2WB8A 3DB8A 4G17A 2R64A 4HYUA 3TXOA 2I0EA 3BQRA 4ACHA 4FKGA 4QTBA 3QLGA 4CFXA 2JDOA 2CN5A 2ZOQA 2R2PA 2OF4A 2XUUA 5KMNA 1I09A 4UWCA 3RAHA 3TM0A 3A62A 2C5XA 3EN9A 3TZMA 3QL8A 4DA5A 3PE1A 4QMPA 4DAWA 3BWFA 2DQ7X 2NP8A 2UZDA 5DLSA 3RMFA 4XP0A 4XG9A 4NUSA 4FTRA 5FXQA 3E93A 4F7LA 4W4WA 2B1PA 4R5YA 4UXLA 1PJKA 4LMNA 4IZYA 4FEWA 1OL6A 3OROA 3QA8A 5D41A 4F08A 3UTOA 2AYPA 4F1OA 3PFYA 3ZHPC 1YWNA 1B38A 1KOAA 1Y91A 2FSTX 3HLLA 3PXZA 3AMBA 5J8IA 3LCSA 4FGRA 4ASZA 4ANNA 2QODA 1ZYLA 3KL8A 3MA3A 5DA3A 3TN8A 4BC6A 4RLLA 3MJ1A 1LEWA 2ZM3A 4EOKA 3BLHA 3PLSA 3R7EA 3VC4A 4Q9ZA 2PZ5A 3H9FA 3MS9A 4Q5HA 2QLUA 3CY3A 5D12A 5H8BA 2B54A 5K5XA 4L01A 4M8TA 4AN3A 4G34A 3OOGA 2OIQA 3O7LD 2Z7QA 4ZIMA 4BWKA 5E90A 2E9PA 3PUPA 1P2AA 2R3QA 4KKGA 4TXCA 4CQEA 4O4CA 5CEQA 3QKLA 3HMIA 5HVKA 1UWJA 1Y6BA 1FGKA 3BE9A 3F7ZA 3PJCA 4D58A 2QO7A 3ENHA 2BAQA 2PUIA 5FXRA 2WXVA 4AXEA 4R7BA 3TKIA 4DH1A 5CNNA 2FUMA 2YFXA 4CRSA 3O50A 2XM9A 3FI8A 2Z8CA 4A06A 3N4VA 3RM6A 4RSSA 4DDIA 2QOIA 4C7TA 3KN5A 4FKJA 4R77A 2EB3A 4HYSA 4HCTA 1ND4A 3AKJA 4GH2A 3SHEA 4TYHA 3ZBXA 1O6KA 3PE2A 5AUZA 4D2VA 4XOZA 3W0NA 3F5UA 4LGGA 1P5EA 3PVGA 5HG9A 5CZIA 3EFJA 4AFJA 5KMMA 5EM8A 4A9YA 3DDQA 5DH3A 2J0MB 3D7ZA 3EQGA 3V5PA 3BZ3A 5J9LA 2XIRA 5C4LA 3LFNA 4TYGA 3COMA 3CLYA 1OZ1A 3DK3A 4N6ZA 4U0IA 3T8OA 3OMVA 3TKUA 4EOIA 5JGAA 2IG7A 4KIKB 4YHFA 1J7IA 2X7FA 1U5QA 4JR7A 3DBCA 5T68A 1W0XC 2XS0A 3Q52A 4GFMA 5DEYA 3UOHA 3L9MA 5M56A 4V0GA 3WE4A 3EKNA 3NPCA 1PY5A 4LUDA 2RL5A 4QNYA 3GC0A 3HMNA 4A4LA 5CWZA 2YM6A 5EI2A 2P4IA 1M2QA 1Z9XA 5DT4A 3AXWA 1OGUA 4O4BB 4QQJA 5IA5A 5DYJA 5DG5A 4HGSA 5A4CA 2X7OA 4E4XA 4LOOA 5IA0A 1ZOEA 5EKOA 4H1JA 2VTSA 1YOLA 2EUFB 2XRWA 4ITJA 3E8EA 4LGDA 4R6VA 3AQVA 4NZWB 4BIDA 5CENA 3RAKA 2BTSA 3E5AA 2I0VA 4E5BA 4MNFA 1U54B 1Q62A 3DKOA 3EB0A 3GU8A 4IB0A 5K4JA 3SV0A 3C0HA 3P08A 3R6XA 4H05A 3IECA 2HAKA 5ACBC 5KUPA 2Z02A 1MQBA 2IW9A 3P0MA 4I6HA 3V8SA 3VF8A 5L2SA 3B8QA 2YACA 4AGCA 3JY9A 2O5KA 3IK3A 5AR7A 3CD3A 3NCGA 2VGPA 5JN2A 1O6LA 4EZ7A 3FZSA 1CKIA 2PY3A 3GEQA 4GCJA 4JDHA 1K3AA 3EQHA 3DA6A 5BVDA 1Q8TA 3ORZA 2X6EA 2HELA 2BZKB 3ZFYA 4DH3A 2OLCA 3EIDA 2EXEA 2YAAA 3BV3A 3OEFX 4I0TA 4I20A 2BMCA 2WTKC 2XVDA 3BIZA 4FZ7A 3QZHA 4FZDB 4BDEA 3W8LA 3LFFA 3OXIA 2GFSA 4YJPA 1NXKA 3GQLA 3ZLWA 2Z7LA 4Y95A 2BDJA 4QTDA 3IPHA 4D28A 3C4XA 3QTSA 4UY9A 1V1KA 4WNPA 1H1SA 1O9UA 1BLXA 4O7VA 4A7CA 4JI9A 1J1CA 3D0EA 2Q0BA 5F9EA 3FLZA 2FSLX 1ZY4A 3P78A 3QRTA 2W4JA 3E8DA 4ONAA 4ARKA 4AT4A 3VAPA 2GNGA 3HMPA 2UW6A 4F7NA 1OKZA 3UNZA 1APME 1R39A 3SW7A 2C1BA 4WG5A 3FMLA 3W0MA 2BFXA 2B9FA 3C9WA 4I0SA 3OTVA 4FKLA 1WBVA 2OJGA 2ITZA 2JKKA 3ET7A 4XP2A 3UO4A 4OBOA 4HNIA 1RDQE 4FV6A 4C02A 1STCE 2C6LA 3MVLA 3MV5A 4KAOA 3VF9A 2YCFA 4RC2A 5AV4A 2C6OA 3O71A 3TZ9A 1UNLA 3A4OX 1T45A 2OI4X 2RFNA 4JQ7A 2JIIA 5L6WL 2QU5A 2QOKA 3TL8A 3FZ1A 3OHTA 3KRXA 4ID7A 3NYNA 4O0WA 4IVBA 5EYCA 2Y4IC 3ZXZA 2UW3A 3LMIA 5I0BA 3PYYA 3JS2A 2B52A 3G90X 4M12A 4YPSA 3W0PA 2BRMA 4S33A 4F1MA 4BCKA 1PMEA 2WMQA 4EK6A 5LMAA 1F5QA 3LQ3A 5TOZA 3VS0A 2HCKA 1CKPA 2UZOA 4RBLA 4CKIA 3JY0A 4F0GA 4K9YA 3UJGA 1CSNA 4M66A 1YWRA 4HPUE 3FMJA 4YZ9A 5CU4A 3FZRA 1R0EA 2XZSA 1YWVA 4PP9A 3ZLYA 4R3PA 3NYXA 4AA5A 5EQYA 3LJ0A 4L00A 4GK4A 4CFNA 5IQIA 2C0TA 3NUNA 1FOTA 2OWBA 3R7GA 3CPBA 4BR3A 3MYGA 4D2WA 1Q3DA 3KREA 4G3FA 4IAAA 2XNOA 4IC8A 5DRBA 5HCZA 5HI2A 4L8MA 4EKLA 3B2WA 4J8NA 5LQFA 2YERA 3C0IA 4FTMA 1UWHA 4WBOA 2OZAB 3L9LA 1ERKA 2XK4A 3QD4A 3NLBA 5FWKK 5J1VA 5BX0A 3HAVA 2PVMA 2QVSE 2G2HA 4PMSA 2NYAA 2CKOA 3Q4UA 5DIAA 4EJ7A 4IVCA 4RIXB 4BDCA 2GNFA 2Y4PA 4NT4A 3UPZA 3G6HA 3JUHA 1OPKA 3VWAA 4O7ZA 5FXSA 4R1VA 3ID6C 2VWBA 3HEGA 5ANGA 5HNGA 4JR3A 3ZUVA 1Q99A 2PZYA 4DH7A 3D15A 2GPHA 2H9VA 4CG9A 4IX5A 1YI4A 4FR4A 1WBTA 3QGWA 2W1EA 3G15A 4GEOA 4M69B 1YDSE 2BROA 4ZS0A 2VWWA 5IISA 3SA0A 4TW9A 2QO9A 2OW3A 3OD6X 4GFGA 5CAOA 3TV6A 4F78A 3FI2A 2VU3A 4L3LA 3EQPA 5DFPA 3PRFA 3AC4A 3I0QA 3OW4A 3D5WA 5E8SA 4O84A 2UW4A 3TT0A 4MTAA 3RP9A 3R8UA 3BYOA 3KVWA 4RWIA 3KIOC 4NKAA 1WAKA 3O51A 1YI6A 3FC2A 4BDKA 4BDGA 3H3CA 2PVLA 5FP6A 5B7VA 3BE2A 1GJOA 3DAKA 3IW4A 4MYGA 1LEZA 4QP7A 5LJJA 2KULA 1GZNA 3UYSA 4ZSAA 2R9SA 4G6OA 1JKSA 4AGUA 3L9PA 1TVOA 4JX7A 4L68A 3ZEWA 4C61A 3C5UA 1Q41A 3RPRA 1OUKA 5HE2A 2VWZA 4MBJA 3UIUA 5ANKA 4O83A 3QTRA 4ALUA 3C4CA 2NPQA 2YCSA 4XYFA 3RINA 3ORLA 4APPA 4S34A 4NW6A 3ZTXA 3QYWA 3BKBA 3OEZA 3EN4A 3MGYA 3ORIA 3DTCA 4JAJA 2WMUA 4JG7A 3DXQA 4NJDA 5AV2A 3SXRA 4ITIA 3F3ZA 5FRIA 5EM6A 4WO5A 4H3PA 5HO6A 1W2CA 4BWPA 2BHEA 4FV4A 3I81A 4WKQA 5FTGA 3D9VA 2HW7A 1OL1A 3FMKA 4HCVA 4AZSA 4B99A 3G33A 4IXPA 2JAVA 3QXPA 5IQEA 3RJCA 3ORPA 2GTMA 2HXLA 3E3PA 4YZNA 3UOLA 4B0GA 3Q4ZA 4FKQA 4OTHA 5M57A 1Q8ZA 5CAQA 3WOWA 5E91A 4DBXA 4MX9A 3QRKA 2ITNA 4IZ7A 5B2LA 4EK3A 2ITOA 1WCCA 3UVPA 3PVBA 3Q60A 3QAME 4FL1A 4NM0A 3JYAA 3FQHA 1UU3A 2C3KA 3VBXA 4YMJA 2V7AA 2IVSA 3B2TA 3FHRA 3POZA 4K6ZA 4KKHA 3LFQA 4MQ1A 5FD2A 3UBDA 3V8WA 3MB7A 2NO3A 3GU5A 3PVUA 5IEYA 2C6EA 4UX9A 3GCVA 2Y6MA 5AMNA 4QDVA 3M42A 2PMOX 3NNUA 4JRNA 4FSMA 4D4VA 4NM7A 3IW7A 4UV0A 5M44A 4D4RA 5CSPA 2CN8A 5CTPA 4EH6A 2B0QA 2WNTA 3W2CA 4GT5A 4G16A 3M1SA 2H96A 3HUCA 3DDPA 3HAMA 2GQGA 4DH5A 3FEGA 3FC1X 4PTEA 2CGUA 2C30A 4O2ZA 5KX8A 5JQ5A 1BYGA 1YHWA 2VTHA 3UG1A 5J9ZA 3KULB 3F88A 3WARA 2IEWA 5C8NA 5CSXA 1JVPP 4PDOA 4CQGA 2PUPA 4EL9A 3RALA 4OAUC 4FE2A 5DOSA 2J4ZA 3ACKA 4ZY5A 3UZTA 3F7WA 4XNEA 3ANRA 3UZPA 3Q2JA 3SXSA 3D83A 3PXYA 3DTWA 1QPJA 5AIRA 4DYMA 4AAYA 3BLRA 2J0IA 4G6NA 4M68A 3EQRA 3U4UA 2PULA 3LZBA 2Q83A 4RX7A 4FSRA 1ZXEA 3IONA 4KB8A 4U42A 2VN9A 3UPXA 4C62A 3QZGA 2OKRA 2CNVA 4L44A 3UP2A 4XLIA 3TJDA 1H1WA 3G0EA 3AC3A 3W2RA 3BLQA 2CGVA 3NNVA 4PQNA 4QRCA 4N4SA 3ZS5A 4BYIA 4F9BA 3U9NA 5CQWA 4BKJA 3P5JC 4FJVA 4MD8E 2QURA 2WTKB 4UMPA 4KWPA 1OKVA 4S31A 4F7JA 3FY2A 1SVHA 5JMSA 4QYGA 5ANIA 3FPMA 2GFCA 5IH5A 4AOTA 3R04A 5EFQA 3EYHA 4FKTA 1NVRA 1YXUA 4R78A 4O1PA 3CY2A 3BWJA 2HZIA 4UBAA 4DEHA 4U40A 3V6SA 3ORTA 1W98A 3AT2A 3LM0A 4YNEA 3ROCA 4FNZA 4FSYA 3PJ1A 3ACJA 4ZSLA 1FVTA 5ICPA 1GAGA 4JBVA 2UW5A 3TZ8A 4UN0C 4IADA 2VO3A 1Q61A 3R00A 3GCSA 2CLQA 4BI2A 4FL3A 2C47A 5CALA 3AC1A 3FYJX 3PSBA 4NJ3A 4GKHA 2CCHA 5ANJA 4CRLA 2CSNA 2IF8A 3G2FA 4BTJA 1XH9A 4BDDA 2O63A 2E9NA 4F09A 4FIGA 3GUBA 2YITA 1PMVA 2ESMA 3KMMA 2C6IA 4AOIA 3AGMA 3WE8A 3LHJA 4HVGA 1JKKA 4BGGA 2OXXA 4C2WA 3EOCA 1SVEA 3CPCA 5C03A 4EC9A 1WVWA 3HVCA 3TG1A 4RC4A 3GC9A 5E92A 3F2AA 4F6UA 4YO4A 5D7VA 4BBEA 2UW8A 4MBLA 3F69A 3VHEA 4CTBA 4MXOA 4ZXTA 4JQEA 1P4OA 2UZNA 1ZOGA 3Q4TA 4FIHA 5E8ZA 4YBKA 4A9TA 2W5BA 3W18A 3QGYA 4MD9E 3TV7A 3QFVA 2OIBA 2XEZA 1REKA 3R1QA 4K33A 2J0JA 3K5UA 4M0YA 4LL5A 3OCGA 4RG0A 4TWCA 3A7IA 2A98A 3R30A 3REPA