3QGWA

Crystal structure of itk kinase bound to an inhibitor
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
261
structure length
244
Chain Sequence
IDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIKEGSMSEDDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Discovery and structure-activity relationship of 3-aminopyrid-2-ones as potent and selective interleukin-2 inducible T-cell kinase (Itk) inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 244
sequence length 261
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3qgwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3qgwA01
2RIOA 3MPAA 4USDA 4MXCA 3R7EA 3P86A 1OKZA 3UVRA 3WZDA 2XMYA 2V55A 3I6UA 5JFVA 3QD2B 5JSMA 3NUAA 3OWKA 2PUUA 3RALA 1FGKA 3GU7A 3FSKA 3KRLA 4J95A 4QMWA 3V6SA 4D1SA 2WMXA 5BX0A 3DK6A 5K9IA 1W0XC 3ZFXA 3HAVA 1OL5A 2REIA 5IUIA 3EQDA 3UZTA 3KULB 1OL2A 3BYSA 4HCTA 3AC3A 3OP5A 1JKLA 4FV9A 2ZM1A 4HCUA 4RIOA 3ZYAA 5CF5A 2VTTA 2O2UA 5J7HA 4TNBA 4B6LA 4CYIA 4FTMA 3BU5A 4DH3A 1MRUA 2YM4A 2WPAA 4WBBB 1F5QA 3QX4A 5KMIA 4GG5A 4PMMA 4C37A 5D7VA 3E64A 3NEWA 3GGFA 3E3PA 3GOKA 3H3CA 3UJGA 3VS4A 2BKKA 3L8PA 2R3LA 5DPVA 2PE1A 1Q62A 2JIIA 3EYGA 3K3IA 3W10A 4R3RA 1XR1A 3MN3A 1XJDA 5CENA 4NM5A 3TNWA 3EHAA 5IA5A 3LIJA 1QMZA 4QTDA 4IIRA 3ORLA 1CM8A 1QCFA 4ZTRA 5M55A 3FQSA 3R8UA 3ACJA 2PULA 1PMUA 2BDJA 1AD5A 1V0OA 2DS1A 4FV8A 4X2JA 4XG7A 4ANMA 4APPA 3R7OA 2X7FA 2VWWA 2V7OA 1PRYA 2RF9A 3GENA 3TIZA 2ZV9A 4JVGA 2ZV2A 3RNYA 3HLLA 3JY9A 3FMKA 4BWXA 3KMMA 5I9UA 1SNUA 3GQIA 5CAQA 1BKXA 4ACMA 4NIFA 3BGPA 4ANNA 5E9EA 2WO6A 4WD5A 2YZAA 3VQHA 4BYIA 4EH2A 1E1VA 2QU5A 3DB8A 4AGCA 2G2HA 2WQMA 2ITPA 4C2WA 3UO4A 2XJ2A 5I3OA 3TI1A 5IDPA 1M52A 2EWAA 3THBA 3HEGA 2VRXA 1H1RA 5C9CA 5FXRA 4I6QA 3ZEWA 5LMAA 1JKKA 3ZH8A 4TN6A 3TWJA 2BZHB 2BUJA 3Q9XA 3MIYA 3LFCA 3F3TA 4WG5A 4BIDA 2X9EA 2I6LA 4JG6A 5I9YA 3OTVA 3CXWA 2G2IA 4YTCA 2C5NA 2EXCX 4FIEA 3WOWA 3HX4A 4MCVA 2XCHA 2XNOA 3DAJA 1E1XA 3FMDA 4XS2A 3VHEA 5F4NA 2JC6A 4GIIA 3ZO2A 1SYKA 4NKSA 3ANRA 5M53A 4C4IA 4GT3A 1ZXEA 3Q6UA 4Z9LA 3KXXA 4LRJA 4QTAA 3S00A 2OFVA 4HNFA 4HYIA 1NA7A 2W96B 2VTAA 2O65A 1JNKA 2FSLX 3Q4ZA 3VHKA 4YJUA 3ZMMA 1TKIA 4AX8A 4F70A 4QYEA 5F9EA 3EKNA 4TYGA 4DGOA 2E9PA 4O7ZA 3W32A 3PYYA 4F4PA 4P5ZA 3H4JA 2WTJA 4I41A 2ITUA 3LCDA 2YIXA 3F5UA 4LI5A 2QI8A 3IGOA 1SZMA 4LMUA 1F3MC 2Y7JA 3FQEA 4MXOA 3MA6A 4X3FC 5TF9A 4UYAA 3ZO4A 4PL4A 3EL8A 2QG7A 1OKVA 4PWNA 4P5QA 4BZOA 5JFWA 4I93A 3AOXA 4ZTHA 1K2PA 2YM8A 4JXFA 4ZK5A 3BELA 3CD8A 3FI4A 5FM3A 4NIFB 1YQJA 2R3HA 4FVQA 4ASZA 5EQYA 3GXLA 4RMZA 1SVEA 2NP8A 4G16A 4AE6A 3DBFA 4RZVA 4M69B 3SG8A 5I5ZA 3R1QA 5LMKA 1MQ4A 3AMBA 3OOMA 2BHHA 4FSMA 4UMTA 3UOHA 3IO7A 3MY1A 4BCHA 1YXTA 4IWPA 3OFMA 4M0ZA 4RC4A 3DZQA 1ZRZA 4EK4A 1S9JA 3TIYA 3ZFYA 3UPZA 3Q4CA 2FYSA 3EN4A 2B9FA 3UG1A 5M51A 3KRWA 3O8PA 4KABA 5IQFA 4AFEA 3FZSA 4A9RA 5LWMA 5JKGA 3QBNA 4KKHA 3TZ9A 3BHVA 3OW4A 4FOCA 2IVUA 3H9FA 3L8XA 3KB7A 1OPJA 3KC3A 3R21A 4CQEA 3QZFA 1ZAOA 3O8TA 3CS9A 3RM7A 4NUSA 4H3PA 5E8SA 5HX6A 1HCKA 3F69A 4PV0A 4QMYA 1BYGA 4XOYA 3QKMA 5LXMA 1P14A 2C3IB 4C2VA 3TDVA 1K9AA 3T9IA 4Y46A 2PWLA 2VX3A 4CKJA 3A8XA 1Y8GA 4HZRA 4JDKA 2P33A 5EOLA 4YJOA 1Q41A 4JR3A 2W7XA 4CKIA 4FV7A 3QQHA 2B7AA 2C47A 2JIUA 4XBRA 3N4VA 2QC6A 3I7BA 1WBVA 4EORA 3UGCA 5KO1A 3BU6A 1WVWA 3OXTA 4WUNA 4TL0A 2PUNA 4O7VA 5BVOA 4XOZA 3E88A 5G6VA 1PYEA 4G1WA 1PXKA 3HV3A 4P7EA 4XJ0A 2CCIA 2OW3A 3ZXTA 3K2LA 2FO0A 4R1YA 4U40A 5AAFA 3OY3A 2W9FB 4AZWA 3SOCA 2J51A 2UW4A 3C13A 3SC1A 3VUDA 1O9UA 2BR1A 3POOA 5C8MA 3FC2A 3F5XA 5FLFA 3RGFA 3V6RA 3CD3A 4CD0A 3U8WA 5AAGA 1IG1A 1QPEA 2RG5A 2WD1A 5E8VA 4O83A 3P7AA 4KKGA 5E92A 5J8IA 4L67A 4C8BA 4L3JA 3NPCA 4IX4A 4QMOA 2W4KA 2BRNA 4FKJA 4TYJA 4AT4A 1OVEA 1H1PA 2RL5A 4CMOA 4YJVA 1JQHA 4FTOA 3W2QA 2J0JA 3PJ8A 4K8AA 2VZ6A 4QQCA 1R39A 1M7NA 4KBAA 4NM0A 4AA5A 5BUIA 5EYDA 4UWCA 2O3PA 3BWJA 3DJ6A 4E5AX 1S9IA 1XH6A 4YJPA 4JQEA 3RPVA 3PE1A 3TV6A 3HMIA 4D2VA 2BZKB 4O2ZA 5HNGA 3RZBA 2A2AA 2QURA 3NIZA 3DKOA 4M8TA 2UVYA 2X2KA 4JAIA 4I5PA 1UNHA 4XP3A 2EU9A 3CGFA 5C27A 5AA8A 4D2WA 4W9XA 4ZP5A 5AUVA 5KZ0A 2I1MA 3FMMA 3RBWA 1JSVA 1UA2A 3VJOA 3UQFA 4EK5A 5LOHA 3C0GA 2CKEA 4BKJA 4FKIA 4C59A 2X0GA 1P4OA 3RPOA 2WTIA 3DDQA 3BYOA 5HCXA 2PMNX 4YTIA 4I6HA 1H0WA 4ZEGA 3OCBA 4NKAA 3Q6WA 3KVXA 4F65A 4CEGA 4GMYA 5BUEA 5L6PA 4G5PA 5DN3A 1LPUA 4G3EA 4JIAA 2UZEA 1FMOE 5CAOA 3ID6C 2YDIA 4XV1A 2UZBA 1JWHA 1Q61A 1U54A 4N57A 2XEZA 3IW5A 2X8IA 2B54A 2C69A 1DS5A 3QTWA 1RJBA 3D15A 3HVCA 4L52A 1PXOA 4WBOA 3BCEA 3VJNA 4NJDA 5ANDA 3OEFX 1GNGA 4U7ZA 3OBJA 3VS0A 4JBVA 2GS2A 3JVSA 2I7QA 2JDTA 4D58A 2WTVA 4I6BA 4M66A 2OICA 4E6AA 5JQ5A 2UZDA 1QPCA 2YJRA 2W05A 2XKDA 2HXLA 1OKWA 5L6WL 5KMLA 2ZDTA 1G8AA 3V3VA 4TWOA 1IEPA 1KUTA 4LGHA 4ZY5A 2C0TA 2QOLA 2X4FA 3WF5A 4JIKA 2YERA 4D0XA 3VBTA 4GRBA 2V62A 5I9WA 1STCE 4JBOA 3I81A 1URWA 4AAAA 1M2RA 5JT2A 2GU8A 4KSPA 4ZZNA 3PXFA 5HO6A 3D5WA 3KGAA 1W83A 5CU2A 4GH2A 2X6EA 5FUTA 3LXPA 4EK8A 3QRUA 2YIQA 2ITVA 4EHGA 1H27A 4YP8A 3AT2A 2YA9A 3FUPA 2OIDA 4K9YA 2VTOA 2XNEA 3BHTA 3ZUTA 3E63A 4BCNA 4O0UA 4AZSA 5E8YA 5A3XA 3TUCA 2HK5A 2OIQA 4YC8A 3IDPA 3CC6A 4QMTA 5HD4A 4FV0A 4ALVA 5JRQA 4C4FA 2O63A 3FL4A 1MUOA 4YJTA 4G34A 2W1HA 1IA8A 4U9AA 3LFBA 4YNOA 5LVLA 1Y57A 4OAVB 4YGAA 1B6CB 4FA2A 5IZFA 5C4LA 4EKKA 5EW8A 4YBJA 2ERZE 3FZPA 3I1AA 4M3QA 4O2PA 4CFNA 4GV1A 2IPXA 5HO8A 3SG9A 3JXWA 4QP9A 4TWCA 2W4JA 1IR3A 1R1WA 2FGIA 2G01A 1R78A 3FZOA 4DGNA 2ESMA 5DOSA 4KWPA 1KE7A 1U54B 4WOVA 2YLEA 4O7SA 2PHKA 3VF9A 2OFUA 1PMVA 2ZM3A 3NUSA 4QPMA 3RWQA 1RDQE 2X9FA 4PTCA 3FKNA 2Z7RA 3TJDA 3NYNA 4UBAA 4A9TA 3VNTA 5AV1A 3QRIA 5IMEA 3QC9A 4MXZA 3W16A 2ZOQA 3SDJA 4E3CA 3AGLA 4GT4A 3GU5A 5ANGA 2XK9A 4MWIA 1FMKA 3OWPA 2OI4X 3R7VA 4OLIA 5J95A 4PDOA 4CFVA 2VWIA 3BYUA 4X2GA 3ZUUA 2CNQA 5FTGA 3WE8A 3PWYA 5HG5A 4DTBA 5J5TA 1E9HA 2YCFA 5BVWA 3U6IA 2Q0NA 5GIPE 4YZDA 3GCQA 2CKPA 3HDNA 5HORA 3PJCA 3HGKA 2JKQA 3FBVA 3R02A 3DNEA 1QPDA 2X2LA 2ZVAA 3KXHA 4E5BA 4E93A 1UU9A 4GU9A 5L2SA 3U4UA 3RI1A 3H9RA 5EI2A 5CVGA 4YJQA 3HP2A 2BRMA 3OCGA 4XYFA 3GCPA 4PP9A 1VYZA 3H9OA 4C36A 2WMSA 3K5UA 3KQ7A 3SHEA 3W33A 2XCKA 2OZAB 4TYHA 3G6HA 3O50A 3ALOA 3MYGA 4C57A 3VS2A 3BV3A 3DAKA 2VTMA 2X6DA 5HIBA 4PPBA 4N6YA 3CLYA 1DM2A 2CHLA 4O22A 4G31A 3VW6A 1BMKA 2ITWA 4BCQA 4E4NA 3KN6A 4KIQA 3PTGA 3E7OA 5DEYA 3HKOA 3MVLA 3PJ1A 2ZB0A 5EM8A 4EHVA 4GEOA 4HW7A 3I5ZA 3R1SA 5E91A 5H3QA 1Q3DA 3WZEA 2ETKA 3R7YA 4F9YA 4FGRA 5E7RA 1SMHA 4G9CA 3IW8A 5LMKC 4MNEB 4NK9A 1MP8A 4XUFA 2XBAA 5D7AA 1MRVA 2PVHA 3D5XA 3DPKA 3IKAA 4JX7A 4Z7HA 2GFCA 3TT0A 3PPKA 3IDCA 1URCA 3O96A 3O17A 4LOPA 1OL6A 4D5HA 2FA2A 2GMXA 3EN9A 4EH9A 4BI0A 1JSTA 1OGUA 3L9MA 4YNEA 4PX6A 2IVVA 3ATTA 2Q0BA 4FKSA 4K77A 2X8DA 4DFLA 4C3FA 4QP1A 1UVRA 3HV4A 4C4HA 2UZWE 2P0CA 1XH7A 2XYUA 4TWNA 2VTIA 4XV3A 3I7CA 4ANLA 3U6JA 5CEKA 2QD9A 3UMXA 2W1DA 2XNGA 4L44A 5E8UA 2CLXA 5HLPA 4RFYA 3R8VA 3R83A 4F1TA 1J1BA 2KULA 4FYNA 3ZSHA 3GFEA 3PUPA 4FV3A 4ASDA 4FTAA 4S30A 3V51A 4JBPA 2UW6A 4MEDA 3IS5A 5ETFA 4AG8A 5HNIX 3FAAA 2XNPA 4IX6A 4C3PA 1JSUA 3SGCA 4ZTQA 3OY1A 3PJ2A 3CR0A 4RGJA 1H08A 2OJFE 3TZ7A 4DEDA 5CEPA 2R3QA 3F2NA 4LV8A 4EZ5A 3Q9WA 2JITA 3E62A 2B52A 3NRMA 5DRBA 3U4WA 5HBEA 4G3CA 4FKWA 4XG2A 4AOJA 4Y5QA 4LFIA 3W2PA 1Q8TA 4FSUA 3SAYA 2RFNA 3ELJA 3VUHA 4D2TA 4I23A 5HO7A 4W4VA 2F57A 2J5FA 3DAEA 4GG7A 5CXZA 3FPQA 4YZMA 1IRKA 4L00A 1SNXA 3N51A 4C0TA 5JFSA 3C5IA 4E5WA 3OBGA 3UZRA 2X8EA 1CDKA 3MGYA 3LFEA 4NTSA 3V01A 3ZCLA 4Z7GA 4FGBA 5CF8A 1JKTA 4GYGA 2YIYA 3UQCA 3MB6A 3MVMA 2OJGA 4TRLA 1YDSE 1G8SA 3DKCA 4RJ7A 3OEZA 1W84A 3H30A 3MESA 1TQIA 3DKGA 2XP2A 3ALNA 2G1TA 4FUYA 2VWXA 4L53A 1YWRA 4FIHA 1QL6A 4BIEA 2XS0A 3OD6X 5D9HA 4GFMA 3P23A 4GU6A 4DHFA 4DH8A 4YTFA 3AQVA 3CKXA 1J7IA 2O0UA 3MJ1A 3QZHA 5ANEA 4ENYA 5ANKA 5HVKA 4Q5EA 2H6DA 5EDPA 1FINA 2HW7A 2XZSA 5CXHA 1OBGA 1ZOEA 3VC4A 5I3RA 3E8EA 4CQGA 4JDJA 5AP6A 2A0CX 4FVPA 1L3RE 3SW7A 5AAEA 4ONAA 3LXKA 5AJQA 4C4EA 1Q5KA 5CF4A 4EHEA 5KZIA 3B8QA 4YZCA 3LCOA 5IA0A 1NY3A 2VD5A 4DFXE 1UNGA 4KIOA 2VWZA 2GS7A 3TUDA 3QCYA 3MH1A 3VULA 3EN7A 2EVAA 2B9JA 2GTMA 2P3GX 5HLNA 3DLZA 5AR2A 5LVOA 3COKA 5CWZA 1TQPA 2XK6A 3LQ5A 4JQ8A 3UNKA 4OTDA 4EH8A 4GL9A 5CS6A 2PPQA 2OF4A 4ACCA 4AXAA 4I94A 3BKBA 2JKOA 4R8QA 3ZEPA 2QHNA 2WAJA 4BDBA 3K54A 4PMTA 4IFGA 3JR1A 3SD0A 3TUBA 4YZBA 4PTGA 5C03A 2XIZA 3ZOSA 4DH7A 5K0XA 2ZAZA 3BEGA 5L2IA 3ET7A 3OXZA 5CAUA 1FVTA 3K3JA 4FZFB 4G3GA 3MVJA 3WILA 4FVRA 1PF8A 2C68A 4AGUA 4H3QA 4IVBA 4ZLOA 2XK8A 2Y9QA 4MX9A 5LQFA 2JLDA 3CGOA 3PZEA 3TNHA 4BTFA 3RJCA 2IW6A 1ZYDA 5ETCA 4JS8A 4QP6A 3QLGA 2XRWA 3T8OA 5GZAA 4D5KA 3TNIA 5JGBA 4LOOA 3LLTA 2GCDA 2IZTA 2OXXA 4KBKA 3R6XA 2ITNA 4IACA 3ZC5A 4FKOA 5A4TA 3KMWA 4RWKA 3R7GA 3CEKA 5HD7A 5CEIA 2RGPA 3UIBA 5KHWA 1ND4A 5CU6A 4O7TA 3GB2A 3MA3A 3D94A 5J1WA 5DGZA 2VTHA 3NZ0A 5DH3A 3FZRA 2HWOA 2X7OA 2R3JA 4YHJA 1WZYA 4FKUA 4WA9A 4EC9A 2R3KA 2ETMA 3QTQA 2XNBA 3GU4A 3G6GA 4KAOA 4QTBA 4RFMA 3TNPC 3KN5A 3A8WA 2VU3A 4GVJA 5ANIA 2QO7A 3S4QA 4YJSA 4M14A 3FPMA 2J90A 5A54A 1OKYA 3UBDA 2Z7QA 5GZ9A 1PYXA 2IG7A 4NZWB 2NNWB 3EFWA 4FX3A 3WI6A 3A4OX 4I0SA 5AP1A 5JGDA 3BPRA 5JMSA 5HTCA 2R3PA 1ZMWA 4FUXA 2PUIA 3E87A 3MIAA 3FMLA 4IM2A 4DH5A 4H1JA 1YI6A 2BTSA 2VO7A 4J1RA 2PMOX 5M4IA 2CCHA 2IN6A 4HJOA 4IB3A 3JUHA 4YJNA 3IW6A 3SQQA 3NYVA 5EM6A 3WZUA 2YABA 4BKYA 4RVKA 1LP4A 3AT3A 2W1ZA 3V8WA 3N4TA 3BLQA 1XBBA 2WMAA 4Y5HA 4M0YA 2OJ9A 3VUMA 3ZUVA 2YCSA 3II5A 5BVFA 4UZHA 3G51A 4X6QC 3POZA 3QD0A 4AA0A 4GK3A 3QD4A 3RCDA 4FT7A 5AV3A 3LXLA 4DN5A 5DIAA 4E1ZA 3F3ZA 2BCJA 2BHEA 4IAZA 4O7RA 4ZZMA 3HRBA 2WU6A 4NJ3A 4CCUA 4LL5A 3G2FA 3PSCA 3ZRMA 3FJQE 3R28A 4P4CA 2XK7A 2PVFA 4O7LA 3D7TA 4GVAA 4PDSA 2J0MB 2HWPA 3D2IA 4MQ1A 5D12A 1WMKA 5AUXA 4Y95A 4QO9A 4QYFA 1ZARA 4BGHA 4FV4A 4WG3A 4CMTA 3MH0A 4IVCA 3NWWA 4FTKA 5H8BA 2DQ7X 3BRBA 5AP0A 4XG4A 4WG4A 3PDTA 2X39A 4GT5A 3ZBXA 3GU8A 1B38A 5JN2A 5AP3A 3Q5IA 2BROA 5DE2A 3COIA 4RX5A 3HA8A 4DEAA 2BRGA 4F7NA 2W5BA 2X81A 1FPUA 3ZM4A 3ZRLA 4E4XA 2HZNA 2VGPA 2WFYA 4CV9A 5KHXA 4I24A 4RLLA 4I0RA 2Y4IB 3DV3A 4M69A 4EYJA 5HQ0A 3HAMA 2HY81 1BUHA 4E6DA 1R0EA 2P2IA 4GW8A 4OGRA 5B7VA 4LMNA 2ZB1A 5HG7A 4QP7A 4WO5A 3FYJX 4F1OA 3RNIA 2BRBA 4FIGA 2OIBA 4FT3A 2QOCA 3NLBA 1SM2A 2A1AB 2EB2A 4G3FA 4JR7A 3MVHA 4BKZA 4RQKA 5BNJA 3G15A 4EKLA 4IX5A 3FI2A 5CLPA 1DI9A 4IWOA 5EW3A 4IE9A 3NCZA 4YLJA 4CFXA 4CNHA 4U81A 1JAMA 4L7SA 5BYZA 4BB4A 1MQBA 4BDIA 2WZJA 2XVDA 2F2UA 3MTFA 3Q2JA 4XNEA 3EQRA 3M1SA 4UYNA 2VWUA 3TZ8A 1UKHA 4EUTA 3R9OA 3WZKA 2Y0AA 3TKIA 3DBDA 5AP2A 3W55A 4PQNA 4IWQA 1Q99A 3R7UA 3SOAA 4O96A 4X21A 4Z16A 3D7ZA 3PSBA 3KREA 4E6QA 2WMWA 1R3CA 4FTIA 4NSTA 4O21A 3LMHA 1L8TA 4HYHA 1I44A 3MFTA 1U59A 4YU2A 3HYHA 4K1BA 5KBRA 4O81A 5LCKA 3HMPA 4WRGA 3R8PA 3NAXA 4E4LA 5L4QA 2VTQA 2ZJWA 4D55A 3D7TB 4YSMA 3NW7A 3F7ZA 2XF0A 4GKIA 4IANA 3W1FA 5HZNA 1OECA 4EK6A 4CG9A 3P79A 1Q8ZA 4OBQA 4I1ZA 2F2CB 2R7BA 2W1CA 5AR8A 3QYZA 2XNNA 4MTAA 3FHIA 3R2YA 3Q53A 3C4EA 4PL3A 2R9SA 4S2ZA 4ACDA 5M08A 1W7HA 4ALUA 5ETIA 2WTKB 1Q8WA 5FEQA 3OUNB 4QYHA 1TVOA 4I4EA 4XH6A 3V8SA 4W4WA 1XWSA 1XH4A 4A4LA 4DEIA 5CEOA 3F61A 5J5SA 4MD7E 5ITAA 3QQGA 3WYYA 4FIIA 4ASEA 3H10A 5CASA 5GNKA 3TZMA 4R5YA 2YDJA 5HE0A 4U43A 3QCXA 5CQUA 4BI1A 3R30A 4D2RA 4O82A 2QG5A 4S34A 2C1BA 2YIWA 2B0QA 2VNWA 4DITA 2QCSA 2CN8A 1RQQA 2JAMA 4GYIA 4QT1A 3UOLA 4PP7A 5A4QA 3CSVA 2UVXA 4GK2A 4IB0A 4L3LA 4ZTNA 5FP6A 4BIBA 4HGLA 3ODZX 5HU9A 5EM7A 3VUIA 3KVWA 4HVIA 4C4JA 2VWVA 3QD3A 2ETRA 3MSSA 4LRMA 4IZYA 4ZSEA 4Q9ZA 3NNWA 5C4KA 2PSQA 4UZDA 3C4XA 2QLQA 4FNYA 5IKWA 1H8FA 4BICA 1OZ1A 1GZOA 2R4BA 3C0HA 3OT3A 4YBKA 5TOZA 3BWFA 3L9LA 3BIZA 2YWVA 1UU8A 2R2PA 2GQGA 3QF9A 5LARA 4AZFA 2GFSA 4L8MA 5HBJA 5AMNA 5FRIA 1KE9A 2R0IA 3KXMA 4RWLA 3PJ3A 3VAPA 1NT2A 5A4LA 4FZAB 3W18A 1UU3A 2A27A 1OMWA 4HGEA 5KX8A 4MXYA 2RKUA 2PMLX 3NCGA 5B2KA 3RHXA 3AG9A 2WIPA 4O0XA 3VBXA 2VTJA 2XH5A 5JZNA 4BCFA 3QUEA 3LW0A 1YXXA 3BQRA 4HGSA 4FEWA 4FSWA 3G5DA 2C1AA 3KCFA 4HPTE 3AD6A 5CVFA 2HZ4A 4Q2AA 3ZO1A 1H1SA 3BHYA 4E73A 4H39A 3LKMA 2ZV8A 4FF8A 4QMZA 2VN9A 3EFKA 4FKPA 2C6DA 4JBQA 3PVGA 3OS3A 2RFDA 3KFAA 3LCTA 3O7LD 4D9UA 3GP0A 2WELA 4RX9A 3PFQA 5D41A 4E26A 4EBVA 5E90A 3L8SA 2DUVA 2Y6MA 3C4FA 3NUYA 4J96A 5TE0A 1IAJA 3CY3A 2HW6A 3MFSA 4PNIA 1UWHA 5J9LA 4FSTA 4TKSA 4O0YA 4FKTA 5B2MA 3E3BX 2IVSA 4YURA 3TV4A 3ERKA 4KA3A 1KOBA 3E93A 4GS6A 3COHA 4BDDA 3QQFA 3Q32A 2W1EA 3HMMA 3LFDA 5AUUA 2C30A 2P4IA 4TNDA 5CQWA 3RINA 1DAWA 1ZYSA 2NRUA 3QLFA 3TDWA 2G15A 3OROA 2QOFA 4MHAA 4YO6A 3EQFA 2ITXA 4KIKA 1REKA 3E92A 3LJ1A 4IX3A 4NCTC 2UZNA 4I20A 4U6RA 4ZSJA 4ANBA 4BDCA 4EH7A 3UZPA 4DG2E 1ZYJA 2NO3A 3DA6A 4MXXA 3V5TA 4GSBA 2E9VA 2PZIA 4FEUA 4EH5A 2UZLA 4RBLA 3OC1A 4WNOA 5DR6A 5LJJA 2F7ZE 3NSZA 2W1FA 5HESA 3LM0A 3QCSA 2IW9A 5DA3A 4EYMA 3VBVA 3UIMA 2RSVA 2R3NA 2Y4IC 3ULIA 4XV9A 4J98A 3SA0A 3UNZA 1YRPA 3QQJA 2EXMA 2GNFA 2JD5A 5K0KA 1CMKE 5CVHA 3C9WA 5AFVA 5IEYA 3UDBA 3MH2A 3RK9A 4BCPA 1T46A 2CGUA 4NFMA 3FXZA 4O38A 1BL7A 1U46A 5JK3A 4PDPA 3DBEA 2FSMX 4MH7A 3FZ1A 4PPCA 4XRJA 1JPAA 1WBWA 2BZIB 4YLKA 2PVMA 3PIZA 3SX9A 5IH6A 1PXLA 1NVSA 5E1EA 2H9VA 3P1AA 3R9NA 4OTPA 4IXPA 3LXNA 4L9IA 1XH8A 4U97A 3TACA 3EOCA 4O91A 3KRRA 5FQDC 1BX6A 3U87A 3ZZEA 4EUUA 4A07A 4ACHA 3S1HA 3NVMB 4F9BA 4KRDA 5G1XA 1ZZ2A 4EQUA 3FMJA 4RJ4A 4XLIA 1W98A 3IPHA 4OW8A 4W4XA 3QGYA 2UVZA 4K18A 3B2TA 2ZYBA 4L7FA 3T3VA 3I0QA 3IG7A 1CKJA 4HGTA 1K3AA 4AZTA 4J99A 5F95A 3QTRA 4G6OA 4BTJA 4ZIMA 2RG6A 3JPVA 2UW3A 4R7IA 4FKVA 1KE5A 4PRJA 4AGWA 4EHZA 4DGLC 1XQZA 4M67A 1IA9A 3HP5A 3TKUA 5CALA 2WHBA 4FG9A 2OK1A 1UU7A 3EZVA 4K33A 4V0GA 2WMBA 1PXNA 3VS1A 3VF8A 1O6YA 2YJSA 4N4SA 5C8KA 4O0RA 2PE2A 2B55A 3VN9A 5IQCA 3FSFA 4I5HA 4QYYA 2SRCA 3DBCA 3H0YA 4FTJA 3LMIA 3OF0A 5L3AA 5BYLA 2PUPA 4KIKB 3LFNA 3ANQA 3KK8A 2OZAA 5IQEA 4F0GA 5K3YA 4QTCA 1YXUA 1H01A 5F20A 5HVYA 3PP1A 2A4LA 3BV2A 2C0OA 4HPUE 4QMPA 3RPRA 1QPJA 3RK7A 1VZOA 4WSQA 5M4FA 4HZSA 3R22A 5K4IA 5IQIA 1PXPA 4AN3A 2C3KA 3KA0A 2R3FA 4QMVA 3WYXA 5DEWA 2C6OA 4LYNA 3TTIA 4CMUA 2R3GA 3FXXA 3UP7A 2W99B 4FTCA 4FKGA 3FZTA 3MJ2A 3QQKA 4IC8A 3PXRA 4BTMA 1R0PA 3FKLA 1G3NA 4FL1A 4FV2A 4CXAA 1WBSA 4EWQA 2QO9A 3LOKA 2PY3A 1WBOA 3QU0A 4MNEA 2C6LA 5GJFA 2R0UA 4IAYA 3WF8A 2OZOA 3L1SA 2GTNA 4CSVA 5JFXA 2QOBA 3E8NA 4FSYA 4AF3A 1BLXA 1OL1A 5BMSA 2OKRA 3QC4A 4AOIA 5J9YA 5IISA 3DFCB 2CSNA 4HOKA 3IONA 2JDSA 4EOIA 2JBOA 3JYAA 4WT6A 3UC3A 3MWUA 4QMSA 1J7LA 1V1KA 2BTRA 3SLSA 3EN6A 1ZYCA 2QONA 1YHSA 2PVNA 3HDMA 4FNWA 5EFQA 5HE1A 4AW5A 2W0JA 3MV5A 1OB3A 3OTUA 4X3JA 3UYTA 4FE2A 1M2PA 3OUKA 3P5KA 3KKVA 4LG4A 2V7AA 5AUYA 3ETAA 2VAGA 1KV2A 4BTKA 2XA4A 3KRJA 4C62A 1WCCA 4R7BA 4LGGA 4F6SA 2WMVA 5J1VA 1Z9XA 2PZPA 2QODA 5GHVA 5CX9A 2C6KA 3W8LA 5L2WA 2QNJA 4U8ZA 5AR3A 3EQIA 2QOQA 2LGCA 3BZ3A 4JAJA 4B8MA 1ZMVA 2FB8A 5A4EA 1GY3A 4RA4A 5KNJA 4Q5HA 3FI3A 4AA4A 3BI6A 4V0GB 4BCGA 4DG0E 2FVDA 4S32A 2ITYA 3Q4UA 2OBJA 2WXVA 3D5UA 3GC0A 4J71A 5CI6A 4RG0A 5IMXA 2YCQA 4Y83A 4R3CA 3FQHA 4FICA 5CU0A 4FMQA 4P2KA 4RLKA 2B9HA 1GOLA 2DYLA 2J2IB 3VUGA 1H24A 3FDNA 3HV6A 2GHMA 5AX9A 4AS0A 1JBPE 3PE2A 1ZOHA 4FC0A 4D1XA 3NUPA 4AW0A 4XP2A 3ZM9A 4BDHA 2CPKE 3NW6A 4ZJJA 3BLRA 3KU2A 3RPSA 3DQXA 4NFNA 3VS5A 3VO3A 2YACA 1GZNA 4F08A 2V0DA 4Y72A 5E1SA 5H8EA 3W8QA 3FY2A 2XUUA 5E4HA 3M42A 2BFYA 4TYIA 3TL8A 1XO2B 2Y4PA 2WQEA 2PMIA 2WIHA 4YO4A 1CKIA 3F9NA 4K0YA 4O1OA 5AIKA 5CNOA 3LAUA 4XG8A 3GCVA 2OH4A 2XK4A 1H00A 3MFRA 1JOWB 1OPLA 2XM8A 3AGMA 4C35A 2PL0A 5EDQA 4BY9E 4F9WA 3NX8A 3OWJA 1KSWA 5DHJA 3QTUA 4BBFA 4CZYB 5IH5A 3UVQA 2YM6A 4WSYA 3OT8A 3ZLYA 4RPVA 2ACXA 3CQUA 3DNDA 2CN5A 4QQ5A 2F49A 3G33A 3ORNA 5CU3A 4NEUA 1EH4A 2XK3A 1DAYA 2QOKA 3BHUA 4MKCA 5FEEA 2IZSA 3MS9A 4R77A 3RHKA 1JLUE 4O1PA 3ZXZA 4OAUC 4QP4A 3RMFA 4L46A 3QTZA 4RX7A 5KKRB 4CVAA 4F0FA 5CYIA 4LQMA 5CU4A 1H28A 3LCKA 3PWDA 4RJ8A 4H36A 2BVAA 1RE8A 4HYUA 2EXEA 3HUCA 2ERKA 3F3UA 2JDOA 3GBZA 3LHJA 3WARA 3VS7A 3EQPA 5FDXA 3IW7A 4J97A 4C7TA 2VTRA 3EQCA 4FTLA 4ZAUA 3F7WA 4I5MA 2VGOA 4CTCA 4PF4A 2HAKA 1YW2A 3ZSGA 4EOQA 4D1ZA 5IQBA 2OH0E 3UG2A 4TWPA 2J5EA 2BMCA 4QP3A 2YDKA 4DFBA 5FM2A 4CV8A 1GZ8A 3F3VA 4FZDB 5CSWA 4FSRA 5DT4A 4EZ7A 4W8DA 4C34A 1PXJA 3RAWA 3TCPA 2WTWA 4FSQA 4QPAA 4OUCA 1OM1A 4XBUA 2WMRA 3RPYA 4D0WA 4JQ7A 3OOGA 4DG3E 1X8BA 2R3MA 3CCNA 3EQBA 3LFQA 4KNBA 4H05A 3U54A 4CT2A 5E8ZA 2QR7A 1ZMUA 4IAFA 5JGAA 4D2SA 3HV5A 4DFZE 4YC3A 3GCUA 3S3IA 3AD4A 3QWJA 4M7IA 4LRKA 3QALE 4D4VA 4RRVA 3I6WA 2F9GA 3UPXA 3HRCA 5FTOA 3RAHA 5HEZA 1H0VA 2YM7A 4BHZA 4BZNA 3C50A 2YHVA 1J7UA 5E8WA 2AC3A 4WRSA 1UNLA 3R9HA 3U9CA 4NW6A 5I9ZA 3A4PA 3BGQA 3NAYA 4IB5A 5FBNC 3SXFA 5DWRA 4DEBA 3R01A 3DXPA 3UO5A 4FTTA 1BI8A 4AFJA 3UQGA 4C58A 4OTGA 4H3BA 4UN0C 4EOLA 2XM9A 2X4ZA 3D14A 3K5VA 4J53A 2OWBA 4ZSLA 4ERKA 3QWKA 5T68A 5BVDA 4HVDA 3PA3A 4PMSA 1SVGA 2XBJA 3FMNA 5FBOA 3NYOA 5HLWA 4J8MA 1H26A 1VEBA 3ZHPC 2E9UA 5AA9A 2O5KA 3C0IA 4S31A 4EBWA 4DYMA 5IUHA 4ZJVA 2Y6OA 3TV7A 3R00A 1AQ1A 5E8TA 3C1XA 4M68A 4F6UA 4LL0A 4IH8A 3CTHA 5HX8A 3G0FA 3AMYA 4FTUA 4MBIA 2PVLA 5HG8A 5AM7A 5BPYA 4BGQA 3EMGA 3ITZA 2R3OA 3MW1A 4FNZA 3KF4A 2WTDA 4RX8A 2QOOA 1OUYA 3PA4A 3ZDUA 3DOGA 4IMYA 3V5WA 5CSPA 4IM0A 1XH9A 3UYSA 3KXZA 3N9XA 1M7QA 2HENA 5IDNA 3P08A 2WQBA 2Z7SA 4AN2A 2YAKA 3PVUA 4FT0A 3U51A 5HTIA 5M57A 3QAME 3BU3A 3QKLA 5DR2A 4DEHA 2GQRA 3ORPA 1ZOGA 4S33A 4GCJA 5C01A 3ZLSA 3VBQA 2UW7A 4XRLA 5AV0A 4EI4A 3G90X 1A9UA 3MY0A 5EYKA 1XBCA 3M11A 2W1GA 3P7CA 5L8JA 1HCLA 2A19B 1PMEA 3LJ2A 3I0OA 5EK7A 3KK9A 2OG8A 4A9SA 3HNGA 3PPJA 3R8ZA 2Z8CA 3TG1A 3E8CA 4IJ9A 5EH0A 3LE6A 3CQWA 2CGWA 3UOJA 4FSZA 3NVKI 5EQPA 2OF2A 3LLAA 3SXSA 4ANQA 4K11A 4KB8A 3RTPA 4LUDA 4X3FB 3PVBA 3DXQA 3ORTA 4GUBA 4EOPA 3VQUA 4M15A 3LMGA 3OW3A 2QHMA 4FSNA 4V05A 3BE2A 1T45A 3BYMA 3ENMA 4FYOA 2PVRA 4GFOA 3DBQA 1OL7A 1LEWA 4RIXB 2GSFA 3ORKA 3S0OA 2GPHA 4YPSA 5A14A 2NRYA 2QQ7A 4QNYA 3F3WA 3KCKA 4YJRA 3UIXA 3LFSA 3FLWA 5CY3A 3S2PA 3A7GA 3QTSA 4U41A 4UX9A 2AC5A 2GHGA 2R64A 3HECA 1ZY5A 2AUHA 1NXKA 4U3YA 1VYWA 3ORXA 5BUJA 2R3IA 4E6CA 5I9XA 3NS9A 4A7CA 4B9DA 2KTYA 2ZMDA 3EKKA 1GIHA 2OXDA 4I22A 5DG5A 3LVPA 5E8XA 3UE4A 4EOJA 1OBDA 2OLCA 5EYCA 5ANJA 4WNKA 1FOTA 2BRHA 1V0BA 3L9PA 4USEA 1PJKA 2XIXA 2I0EA 3O71A 5AV4A 5F94A 5A6NA 2W5HA 4ZTLA 3QTIA 1KE8A 3U9NA 2C3JA 2HOGA 2ZDUA 4W9WA 2UV2A 2PYWA 4O0SA 1PKDA 5KMKA 4N0SA 4CGAA 2GNGA 3OMVA 4AOTA 3EQHA 4AWIA 5ETAA 4XLVA 3R63A 4NM7A 5AR4A 3UP2A 3V04A 2P55A 4PMPA 2UW8A 2YIRA 4U5JA 3MDYA 3OXIA 2E2BA 2CMWA 4RT7A 2VTLA 3A60A 1XBAA 5BYYA 1NVRA 3QRKA 3REPA 5T6KA 3SW4A 2C5XA 4CZTA 3PG3A 4D4RA 2I0YA 3CKWA 3D0EA 3PXKA 1ZYLA 3DY7A 4QTEA 5A6OA 2HY0A 1FQ1B 4TT7A 3QQUA 4ASXA 3HUBA 3IQ7A 2GHLA 2WOTA 4R3PA 4O0TA 4AN9A 5A46A 1YWNA 3KRXA 1H4LA 3HMOA 3JS2A 4NM3A 5ACKA 3EIDA 2ONLA 2WKMA 3ZO3A 3DB6A 4Z3VA 3OCSA 4G5JA 4EJNA 1LUFA 1U4DA 5HU3A 5CANA 1BL6A 3QUPA 5AADA 1J1CA 1APME 2XNMA 3L8VA 4DTAA 3O0GA 2BZJA 3PY0A 4MXAA 1DI8A 4MNFA 4NW5A 4RVMA 2PU8A 1PHKA 1YOLA 4DH1A 3L9NA 2EUFB 4DEEA 4R78A 1ZZLA 4KD1A 3DJ5A 2OSCA 5EI8A 3GFWA 4JOAA 3PRFA 4GJ2A 3TJCA 2J0LA 3V5PA 4AZVA 5JRSA 3ZZWA 3PG1A 2VO6A 2O8YA 2C6EA 5K5XA 3I60A 4D4SA 3ACKA 4FL2A 4Y73A 3FE3A 1M2QA 3IW4A 4RVLA 3RAIA 3FV8A 4F09A 3FMEA 5HE2A 4XV2A 5IPJA 3WF9A 2JGZA 2OJJA 5HICA 2WMTA 1P4FA 3F2AA 3EL7A 3I5NA 3GI3A 4HYSA 2QLUA 3HMNA 4JLCA 3AC1A 3FLSA 4I92A 5KMNA 4X7QA 3VW8A 3ZLXA 5H8GA 3EN5A 4BCMA 5K5NA 5GIOE 2G9XA 3PPZA 3PLAE 1W8CA 3QTXA 4O86A 2YN8A 3WF7A 4UALA 3DFAA 2PK9A 4UXQA 3QCQA 5DRDA 3MPMA 3SVVA 4L3PA 2Z2WA 4TTHB 3DT1A 4ITHA 5HOAA 2YFXA 3LJ0A 4BDJA 3T3UA 2UZTA 3D83A 5DLSA 4MAOA 4FEVA 1V0PA 4QQJA 4BYJA 1KV1A 3B2WA 3Q96A 4OBOA 4O6LA 3UODA 4NWMA 1JVPP 1O6LA 4H58A 1LEZA 2BALA 4I0TA 4BDEA 1CKPA 4NH1A 4YHFA 4BDGA 5CT0A 3RP9A 1Q8YA 4DBXA 2C5YA 1P5EA 4C02A 2H34A 5CEQA 3O23A 4KS8A 4I21A 4ARKA 5IEVA 4XMOA 3GUBA 3DK3A 4LV5A 2QR8A 4OTQA 3ROCA 2J6MA 2F7EE 3EH9A 5KE0A 2JKKA 2C0IA 4M12A 3LPBA 3F2RA 4IAKA 3DDPA 4IZ5A 4AW2A 3VS6A 4OTRA 2YISA 4G6NA 4JNWA 3OCTA 5J9ZA 5JQ8A 5IH4A 1YWVA 4F9AA 3Q2MA 5HBHA 4BL1A 2J4ZA 2HZ0A 3UO6A 4BWKA 1KOAA 2JBPA 4FR4A 1XHAA 4ENXA 4AT3A 5BVNA 3DXNA 3PP0A 5DBXA 2XKEA 2VTSA 1Y91A 2WTCA 3ENHA 2OXYA 3DCVA 3OZ6A 3C4ZA 4KS7A 4FTNA 3WF6A 4PY1A 3MH3A 4U3ZA 5M07A 3GC7A 1ATPE 3UIUA 2Q83A 4F63A 4G17A 5DT0A 3LQ8A 2VTPA 4KUJA 2PTKA 3CIKA 3Q5ZA 5TT7A 3Q52A 3TKHA 2LAVA 3TEIA 3HA6A 2B4SB 3WIKA 3V8TA 4YPDA 2CDZA 4QP8A 4YTHA 4CTBA 4A4XA 2VNYA 1OIYA 2PVKA 4QMUA 2HYYA 4M97A 4BWPA 1YOMA 4ACGA 5DT3A 2YITA 4GIHA 3EFJA 5IA2A 2W9ZB 5KMJA 3R1YA 4EQCA 4R6VA 1OUKA 4MK0A 4CFMA 5L6OA 4FKQA 4K6ZA 1H07A 4C33A 4G9RA 4IWDA 3AD5A 3FLYA 4FZ7A 5H2UA 4CFFA 4EK3A 4FG7A 5JH6A 4TYEA 3LQ3A 3VIDA 3V5LA 4ALWA 3BX5A 3F82A 5DI1A 3D4QA 4L68A 2HCKA 3DTCA 4IQ6A 3QFVA 4JJRA 5A9UA 4DF3A 2XIRA 3NNXA 4LM5A 4U42A 4HVSA 4Z55A 4BC6A 1WBPA 4FTRA 1OI9A 3NNVA 1Y8YA 2B53A 4JRVA 3V5QA 4FBXA 2W5AA 5ACBC 2XJ1A 1W82A 2IO6A 4FEXA 1NW1A 1F0QA 4JX3A 4U79A 4F0IA 4OT5A 5DFPA 3UNJA 4XP0A 4G3DA 5AIRA 3VBYA 2YLFA 3NNUA 4D2PA 2H8HA 4RA5A 4UMRA 3DQWA 4UXLA 3ZU7A 4EOSA 4RQVA 5AUWA 4AE9A 3S95A 3FEGA 5EQEA 4JL9A 4O0VA 3IOKA 4RJ5A 4DLIA 4BR3A 2RFEA 2WOUA 3HZTA 3FHRA 4EL9A 3FYKX 3IGGA 4OTHA 4KBCA 3NR9A 3ORMA 4XX9A 4ZMEA 4O0WA 5CSXA 4A4OA 4AQCA 2V5QA 3OVVA 4FTQA 4ZZOA 1PMNA 1YHVA 3P9JA 5EHLA 5C1QB 4U45A 5BVEA 3IECA 3UTOA 4ZY4A 4PDYA 4D4YA 1J91A 2HXQA 3DTWA 2VUWA 3HRFA 3LFAA 4II5A 4IEBA 4AU8A 2CNUA 4O27B 2P2HA 4R1VA 3BLHA 4UWYA 2BAQA 5J79A 1WBNA 5EOBA 4ZMFA 3QRJA 1YDRE 2VO3A 4AACA 5B2LA 3QHRA 4QQTA 2C3LA 1Q8UA 1TQMA 5CNNA 2IWIA 5CTPA 3PY3A 2X2MA 4RC2A 4NYEA 2QOIA 4I3ZA 3UVPA 3Q9ZA 3BE9A 3GVUA 3PXQA 5IA1A 3GQLA 2ZV7A 4RIWA 4A9UA 5DR9A 5HHWA 2W1IA 3FWQA 4PNKA 2WEIA 3AC4A 3C4WA 3A7IA 2YM3A 4AGDA 3FLZA 3ZONA 2VWBA 2BIKB 2PZ5A 1ZWSA 3AT4A 3MI9A 3P78A 3BHHA 3WIGA 4NTTA 3ZS5A 4HNIA 3D5VA 3R73A 4A9YA 5I4NA 4AP7A 2IVTA 5FWKK 4OR5A 2WB8A 3E7VA 4OBPA 3KL8A 3KF7A 3CTQA 3KXGA 4MBJA 4FT5A 1KE6A 2J7TA 5H9BA 5GINE 2GNHA 2I0HA 5HIEA 3KMUA 1Q97A 2YM5A 4YZ9A 4BHNA 2V22A 4DEGA 1SVHA 3BGZA 2J50A 1Q4LA 3MBLA 2CKOA 2ITOA 4IVAA 1GJOA 3P7BA 3F88A 2WMQA 3LCSA 5BVKA 5GZ8A 5CT7A 3GC9A 3G9LX 4OTFA 4RIYA 4X6RA 1ZY4A 2UUEA 3FLNC 5BQ0A 5IA4A 2JAVA 4ANSA 2PZRA 2XKFA 4IB1A 4PTEA 4EOMA 3BBTB 1A06A 4FOBA 1KWPA 4ZXTA 5EDRA 2B1PA 5L2TA 3U55A 2CLQA 2XRUA 5LCJA 3RK5A 4G6LA 4BCOA 2Z02A 3PZHA 1UV5A 4DFUA 2C6IA 3W2OA 4OTWA 4DTKA 1WVYA 4JT3A 3R9DA 5C8NA 3R71A 5L2QA 4ITIA 2HZIA 4BZDA 5AUTA 4A06A 2OJIA 4RSSA 2UW5A 2CKQA 3F6XA 4IADA 5LVMA 3NUUA 2JEDA 5HE3A 5LMBA 3CE3A 4ORKA 3OHTA 1PXIA 3A62A 4WUAA 5LVNA 2GQSA 4F1MA 4O7WA 1Z5MA 2CGVA 3PXYA 3EQGA 4QMNA 4F7LA 2WEVA 4U44A 4F6WA 2RFSA 2ONLC 1AGWA 1Q3WA 1YOJA 3QHWA 4IFCA 1OIQA 3MFUA 4USFA 2WTKC 3IDBA 4DT9A 4EJ7A 3A61A 4QPSA 4IVDA 1J3HA 4L01A 4OT6A 4B0GA 4XEYA 4MBLA 1NVQA 4UMUA 4ZLZA 4QMQA 3RAKA 4G2FA 4BCIA 4JDIA 3CPCA 4LUEA 3WE4A 2GNIA 3CBLA 4RIWB 1GAGA 4CRSA 2R3RA 2QVSE 3C4CA 3R9RA 3R8LA 2CNVA 1XKKA 3DS6A 3HV7A 3A7JA 4FI1A 3QKKA 4NT4A 5EKOA 5EYMA 4ZJIA 3ZSIA 4ZLYA 2PVJA 2R7IA 4QRCA 2IW8A 3CPBA 4DLJA 2OGVA 5GJGA 4BGGA 2WNTA 2PVYA 4DT8A 4NL0A 4PPAA 3TXOA 1CTPE 1WBTA 2GNLA 1Y6AA 4L43A 3NMUF 5DMZA 4OTIA 3Q60A 2QOHA 2QO2A 4L42A 3P0MA 4UV0A 2WQOA 3Q04A 5DNRA 4HVGA 4FG8A 4C61A 3GC8A 3ZC6A 3SV0A 3DK7A 2VWYA 5EHOA 3R0TA 4ZSGA 4BDFA 4E7WA 3EB0A 4HVHA 2BIYA 4QOXA 3TNQB 5M4CA 4FIFA 4FV5A 3D2KA 3EJ1A 3C51A 5HG9A 3PIXA 4JRNA 1VJYA 3QXPA 3DZOA 5ANOA 5EI6A 4CFWA 2BFXA 2UZOA 4RIYB 3UOKA 3CJGA 4B7TA 4CYJA 4GK4A 2GNJA 4IM3A 5FDPA 4RJ3A 3I4BA 4L6QA 4YC6A 2FSOX 2Y8OA 5EG3A 1FBNA 2JDVA 3IK3A 4BF2A 3O7LB 4TY1A 4ZOGA 3D9VA 4YSJA 2BAJA 2NPQA 4ZS0A 5AM6A 4J8NA 1O6KA 4GJ3A 3QQLA 5DVRA 5IA3A 2ITQA 4FK3A 4KRCA 4MD8E 1WVXA 3QRTA 3SRVA 5LWNA 4CZUA 5IQDA 4IJPA 4QYGA 2YEXA 3ORIA 3KXNA 3VRZA 3ZFMA 4EONA 3GT8A 3AC5A 3RVGA 3Q3BA 3VWAA 1FVRA 4YHTA 1YVJA 4X0MA 4XG6A 3E5AA 2VO0A 2C5OA 3PLSA 3KEXA 2ITZA 2VX1A 3BEAA 2XYNA 3FI8A 4X2KA 3FL5A 4IDTA 4U80A 1BI7A 2OU7A 4DGGA 4FZ6A 4FIJA 2WMUA 3O51A 4K2RA 3U6HA 4DCEA 4IZ7A 3MB7A 4JI9A 4MF1A 4RJ6A 4XHKB 3B8RA 2W06A 3COMA 2XB7A 4F99A 2JDRA 3WZJA 4RWIA 4C4GA 3G0EA 3JY0A 1YI3A 5CF6A 4KINA 1YKRA 4BI2A 4I6FA 4YLLA 4DA5A 4RFZA 2JKMA 1XH5A 2JIVA 2FUMA 5FG8A 5B0XA 2E9NA 3EWHA 3VBWA 2ZM4A 4IC7A 4IDVA 4WNPA 4GFGA 4UMPA 5J7BA 3FY0A 1A48A 4MYGA 3FXWA 2O64A 4RZWA 3W2CA 4DCAA 4H1MA 1GIJA 3CP9A 2YZLA 3RKBA 2W4OA 1OPKA 4GUEA 4E20A 5HIDA 4TXCA 2XEYA 1G5SA 3CTJA 4Y85A 3DKFA 1LR4A 3GU6A 5HCYA 4CT1A 3ATSA 4X2FA 2BKZA 5FGKA 3CJFA 3F5GA 3QXOA 4X2NA 3C5UA 4C38A 3NW5A 3E8DA 4M84A 5BMMA 2WGJA 4HCVA 3P4KA 5KMOA 3PY1A 5IF1A 4ZTMA 5EKNA 5IEXA 4O6EA 5KMMA 5TKDA 3R1NA 4LOQA 3O8UA 3ULZA 4U0IA 5C26A 4CFUA 4DINA 5T3QA 4CCBA 4JG7A 5CZHA 3EFLA 4DBNA 5HCZA 2E9OA 5AEPA 2JFMA 5FEDA 3TN8A 3QA8A 4I4FA 4O7YA 5IQAA 3QGWA 4IAIA 4BFMA 4R5SA 4N6ZA 4YR8A 3LFFA 5IU2A 2BAKA 3OG7A 4BN1A 2R5TA 1UKIA 3QUDA 4KSQA 4DE4A 4FV1A 3PA5A 5L8KA 5IQGA 3EZRA 2X7GA 5AR5A 4CLJA 5HKMA 2UW0A 3NIEA 5M56A 3SRVB 5JZJA 4IBMA 2XIKA 1PW2A 4AW1A 4YUQA 5KBQA 3T9TA 5HTBA 1GIIA 4KIPA 5JEBA 4EZ3A 4RWJA 4RVTA 5CAPA 3Q4TA 3A2CA 4UMQA 4BBEA 5FP5A 4EOOA 2PE0A 4FEQA 4J7BA 4JG8A 3NYXA 5AP7A 4BDAA 5GJDA 1U5QA 3JVRA 3R04A 3TM0A 2QU6A 4E8AA 1U5RA 4XCUA 1YI4A 2I0VA 4ERWA 2XIYA 3F5PA 2VV9A 4WKQA 5AWMA 2IJMA 3W2SA 2IZRA 4MD9E 1PXMA 5AR7A 5D10A 4TW9A 4WHZA 5AP5A 5D1JA 4JDHA 3QZGA 5I0BA 4FKLA 5M09A 2J0KA 2BPMA 3BYVA 1ERKA 4I5CA 3VS3A 3GNIB 3ZDIA 5CEMA 4QD6A 4TZRA 3AXWA 3OWLA 2JFLA 3QA0A 1OITA 3EYHA 2ZMCA 4ANOA 2YAAA 1HOWA 4IHPA 4WIHA 2I40A 5F1ZA 2Z7LA 1WAKA 4X3FA 3BQCA 4ZSAA 3H0ZA 5CAVA 2Z60A 4EH3A 3QYWA 4PUZA 3ZTXA 4TYHB 3N4UA 4B8LA 4EWHA 3PRIA 5K4JA 2BDFA 4LGDA 1IASA 3GOPA 4EOKA 4RIXA 4F7JA 3W2RA 3IOPA 4FV6A 3QL8A 5ICPA 4DFNA 4N70A 4AT5A 5TR6A 4L45A 1VR2A 1B39A 4QMLA 3AC8A 5CI7A 3QX2A 3I79A 4W4YA 3FC1X 1YHWA 2AYPA 2YCRA 5HGIA 2B9IA 4ZS4A 5EM5A 1CSNA 3CQEA 4M13A 4AUAA 2IZUA 4FK6A 2F7XE 1M17A 1YDTE 4IZAA 4PL5A 3FKOA 3WBLA 5KUPA 5I9VA 2F4JA 4FNXA 5FXSA 5CSHA 3ZRKA 5HNBA 3A99A 5LVPA 1Y6BA 2ITTA 4IW0A 2XJ0A 3AMAA 3FLQA 4YZNA 2BILB 4BRXA 3UMWA 1H25A 4BBMA 4QMMA 1RW8A 2X1NA 2XKCA 3DLSA 4YMJA 4QNAA 3UC4A 3NUNA 3RCJA 4Q9SA 3VRYA 4XG3A 3MTLA 4TPTA 1P2AA 4D28A 3PXZA 2CGXA 4O7NA 4EQMA 2YWPA 3C7QA 3PVWA 4IAAA 5FXQA 1M14A 3VVHA 5IQHA 4UEUA 1REJA 4V01A 3SKCA 2UZUE 1H1WA 1YXSA 4ID7A 4ZTSA 4MF0A 4B99A 4BDKA 1UWJA 1FVVA 4UY9A 2UW9A 2PZYA 1JKSA 4CLIA 3KULA 4V04A 3NDMA 4MVFA 4C3RA 4F9CA 1I09A 2BDWA 3MPTA 5J87A 4APCA 3CY2A 5CZIA 1H1QA 4Y8DA 3SXRA 5AX3A 2VTNA 4DGMA 5KCVA 1MRYA 4CRLA 1Z57A 1PKGA 3F66A 5EW9A 2C6TA 3DGKA 5AV2A 4B4LA 2W17A 4CKRA 3GEQA 2OO8X 3DU8A 1GZKA 4W8EA 3V5JA 2HIWA 3ODYX 3GCSA 4EC8A 5TO8A 3HL7A 2C5VA 3G9NA 3LM5A 3M2WA 3RM6A 2WQNA 3RZFA 2WU7A 4MWHA 4P90A 4WNMA 3VUTA 5HVJA 4R7HA 3O2MA 4D9TA 4MQ2A 4EH6A 3R7IA 3LZBA 4BCJA 4BVUA 5AP4A 3NUXA 1YXVA 4F64A 2CJMA 5M4UA 4FT9A 4QMXA 3VUKA 4AZEA 5A4CA 3AC2A 3PSDA 4FODA 4NCTA 3RWPA 4KKEA 4NU1A 4DAWA 3R2BA 1ZLTA 2QKRA 3BBWA 1OIRA 3KY2A 2G2FA 3PIYA 5IG1A 5EHYA 2QKWB 4FKRA 4QP2A 1OIUA 2UZVA 5AUZA 3ROYA 4BCKA 4ITJA 4F7SA 3A7HA 4FL3A 2HELA 1WFCA 1FGIA 3ZBFA 4GKHA 4RC3A 4EH4A 3A7FA 3DJ7A 4CG8A 3TTJA 5CSVA 3FMHA 3Q9YA 5M44A 2GS6A 5HI2A 2FSTX 2GDOA 2J0IA 5DYJA 4ZY6A 4E4MA 5IUGA 5L8LA 2EB3A 2VX0A 2H96A 3MY5A 1PY5A 4UB7A 3R8MA 3ZLWA 4UWBA 5D11A 1IAHA 5KKRC 3NGAA 4XG9A 3ORZA 4EEVA 5FTQA 5M06A 2C4GA 2C6MA 4DFYA 5FD2A 2J9MA 4J52A 4DC2A 4O84A 1Q24A 3QZIA 2FH9A 2DWBA
chains in the Genus database with same CATH superfamily
2RIOA 3MPAA 4USDA 4MXCA 3R7EA 3P86A 1OKZA 3UVRA 3WZDA 2XMYA 2V55A 3I6UA 5JFVA 3QD2B 5JSMA 3NUAA 3OWKA 2PUUA 3RALA 1FGKA 3GU7A 3FSKA 3KRLA 4J95A 4QMWA 3V6SA 4D1SA 2WMXA 5BX0A 3DK6A 5K9IA 1W0XC 3ZFXA 3HAVA 1OL5A 2REIA 5IUIA 3EQDA 3UZTA 3KULB 1OL2A 3BYSA 4HCTA 3AC3A 3OP5A 1JKLA 4FV9A 2ZM1A 4HCUA 4RIOA 3ZYAA 5CF5A 2VTTA 2O2UA 5J7HA 4TNBA 4B6LA 4CYIA 4FTMA 3BU5A 4DH3A 1MRUA 2YM4A 2WPAA 4WBBB 1F5QA 3QX4A 5KMIA 4GG5A 4PMMA 4C37A 5D7VA 3E64A 3NEWA 3GGFA 3E3PA 3GOKA 3H3CA 3UJGA 3VS4A 2BKKA 3L8PA 2R3LA 5DPVA 2PE1A 1Q62A 2JIIA 3EYGA 3K3IA 3W10A 4R3RA 1XR1A 3MN3A 1XJDA 5CENA 4NM5A 3TNWA 3EHAA 5IA5A 3LIJA 1QMZA 4QTDA 4IIRA 3ORLA 1CM8A 1QCFA 4ZTRA 5M55A 3FQSA 3R8UA 3ACJA 2PULA 1PMUA 2BDJA 1AD5A 1V0OA 2DS1A 4FV8A 4X2JA 4XG7A 4ANMA 4APPA 3R7OA 2X7FA 2VWWA 2V7OA 1PRYA 2RF9A 3GENA 3TIZA 2ZV9A 4JVGA 2ZV2A 3RNYA 4F78A 3HLLA 3JY9A 3FMKA 4BWXA 3KMMA 5I9UA 1SNUA 3GQIA 5CAQA 1BKXA 4ACMA 4NIFA 3BGPA 4ANNA 5E9EA 2WO6A 4WD5A 2YZAA 3VQHA 4BYIA 4EH2A 1E1VA 2QU5A 3DB8A 4AGCA 2G2HA 2WQMA 2ITPA 4C2WA 3UO4A 3O5AA 2XJ2A 5I3OA 3TI1A 5IDPA 1M52A 3P5JC 2EWAA 3THBA 3HEGA 2VRXA 1H1RA 5C9CA 5FXRA 4I6QA 3ZEWA 5LMAA 1JKKA 3ZH8A 4TN6A 3TWJA 2BZHB 2BUJA 3Q9XA 3MIYA 3LFCA 3F3TA 4WG5A 4BIDA 2X9EA 2I6LA 4JG6A 5I9YA 3OTVA 3CXWA 2G2IA 4YTCA 2C5NA 2EXCX 4FIEA 3WOWA 3HX4A 4MCVA 2XCHA 2AEGA 2XNOA 3DAJA 1E1XA 3FMDA 4XS2A 3VHEA 5F4NA 2JC6A 4GIIA 3ZO2A 1SYKA 4NKSA 3ANRA 5M53A 4C4IA 4GT3A 1ZXEA 3Q6UA 4Z9LA 3KXXA 4LRJA 4QTAA 3S00A 2OFVA 4HNFA 4HYIA 1NA7A 2W96B 2VTAA 2O65A 5BV3A 1JNKA 2FSLX 3Q4ZA 3VHKA 4YJUA 3ZMMA 1TKIA 4AX8A 4F70A 4QYEA 5F9EA 3EKNA 4TYGA 4DGOA 2E9PA 4O7ZA 3W32A 3PYYA 4F4PA 4P5ZA 3H4JA 2WTJA 4I41A 2ITUA 3LCDA 2YIXA 3F5UA 4LI5A 2QI8A 3IGOA 1SZMA 4LMUA 1F3MC 2Y7JA 3FQEA 4MXOA 3MA6A 4X3FC 5TF9A 4UYAA 3ZO4A 4PL4A 3EL8A 2QG7A 1OKVA 4PWNA 2AQXA 4P5QA 4BZOA 5JFWA 4JMQA 4I93A 3AOXA 4ZTHA 1K2PA 2YM8A 4JXFA 4ZK5A 3BELA 3CD8A 3FI4A 5FM3A 4NIFB 1YQJA 2R3HA 4FVQA 4ASZA 5EQYA 3GXLA 4RMZA 1SVEA 2NP8A 4G16A 4AE6A 3DBFA 4RZVA 4M69B 3SG8A 5I5ZA 3R1QA 5LMKA 1MQ4A 3AMBA 3OOMA 2BHHA 4FSMA 4UMTA 3UOHA 3IO7A 3MY1A 2X0OA 4BCHA 1YXTA 4IWPA 3OFMA 4M0ZA 4RC4A 3DZQA 1ZRZA 4EK4A 1S9JA 3TIYA 3ZFYA 3UPZA 3Q4CA 2FYSA 3EN4A 2B9FA 3UG1A 5M51A 3KRWA 4O4CA 3O8PA 4KABA 5IQFA 4AFEA 3FZSA 4A9RA 5LWMA 5JKGA 3QBNA 4KKHA 3TZ9A 3BHVA 3OW4A 4FOCA 2IVUA 3H9FA 3L8XA 3KB7A 1OPJA 3KC3A 3R21A 4CQEA 3QZFA 1ZAOA 3O8TA 3CS9A 3RM7A 4NUSA 4H3PA 5E8SA 5HX6A 1HCKA 3F69A 4PV0A 4QMYA 1BYGA 4XOYA 3QKMA 5LXMA 1P14A 2C3IB 4C2VA 3TDVA 1K9AA 3T9IA 4Y46A 2PWLA 2VX3A 4CKJA 3A8XA 1Y8GA 4HZRA 4JDKA 2P33A 5EOLA 4YJOA 1Q41A 4JR3A 2W7XA 4CKIA 4FV7A 3QQHA 2B7AA 2C47A 2JIUA 4XBRA 3N4VA 2QC6A 3I7BA 1WBVA 1TZDA 4EORA 3UGCA 5KO1A 3BU6A 1WVWA 3OXTA 4WUNA 4TL0A 2PUNA 4O7VA 5BVOA 4XOZA 3E88A 5G6VA 1PYEA 4G1WA 1PXKA 3HV3A 4P7EA 4XJ0A 2CCIA 2OW3A 3ZXTA 3K2LA 2FO0A 4R1YA 4U40A 5AAFA 3OY3A 2W9FB 4AZWA 3SOCA 2J51A 2UW4A 3C13A 3SC1A 3VUDA 1O9UA 2BR1A 3POOA 4DHZA 5C8MA 3FC2A 3F5XA 5FLFA 3RGFA 3V6RA 3CD3A 4CD0A 3U8WA 5AAGA 1IG1A 1QPEA 2RG5A 2WD1A 5E8VA 4O83A 3P7AA 4KKGA 5E92A 5J8IA 4L67A 4C8BA 4L3JA 3NPCA 4IX4A 4QMOA 2W4KA 2BRNA 4FKJA 4TYJA 4AT4A 1OVEA 1H1PA 2RL5A 4CMOA 4YJVA 1JQHA 4FTOA 3W2QA 2J0JA 4AXFA 3PJ8A 4K8AA 2VZ6A 4QQCA 1R39A 1M7NA 4KBAA 4NM0A 4AA5A 5BUIA 5EYDA 4UWCA 2O3PA 3BWJA 3DJ6A 4E5AX 1S9IA 1XH6A 4YJPA 4JQEA 3RPVA 3PE1A 3TV6A 3HMIA 4D2VA 2BZKB 4O2ZA 5HNGA 3RZBA 2A2AA 2QURA 3NIZA 3DKOA 4M8TA 2UVYA 2X2KA 4JAIA 4I5PA 1UNHA 4XP3A 2EU9A 3CGFA 5C27A 5AA8A 4D2WA 4W9XA 4ZP5A 5AUVA 5KZ0A 2I1MA 3FMMA 3RBWA 1JSVA 1UA2A 3VJOA 3UQFA 4EK5A 5LOHA 3C0GA 2CKEA 4BKJA 4FKIA 4C59A 2X0GA 1P4OA 3RPOA 2WTIA 3DDQA 3BYOA 5HCXA 2PMNX 4YTIA 4I6HA 1H0WA 4ZEGA 3OCBA 4NKAA 3Q6WA 3KVXA 4F65A 4CEGA 4GMYA 5BUEA 5L6PA 2NYAA 4G5PA 5DN3A 1LPUA 4G3EA 4JIAA 2UZEA 1FMOE 5CAOA 3ID6C 2YDIA 4XV1A 2UZBA 1JWHA 1Q61A 1U54A 4N57A 2XEZA 3IW5A 2X8IA 2B54A 2C69A 1DS5A 3QTWA 1RJBA 3D15A 3HVCA 4L52A 1PXOA 4WBOA 3BCEA 3VJNA 4NJDA 5ANDA 3OEFX 1GNGA 4U7ZA 3OBJA 3VS0A 4JBVA 2GS2A 3JVSA 2I7QA 4DHIB 2JDTA 4D58A 2WTVA 4I6BA 4M66A 2OICA 4E6AA 5JQ5A 2UZDA 1QPCA 2YJRA 2W05A 2XKDA 2HXLA 1OKWA 5L6WL 5KMLA 2ZDTA 1G8AA 3V3VA 4TWOA 4AXEA 1IEPA 1KUTA 4LGHA 4ZY5A 2C0TA 2QOLA 2X4FA 3WF5A 4JIKA 2YERA 4D0XA 3VBTA 4GRBA 2V62A 5I9WA 1STCE 4JBOA 3I81A 1URWA 4AAAA 1M2RA 5JT2A 2GU8A 4KSPA 4ZZNA 3PXFA 5HO6A 3D5WA 3KGAA 1W83A 5CU2A 4GH2A 2X6EA 5FUTA 3LXPA 4EK8A 3QRUA 2YIQA 2ITVA 4EHGA 1H27A 4YP8A 3AT2A 2YA9A 3FUPA 2OIDA 4K9YA 2VTOA 2XNEA 3BHTA 3ZUTA 3E63A 4BCNA 4O0UA 4AZSA 5E8YA 5A3XA 3TUCA 2HK5A 2OIQA 4YC8A 3IDPA 3CC6A 4QMTA 5HD4A 4FV0A 4ALVA 5JRQA 4C4FA 2O63A 3FL4A 1MUOA 4YJTA 4G34A 2W1HA 1IA8A 4U9AA 3LFBA 4YNOA 5LVLA 4O4FA 1Y57A 4OAVB 4YGAA 1B6CB 4FA2A 5IZFA 5C4LA 4EKKA 5EW8A 4YBJA 2ERZE 3FZPA 3I1AA 4M3QA 4O2PA 4CFNA 4GV1A 2IPXA 5HO8A 3SG9A 3JXWA 4QP9A 4TWCA 2W4JA 1IR3A 1R1WA 2FGIA 2G01A 1R78A 3FZOA 4DGNA 2ESMA 5DOSA 4KWPA 1KE7A 1U54B 4WOVA 2YLEA 4O7SA 2PHKA 3VF9A 2OFUA 1PMVA 2ZM3A 3NUSA 4QPMA 3RWQA 1RDQE 2X9FA 4PTCA 3FKNA 2Z7RA 3TJDA 3NYNA 4UBAA 4A9TA 3VNTA 5AV1A 3QRIA 5IMEA 3QC9A 4MXZA 3W16A 2ZOQA 3SDJA 4E3CA 3AGLA 4GT4A 3GU5A 5ANGA 2XK9A 4MWIA 1FMKA 3OWPA 2OI4X 3R7VA 4OLIA 5J95A 4PDOA 4CFVA 2VWIA 3BYUA 4X2GA 3ZUUA 2CNQA 5FTGA 3WE8A 3PWYA 5HG5A 4DTBA 5J5TA 1E9HA 2YCFA 5BVWA 3U6IA 2Q0NA 5GIPE 4YZDA 3GCQA 2CKPA 3HDNA 5HORA 3PJCA 3HGKA 3AKKA 4MUQA 2JKQA 4FJVA 3FBVA 3R02A 3DNEA 1QPDA 2X2LA 2ZVAA 3KXHA 4E5BA 4E93A 1UU9A 4GU9A 5L2SA 3U4UA 3RI1A 3H9RA 5EI2A 5CVGA 4YJQA 3HP2A 2BRMA 3OCGA 4XYFA 3GCPA 4PP9A 1VYZA 3H9OA 4C36A 2WMSA 3K5UA 3KQ7A 3SHEA 3W33A 2XCKA 2OZAB 4TYHA 3G6HA 3O50A 3ALOA 3MYGA 4C57A 3VS2A 3BV3A 3DAKA 2VTMA 2X6DA 5HIBA 4PPBA 4N6YA 3CLYA 1DM2A 2CHLA 4O22A 4G31A 3VW6A 1BMKA 2ITWA 4BCQA 4E4NA 3KN6A 4KIQA 3PTGA 3E7OA 5DEYA 3HKOA 3MVLA 3PJ1A 2ZB0A 5EM8A 4EHVA 4GEOA 4HW7A 3I5ZA 3R1SA 5E91A 5H3QA 1Q3DA 1ST4A 3WZEA 2ETKA 3R7YA 4F9YA 4FGRA 5E7RA 1SMHA 4G9CA 3IW8A 5LMKC 4MNEB 4NK9A 1MP8A 4XUFA 2XBAA 5D7AA 1MRVA 2PVHA 3D5XA 3DPKA 3IKAA 4JX7A 4Z7HA 2GFCA 3TT0A 3PPKA 3IDCA 1URCA 3O96A 3O17A 4LOPA 1OL6A 4D5HA 2FA2A 2GMXA 3EN9A 4EH9A 4BI0A 1JSTA 1OGUA 3L9MA 4YNEA 4PX6A 2IVVA 3ATTA 2Q0BA 4FKSA 4K77A 2X8DA 4DFLA 4C3FA 4QP1A 1UVRA 3HV4A 4C4HA 2UZWE 2P0CA 1XH7A 2XYUA 4TWNA 2VTIA 4XV3A 3I7CA 4ANLA 5IEVA 5CEKA 2QD9A 3UMXA 2W1DA 2XNGA 4L44A 5E8UA 2CLXA 5HLPA 4RFYA 3R8VA 3R83A 4F1TA 1J1BA 2KULA 4FYNA 3ZSHA 3GFEA 3PUPA 4FV3A 4ASDA 4FTAA 4S30A 3V51A 4JBPA 2UW6A 4MEDA 3IS5A 5ETFA 4AG8A 5HNIX 3FAAA 2XNPA 4IX6A 4C3PA 1JSUA 3SGCA 4ZTQA 3OY1A 3PJ2A 3CR0A 4RGJA 1H08A 2OJFE 3TZ7A 4DEDA 5CEPA 2R3QA 3F2NA 4LV8A 4EZ5A 3Q9WA 2JITA 3E62A 2B52A 3NRMA 5DRBA 3U4WA 5HBEA 4G3CA 4FKWA 4XG2A 4AOJA 4Y5QA 4LFIA 3W2PA 1Q8TA 4FSUA 3SAYA 2RFNA 3ELJA 3VUHA 4D2TA 4I23A 5HO7A 4W4VA 2F57A 2J5FA 3DAEA 4GG7A 5CXZA 3FPQA 4FRFA 4YZMA 1IRKA 4L00A 1SNXA 3N51A 4C0TA 5JFSA 3C5IA 4E5WA 3OBGA 3UZRA 2X8EA 1CDKA 3MGYA 3LFEA 4NTSA 3V01A 3ZCLA 4Z7GA 4FGBA 5CF8A 1JKTA 4GYGA 2YIYA 3UQCA 3MB6A 3MVMA 2OJGA 4TRLA 1YDSE 1G8SA 3DKCA 4RJ7A 3OEZA 1W84A 3H30A 3MESA 1TQIA 3DKGA 2XP2A 3ALNA 2G1TA 4FUYA 2VWXA 4L53A 1YWRA 4FIHA 1QL6A 4BIEA 2XS0A 3OD6X 5D9HA 4GFMA 3P23A 4GU6A 4DHFA 4DH8A 4YTFA 3AQVA 3CKXA 1J7IA 2O0UA 3MJ1A 3QZHA 5ANEA 4ENYA 5ANKA 5HVKA 4Q5EA 2H6DA 5EDPA 1FINA 2HW7A 2XZSA 5CXHA 1OBGA 4QDEA 1ZOEA 3VC4A 5I3RA 3E8EA 4CQGA 4JDJA 2X0QA 5AP6A 2A0CX 4FVPA 1L3RE 3SW7A 5AAEA 4ONAA 3LXKA 5AJQA 4C4EA 1Q5KA 5CF4A 4EHEA 5KZIA 3B8QA 4YZCA 3LCOA 5IA0A 1NY3A 2VD5A 4DFXE 1UNGA 4KIOA 3TMOA 2VWZA 2GS7A 3TUDA 3QCYA 3MH1A 3VULA 3EN7A 2EVAA 2B9JA 2GTMA 2P3GX 5HLNA 3DLZA 5AR2A 5LVOA 3COKA 5CWZA 1TQPA 2XK6A 3LQ5A 4JQ8A 3UNKA 4OTDA 4EH8A 4GL9A 5CS6A 2PPQA 2OF4A 4ACCA 4AXAA 4I94A 3BKBA 2JKOA 4R8QA 3ZEPA 2QHNA 2WAJA 4BDBA 3K54A 4PMTA 4IFGA 3BL9A 3JR1A 3SD0A 3TUBA 4YZBA 4PTGA 5C03A 2XIZA 3ZOSA 4DH7A 5K0XA 2ZAZA 3BEGA 5L2IA 3ET7A 3OXZA 5CAUA 1FVTA 3K3JA 4FZFB 4G3GA 3MVJA 3WILA 4FVRA 1PF8A 2C68A 4AGUA 4H3QA 4IVBA 4ZLOA 2XK8A 2Y9QA 4MX9A 5LQFA 2JLDA 3CGOA 3PZEA 3TNHA 4BTFA 3RJCA 2IW6A 1ZYDA 5ETCA 4JS8A 4QP6A 3QLGA 2XRWA 3T8OA 5GZAA 4D5KA 3TNIA 5JGBA 4LOOA 3LLTA 2GCDA 2IZTA 2OXXA 4KBKA 3R6XA 2ITNA 4IACA 3ZC5A 4FKOA 5A4TA 3KMWA 4RWKA 3R7GA 3CEKA 5HD7A 5CEIA 2RGPA 3UIBA 5KHWA 1ND4A 5CU6A 4O7TA 3GB2A 3MA3A 3D94A 5J1WA 5DGZA 2VTHA 3NZ0A 5DH3A 3FZRA 2HWOA 2X7OA 2R3JA 4YHJA 1WZYA 4FKUA 4WA9A 4EC9A 2R3KA 2ETMA 3QTQA 2XNBA 3GU4A 3G6GA 4KAOA 4QTBA 4RFMA 3TNPC 3KN5A 3A8WA 2VU3A 4GVJA 5ANIA 2QO7A 3S4QA 4YJSA 4M14A 3FPMA 2J90A 5A54A 1OKYA 3UBDA 4QDVA 2Z7QA 5GZ9A 1PYXA 2IG7A 4NZWB 2NNWB 3EFWA 4FX3A 3WI6A 3A4OX 4I0SA 5AP1A 5JGDA 3BPRA 5JMSA 5HTCA 2R3PA 1ZMWA 4FUXA 2PUIA 3E87A 3MIAA 3FMLA 4IM2A 4DH5A 4H1JA 1YI6A 2BTSA 2VO7A 4J1RA 2PMOX 5M4IA 2CCHA 2IN6A 4HJOA 4IB3A 3JUHA 4YJNA 3IW6A 3SQQA 3NYVA 5EM6A 3WZUA 2YABA 4BKYA 4RVKA 1LP4A 3AT3A 2W1ZA 3V8WA 3N4TA 3BLQA 1XBBA 2WMAA 4Y5HA 4M0YA 2OJ9A 3VUMA 3ZUVA 2YCSA 3II5A 5BVFA 4UZHA 3G51A 4X6QC 3POZA 3QD0A 4AA0A 4GK3A 3QD4A 3RCDA 4FT7A 5AV3A 3LXLA 4DN5A 5DIAA 4E1ZA 3F3ZA 3W0RA 2BCJA 2BHEA 4IAZA 4O7RA 4ZZMA 3HRBA 2WU6A 4NJ3A 4CCUA 4LL5A 3G2FA 3PSCA 3ZRMA 3FJQE 3R28A 4P4CA 2XK7A 2PVFA 4O7LA 3D7TA 4GVAA 4PDSA 2J0MB 2HWPA 3D2IA 4MQ1A 5D12A 1WMKA 5AUXA 4Y95A 4QO9A 4QYFA 1ZARA 4BGHA 4FV4A 4WG3A 4CMTA 3MH0A 4IVCA 3NWWA 4FTKA 5H8BA 2DQ7X 3BRBA 5AP0A 4XG4A 4WG4A 3PDTA 2X39A 4GT5A 3ZBXA 3GU8A 1B38A 5JN2A 5AP3A 3Q5IA 2BROA 5DE2A 3COIA 4RX5A 3HA8A 4DEAA 2BRGA 4F7NA 2W5BA 2X81A 1FPUA 3ZM4A 3ZRLA 4E4XA 2HZNA 2VGPA 2WFYA 4CV9A 5KHXA 4I24A 4RLLA 4I0RA 2Y4IB 3DV3A 4M69A 4EYJA 5HQ0A 3HAMA 2HY81 1BUHA 4E6DA 1R0EA 2P2IA 4GW8A 4OGRA 5B7VA 4LMNA 2ZB1A 5HG7A 4QP7A 4WO5A 3FYJX 4F1OA 3RNIA 2BRBA 4FIGA 2OIBA 4FT3A 2QOCA 3NLBA 1SM2A 2A1AB 2EB2A 4G3FA 4JR7A 3MVHA 4BKZA 4RQKA 5BNJA 3G15A 4EKLA 4IX5A 3FI2A 5CLPA 1DI9A 4IWOA 5EW3A 4IE9A 3NCZA 4YLJA 4CFXA 4CNHA 4U81A 1JAMA 3W0OA 4L7SA 5BYZA 4BB4A 1MQBA 4BDIA 2WZJA 2XVDA 2F2UA 3MTFA 3Q2JA 4XNEA 3EQRA 3M1SA 4UYNA 2VWUA 3TZ8A 1UKHA 4EUTA 3R9OA 3WZKA 2Y0AA 3TKIA 3DBDA 5AP2A 2ZFYA 3W55A 4PQNA 4IWQA 1Q99A 3R7UA 3SOAA 4O96A 4X21A 4Z16A 3D7ZA 3PSBA 3KREA 4E6QA 2WMWA 1R3CA 4FTIA 4NSTA 4O21A 3LMHA 1L8TA 4HYHA 1I44A 3MFTA 1U59A 4YU2A 3HYHA 4K1BA 5KBRA 4O81A 5LCKA 3HMPA 4WRGA 3R8PA 3NAXA 4E4LA 5L4QA 2VTQA 2ZJWA 4D55A 3D7TB 4YSMA 3NW7A 3F7ZA 2XF0A 2XALA 4IANA 4GKIA 3W1FA 5HZNA 1OECA 4EK6A 4CG9A 3P79A 1Q8ZA 4OBQA 4I1ZA 2F2CB 2R7BA 2W1CA 5AR8A 3QYZA 2XNNA 4MTAA 3FHIA 3R2YA 3Q53A 3C4EA 4PL3A 2R9SA 4S2ZA 4ACDA 5M08A 1W7HA 4ALUA 5ETIA 2WTKB 1Q8WA 5FEQA 3OUNB 4QYHA 1TVOA 4I4EA 4XH6A 3V8SA 4W4WA 1XWSA 1XH4A 4A4LA 4DEIA 5CEOA 3F61A 5J5SA 4MD7E 5ITAA 3QQGA 3WYYA 4FIIA 4ASEA 3H10A 5CASA 5GNKA 3TZMA 4R5YA 2YDJA 5HE0A 4U43A 3QCXA 5CQUA 4BI1A 3R30A 4D2RA 4O82A 2QG5A 4S34A 2C1BA 2YIWA 2B0QA 2VNWA 4DITA 2QCSA 3PUFC 2CN8A 1RQQA 2JAMA 4GYIA 4QT1A 3UOLA 4PP7A 5A4QA 3CSVA 2UVXA 4GK2A 3W0SA 4IB0A 4L3LA 4ZTNA 5FP6A 4BIBA 1OGYA 4HGLA 3ODZX 5HU9A 5EM7A 3VUIA 3KVWA 4HVIA 4C4JA 2VWVA 3QD3A 2ETRA 3MSSA 4LRMA 4IZYA 4ZSEA 4Q9ZA 3NNWA 5C4KA 2PSQA 4UZDA 3C4XA 2QLQA 4FNYA 5IKWA 1H8FA 4BICA 1OZ1A 1GZOA 2R4BA 3C0HA 3OT3A 4YBKA 5TOZA 3BWFA 3L9LA 1ST0A 3BIZA 2YWVA 1UU8A 2R2PA 2GQGA 3QF9A 5LARA 4AZFA 2GFSA 4L8MA 5HBJA 5AMNA 5FRIA 1KE9A 2R0IA 3KXMA 4RWLA 3PJ3A 3VAPA 1NT2A 5A4LA 4FZAB 3W18A 1UU3A 2A27A 1OMWA 4HGEA 5KX8A 4MXYA 2RKUA 2PMLX 3NCGA 5B2KA 3RHXA 3AG9A 2WIPA 4O0XA 3VBXA 2VTJA 2XH5A 5JZNA 4BCFA 3QUEA 3LW0A 1YXXA 3BQRA 4HGSA 4FEWA 4FSWA 3G5DA 2C1AA 3KCFA 4BJJA 4HPTE 3AD6A 5CVFA 2HZ4A 4Q2AA 3ZO1A 1H1SA 3BHYA 4E73A 4H39A 3LKMA 2ZV8A 4FF8A 4QMZA 2VN9A 3EFKA 4FKPA 2C6DA 4JBQA 3PVGA 3OS3A 2RFDA 3KFAA 3LCTA 3O7LD 4D9UA 3GP0A 2WELA 4RX9A 3PFQA 5D41A 4E26A 4EBVA 5E90A 3L8SA 2DUVA 2Y6MA 3C4FA 3NUYA 4J96A 5TE0A 1IAJA 3CY3A 4I6LA 2XAOA 2HW6A 3MFSA 4PNIA 1UWHA 5J9LA 4FSTA 4TKSA 4O0YA 4FKTA 5B2MA 3E3BX 2IVSA 4YURA 3TV4A 3ERKA 4KA3A 1KOBA 3E93A 4GS6A 3COHA 4BDDA 3QQFA 3Q32A 2W1EA 3HMMA 3LFDA 5AUUA 2C30A 2P4IA 4TNDA 5CQWA 3RINA 1DAWA 1ZYSA 2NRUA 3QLFA 3TDWA 2G15A 3OROA 2QOFA 4MHAA 4YO6A 3EQFA 2ITXA 4KIKA 1REKA 3E92A 3LJ1A 4IX3A 4NCTC 2UZNA 4I20A 4U6RA 4ZSJA 4ANBA 4BDCA 4EH7A 3UZPA 4DG2E 1ZYJA 2NO3A 3DA6A 4MXXA 3V5TA 4GSBA 2E9VA 2PZIA 4FEUA 4EH5A 2UZLA 4RBLA 3OC1A 4WNOA 5DR6A 5LJJA 2F7ZE 3NSZA 2W1FA 5HESA 3LM0A 3QCSA 2IW9A 5DA3A 4EYMA 3VBVA 3UIMA 2RSVA 2R3NA 2Y4IC 3ULIA 4XV9A 4J98A 3SA0A 3UNZA 1YRPA 3QQJA 2EXMA 2GNFA 2JD5A 5K0KA 1CMKE 5CVHA 3C9WA 5AFVA 5IEYA 3UDBA 3MH2A 3RK9A 4BCPA 1T46A 2CGUA 4NFMA 3FXZA 4O38A 1BL7A 1U46A 5JK3A 4PDPA 3DBEA 2FSMX 4MH7A 3FZ1A 4PPCA 4XRJA 1JPAA 1WBWA 2BZIB 4YLKA 2PVMA 3PIZA 3SX9A 5IH6A 1PXLA 1NVSA 5E1EA 2H9VA 3P1AA 3R9NA 4OTPA 4LDTA 4IXPA 3LXNA 4L9IA 1XH8A 4U97A 3TACA 3EOCA 4O91A 3KRRA 5FQDC 1BX6A 3U87A 3ZZEA 4EUUA 4A07A 4ACHA 3S1HA 4BJJB 3NVMB 4F9BA 4KRDA 5G1XA 1ZZ2A 4EQUA 3FMJA 4RJ4A 4XLIA 1W98A 3IPHA 4OW8A 4W4XA 3QGYA 2UVZA 4K18A 3B2TA 2ZYBA 4L7FA 4LV7A 3T3VA 3I0QA 3IG7A 1CKJA 4HGTA 1K3AA 4AZTA 4J99A 5F95A 3QTRA 4G6OA 4BTJA 4ZIMA 2RG6A 3JPVA 2UW3A 4R7IA 4FKVA 1KE5A 4PRJA 4AGWA 4EHZA 4DGLC 1XQZA 4M67A 1IA9A 3HP5A 3TKUA 5CALA 2WHBA 4FG9A 2OK1A 1UU7A 3EZVA 4K33A 4V0GA 2WMBA 1PXNA 3VS1A 3VF8A 1O6YA 2YJSA 4N4SA 5C8KA 4O0RA 2PE2A 2B55A 3VN9A 5IQCA 3FSFA 4I5HA 4QYYA 2SRCA 3DBCA 3H0YA 4FTJA 3LMIA 3OF0A 5L3AA 5BYLA 2PUPA 4KIKB 3LFNA 3ANQA 3KK8A 2OZAA 5IQEA 4F0GA 5K3YA 4QTCA 1YXUA 1H01A 5F20A 5HVYA 3PP1A 2A4LA 3BV2A 2C0OA 4HPUE 4QMPA 3RPRA 1QPJA 3RK7A 4DHJA 1VZOA 4WSQA 5M4FA 4HZSA 3R22A 5K4IA 5IQIA 1PXPA 4AN3A 2C3KA 3KA0A 2R3FA 4QMVA 3WYXA 5DEWA 2C6OA 4LYNA 3TTIA 4CMUA 2R3GA 3FXXA 3UP7A 2W99B 4FTCA 4FKGA 3FZTA 3MJ2A 3QQKA 4IC8A 3PXRA 4BTMA 1R0PA 3FKLA 1G3NA 4FL1A 4FV2A 4CXAA 1WBSA 4EWQA 2QO9A 3LOKA 2PY3A 1WBOA 3QU0A 4MNEA 2C6LA 5GJFA 2R0UA 4IAYA 3WF8A 2OZOA 3L1SA 2GTNA 4CSVA 5JFXA 2QOBA 3E8NA 4FSYA 4AF3A 1BLXA 1OL1A 5BMSA 2OKRA