3QGWA

Crystal structure of itk kinase bound to an inhibitor
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
261
structure length
244
Chain Sequence
IDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIKEGSMSEDDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery and structure-activity relationship of 3-aminopyrid-2-ones as potent and selective interleukin-2 inducible T-cell kinase (Itk) inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase ITK/TSK
total genus 74
structure length 244
sequence length 261
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3qgwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3qgwA01
4PPCA 3MPAA 1VJYA 2QLUA 2UV2A 2VTSA 4YJNA 4KKHA 2VTOA 3Q6WA 1UWJA 4TRLA 5FM2A 4I24A 4I6HA 4BVUA 3Q9YA 4I5MA 4FZAB 2PYWA 3UMWA 4KUJA 3CY2A 3OP5A 4G3FA 2C4GA 2VTMA 3PSCA 4ASDA 2Z02A 3FZ1A 5GZ8A 2C0OA 3DTWA 2JD5A 4I1ZA 2Y7JA 2IZUA 4CFNA 5HG9A 4U7ZA 4PQNA 2V62A 3RVGA 3FWQA 5FGKA 3ALNA 1LR4A 4KRCA 4RA4A 4YURA 4JBQA 3ULZA 4AXAA 2UW6A 3R9NA 2W5AA 2BAQA 1JOWB 3CJFA 3QRKA 4OUCA 3EL8A 4QMSA 4AGDA 4O38A 2R3HA 1BL7A 1XKKA 2GNLA 4NJ3A 2YIWA 4J52A 4L46A 2YWPA 5K0KA 4BCMA 3W18A 4AA5A 4ERKA 5CXZA 3F3UA 4MNEB 3UGCA 3U6IA 3GU7A 3ERKA 3PA5A 3FUPA 3HRBA 4RLLA 4UBAA 5LQFA 3JY9A 2QQ7A 4NCTA 2XNOA 4FUXA 3KXNA 4U41A 2VWZA 5AADA 1Q99A 2VTJA 3EN7A 3OWJA 2B4SB 5FBOA 4H05A 1DI8A 3T9TA 2CSNA 2DUVA 2J50A 3UNKA 4GU6A 4XBUA 5HCZA 2OH0E 3RMFA 3GOPA 3QZGA 4ANOA 3OF0A 3CE3A 4C2WA 3WZDA 2VX1A 2XYNA 4IACA 4TYIA 2YEXA 2OIQA 3V3VA 3ZEWA 3OT8A 3PXQA 3UQCA 4I0SA 3LPBA 3BYMA 2WQEA 4IC8A 5FM3A 4C7TA 3CC6A 3HEGA 2OKRA 1SYKA 5AP4A 2WU7A 3EHAA 5AFVA 2ZV7A 5DEYA 3KRLA 3VHEA 4I21A 3VUTA 5BQ0A 3F5PA 4DITA 3NUXA 2XP2A 1M17A 3B2TA 4DH5A 3UVQA 2I40A 3K5UA 2KTYA 3BQCA 3RGFA 4BDBA 1PYXA 2XK8A 2JBOA 1H8FA 2JKMA 4QPAA 4BB4A 4QYYA 3ZTXA 3TV7A 2XKCA 2BUJA 3VAPA 4RFYA 3FAAA 5DH3A 4KB8A 3R9RA 2V7AA 5J7HA 1W7HA 3R7EA 3P7BA 4FIIA 5AR8A 3ZXZA 2B9HA 2VTLA 4ZSEA 5TT7A 5L8JA 2NRUA 3R7UA 3ZCLA 5CEIA 4F7SA 1OM1A 3PXKA 4JX3A 4QMWA 2VWVA 3FLNC 4FIGA 3HRCA 4Z9LA 2BFXA 2UVXA 3NLBA 3EQCA 2GU8A 1PXNA 3P78A 5EM7A 2GFCA 5E8WA 2VTPA 4CCUA 4RJ3A 3QA0A 4EK4A 4E26A 3F7ZA 2PL0A 3KXXA 2Y4IB 3MBLA 3TACA 4OBPA 4QNYA 1U46A 3ORIA 4IDTA 4DTBA 4L68A 2OJ9A 3L8VA 4YJQA 3SW4A 5I0BA 5IA0A 2EUFB 3K5VA 2AC3A 4FVPA 3EQPA 3F3ZA 1KE8A 2AC5A 4JOAA 5EG3A 5BVFA 1OL7A 3QRTA 2QHNA 1UU7A 2OU7A 1ZYSA 4A07A 3DB6A 4EZ3A 2UVYA 3R2YA 4E6CA 4F7NA 3ORTA 1U5QA 5FQDC 4RZWA 2I0VA 3TV6A 3A7IA 2F7ZE 3DU8A 3PFQA 4XP3A 5DHJA 3MPMA 2OJGA 1Y8GA 2XS0A 2EXEA 3DGKA 4UZHA 5EYMA 5A14A 2IW8A 5A4EA 4R7IA 5AP1A 3RKBA 4I0RA 3IGGA 3RK7A 4MH7A 4AQCA 5CAPA 3ELJA 4J1RA 1OUKA 1OL6A 3FHIA 3BYUA 3U6HA 5H9BA 5C03A 4DT9A 4EKLA 4MNFA 5HTCA 1CDKA 1W84A 3BRBA 4RVTA 3EQFA 1IRKA 3QXPA 3EQHA 3R9OA 3VVHA 3OMVA 5F9EA 1R0PA 4BCHA 4A9RA 3PXZA 5EW9A 3MGYA 3ORXA 3DXPA 2UZLA 1M2RA 3P08A 3RWPA 3VHKA 4M69B 2C68A 3BHHA 3HV3A 4LL0A 4FODA 5E1EA 4AZWA 2HY0A 2XNEA 5KMNA 3FXXA 4MWIA 2ZM3A 2JC6A 2VAGA 4FL3A 4FT5A 4TNBA 3KREA 3IECA 2AUHA 4NKAA 5JSMA 5IQIA 3E93A 2B7AA 5CAUA 4IZAA 5JK3A 4JG8A 4FGRA 4BZDA 3EL7A 1M2PA 1KE6A 3GB2A 4FL1A 4XV1A 5DEWA 4CLIA 4J96A 2C6EA 4GFGA 2F7EE 4GVJA 4UXLA 4FIFA 5CU6A 5F95A 3QHWA 4F6WA 3PXRA 2HENA 1Y57A 3H9FA 5E8ZA 3R1SA 4IWQA 1V0OA 2ESMA 4OAVB 3VBVA 1KV1A 4YZMA 4EOPA 3G5DA 1Q3DA 3NNXA 5J9YA 4J97A 3QU0A 3HKOA 3FXZA 1TKIA 4D2PA 2BCJA 2R2PA 5JGAA 2G2FA 5I9ZA 3H3CA 3PVBA 3VS6A 3DTCA 4BDHA 4OTRA 4JAIA 5EQYA 5AMNA 4Z7GA 3E87A 3G0EA 2W05A 1U5RA 4UMRA 3FL4A 4EHEA 2FGIA 4C3RA 5D41A 3COKA 3F3VA 3AT4A 2XH5A 1F5QA 2P0CA 4Y85A 2DQ7X 5H8GA 1M7NA 2C3LA 1FBNA 3EKNA 4BI2A 4LI5A 2XB7A 3VBWA 3MB6A 4EH3A 1H24A 4BDGA 3MPTA 4E73A 3D15A 3KK9A 4NZWB 5ETFA 2XJ0A 3QWJA 3R7GA 4W4WA 3QYZA 4E5AX 4X21A 1PKDA 3ZH8A 2Q0BA 5EI6A 3MH3A 1OIYA 2B9IA 3FKLA 2OXDA 1L8TA 3VBXA 3PWDA 3HYHA 5I9UA 4Y73A 4DC2A 5GJDA 4EHGA 4G3CA 4LGGA 4D1XA 3CQUA 1G8AA 4HVHA 3BI6A 2CDZA 3LCKA 4MXCA 2V5QA 4QOXA 3R01A 3TKUA 4FZFB 4MQ1A 5FTQA 5JH6A 3HUBA 4U8ZA 4BHZA 4BGHA 4IZ7A 1ZRZA 4U97A 1PXIA 3EN9A 3NS9A 4O7LA 2ZV9A 3FMLA 4FV2A 2IVVA 5FD2A 3QRUA 2PULA 3EH9A 5A6OA 4HPUE 4LYNA 5M4UA 4XV9A 4D28A 3MV5A 2JAVA 4IW0A 4BHNA 4N4SA 5HIDA 2W7XA 3IPHA 3QKKA 3AOXA 1J7LA 4QMXA 3AT2A 4BFMA 3QQJA 1PXJA 4DA5A 2YIXA 4ZZNA 5C4LA 3RHXA 4TKSA 3LJ0A 3MS9A 1A9UA 1OIQA 2XIYA 5HD7A 2CNVA 2UZTA 3F6XA 3MY1A 3RBWA 4BDIA 3ZZEA 4D2VA 2ITZA 2GNFA 2Y6MA 4TY1A 5E8XA 3P5KA 4DCEA 1OBGA 4JNWA 2EVAA 3D4QA 3NWWA 4EQCA 2HK5A 2QO9A 2CGUA 4EWHA 4H3PA 2B53A 2WNTA 4ZP5A 4E7WA 3VF9A 5ACBC 3WF6A 3VF8A 4CVAA 3LFNA 4L45A 4U80A 4MXAA 3V5LA 5HBEA 5BVWA 3VBYA 2W9FB 1ZARA 3MSSA 4FICA 4HZSA 4YJUA 2QCSA 2ZAZA 4FKRA 4YJVA 4XG2A 5DR2A 4R7BA 5E7RA 4FV3A 3RM7A 3TNIA 3BQRA 2PZIA 4G6NA 3HP2A 3VS7A 4YR8A 4AFJA 3DKFA 3VJOA 4RVKA 2WGJA 5IU2A 1ND4A 2EB2A 1Q24A 3R9HA 3E5AA 3DBEA 1FPUA 3FYKX 4JG7A 3IW6A 3ODYX 5BVKA 4P4CA 4BBFA 4UMPA 3O8TA 5D10A 3PJ8A 3COIA 2QOIA 4XS2A 4XG4A 5AAFA 2WQBA 2XKEA 3UZRA 3WZJA 2X7OA 1YHWA 1LPUA 3GOKA 3S0OA 2RL5A 1M52A 1R39A 1VEBA 2J0MB 3LVPA 4I0TA 3QTXA 3R9DA 5GIPE 3OCBA 1ATPE 2WTDA 3GCPA 3DXNA 3QQUA 3CXWA 5ICPA 4M14A 2FVDA 4EH5A 5AUTA 4ANMA 3M2WA 5KHXA 4DFLA 4ZJIA 4MF0A 4U81A 5GHVA 3VS2A 4EHVA 3AG9A 4NL0A 3DK6A 2WTVA 3JXWA 5J8IA 3UTOA 2Z7RA 5ANIA 1RJBA 4FSTA 3HNGA 4HPTE 4RZVA 1BI8A 3D9VA 2QOBA 3LCOA 1PJKA 2VX3A 5DA3A 3U6JA 5KNJA 4EOSA 4DGOA 2PPQA 3UODA 5CSHA 5HE0A 4DGNA 1YQJA 4IAZA 4AG8A 4CMUA 4JL9A 3SQQA 5CTPA 4RPVA 5HVKA 1OIUA 3NW7A 4QMZA 3I79A 3PVGA 4HGLA 4LRKA 4CZTA 5IEYA 1W0XC 4IM3A 4DEBA 3HV6A 4JIKA 5CAOA 5TF9A 2GHLA 4QT1A 2QOQA 4GCJA 4O82A 4C57A 4XV3A 4UYAA 4KSQA 1ZLTA 2J0IA 2HAKA 3Q9WA 2UZBA 3QTUA 4F7LA 3LFAA 4YJOA 4I22A 1ZOEA 4H58A 3GUBA 4M69A 4F1TA 4S34A 2GQRA 2VGPA 4RX8A 4UN0C 2B52A 2VWUA 2XNGA 3BU5A 4PRJA 4ZTRA 4C4FA 2PVLA 1VR2A 1R78A 4PMTA 5AP5A 5JFWA 4NH1A 1R3CA 5HBJA 3I7CA 5L8LA 1P4FA 5ANDA 4OW8A 3DDPA 4IXPA 4Z7HA 5FBNC 4FKWA 3TUCA 4UWYA 2W1FA 3F61A 4O6LA 3U9NA 4WNOA 2XBJA 4O27B 4LV5A 3MVLA 4GK2A 4AA0A 3C4ZA 1FMKA 1TQPA 3NNUA 2QODA 4YHJA 4DF3A 3I1AA 3LM5A 4JG6A 4L42A 2BDWA 2HZ0A 4FZ7A 4CQGA 1J3HA 1KSWA 4D4SA 3DK3A 3UZTA 3EZVA 4EOIA 2C6DA 4APCA 3ZMMA 1JSUA 1YWNA 5BVNA 3PLAE 4A9YA 3RALA 4FKJA 3W33A 2W4OA 4BCPA 3EZRA 1O6LA 4FKLA 4FTCA 5AUXA 2RFEA 3LMIA 3KY2A 2BR1A 2GQGA 3ROYA 4Q2AA 2W17A 4BCKA 4A9TA 3DZOA 3QLFA 4V01A 4FK6A 4XG3A 4IM2A 3ZM9A 2OFUA 1UKIA 3I0QA 4CYJA 3VUDA 3UQFA 4GJ3A 4P5ZA 3BEAA 1OB3A 4WSYA 3ULIA 3PY1A 1HCLA 2XNBA 1H1QA 2GFSA 4FNWA 1SVGA 4LMUA 1WCCA 3ANQA 2CNUA 2VZ6A 4JBPA 5J87A 4AOTA 4K1BA 4TWPA 3O96A 3R7VA 4EH2A 4GKIA 3HL7A 4U6RA 4EEVA 3G6GA 5IEVA 5ETIA 4FSUA 3AC2A 3UZPA 2PMNX 3LFSA 4FUYA 4WNPA 1UVRA 5HESA 1H4LA 3NIZA 4L00A 3SX9A 3BLHA 4Y5HA 5FEEA 4USEA 2GHMA 4QMPA 2HW7A 3ZZWA 1A06A 2VV9A 4AZEA 4D5HA 4NM3A 2JEDA 3JVRA 2XK4A 3E62A 3KMWA 2R3FA 1GAGA 4W8EA 3UP2A 2B54A 4Q5HA 4QP4A 3BYSA 3OWLA 5AV1A 5F1ZA 5D9HA 3SAYA 5HGIA 4JRNA 4TL0A 3IDPA 4DN5A 2R3NA 2O5KA 2OICA 5HNBA 3FLYA 4QTCA 3DY7A 4FV8A 3WYYA 2QOHA 1G8SA 2WOTA 3MVJA 4TT7A 3RAKA 2V7OA 3PIYA 4EOLA 1MP8A 3PG1A 2XKDA 5AUYA 4GVAA 4CD0A 3OXTA 1H26A 1UNGA 5EYKA 4JDJA 4O2ZA 4F9BA 3TIYA 1PKGA 2XCHA 2ZDTA 4J53A 5CF5A 4ZIMA 5K0XA 5L2WA 3OOMA 3P9JA 2R3PA 3F5GA 5DVRA 5EW3A 3WBLA 4FYNA 3VULA 2OW3A 4NJDA 4X3FA 4FSMA 2GQSA 2PUPA 2IO6A 2PY3A 4R1VA 5LCJA 5C01A 4AE6A 1A48A 2QKWB 3EIDA 3FY0A 3NRMA 4EK5A 4MX9A 3VUHA 2CKEA 2EB3A 4MXOA 4H3QA 4RGJA 4UV0A 4C59A 5JKGA 4BR3A 2ZM4A 3R63A 4CMTA 4QMNA 5GZAA 4DFUA 4FKUA 4PX6A 2H9VA 2GHGA 5CF8A 1YDTE 4I6FA 4QTEA 2WTKB 4PDPA 4R5YA 4E5WA 4DH3A 1Z57A 5AIRA 5ANOA 3OCSA 3D5XA 2FSOX 1YKRA 1JKTA 2VNYA 1PMVA 1J1BA 3C0IA 2ZOQA 4OR5A 3ZLSA 4ANSA 1FVTA 2HZIA 4EWQA 3KFAA 2C5VA 3TJDA 4RIYB 2C6MA 3AGLA 3QTZA 2WTCA 4P7EA 4EH8A 1OKWA 1Q8TA 4A06A 3DZQA 1ZYCA 4P5QA 4JI9A 3DAJA 4EQMA 1OIRA 3MVMA 1NXKA 4U79A 5EHLA 3TZ9A 5IEXA 5IA4A 2O2UA 2HWPA 1Q4LA 3AC5A 2RG6A 5BVEA 4D2WA 4DTAA 2W4KA 4X2GA 2JAMA 2PTKA 3M42A 3MTFA 4ARKA 4DG3E 3BHUA 4YTFA 2XMYA 4YJTA 5IA1A 1FOTA 3ORLA 3KF7A 3PSDA 1X8BA 3PXYA 3R22A 4TXCA 4ZJVA 2CPKE 5HLNA 3O7LD 3VC4A 1DAWA 1F0QA 4CQEA 4IZ5A 4GT4A 3CEKA 2YM8A 1JKSA 3NZ0A 1Q62A 4O81A 5AM7A 4DFYA 3UBDA 4GIIA 3ACKA 3VS0A 3I5ZA 3BGQA 2YCQA 3TWJA 2ZM1A 3UO6A 4CYIA 5FXRA 2YJSA 4EJNA 2R3KA 4XH6A 2NPQA 3PSBA 2OG8A 4YTHA 2JLDA 4C4JA 5K5XA 3CBLA 3I81A 1QCFA 5E91A 5JRQA 5ANGA 4FEUA 5FEQA 1ZYJA 1SM2A 2W1CA 3JY0A 4IADA 2XNPA 5AM6A 1J7UA 2X9EA 5AX3A 1CKPA 3C50A 3R83A 1MRUA 1XHAA 4H1MA 3HLLA 3RNIA 3LIJA 3IW8A 4G9RA 1BI7A 4O86A 2OF4A 2YCFA 2O0UA 3FEGA 3KL8A 4S30A 4MWHA 4DEEA 1XH7A 4BDKA 4EI4A 4HVDA 5IDNA 3LW0A 3QRJA 4H3BA 3PJCA 3QD2B 2BHHA 3SHEA 4LGHA 4M8TA 4C02A 5CASA 4R1YA 5ETAA 3EJ1A 3NUPA 1KV2A 2X2MA 4PL3A 4CNHA 4PTCA 4G3DA 3L1SA 1P5EA 2ZVAA 1UU3A 3O23A 3FZSA 2HCKA 4M0ZA 4QMOA 4QMVA 5EHOA 3RP9A 4O7ZA 4LL5A 2E9OA 5L6PA 4IX5A 5HG8A 2C1BA 5A54A 3OY1A 5CT7A 2XIKA 1JVPP 5DR9A 3TI1A 4F1OA 3DJ6A 4PDYA 2X8IA 1FGIA 5HTIA 3V01A 4RJ8A 3QLGA 4FIHA 3ZM4A 3EQGA 4B8LA 2XIRA 1S9JA 5I9WA 5JGBA 4FEXA 2WMAA 3DS6A 3DBDA 3FKOA 5LMBA 3FI4A 2PUNA 1DM2A 4KIQA 4NTTA 4EOJA 4QP3A 3UMXA 3HAVA 5BMSA 5HO8A 1WBOA 3E8NA 3P7AA 4GYGA 4F99A 3GNIB 4MCVA 2P4IA 2W0JA 3O8PA 4BKJA 3RAWA 1NA7A 4RIWB 1UNHA 4E3CA 5M53A 3ZLWA 1NVQA 3KQ7A 2J0KA 4HNFA 4YPSA 3R8VA 5HICA 5KE0A 5JZNA 1DAYA 4EONA 5KMIA 4CFWA 4O84A 2R64A 2V22A 4EUUA 4AN3A 5KHWA 1XBCA 1L3RE 5CEOA 5HU3A 3NYVA 2XRUA 4MD9E 3NAYA 3FZRA 1H25A 2PWLA 3CP9A 3M1SA 4PMMA 2I7QA 3FDNA 5AUUA 3D7TA 3G9NA 4F9YA 5E8VA 5HO6A 2YA9A 5EK7A 4NUSA 3BEGA 4MAOA 4QQ5A 5FG8A 4EC9A 4IVBA 4L52A 4L3JA 2ITXA 5A4CA 2BVAA 4C4IA 4H39A 4OAUC 3BWJA 2W1ZA 2YACA 4BTKA 2QR7A 2R7BA 5L2TA 4V04A 5DNRA 4ZLYA 2GS6A 5BYZA 3RINA 3IDBA 3OVVA 1ZMVA 3LQ5A 5L4QA 3P23A 3AC8A 3HMOA 3NUYA 3FPQA 2XCKA 1Z5MA 1IR3A 3BE9A 4DBNA 5KMJA 3G0FA 1OECA 2XA4A 5EDQA 4C61A 4DEDA 3QF9A 3OXZA 1URWA 2ERZE 5HLWA 3TKIA 1PXKA 1PHKA 1WBSA 4HVSA 4PPBA 2QOOA 4RJ6A 2YCSA 2XK9A 3FL5A 2XM8A 5LWNA 1PXPA 2GNGA 1GIIA 4EH4A 2Y8OA 3QKLA 4MNEA 4XG8A 4FL2A 4C58A 3OBGA 3PRFA 3V04A 5EKOA 5HCYA 4CT2A 2F49A 1AGWA 4X2NA 3FI2A 5LVPA 3IKAA 5IQAA 5CNOA 1U54A 5FRIA 3OTVA 2W96B 5J7BA 3HV5A 4XLVA 5JZJA 4KSPA 3FQHA 3EFJA 2IZTA 3IW4A 3TZMA 5IZFA 1J91A 4D0WA 3RAIA 4KBKA 1QL6A 3FBVA 4RMZA 1H08A 3ORNA 4O0XA 4IAYA 2JKKA 4FA2A 3CPBA 5EW8A 3PJ1A 5L2SA 3PZEA 1CTPE 4CZUA 3A4PA 4L01A 3HA8A 2OIBA 4NW6A 4DGLC 3FJQE 5TO8A 2R0IA 2R9SA 3I4BA 5LCKA 2C5OA 2C1AA 5FUTA 5J9LA 2OK1A 2C3KA 4PY1A 4U40A 3ZOSA 2VRXA 2QI8A 4IM0A 3CY3A 2UZNA 4O0VA 2JFLA 3VS3A 1QPJA 5EDPA 3WIKA 3TM0A 1QPDA 2A19B 2R0UA 3I5NA 4EHZA 4JVGA 5HOAA 4ACCA 3QTRA 4DBXA 4DINA 2OLCA 1FVVA 2ZV2A 3KN6A 3VIDA 4UWCA 2VWBA 3VQHA 3OROA 3V51A 4UEUA 4ANBA 4JDIA 4RT7A 3C4EA 4FKVA 2VU3A 3AMBA 1YI3A 3AD5A 3NX8A 4KA3A 4UALA 5L6OA 3ZUVA 4H36A 1CKJA 2ZJWA 4R7HA 3S1HA 2WMBA 2VO6A 1W8CA 3DNEA 1DI9A 4NSTA 4I94A 3FLZA 4RX7A 4X6RA 2G2HA 4YP8A 5JFXA 3VJNA 3FMDA 4X3JA 3C5UA 2X0GA 3HMIA 2W1GA 4I92A 5EI8A 5FDXA 4P2KA 4BI0A 4ZTHA 4E4MA 4I6QA 3FQEA 3R1NA 4GL9A 3Q4CA 4K2RA 4K77A 4OTPA 2FYSA 3LXLA 3VUIA 2WEVA 2JFMA 3C4CA 3POOA 4C4GA 5HD4A 4GH2A 4KIOA 3BBTB 4ZY6A 1WVYA 3OWPA 3F2AA 5DFPA 2PVNA 2C6OA 4KS8A 2R5TA 1PMEA 4DEHA 2OSCA 2DYLA 4KWPA 5C26A 2BKKA 4ENXA 3BELA 3QX2A 5C4KA 1O6KA 4JXFA 5FTOA 2R3JA 4M67A 3KULB 4YZ9A 5KMLA 4IDVA 5CSXA 2FO0A 2JDVA 3FMMA 3P7CA 4FGBA 3UVRA 3H0YA 4D4VA 1XJDA 3KXHA 4I5HA 3H9RA 4X7QA 3RPSA 2R4BA 3DKOA 5GIOE 2QO7A 4W4XA 2CGWA 3GU5A 5J5SA 4X2JA 4A7CA 5C27A 3RI1A 3IG7A 3KVWA 3UNJA 4ASEA 3AMYA 4RA5A 3ZC6A 2XK3A 2Y9QA 2GNJA 4RC2A 3E92A 3MJ1A 2ERKA 2UZVA 4HCTA 4CLJA 4O1OA 1IG1A 2OJJA 2OZAB 3O7LB 4DFBA 3R1QA 1H07A 4FX3A 3ZO4A 5DT3A 5AP0A 4ONAA 5AAGA 4ZS0A 5LMKC 5DYJA 2VO0A 3DQWA 3E8DA 4F09A 4AF3A 3TNHA 3DAEA 3W2QA 2P55A 2PZPA 3S2PA 5GZ9A 2UW8A 4IAAA 5HEZA 3F69A 4ZSLA 2W1HA 3SOCA 3QQHA 3UIMA 4EORA 2WMVA 2YM5A 3ORKA 2JIVA 4FNZA 4KIPA 4ORKA 4F0IA 4B4LA 4NKSA 4KINA 1OKVA 2WQMA 2BALA 3A60A 4BCQA 3REPA 4BKZA 3DLSA 4B6LA 3QHRA 5ANJA 3Q4TA 4F08A 4AGCA 5AA9A 3TL8A 4FZ6A 3UNZA 2GS2A 4FKSA 4JJRA 1JQHA 3R1YA 3BU3A 4QP8A 5HE2A 3SVVA 2WTKC 2O65A 4OBOA 3U8WA 3SXFA 4G3GA 3WARA 3ZRKA 5M4CA 2X8EA 5CX9A 5B2MA 5DMZA 4FEQA 5KMOA 5BVDA 1PY5A 3COHA 2PE2A 4L8MA 4O7WA 2ITUA 2Z8CA 3WIGA 4F1MA 4MEDA 1BLXA 3VUKA 3L9NA 2YLFA 4X3FC 2J0JA 5AR2A 4AACA 4CCBA 2CLXA 4I6BA 4RX5A 3TEIA 3K3IA 1YOLA 3PP0A 4QPSA 3WYXA 4ASXA 4WRGA 4UX9A 4GMYA 1Q8UA 3WF7A 2OO8X 3KN5A 3PRIA 4YBKA 3RM6A 4E4XA 4LM5A 1SNXA 4QYEA 3ZFYA 5JN2A 4IZYA 4L7FA 1WAKA 4XYFA 3TNQB 2WMXA 5F4NA 5I4NA 5IISA 5HIEA 5M4FA 2OH4A 4BC6A 5BNJA 5E1SA 4CFXA 4QMYA 5B2LA 2WXVA 3FMKA 4KKEA 2R3QA 4D5KA 2J2IB 4W8DA 4XHKB 4WA9A 3DKCA 1EH4A 3D0EA 4AT3A 4HVIA 4YZDA 3OT3A 4E1ZA 3KF4A 2YM7A 5I5ZA 1RE8A 3WE8A 4MF1A 3PPKA 3W8QA 3A7FA 3E63A 3E8CA 1CMKE 2JDOA 2OJIA 2Y4PA 3UO4A 2NO3A 4QMQA 4JS8A 4FT0A 3Q3BA 3IGOA 2BDJA 3H0ZA 1WVWA 2YITA 3OC1A 1FGKA 2X1NA 2ONLA 3Q6UA 4C35A 2FH9A 4FTUA 3UJGA 4AGUA 3KCKA 2J9MA 4RIOA 4O7SA 3O8UA 4CSVA 3LFBA 4JDKA 3SKCA 4BIEA 4J8MA 2PSQA 4TYGA 4DFZE 3W1FA 2WB8A 3BGPA 3AGMA 4OLIA 1H1RA 3RK5A 3HAMA 4G31A 5HU9A 3QXOA 4KD1A 4AE9A 4FSWA 4GKHA 4AUAA 4FKIA 4DH8A 4ZSGA 3EQBA 3OOGA 4J98A 4IH8A 3OUKA 4TZRA 1Z9XA 5JMSA 3FMHA 5EQPA 3UE4A 2IN6A 2WFYA 4J7BA 3SLSA 3TNPC 4ANLA 2XEYA 5IDPA 1OUYA 5LWMA 1V0BA 4BIBA 2ITWA 2W5HA 3GCSA 5J9ZA 2CN5A 1JBPE 4EH6A 5IPJA 4FEVA 3QD4A 4HYSA 5AR3A 1G5SA 2R3RA 2QC6A 3FC1X 3FLSA 4IJPA 4OTWA 5BVOA 5D12A 5CEKA 4M0YA 3DBQA 4C4HA 2XZSA 5KCVA 4HYUA 4S2ZA 4AFEA 3GCVA 2W1IA 1WBPA 3QQKA 5M51A 2J51A 4ZY4A 1I44A 4HYHA 4ZS4A 4K6ZA 4R6VA 3Q52A 2ITTA 4XLIA 2X6EA 2VNWA 3V5JA 2QG5A 1O9UA 4BY9E 1UU8A 3DKGA 5DRDA 5L2IA 2BRMA 4YBJA 4ZY5A 3MN3A 4ITIA 1FQ1B 4XX9A 2VTAA 3MVHA 3RHKA 3PA4A 2Z2WA 4YMJA 3BV3A 5FXSA 5DG5A 3OEZA 1FVRA 3GU6A 3MY5A 4UZDA 5CEMA 2QOKA 4X6QC 2Y6OA 4MK0A 4F63A 5D1JA 3COMA 4IANA 5KX8A 2WMRA 3CQWA 5B0XA 3Q04A 3G90X 2IVTA 1OKYA 2WTJA 4IAFA 1H01A 5CZIA 4AZFA 4A9UA 4NU1A 4I5PA 2J90A 3EB0A 2QOCA 3IS5A 5EKNA 4GSBA 4WHZA 4N70A 3SRVB 3KEXA 3LFQA 4JIAA 2FUMA 4U3YA 4C2VA 2VO7A 4GW8A 4TWNA 3EFKA 4Q9SA 4BDAA 2QHMA 5DI1A 4WUNA 1Y6BA 3CGFA 4F4PA 4EOQA 3F2NA 5IH5A 4AOIA 1WMKA 4IWDA 1MQ4A 4FKPA 2R3OA 1Q8ZA 4PTEA 3E8EA 5A3XA 2BAJA 4FG7A 3GQLA 4IEBA 5IA3A 4XRLA 4JRVA 2WAJA 5AP2A 2W1DA 4ZAUA 4CGAA 2VWWA 4FZDB 5AWMA 2XF0A 3MH2A 4CEGA 2E9PA 3DJ7A 3FV8A 3TDWA 3FYJX 4KIKA 3DBCA 2H96A 3UIXA 1NW1A 5BPYA 1QPEA 4ITJA 2PVKA 4ITHA 1YDRE 3AQVA 4CFMA 2BPMA 5JFVA 4I5CA 1OITA 3HDMA 4NCTC 4IX3A 2QLQA 3CTQA 4E4LA 2ZB0A 4QNAA 4WRSA 3TKHA 4ZLZA 4EZ5A 5BYLA 1JKKA 4V0GB 4QRCA 2UVZA 2YIYA 3MFSA 4UYNA 5GJFA 3SW7A 5LVLA 3DJ5A 5K3YA 2WQNA 3EKKA 2XIZA 4IB1A 3GC0A 4ANQA 1ZMWA 3KRJA 3EMGA 3VUMA 3O17A 5DPVA 4FSZA 3TNWA 1WFCA 3CSVA 4FNXA 5K4IA 4E6DA 5H8BA 2I6LA 2IWIA 2PUUA 4UB7A 4YZBA 4HNIA 4MBLA 3VS4A 5HVYA 3NYOA 3NNWA 3ZFXA 1XH4A 2BTSA 2R3LA 2WMTA 3U55A 3BKBA 4QYHA 1Q97A 2CJMA 2UW5A 3ZLXA 4QO9A 4EH7A 2QVSE 3LAUA 3PE2A 5EM8A 5JQ8A 3C0GA 3Q4UA 1SVHA 3BYVA 1O6YA 2ETKA 3KMUA 3GCUA 3QZIA 4I23A 4IVAA 4I3ZA 4AN2A 5HNGA 3TT0A 3RCJA 3ATSA 2BIKB 4X2FA 3MFUA 1M2QA 2C69A 4PL4A 5AX9A 3TDVA 3C5IA 3R8PA 3UPXA 2R3IA 3R7OA 5FDPA 3P1AA 3OCGA 2G01A 2YCRA 1ZY4A 3UO5A 3TV4A 5EM5A 4FK3A 4O0YA 3CTHA 4TWOA 3FHRA 5CQUA 5AR5A 5L8KA 3HP5A 3EWHA 4IIRA 3FZOA 5B2KA 1E9HA 4FG9A 3SG9A 3TUBA 2V55A 3QQFA 3R7IA 4MD7E 3UIUA 4RWIA 4D2SA 4F65A 1XH8A 2ONLC 5AUZA 4S32A 4LRJA 3UOKA 2XNMA 5M44A 3SGCA 5IQEA 2ITOA 4AA4A 2VUWA 3CIKA 5EM6A 4IAIA 5JFSA 3E88A 1TQMA 4L43A 2QO2A 1Q8WA 1OPLA 3GXLA 4RVMA 3VBTA 5M56A 3UC3A 1UA2A 2QU5A 4RJ7A 1T46A 3UC4A 1SZMA 1NVSA 2A27A 1ZZ2A 4V0GA 3MWUA 5E4HA 1ZZLA 4P90A 3ZUUA 4XUFA 1JSTA 2YERA 3PA3A 5M09A 4D55A 2NRYA 5CANA 5GNKA 2WMWA 5EQEA 4D1SA 4LV8A 1XR1A 1YXXA 3T9IA 3KMMA 4BBEA 3FZPA 3A7GA 1GZ8A 1ZAOA 4KKGA 5CI6A 4O7VA 2G2IA 2HZNA 1GY3A 4IFCA 2B0QA 2WMUA 1BKXA 3NEWA 3LLAA 4BDCA 4HOKA 4ALWA 4BI1A 4EYMA 2OGVA 4AZSA 5HQ0A 3OBJA 3MI9A 1GZOA 4WKQA 4RX9A 4R77A 2IW6A 5LOHA 4FTIA 2I0YA 3A7HA 4JDHA 4JR7A 2ITNA 4QQCA 1UWHA 2XIXA 4K0YA 3NR9A 3U9CA 4CFFA 5L3AA 3BBWA 3UOHA 2X6DA 3LKMA 1B6CB 4LRMA 3QZFA 1TQIA 4O7NA 2WOUA 4WUAA 4HJOA 3WF9A 3FI8A 5CZHA 3VN9A 3ALOA 3QFVA 5LMAA 2VTIA 3IOPA 2XEZA 5E8TA 2YM4A 5BX0A 4FOBA 5HI2A 4PNKA 5EOLA 5HX6A 3E3PA 2C0TA 1PW2A 3NW5A 3A8XA 5LVNA 2R7IA 2CLQA 1KWPA 2PE1A 4UWBA 4YNOA 3BU6A 1ZYDA 2XBAA 3LJ1A 4WT6A 2WZJA 3E7VA 4IBMA 2BRBA 4YHFA 2G15A 4QP2A 4F7JA 3FKNA 3FMJA 3ORMA 1G3NA 3GU4A 4NK9A 2WPAA 4RFMA 2V0DA 4FTQA 2A0CX 1P2AA 2O8YA 3DCVA 3IK3A 3BWFA 3C4FA 5CSWA 5A4TA 4DTKA 3AD6A 4YLLA 5H3QA 3Q2MA 2QURA 4DFNA 3BX5A 1H0VA 2EXCX 5IQFA 3PJ3A 4A9SA 3R00A 5H2UA 2YDJA 4L67A 4E6AA 5CI7A 3RZFA 3L8XA 2QNJA 1T45A 3GQIA 3LMGA 5IA2A 1UV5A 4FVRA 2A2AA 5CSPA 3FI3A 1BYGA 3KXZA 1MUOA 4XP0A 4K18A 2XNNA 4B0GA 2WU6A 4ASZA 1H1WA 4NIFB 5HTBA 3EQRA 5JEBA 3PVUA 3TJCA 3TG1A 3IW5A 3NYNA 3VRYA 3LJ2A 4CTBA 2VTRA 2X9FA 5CAQA 1OPKA 2CGVA 2VX0A 3MFRA 2H6DA 4GFMA 4ZTQA 5TR6A 3UQGA 4O21A 4JQ7A 2WEIA 2BFYA 4MYGA 2P33A 4NM0A 2GS7A 3BHTA 3PYYA 1ERKA 4PDOA 3TN8A 2W5BA 4U9AA 5LVMA 4BCGA 3BGZA 3LHJA 3UVPA 1U59A 3K3JA 3V5PA 2PUIA 5T3QA 4M68A 4BICA 3W2SA 3W10A 1E1VA 1HOWA 3Q32A 2CHLA 3QX4A 4NEUA 4YC6A 1PMNA 4BTMA 4DG2E 3Q96A 3KRWA 1YRPA 4RFZA 2X7GA 4FT9A 5DWRA 5CF6A 3U54A 1WBNA 3I0OA 2UZDA 4G16A 4FV7A 3QCYA 2BZJA 3O2MA 3QCQA 3QA8A 4QYGA 4WNMA 3W2OA 3WE4A 5KKRC 4FTMA 3ID6C 4Y46A 4FT3A 3RCDA 4FIJA 4AT5A 1TVOA 3D5WA 2YJRA 4LFIA 4QMLA 3OCTA 4GFOA 3EYGA 4RIYA 4U45A 5CU3A 3NUSA 3LCTA 2F2UA 2GPHA 3F5XA 4MHAA 5KBQA 1Y8YA 1YWRA 4QD6A 3NUUA 4WBBB 4RBLA 2FSMX 3L9MA 4JX7A 1K3AA 4ZXTA 5LJJA 4F70A 4GUBA 3UDBA 4XRJA 2Z7QA 2EWAA 4EJ7A 3I7BA 4DH7A 1F3MC 2IVSA 1XH5A 4MQ2A 5IQDA 4YU2A 3NCGA 4TTHB 4GEOA 5DT0A 3BV2A 3NNVA 3GBZA 3NIEA 3O51A 2PVJA 4XNEA 5D7VA 3SXRA 4YPDA 4AX8A 3ACJA 3NAXA 4YGAA 5DLSA 4O7YA 3MIYA 2VTTA 5FEDA 5IMXA 3VQUA 4KRDA 4QMTA 4YLKA 3AC3A 3A8WA 4AU8A 4L7SA 4AW0A 3B8RA 3C0HA 2QOFA 5T6KA 2FB8A 4DH1A 4R8QA 4JBVA 2Q83A 3DAKA 3LMHA 3OTUA 3T3UA 5BUEA 5FTGA 2R3MA 1RDQE 3HGKA 4NM5A 5IQGA 4EK3A 1SMHA 3TXOA 5JT2A 1I09A 3Q2JA 4HCUA 3MESA 5CQWA 4QTDA 4QPMA 3TTJA 5KZIA 3RWQA 2UUEA 4YO6A 4JLCA 3W55A 4YJPA 1RW8A 2PVRA 5K9IA 4OT6A 4TPTA 4OTDA 2EXMA 4FMQA 3F3TA 1JWHA 2C5NA 4CRLA 4B9DA 4BL1A 4W4YA 2QOLA 2YZAA 2PMIA 3LE6A 3QALE 3ANRA 2WTIA 5EYCA 1XO2B 4XV2A 1YOMA 1OL2A 3S4QA 2O63A 2C5XA 2PE0A 2VTHA 2CCHA 4CG9A 5C8MA 3S3IA 4LOQA 4DCAA 1BX6A 4Z16A 3CR0A 3PE1A 4U44A 5CENA 1VYWA 3VUGA 4FTNA 3JYAA 2HWOA 4YSMA 2B9FA 2J5EA 2YIQA 2C6KA 2HZ4A 2RKUA 3II5A 4RC4A 3RPRA 4ZMEA 1B38A 1JKLA 2JBPA 2WMQA 4M15A 4DHFA 3LOKA 2CCIA 2WIPA 3RPOA 3WILA 3QZHA 1YI4A 4W9WA 2YM3A 5TE0A 3KU2A 4IWPA 2OXXA 4NIFA 4KIKB 2DWBA 3UYTA 4ZZMA 2Y0AA 1REKA 3MFTA 2J4ZA 3GT8A 1XWSA 3HRFA 4ANNA 4O0TA 5AR4A 2VD5A 4BCFA 2OI4X 1ZOGA 3F88A 4NTSA 3FQSA 4CRSA 3QQGA 3VS5A 4X2KA 2LGCA 1JNKA 1Q3WA 4M66A 4C62A 4EH9A 5C1QB 2EU9A 2RF9A 4DEGA 3AC4A 4FTKA 3UG1A 2ETMA 3F66A 4PP9A 2JDTA 3DXQA 4QQJA 3GCQA 3R02A 1APME 2PZRA 2X81A 4NWMA 5DOSA 3N4UA 1PYEA 2FSTX 2QR8A 4GK3A 5KUPA 3WOWA 3ZS5A 4AS0A 5J95A 4DLJA 4ZTLA 4TYHB 4BYJA 3NVKI 4DGMA 4HGSA 4AP7A 5H8EA 1WZYA 4QYFA 1XBBA 2UW7A 4IFGA 3KA0A 4YO4A 4O0WA 3D2IA 1P4OA 4K11A 3TUDA 4YNEA 3ZSIA 2CKOA 4M7IA 3JR1A 4XG9A 4LOPA 4C3PA 4IJ9A 4BRXA 4TN6A 3PUPA 4S33A 3QCXA 4XOZA 4YJRA 4IVCA 1AD5A 3G51A 3CS9A 4FSRA 4FV5A 4BTFA 3NGAA 3KC3A 5CU4A 5AR7A 5DN3A 3PP1A 3HMNA 1QPCA 4GT5A 2QG7A 4R78A 4C36A 3QGWA 4OTFA 3F7WA 4RWKA 5CVFA 3ZO1A 4O0SA 5CSVA 3PDTA 3QQLA 3SG8A 4YSJA 1KOBA 2GCDA 2CN8A 2IJMA 5JRSA 3ZDUA 1FMOE 1Y6AA 2J5FA 4BBMA 3NW6A 2WO6A 5HNIX 3PY0A 2RFDA 2WD1A 5ETCA 4CXAA 2RG5A 3FMNA 4GJ2A 2XRWA 2X8DA 4J8NA 4PV0A 3U4UA 3V8WA 1R1WA 3VNTA 4EOMA 2ZV8A 4CZYB 3R2BA 3QRIA 4OBQA 3MW1A 4FOCA 4FKTA 4FE2A 3OFMA 1RQQA 4UMQA 3UPZA 4JR3A 2UW0A 1UKHA 1YHSA 4UXQA 3I6WA 1YI6A 3ENMA 4FC0A 3SDJA 4CMOA 4S31A 3Q5IA 4B8MA 4BIDA 3Q53A 3M11A 2QKRA 3D7ZA 3OY3A 3F2RA 4AGWA 3PG3A 2YHVA 4MXYA 4F0GA 3IOKA 4RRVA 5CY3A 3C4XA 2GNHA 5DT4A 3R71A 1IA8A 4IB3A 1YXVA 4L3PA 3OZ6A 2W4JA 4EYJA 4BGGA 2C6TA 2BZKB 4WIHA 1OPJA 2YAAA 4FI1A 3DT1A 5AV3A 2GNIA 2X7FA 3ZYAA 4G3EA 4D2TA 5KZ0A 4PNIA 4RIXA 3W2CA 4CKIA 4EQUA 4YTCA 4RIWA 2VTQA 2NP8A 4YZNA 3BZ3A 4BZOA 2JDSA 3E7OA 5F20A 2WHBA 3GC9A 3G6HA 2HOGA 4BN1A 4BWPA 3OW4A 2ZDUA 2BROA 3A7JA 4FTLA 3R73A 4D9UA 4MVFA 5K5NA 2B1PA 2YABA 3NUNA 1S9IA 2HY81 4I20A 3T3VA 3SRVA 2P3GX 4QTBA 3ZRMA 3GFWA 2OJFE 1R0EA 2H34A 2YAKA 5CAVA 5B7VA 2R3GA 3CD8A 4YJSA 4D58A 4ZTMA 1CSNA 2KULA 3CGOA 2C30A 3HVCA 1JSVA 3MH1A 4GRBA 5IH6A 4IE9A 2YM6A 3KKVA 4KS7A 4YHTA 3PIZA 4DFXE 3RPVA 2HXQA 3EN6A 4MXZA 3SV0A 3G2FA 3AMAA 2W9ZB 2OXYA 5IQHA 3KRRA 3MY0A 3NDMA 3OHTA 2C6LA 3OS3A 3QCSA 3ORPA 2OF2A 4O6EA 1IASA 3IDCA 5AUWA 3V6SA 2ZMDA 3EFLA 2X4FA 3VRZA 4D2RA 3PPZA 4DLIA 5IUGA 3FSKA 3LXKA 2UZOA 3DQXA 4U3ZA 2WMSA 4WO5A 3OW3A 4PF4A 1ZWSA 4RJ4A 4EOOA 2PVMA 3LFDA 5C8KA 4ZLOA 3DPKA 1W82A 3EQDA 1KE7A 3A61A 5AV0A 4B7TA 2OFVA 4G5JA 2GTMA 4J71A 5HO7A 5JQ5A 5KMKA 2GTNA 3VW6A 5C9CA 3LLTA 5BMMA 2JDRA 2C5YA 5IH4A 1IAJA 1K9AA 2BRHA 3DB8A 4R3CA 1H00A 5HBHA 4Q9ZA 1VYZA 4FKQA 4UY9A 5TOZA 4D9TA 2BRNA 4FVQA 4JT3A 4L44A 4M84A 5A4QA 3G15A 5GINE 3SOAA 5M57A 3DFCB 4PMSA 3SA0A 2RGPA 4EC8A 1SVEA 4Z55A 1K2PA 4QMUA 2OZAA 3TCPA 4EK8A 3T8OA 4ALUA 3FXWA 2B9JA 4HCVA 1NT2A 4W9XA 1MRYA 1OL5A 2QU6A 3QTQA 3H30A 3FMEA 4R3RA 5CVGA 2SRCA 4BTJA 2Z7SA 4KNBA 4PTGA 4QP9A 3ZEPA 3V5QA 3ROCA 5M4IA 1ZYLA 4ACHA 2PZ5A 4II5A 1MRVA 1ZY5A 2PMOX 1NVRA 2JIUA 3KGAA 4GUEA 4G5PA 4CFVA 3NVMB 2G1TA 1KUTA 5ITAA 1OBDA 4FIEA 3L9LA 4CV9A 3MH0A 3KULA 4E8AA 3GVUA 4AW2A 2YDIA 5AV2A 4CKJA 3BHVA 4ENYA 1CM8A 2PHKA 2O64A 4O2PA 3FSFA 2DS1A 3KK8A 4C33A 4M97A 4QP6A 2A4LA 2F9GA 2P2IA 3W2RA 4FV1A 2OWBA 3GI3A 2J0LA 1W83A 2BTRA 5LXMA 5E8SA 2WIHA 3DBFA 3ZUTA 3D94A 3A99A 4N57A 2WELA 2XJ1A 4UMTA 4FTAA 4O91A 5EH0A 1OI9A 3E64A 3V8TA 4PL5A 3TZ7A 1LEWA 4D1ZA 2P2HA 2X39A 4GYIA 4E93A 5AV4A 4DEIA 3FLQA 2RFSA 5KMMA 3EFWA 2I1MA 3BLQA 1M7QA 2F57A 1PXOA 4C4EA 2VWXA 2XJ2A 3R21A 3PJ2A 4FG8A 5AIKA 3MB7A 4IHPA 1YXTA 4NFMA 5FWKK 1IAHA 4E20A 4WG4A 4BCOA 4Y8DA 5M55A 2BZHB 2VTNA 4A4OA 4EBWA 4CV8A 2BRGA 4RIXB 2RSVA 4ZK5A 5HIBA 1BUHA 3KVXA 2H8HA 2BIYA 3EYHA 4FV6A 3GGFA 4TYJA 2XVDA 5L2QA 5A6NA 3Q9XA 2YDKA 3ZC5A 4I93A 4NFNA 1GJOA 3DOGA 4FTOA 3NSZA 5CYIA 1YOJA 3HZTA 4A4LA 5CU2A 4EOKA 3NPCA 3PZHA 3KXGA 5E92A 3UOLA 5BUJA 2IW9A 3IW7A 4IVDA 3P0MA 4Y83A 5I9VA 3BYOA 4JAJA 5CLPA 3K2LA 4BF2A 5HZNA 1YVJA 1OZ1A 2E2BA 2XK7A 3ZSGA 2ACXA 2LAVA 3HDNA 2PVHA 3SC1A 2IZSA 2OBJA 3Q60A 5I9XA 4XG6A 4FV4A 1PF8A 5ANEA 3MA3A 1IA9A 3GU8A 3CTJA 2HXLA 3UP7A 3CKWA 1ZMUA 1GZKA 2CKPA 3HECA 2WQOA 4LG4A 5BUIA 3LFFA 2IVUA 4FSQA 5FLFA 5HHWA 4ACGA 2X2LA 3FLWA 3CQEA 4BYIA 4UMUA 4H1JA 3ZO2A 1XH6A 2ITPA 2W06A 2YISA 4FF8A 5CXHA 4O83A 3F3WA 3C51A 2REIA 4TWCA 4ZSJA 4L3LA 4JQ8A 4QQTA 2PMLX 3R8MA 2OZOA 2YZLA 4FNYA 3KRXA 2Z60A 4MD8E 3MDYA 2OIDA 3LFCA 4Y95A 1YDSE 4M12A 3ZDIA 4G6OA 3SXSA 4TNDA 4U43A 1WVXA 4D4YA 4XMOA 4ZOGA 3LXPA 4FV0A 3R8UA 5AAEA 5D11A 3EQIA 4LGDA 4APPA 1AQ1A 4BCJA 4X3FB 4LUEA 4MXXA 2J7TA 3QL8A 4EZ7A 4EL9A 4Y72A 2PK9A 4XEYA 2XYUA 4WOVA 5DIAA 2BAKA 3G33A 4HGEA 3RPYA 4BDEA 1YW2A 4C34A 3RNYA 5M08A 1UNLA 4TYHA 3BLRA 1KOAA 2FSLX 4J99A 3PXFA 1YXSA 4AW1A 4AT4A 2XKFA 5G6VA 3FY2A 3U51A 1GOLA 1OL1A 2ITYA 1YWVA 4ALVA 3O71A 3MTLA 4TW9A 5HG7A 4RQVA 3P4KA 3GENA 3D5VA 3F9NA 4E6QA 3D14A 3QTIA 4E5BA 4Z3VA 4YLJA 3D5UA 4AW5A 3OUNB 3U87A 3L9PA 5CWZA 3H9OA 4LQMA 3R8LA 2Z7LA 4DE4A 3W2PA 4N6YA 5A4LA 2VWYA 3QKMA 4XBRA 5AP6A 3PLSA 4IB0A 4ACDA 4AN9A 2GMXA 4C8BA 2F7XE 1GZNA 4Y5QA 3C1XA 4B99A 2AYPA 4YC3A 4PWNA 5CVHA 4CT1A 2C0IA 2E9VA 3AC1A 4I4FA 5IF1A 2NNWB 3QD3A 4EKKA 4GG7A 1H1SA 1MQBA 4FYOA 5CF4A 3UOJA 5M07A 4HVGA 4USDA 2JGZA 2I0HA 1H27A 3B8QA 2JITA 4WG3A 5A46A 3ET7A 4DYMA 4PP7A 4ZMFA 1NY3A 5I9YA 3V5TA 3F5UA 4MTAA 4FSYA 4NYEA 2GSFA 4WBOA 1IEPA 1YHVA 2BDFA 2X4ZA 3GC8A 3POZA 4MKCA 3V8SA 5HORA 5IUHA 1H1PA 5HKMA 3ZO3A 3ORZA 3N9XA 2C3JA 3IONA 3HUCA 4NT4A 1GIHA 2QD9A 2UW9A 3OEFX 4GK4A 5HVJA 4PUZA 4G9CA 3LXNA 3R30A 5J79A 1Y91A 4G6LA 3E3BX 2ZB1A 4L9IA 2E9UA 4KBCA 3HMMA 1H0WA 5M06A 2X2KA 4O22A 3BPRA 3VS1A 4ID7A 4XJ0A 4D0XA 4X0MA 1XH9A 2YIRA 2GDOA 3BIZA 4NM7A 3OG7A 4RSSA 3HA6A 1PXMA 1V1KA 3C4WA 5J5TA 2B55A 2WTWA 5IQCA 4ZEGA 4IB5A 4ZSAA 4FSNA 1E1XA 3MA6A 4O96A 4R5SA 3KCFA 1REJA 3BCEA 4BDFA 3Q4ZA 4OGRA 3IQ7A 3DDQA 4YC8A 4F64A 1GIJA 1QMZA 3ZBFA 2Y4IC 3QAME 4BGQA 1JAMA 4RG0A 4TYEA 3CJGA 2C3IB 4BKYA 4YUQA 1W98A 3B2WA 5LMKA 1JPAA 2PVYA 2YN8A 3PIXA 3HMPA 3VO3A 4DT8A 3QUPA 4M3QA 3TZ8A 1FINA 1Q8YA 1SNUA 2HELA 5HLPA 4OTQA 2HYYA 4N0SA 4YTIA 3LQ8A 3ZXTA 3H10A 4KABA 3EOCA 4QP7A 3OWKA 1URCA 2UZUE 3AT3A 3ENHA 3LZBA 5HE3A 2UW4A 3F82A 3TTIA 4BDJA 3DLZA 2RFNA 3FC2A 5AUVA 4O0RA 3I6UA 1LEZA 1Q41A 2YLEA 3C13A 3R28A 5TKDA 3RJCA 3DFAA 3K54A 4ACMA 4AOJA 4DAWA 3LQ3A 4U42A 3D7TB 2I0EA 4RC3A 3RZBA 4O7TA 3DA6A 5K4JA 2BILB 5J1WA 1DS5A 4IAKA 4BZNA 3N51A 4HW7A 4HGTA 3LM0A 4JBOA 4QP1A 5C8NA 5F94A 5FP6A 4G1WA 1JLUE 4U5JA 4XOYA 3H4JA 2J6MA 4GU9A 3D83A 3GC7A 5BYYA 2VN9A 1WBTA 4RQKA 3VWAA 4FKGA 4QMMA 5EHYA 3EN5A 4USFA 4FBXA 3A2CA 3DNDA 3GEQA 3A4OX 5I3RA 4LMNA 4I4EA 4U0IA 3MYGA 2VWIA 3VW8A 5IUIA 5FXQA 2O3PA 2BKZA 3CD3A 4FTRA 4XCUA 3I60A 4OTGA 3QBNA 3WZKA 1U54B 3BHYA 4GG5A 1Q61A 2UW3A 4FR4A 4ZTSA 5CU0A 4PMPA 3R7YA 3W8LA 3VBQA 3QTWA 3FE3A 1M14A 3D2KA 3QYWA 2XM9A 5EI2A 4R3PA 3G9LX 3GP0A 2F2CB 4BWKA 4NW5A 3Q5ZA 5GJGA 2BMCA 5FP5A 5E90A 5KKRB 3NCZA 4QTAA 4FTJA 5ANKA 4ZZOA 2PVFA 3R8ZA 1LP4A 3WF8A 1CKIA 4J95A 2XUUA 3QWKA 4IMYA 5IA5A 3PWYA 4N6ZA 4LOOA 3RTPA 2UZWE 4G17A 3ATTA 5EFQA 4K9YA 3KXMA 4IX4A 3P86A 5DE2A 2ETRA 3NYXA 1XBAA 2VO3A 5HE1A 3UIBA 1V0PA 4PDSA 5KO1A 3N4VA 4GV1A 5E9EA 3BE2A 3KB7A 3RAHA 3THBA 3IO7A 2CMWA 3NMUF 3OD6X 1WBWA 5AEPA 1J7IA 3CPCA 4AAAA 3L8SA 4RWLA 3WI6A 4CKRA 3PTGA 4OT5A 2A1AB 4K33A 4RLKA 5DR6A 3EN4A 3ZLYA 5ACKA 5A9UA 4DGGA 1P14A 2ZYBA 4C0TA 5IQBA 2W99B 3ZRLA 3L8PA 4FV9A 5IG1A 4IWOA 4O7RA 4O0UA 4C3FA 3Q9ZA 4M13A 4CFUA 3S00A 4GT3A 3WZEA 3GFEA 3W16A 3RK9A 5KBRA 3CKXA 2W1EA 4G2FA 4MBIA 1PXLA 3JUHA 4RVLA 1BMKA 3ZU7A 5CEQA 4F6SA 2UZEA 5J1VA 3C7QA 2PZYA 1BL6A 3C9WA 3WF5A 5EDRA 3ZONA 1Q5KA 2YWVA 4WG5A 3DK7A 5I3OA 5AP3A 4C37A 4L6QA 4FT7A 3ZBXA 2RIOA 4AZVA 3ZSHA 4EBVA 5HG5A 3R0TA 4KAOA 2HIWA 1LUFA 2Q0NA 3LFEA 4CG8A 4AZTA 5DBXA 3CCNA 3OXIA 4HZRA 5AJQA 3QC9A 3MJ2A 4EK6A 3ODZX 3PY3A 4F9AA 2G9XA 4G34A 4ERWA 3PVWA 3QTSA 4Q5EA 5JGDA 3FPMA 4C38A 3QUEA 1KE9A 5CALA 1B39A 3FZTA 1KE5A 5CS6A 5T68A 2IZRA 4XG7A 3TIZA 3UYSA 1VZOA 4BDDA 4F0FA 5HX8A 1J1CA 3R04A 3SD0A 4V05A 2PU8A 3PPJA 1XQZA 3U4WA 3ZHPC 3R6XA 5IKWA 3LCSA 2ITQA 2E9NA 3V6RA 4F6UA 4HYIA 3HV4A 4IX6A 2CGXA 2WKMA 4O1PA 4F9CA 1OMWA 1STCE 2VGOA 3MIAA 4BWXA 3QC4A 5LVOA 4OTIA 2C6IA 2CKQA 3NUAA 2CNQA 1U4DA 4RWJA 4RJ5A 3AD4A 1UU9A 2BHEA 2JKOA 1ZOHA 4ZJJA 3WZUA 2JKQA 4GS6A 2HW6A 5CNNA 2BZIB 3LCDA 4KBAA 5G1XA 4LUDA 1OKZA 5IMEA 2IG7A 1GNGA 4XP2A 5LARA 2ZMCA 1HCKA 4W4VA 2FA2A 4FEWA 1WBVA 2XK6A 3S95A 3UG2A 3ZFMA 1OGUA 3HX4A 1YXUA 1PRYA 3QGYA 1H28A 4BCIA 4DG0E 4PPAA 4YZCA 4WNKA 5CEPA 4OTHA 4BCNA 2IPXA 2YFXA 4CTCA 4ZTNA 3O50A 3CLYA 4WD5A 4L53A 4A4XA 2QONA 4K8AA 2C47A 5D7AA 5HCXA 4D4RA 5EOBA 1OVEA 2JIIA 4AWIA 1ZXEA 3A62A 3JVSA 5CT0A 3AXWA 3P79A 5E8YA 4E4NA 3HV7A 4IQ6A 4DEAA 4F9WA 3QUDA 5L6WL 3V5WA 5DGZA 2F4JA 5AA8A 3O0GA 5AP7A 4FTTA 3N4TA 5E8UA 3QD0A 4GIHA 3ITZA 4FKOA 1PMUA 3JS2A 4MBJA 4JQEA 3DV3A 3ETAA 4I41A 4IC7A 5DRBA 3JPVA 4WSQA 5EYDA 4EUTA 3W32A 2ITVA
chains in the Genus database with same CATH superfamily
4PPCA 3MPAA 1VJYA 1OGYA 3TMOA 2QLUA 2UV2A 2VTSA 4YJNA 4KKHA 2VTOA 3Q6WA 1UWJA 4TRLA 5FM2A 4I24A 4F78A 4I6HA 4BVUA 3Q9YA 4I5MA 4FZAB 2PYWA 3UMWA 4KUJA 3CY2A 3OP5A 4G3FA 2C4GA 2VTMA 3PSCA 4ASDA 2Z02A 3FZ1A 5GZ8A 3VONA 2C0OA 3DTWA 2JD5A 4I1ZA 2Y7JA 2IZUA 4CFNA 5HG9A 4U7ZA 4PQNA 2V62A 3RVGA 3FWQA 5FGKA 3ALNA 1LR4A 4KRCA 4RA4A 4YURA 4JBQA 3ULZA 4AXAA 2UW6A 1VLRA 3R9NA 2W5AA 2BAQA 1JOWB 3CJFA 3QRKA 4OUCA 3EL8A 4QMSA 4AGDA 4O38A 2R3HA 1BL7A 1XKKA 2GNLA 4NJ3A 2YIWA 4J52A 4L46A 2YWPA 5K0KA 4BCMA 3W18A 4AA5A 4ERKA 5CXZA 3F3UA 4MNEB 3UGCA 3U6IA 3GU7A 3ERKA 3PA5A 3FUPA 3HRBA 4RLLA 4UBAA 5LQFA 3JY9A 2QQ7A 4FJVA 4NCTA 2XNOA 4FUXA 3KXNA 4U41A 2VWZA 5AADA 1Q99A 2VTJA 3EN7A 3OWJA 2B4SB 5FBOA 4H05A 1DI8A 3T9TA 2CSNA 2DUVA 2J50A 3UNKA 4GU6A 4XBUA 5HCZA 2OH0E 3RMFA 3GOPA 3QZGA 4ANOA 3OF0A 3CE3A 4C2WA 3WZDA 2VX1A 2XYNA 4IACA 4TYIA 2YEXA 2OIQA 3V3VA 3ZEWA 3OT8A 3PXQA 3UQCA 4I0SA 3LPBA 3BYMA 2WQEA 4IC8A 5FM3A 4C7TA 3CC6A 3HEGA 2OKRA 1SYKA 5AP4A 2WU7A 3EHAA 5AFVA 2ZV7A 5DEYA 3KRLA 3VHEA 1W2FA 4I21A 3VUTA 5BQ0A 3F5PA 4DITA 3NUXA 2XP2A 1M17A 3B2TA 4DH5A 3UVQA 2I40A 3K5UA 2KTYA 3BQCA 3RGFA 4BDBA 1PYXA 2XK8A 2JBOA 1H8FA 2JKMA 4QPAA 4BB4A 4QYYA 3ZTXA 3TV7A 2XKCA 2BUJA 3VAPA 4RFYA 3FAAA 5DH3A 4KB8A 3R9RA 2V7AA 5J7HA 1W7HA 3R7EA 3P7BA 4FIIA 5AR8A 3ZXZA 2B9HA 2VTLA 4ZSEA 5TT7A 5L8JA 2NRUA 3R7UA 3ZCLA 5CEIA 4F7SA 1OM1A 3PXKA 4JX3A 4QMWA 2VWVA 3FLNC 4FIGA 3UDSA 3HRCA 4Z9LA 2BFXA 2UVXA 3NLBA 3EQCA 2GU8A 1PXNA 3P78A 5EM7A 2GFCA 5E8WA 2VTPA 4CCUA 4RJ3A 4AXFA 3QA0A 4EK4A 4E26A 3F7ZA 2PL0A 3KXXA 2Y4IB 3MBLA 3TACA 4OBPA 4QNYA 1U46A 3ORIA 4IDTA 4DHIB 4DTBA 4L68A 2OJ9A 3L8VA 4YJQA 3SW4A 5I0BA 5IA0A 2EUFB 3K5VA 2AC3A 4FVPA 3EQPA 3F3ZA 1KE8A 2AC5A 4JOAA 5EG3A 5BVFA 1OL7A 3QRTA 2QHNA 1UU7A 2OU7A 1ZYSA 4A07A 3DB6A 4EZ3A 2UVYA 3R2YA 4E6CA 4F7NA 3ORTA 1U5QA 5FQDC 4RZWA 2I0VA 3TV6A 3A7IA 2F7ZE 3DU8A 3PFQA 4XP3A 5DHJA 3MPMA 2OJGA 1Y8GA 2XS0A 2EXEA 3DGKA 4UZHA 5EYMA 5A14A 2IW8A 5A4EA 4R7IA 5AP1A 3RKBA 4I0RA 3IGGA 3RK7A 2NYAA 4O4EA 4MH7A 4AQCA 5CAPA 3ELJA 4J1RA 1OUKA 1OL6A 3FHIA 3BYUA 3U6HA 5H9BA 5C03A 4DT9A 4EKLA 4MNFA 5HTCA 1CDKA 1W84A 3BRBA 4RVTA 3EQFA 1IRKA 3QXPA 3EQHA 3R9OA 3VVHA 3OMVA 5F9EA 1R0PA 4BCHA 4A9RA 3PXZA 5EW9A 3MGYA 3ORXA 3DXPA 3W0RA 2UZLA 1M2RA 3P08A 3RWPA 3VHKA 4M69B 2C68A 3BHHA 3HV3A 4LL0A 4FODA 5E1EA 4AZWA 2HY0A 2XNEA 5KMNA 3FXXA 4MWIA 2ZM3A 2JC6A 2VAGA 4FL3A 4FT5A 4TNBA 3KREA 3IECA 2AUHA 4NKAA 5JSMA 5IQIA 3E93A 2B7AA 5CAUA 4IZAA 5JK3A 4JG8A 4FGRA 4BZDA 3EL7A 1M2PA 1KE6A 3GB2A 4FL1A 4XV1A 5DEWA 4CLIA 4J96A 2C6EA 4GFGA 2F7EE 4GVJA 4UXLA 4FIFA 5CU6A 5F95A 3QHWA 4F6WA 3PXRA 2HENA 1Y57A 3H9FA 5E8ZA 3R1SA 4IWQA 1V0OA 2ESMA 4OAVB 3VBVA 1KV1A 4YZMA 4EOPA 3G5DA 2XARA 1Q3DA 3NNXA 5J9YA 4J97A 3QU0A 3HKOA 3FXZA 1TKIA 4D2PA 2BCJA 2R2PA 5JGAA 2G2FA 5I9ZA 3H3CA 3PVBA 3VS6A 3DTCA 4BDHA 4OTRA 4JAIA 5EQYA 5AMNA 4Z7GA 3E87A 3G0EA 2W05A 3P5JC 1U5RA 4UMRA 3FL4A 4EHEA 2FGIA 4C3RA 5D41A 3COKA 3F3VA 3AT4A 2XH5A 1F5QA 2P0CA 4Y85A 2DQ7X 5H8GA 1M7NA 2C3LA 1FBNA 3EKNA 4BI2A 4LI5A 2XB7A 3VBWA 3MB6A 4EH3A 1H24A 4BDGA 3MPTA 4E73A 3D15A 3KK9A 4NZWB 5ETFA 2XJ0A 3QWJA 3R7GA 4W4WA 3QYZA 4E5AX 4X21A 1PKDA 3ZH8A 2Q0BA 5EI6A 3MH3A 1OIYA 2B9IA 3FKLA 2OXDA 1L8TA 3VBXA 3PWDA 3HYHA 5I9UA 4Y73A 4DC2A 5GJDA 4EHGA 4G3CA 4LGGA 4D1XA 3CQUA 1G8AA 4HVHA 3BI6A 2CDZA 3LCKA 4MXCA 2V5QA 4QOXA 3R01A 3TKUA 4FZFB 4MQ1A 5FTQA 5JH6A 3HUBA 4U8ZA 4BHZA 4BGHA 4IZ7A 1ZRZA 4U97A 1PXIA 3EN9A 3NS9A 4O7LA 2ZV9A 3FMLA 4FV2A 2IVVA 5FD2A 3QRUA 2PULA 3EH9A 5A6OA 4HPUE 4LYNA 5M4UA 4XV9A 4D28A 3MV5A 2JAVA 4IW0A 4BHNA 4N4SA 5HIDA 2W7XA 3IPHA 3QKKA 3AOXA 1J7LA 4QMXA 3AT2A 4BFMA 3QQJA 1PXJA 4DA5A 2YIXA 4ZZNA 5C4LA 3RHXA 4TKSA 3LJ0A 3MS9A 1A9UA 1OIQA 2XIYA 5HD7A 2CNVA 2UZTA 3F6XA 3MY1A 3RBWA 4BDIA 3ZZEA 4D2VA 2ITZA 2GNFA 2Y6MA 4TY1A 5E8XA 3P5KA 4DCEA 1OBGA 2AEGA 4JNWA 2EVAA 3D4QA 3NWWA 4EQCA 2HK5A 2QO9A 2CGUA 4EWHA 4H3PA 2B53A 2WNTA 4ZP5A 4E7WA 4DHJA 3VF9A 5ACBC 3WF6A 3VF8A 4CVAA 3LFNA 4L45A 4U80A 4MXAA 3V5LA 5HBEA 5BVWA 3VBYA 2W9FB 1ZARA 3MSSA 4FICA 4HZSA 4YJUA 2QCSA 2ZAZA 4FKRA 4YJVA 4XG2A 5DR2A 4R7BA 5E7RA 4FV3A 3RM7A 3TNIA 3BQRA 2PZIA 4G6NA 3HP2A 3VS7A 4YR8A 4AFJA 3DKFA 3VJOA 4RVKA 2WGJA 5IU2A 1ND4A 2EB2A 1Q24A 3R9HA 3E5AA 3DBEA 1FPUA 3FYKX 4JG7A 3IW6A 4JMQA 3ODYX 5BVKA 4P4CA 4BBFA 4UMPA 3O8TA 5D10A 3PJ8A 3COIA 2QOIA 4XS2A 4XG4A 5AAFA 2WQBA 2XKEA 3UZRA 3WZJA 2X7OA 1YHWA 1LPUA 3GOKA 3S0OA 2RL5A 1M52A 1R39A 1VEBA 2J0MB 3LVPA 4I0TA 3QTXA 3R9DA 5GIPE 3OCBA 1ATPE 2WTDA 3GCPA 3DXNA 3QQUA 3CXWA 5ICPA 4M14A 2FVDA 4EH5A 5AUTA 4ANMA 3M2WA 5KHXA 4DFLA 4ZJIA 4MF0A 4U81A 5GHVA 3VS2A 4EHVA 3AG9A 4NL0A 3DK6A 2WTVA 3JXWA 5J8IA 3UTOA 2Z7RA 5ANIA 1RJBA 4FSTA 3HNGA 4HPTE 4RZVA 1BI8A 3D9VA 2QOBA 3LCOA 1PJKA 2VX3A 5DA3A 3U6JA 5KNJA 4EOSA 4DGOA 2PPQA 3UODA 5CSHA 5HE0A 4DGNA 1YQJA 4IAZA 4AG8A 4CMUA 4JL9A 3SQQA 5CTPA 4RPVA 5HVKA 1OIUA 3NW7A 4QMZA 3I79A 3PVGA 4HGLA 4LRKA 4CZTA 5IEYA 1W0XC 4IM3A 4DEBA 3HV6A 4JIKA 5CAOA 5TF9A 2GHLA 4QT1A 2QOQA 4GCJA 4O82A 4C57A 4XV3A 4UYAA 4KSQA 1ZLTA 2J0IA 2HAKA 3Q9WA 2UZBA 3QTUA 4F7LA 3LFAA 4YJOA 4I22A 1ZOEA 4H58A 3GUBA 4M69A 4F1TA 4S34A 2GQRA 2VGPA 4RX8A 4UN0C 2B52A 2VWUA 2XNGA 3BU5A 4PRJA 4ZTRA 4C4FA 2PVLA 1VR2A 1R78A 4PMTA 5AP5A 5JFWA 4NH1A 1R3CA 5HBJA 3I7CA 5L8LA 1P4FA 5ANDA 4OW8A 3DDPA 4IXPA 4Z7HA 5FBNC 4FKWA 3TUCA 4UWYA 2W1FA 3F61A 4O6LA 3U9NA 4WNOA 2XBJA 4O27B 4LV5A 3MVLA 4GK2A 4AA0A 3C4ZA 1FMKA 1TQPA 3NNUA 2QODA 4YHJA 4DF3A 3I1AA 3LM5A 4JG6A 4L42A 2BDWA 2HZ0A 4FZ7A 4CQGA 1J3HA 1KSWA 4D4SA 3DK3A 3UZTA 3EZVA 4EOIA 2C6DA 4APCA 3ZMMA 1JSUA 1YWNA 5BVNA 4DDGA 3PLAE 4A9YA 3RALA 4FKJA 3W33A 2W4OA 4BCPA 3EZRA 1O6LA 4FKLA 4FTCA 5AUXA 2RFEA 3LMIA 3KY2A 2BR1A 2GQGA 3ROYA 4Q2AA 2W17A 4BCKA 4A9TA 3DZOA 3QLFA 4V01A 4FK6A 4XG3A 4IM2A 3ZM9A 2OFUA 1UKIA 3I0QA 4CYJA 3VUDA 3UQFA 4GJ3A 4P5ZA 3BEAA 1OB3A 4WSYA 3ULIA 3PY1A 1HCLA 2XNBA 1H1QA 2GFSA 4FNWA 1SVGA 4LMUA 1WCCA 3ANQA 2CNUA 2VZ6A 4JBPA 5J87A 4AOTA 4K1BA 4TWPA 3O96A 3R7VA 4EH2A 4GKIA 3HL7A 4U6RA 4EEVA 3G6GA 5IEVA 3O5AA 5ETIA 4FSUA 3AC2A 3UZPA 2PMNX 3LFSA 4FUYA 4WNPA 1UVRA 5HESA 1H4LA 3NIZA 4L00A 3SX9A 3BLHA 4Y5HA 5FEEA 4USEA 2GHMA 4QMPA 2HW7A 3ZZWA 1A06A 2VV9A 4AZEA 4D5HA 4NM3A 2JEDA 3JVRA 2XK4A 3E62A 3KMWA 2R3FA 1GAGA 4W8EA 3UP2A 2B54A 4Q5HA 4QP4A 3BYSA 3OWLA 5AV1A 5F1ZA 5D9HA 3SAYA 5HGIA 4JRNA 4TL0A 3IDPA 4DN5A 2R3NA 2O5KA 2OICA 5HNBA 3FLYA 4QTCA 3DY7A 4FV8A 3WYYA 2QOHA 1G8SA 2WOTA 3MVJA 4TT7A 3RAKA 2V7OA 3PIYA 4EOLA 1MP8A 3PG1A 2XKDA 5AUYA 4GVAA 4CD0A 3OXTA 1H26A 1UNGA 5EYKA 4JDJA 4O2ZA 4F9BA 3TIYA 1PKGA 2XCHA 2ZDTA 4J53A 5CF5A 4ZIMA 5K0XA 5L2WA 3OOMA 3P9JA 2R3PA 3F5GA 5DVRA 5EW3A 3WBLA 4FYNA 3VULA 2OW3A 4NJDA 4X3FA 4FSMA 2GQSA 2PUPA 2IO6A 2PY3A 4R1VA 5LCJA 5C01A 4AE6A 1A48A 2QKWB 3EIDA 3FY0A 3NRMA 4EK5A 4MX9A 3VUHA 2CKEA 2EB3A 4MXOA 4H3QA 4RGJA 4UV0A 4C59A 5JKGA 4BR3A 2ZM4A 3R63A 4CMTA 4QMNA 5GZAA 4DFUA 4FKUA 4PX6A 2H9VA 2GHGA 5CF8A 1YDTE 4I6FA 4QTEA 2WTKB 4PDPA 4R5YA 4E5WA 4DH3A 1Z57A 5AIRA 5ANOA 3OCSA 3D5XA 2FSOX 1YKRA 1JKTA 2VNYA 1PMVA 1J1BA 3C0IA 2ZOQA 4OR5A 3ZLSA 4ANSA 1FVTA 2HZIA 4EWQA 3KFAA 2C5VA 3TJDA 4RIYB 2C6MA 3AGLA 3QTZA 2WTCA 4P7EA 4EH8A 1OKWA 1Q8TA 4A06A 3DZQA 1ZYCA 4P5QA 4JI9A 3DAJA 4EQMA 1OIRA 3MVMA 1NXKA 4U79A 5EHLA 3TZ9A 5IEXA 5IA4A 2O2UA 2HWPA 1Q4LA 3AC5A 2RG6A 5BVEA 4D2WA 4DTAA 2W4KA 4X2GA 2JAMA 2PTKA 3M42A 3MTFA 4ARKA 4DG3E 3BHUA 4YTFA 2XMYA 4YJTA 5IA1A 1FOTA 3ORLA 3KF7A 3PSDA 1X8BA 3PXYA 3R22A 4TXCA 4ZJVA 2CPKE 5HLNA 3O7LD 3VC4A 1DAWA 1F0QA 4CQEA 4IZ5A 4GT4A 3CEKA 2YM8A 1JKSA 3NZ0A 1Q62A 4O81A 5AM7A 4DFYA 3UBDA 4GIIA 3ACKA 4DHZA 3VS0A 3I5ZA 3BGQA 2YCQA 3TWJA 2ZM1A 3UO6A 4CYIA 5FXRA 2YJSA 4EJNA 2R3KA 4XH6A 2NPQA 3PSBA 2OG8A 4YTHA 2JLDA 4C4JA 5K5XA 3CBLA 3I81A 1QCFA 5E91A 5JRQA 5ANGA 4FEUA 5FEQA 1ZYJA 1SM2A 2W1CA 3JY0A 4IADA 2XNPA 5AM6A 1J7UA 2X9EA 5AX3A 1CKPA 3C50A 3R83A 1MRUA 1XHAA 4H1MA 3HLLA 3RNIA 3LIJA 3IW8A 4G9RA 1BI7A 4O86A 2OF4A 2YCFA 2O0UA 3FEGA 3KL8A 4S30A 4MWHA 4DEEA 1XH7A 4BDKA 4EI4A 4HVDA 5IDNA 3LW0A 3W0NA 3QRJA 4H3BA 3PJCA 3QD2B 2BHHA 3SHEA 4LGHA 4M8TA 4C02A 5CASA 4R1YA 5ETAA 3EJ1A 3NUPA 1KV2A 2X2MA 4PL3A 4CNHA 4PTCA 4G3DA 3L1SA 3AKKA 1P5EA 2ZVAA 1UU3A 3O23A 3FZSA 2HCKA 4M0ZA 4QMOA 4QMVA 5EHOA 3RP9A 4O7ZA 4LL5A 2E9OA 5L6PA 4IX5A 5HG8A 2C1BA 5A54A 3OY1A 5CT7A 2XIKA 1JVPP 5DR9A 3TI1A 4F1OA 3DJ6A 4PDYA 2X8IA 1FGIA 5HTIA 3V01A 4RJ8A 3QLGA 4FIHA 3ZM4A 3EQGA 4B8LA 2XIRA 1S9JA 5I9WA 5JGBA 4FEXA 2WMAA 3DS6A 3DBDA 3FKOA 5LMBA 3FI4A 2PUNA 1DM2A 4KIQA 4NTTA 4EOJA 4QP3A 3UMXA 1G8KA 2X0PA 3HAVA 5BMSA 5HO8A 1WBOA 3E8NA 3P7AA 4GYGA 4F99A 3GNIB 4MCVA 2P4IA 2W0JA 3O8PA 4BKJA 3RAWA 1NA7A 4RIWB 1UNHA 4E3CA 5M53A 3ZLWA 1NVQA 3KQ7A 2J0KA 4HNFA 4YPSA 3R8VA 5HICA 5KE0A 5JZNA 1DAYA 4EONA 5KMIA 4CFWA 4O84A 2R64A 2V22A 4EUUA 4AN3A 5KHWA 1XBCA 1L3RE 3UDTA 5CEOA 5HU3A 3NYVA 2XRUA 4MD9E 1ST4A 3NAYA 3FZRA 1H25A 2PWLA 3CP9A 3M1SA 4PMMA 2I7QA 3FDNA 5AUUA 3D7TA 3G9NA 4F9YA 5E8VA 5HO6A 2YA9A 5EK7A 4NUSA 3BEGA 4MAOA 4QQ5A 5FG8A 4EC9A 4IVBA 4L52A 4L3JA 2ITXA 5A4CA 2BVAA 4C4IA 4H39A 4OAUC 3BWJA 2W1ZA 2YACA 4BTKA 2QR7A 2R7BA 5L2TA 4V04A 5DNRA 4ZLYA 2GS6A 5BYZA 3RINA 3IDBA 3OVVA 1ZMVA 3LQ5A 5L4QA 3P23A 3AC8A 3HMOA 3NUYA 3FPQA 2XCKA 1Z5MA 1IR3A 3BE9A 4DBNA 5KMJA 3KIOC 4AXCA 3G0FA 1OECA 2XA4A 5EDQA 4C61A 4DEDA 3QF9A 3OXZA 1URWA 2ERZE 5HLWA 3TKIA 1PXKA 1PHKA 1WBSA 4HVSA 4PPBA 2QOOA 4RJ6A 2YCSA 2X0QA 2XK9A 3FL5A 2XM8A 5LWNA 1PXPA 2GNGA 1GIIA 4EH4A 2Y8OA 3QKLA 4MNEA 4XG8A 4FL2A 4C58A 3OBGA 3PRFA 3V04A 5EKOA 5HCYA 4CT2A 2F49A 1AGWA 4X2NA 3FI2A 5LVPA 3IKAA 3NFFB 5IQAA 5CNOA 1U54A 5FRIA 3OTVA 2W96B 5J7BA 3HV5A 4XLVA 5JZJA 4KSPA 3FQHA 3EFJA 2IZTA 3IW4A 3TZMA 5IZFA 1XMMA 1J91A 4D0WA 3RAIA 3PFYA 4KBKA 1QL6A 3FBVA 4AXDA 4RMZA 1H08A 3ORNA 4O0XA 4IAYA 2JKKA 4FA2A 2XAOA 3CPBA 5EW8A 3PJ1A 5L2SA 3PZEA 1CTPE 4CZUA 3A4PA 4L01A 3HA8A 2OIBA 4NW6A 4DGLC 3FJQE 5TO8A 2R0IA 2R9SA 3I4BA 5LCKA 2C5OA 2C1AA 5FUTA 5J9LA 2OK1A 2C3KA 4PY1A 4U40A 3ZOSA 2VRXA 2QI8A 4IM0A 1XMLA 3CY3A 2UZNA 4O0VA 2JFLA 3VS3A 1QPJA 5EDPA 3WIKA 3TM0A 1QPDA 2A19B 2R0UA 1TZDA 3I5NA 4EHZA 4JVGA 5HOAA 4ACCA 3QTRA 4DBXA 4DINA 2OLCA 1FVVA 2ZV2A 3KN6A 3VIDA 4UWCA 2VWBA 3VQHA 3OROA 3V51A 4UEUA 4ANBA 4JDIA 4RT7A 3C4EA 4FKVA 2VU3A 3AMBA 1YI3A 3AD5A 3NX8A 4KA3A 4UALA 5L6OA 3ZUVA 4H36A 1CKJA 2ZJWA 4R7HA 3S1HA 2WMBA 2VO6A 1W8CA 3DNEA 1DI9A 4NSTA 4I94A 3FLZA 4RX7A 4X6RA 2G2HA 4YP8A 5JFXA 3VJNA 3FMDA 4X3JA 3C5UA 2X0GA 3HMIA 2W1GA 4I92A 5EI8A 5FDXA 4P2KA 4BI0A 4ZTHA 4E4MA 4I6QA 3FQEA 3R1NA 4GL9A 3Q4CA 4K2RA 4K77A 4OTPA 2FYSA 3LXLA 3VUIA 2WEVA 2JFMA 3C4CA 3POOA 4C4GA 5HD4A 4GH2A 4KIOA 3BBTB 4ZY6A 1WVYA 3OWPA 3F2AA 5DFPA 2PVNA 2C6OA 4KS8A 2R5TA 1PMEA 4DEHA 2OSCA 2DYLA 4KWPA 5C26A 2BKKA 4ENXA 3BELA 3QX2A 5C4KA 1O6KA 4JXFA 5FTOA 2R3JA 4M67A 3KULB 4YZ9A 5KMLA 4IDVA 5CSXA 2FO0A 2JDVA 3FMMA 3P7CA 4FGBA 3UVRA 3H0YA 4D4VA 1XJDA 3KXHA 4I5HA 3H9RA 4X7QA 3RPSA 2R4BA 3DKOA 5GIOE 2QO7A 4W4XA 2CGWA 3GU5A 5J5SA 4X2JA 4A7CA 5C27A 3RI1A 3IG7A 3KVWA 3UNJA 4ASEA 3AMYA 4RA5A 3ZC6A 2XK3A 2Y9QA 2GNJA 4RC2A 3E92A 3MJ1A 2ERKA 2UZVA 4HCTA 4CLJA 4O1OA 1IG1A 2OJJA 2OZAB 3O7LB 4DFBA 3R1QA 1H07A 4FX3A 3ZO4A 5DT3A 5AP0A 4ONAA 5AAGA 4ZS0A 5LMKC 5DYJA 2VO0A 3DQWA 3E8DA 4F09A 4AF3A 3TNHA 3DAEA 3W2QA 2P55A 2PZPA 4LV7A 3S2PA 5GZ9A 2UW8A 4IAAA 5HEZA 3F69A 4ZSLA 2W1HA 3SOCA 3QQHA 3UIMA 4EORA 2WMVA 2YM5A 3ORKA 2JIVA 4FNZA 4KIPA 4ORKA 4F0IA 4B4LA 4NKSA 4KINA 1OKVA 2WQMA 2BALA 3A60A 4BCQA 3REPA 4BKZA 3DLSA 4B6LA 3QHRA 5ANJA 3Q4TA 4F08A 4AGCA 5AA9A 3TL8A 4FZ6A 3UNZA 2GS2A 4FKSA 4JJRA 1JQHA 3R1YA 3BU3A 4QP8A 5HE2A 3SVVA 2WTKC 2O65A 4OBOA 3U8WA 3SXFA 4G3GA 3WARA 3ZRKA 5M4CA 2X8EA 5CX9A 5B2MA 5DMZA 3W0MA 4FEQA 5KMOA 5BVDA 1PY5A 3COHA 2PE2A 4L8MA 4O7WA 2ITUA 2Z8CA 3WIGA 4F1MA 4MEDA 1BLXA 3VUKA 3L9NA 2YLFA 4X3FC 2J0JA 5AR2A 4AACA 4CCBA 2CLXA 4I6BA 4RX5A 3TEIA 3K3IA 1YOLA 3PP0A 4QPSA 3WYXA 4ASXA 4WRGA 4UX9A 4GMYA 1Q8UA 3WF7A 2OO8X 3KN5A 3PRIA 4YBKA 3RM6A 4E4XA 4LM5A 1SNXA 4QYEA 3ZFYA 5JN2A 4IZYA 4L7FA 1WAKA 4XYFA 3TNQB 2WMXA 5F4NA 5I4NA 5IISA 5HIEA 5M4FA 2OH4A 4BC6A 5BNJA 5E1SA 4CFXA 4QMYA 5B2LA 2WXVA 3FMKA 4KKEA 2R3QA 4D5KA 2J2IB 4W8DA 4XHKB 4WA9A 3DKCA 1EH4A 3D0EA 4AT3A 4HVIA 4YZDA 3OT3A 4E1ZA 3KF4A 2YM7A 5I5ZA 1RE8A 3WE8A 4MF1A 3PPKA 3W8QA 3A7FA 3E63A 3E8CA 1CMKE 2JDOA 2OJIA 2Y4PA 3UO4A 2NO3A 4QMQA 4JS8A 4FT0A 3Q3BA 3IGOA 2BDJA 3H0ZA 1WVWA 2YITA 3OC1A 1FGKA 2X1NA 2ONLA 3Q6UA 4C35A 2FH9A 4FTUA 4O4CA 3UJGA 4AGUA 3KCKA 2J9MA 4RIOA 4O7SA 3O8UA 4CSVA 3LFBA 4JDKA 3SKCA 4BIEA 4J8MA 2PSQA 4TYGA 4DFZE 3W1FA 2WB8A 3BGPA 3AGMA 4OLIA 1H1RA 3RK5A 3HAMA 4G31A 5HU9A 3QXOA 4KD1A 4AE9A 4FSWA 4GKHA 4AUAA 4FKIA 4DH8A 4ZSGA 2IF8A 3EQBA 3OOGA 4J98A 4IH8A 3OUKA 4TZRA 1Z9XA 5JMSA 3FMHA 5EQPA 3UE4A 2IN6A 2WFYA 4J7BA 3SLSA 3TNPC 4ANLA 2XEYA 5IDPA 1OUYA 5LWMA 1V0BA 4BIBA 2ITWA 2W5HA 3GCSA 5J9ZA 2CN5A 1JBPE 4EH6A 5IPJA 4FEVA 3QD4A 4HYSA 5AR3A 1G5SA 2R3RA 2QC6A 3FC1X 3FLSA 4IJPA 4OTWA 5BVOA 5D12A 5CEKA 4M0YA 3DBQA 4C4HA 2XZSA 5KCVA 4HYUA 4S2ZA 4AFEA 3GCVA 2W1IA 1WBPA 3QQKA 5M51A 2J51A 3BLAA 4ZY4A 1I44A 4HYHA 4ZS4A 4K6ZA 4R6VA 3Q52A 2ITTA 4XLIA 2X6EA 2VNWA 3V5JA 2QG5A 1O9UA 4BY9E 1UU8A 3DKGA 5DRDA 5L2IA 2BRMA 4YBJA 4ZY5A 3MN3A 4ITIA 1FQ1B 4XX9A 2VTAA 3MVHA 3RHKA 3PA4A 2Z2WA 4YMJA 3BV3A 5FXSA 5DG5A 3OEZA 1FVRA 3GU6A 3MY5A 4UZDA 5CEMA 2QOKA 4X6QC 2Y6OA 4MK0A 4F63A 5D1JA 3COMA 4IANA 5KX8A 2WMRA 3CQWA 5B0XA 3Q04A 3G90X 2IVTA 1OKYA 2WTJA 4IAFA 1H01A 5CZIA 3W0QA 4AZFA 4A9UA 4NU1A 4I5PA 2J90A 3EB0A 2QOCA 3IS5A 5EKNA 4GSBA 4WHZA 4N70A 3SRVB 3KEXA 3LFQA 4JIAA 2FUMA 4U3YA 4C2VA 3BL7A 2VO7A 4GW8A 4TWNA 3EFKA 4Q9SA 4BDAA 2QHMA 5DI1A 4WUNA 1Y6BA 3CGFA 4F4PA 4EOQA 3F2NA 5IH5A 4AOIA 1WMKA 4IWDA 1MQ4A 4FKPA 2R3OA 1TFFA 1Q8ZA 4PTEA 3E8EA 5A3XA 2BAJA 4FG7A 3GQLA 4IEBA 5IA3A 2ZFYA 4XRLA 4JRVA 2WAJA 5AP2A 2W1DA 4ZAUA 4AAYA 2VWWA 4FZDB 5AWMA 4CGAA 2XF0A 3MH2A 4CEGA 2E9PA 3DJ7A 3FV8A