3ZLYA

Crystal structure of mek1 in complex with fragment 8
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
343
structure length
310
Chain Sequence
LELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE KINASE 1
publication title The Use of Virtual Screening and Differential Scanning Fluorimetry for the Rapid Identification of Fragments Active Against Mek1.
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 310
sequence length 343
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2013-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zlyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zlyA01
2C69A 4CYIA 3IGGA 3DZQA 3K3JA 3UPXA 3JS2A 4PV0A 2ZMCA 5CEMA 3WI6A 3CD8A 5CASA 2ITWA 2X8IA 3NEWA 1OIRA 4IVAA 1H01A 2XIRA 3KGAA 4QQ5A 2GNIA 3WBLA 4USFA 2VRXA 1YI4A 2BAKA 3K3IA 3MH1A 4LI5A 4FNYA 2JIIA 3IONA 3MPTA 3RKBA 5CAQA 5ACKA 4JNWA 4PX6A 4U6RA 4EOIA 3WIKA 2QU5A 3D7TB 4HCTA 3UMXA 3REPA 3OC1A 4GK2A 2QO9A 4M14A 3WOWA 1J7IA 3WE4A 2BCJA 3GQLA 5JSMA 2F7EE 3GBZA 1Q99A 4RX8A 3HP5A 2Z60A 3HA8A 4HZSA 4DAWA 2CGXA 3U9CA 3ZSHA 2GS6A 2DYLA 4ITIA 3UG2A 2C6MA 3R8MA 5FRIA 2UW9A 3M11A 2ZM3A 2V55A 4FC0A 4K11A 5FXQA 3MDYA 3GC7A 2ZMDA 3Q04A 2GPHA 3OY1A 4FV9A 2WTDA 4GEOA 4FEWA 2BALA 3PXQA 3QAME 2JEDA 3IDPA 3WF6A 2BZJA 5CI7A 3BELA 1DI9A 2YCFA 4IQ6A 4YZCA 3UQGA 3ZYAA 5A9UA 1OIQA 1BUHA 2OBJA 3C0IA 5LMBA 3MIAA 4PL3A 1J91A 4BL1A 3DNDA 5HCXA 1JSVA 3ZHPC 3PJ2A 3PSDA 3CPBA 3HMNA 3IQ7A 3CXWA 3NW6A 4UXQA 5CNOA 2H9VA 3G90X 3PE1A 4C3FA 3I81A 5IMEA 2AYPA 4L43A 3E88A 1JOWB 4XV2A 5H8GA 4Y85A 4F65A 1URCA 4Y5QA 3V5PA 4D2WA 4I0SA 4DEDA 3JXWA 2XEZA 4YTFA 3LFCA 3I6WA 4YJSA 3ZFXA 2BRMA 3U6HA 4IAYA 3LCDA 3PA3A 2ZB1A 3MY5A 4M7IA 3IW7A 5EK7A 5HO8A 5L2WA 5EYMA 2A4LA 5CS6A 3BGPA 2IW8A 3E8CA 5FWKK 4AGDA 2CKPA 3D0EA 4O0TA 2WTCA 3FI2A 1BI8A 4RZWA 4FF8A 4NTSA 3RHXA 3DKCA 5L6PA 3CTHA 5A6NA 1UU7A 2XB7A 3PTGA 2G2HA 3C51A 2J5FA 3MPMA 4IANA 5HG8A 1WFCA 5K0XA 4NM5A 4W4VA 1R1WA 4GV1A 4O7SA 4AA0A 4EHVA 1PXLA 1KV2A 4IX4A 4USEA 2J7TA 1JSUA 4C2WA 4FIEA 1L8TA 4JXFA 3ZFMA 4GYIA 1GY3A 3NVMB 2X81A 4AX8A 3OCBA 2CPKE 4YO4A 4JVGA 4QMPA 4C4HA 2E9OA 4E4LA 3VVHA 2WXVA 4LOOA 2VTIA 1K9AA 3ORLA 5HOAA 5IA4A 3EFJA 4NYEA 2BUJA 4MAOA 4U81A 4R7IA 4ASXA 1MQBA 1OKZA 1CSNA 5FTQA 4W9WA 4DYMA 4B7TA 4R77A 3KA0A 4AA5A 2UW0A 3NUUA 3P5KA 2XKEA 4UYNA 2BILB 4I93A 5FG8A 5J8IA 2PZIA 3LFQA 5DGZA 4IM3A 2B7AA 3SQQA 3V01A 4O7TA 2C5VA 3VS4A 4FSWA 4G1WA 5F20A 3ZCLA 5BPYA 1FOTA 3WZUA 3UG1A 4I6FA 2Y6OA 4QNYA 4WRSA 4ZK5A 3U51A 4QYHA 4RFZA 2W4KA 5AUWA 2Z7SA 2BHHA 3O96A 3WF8A 4FA2A 5DIAA 5IDPA 4I0RA 2HAKA 3QZHA 1XKKA 1QPJA 2R3MA 3IDBA 3R1YA 5EM6A 4E7WA 4BRXA 1K3AA 4LRMA 3SXRA 3CGFA 5BMSA 3Q96A 4HGSA 5I9ZA 4ALUA 4GUEA 2ERKA 4CZUA 2YEXA 3IPHA 3PY0A 3PG3A 3DAEA 5LARA 4B8LA 4DEEA 4FTTA 2IW9A 4IAZA 3QGWA 2YFXA 3AT3A 4FICA 4NL0A 2OIBA 2ZM1A 4FTIA 4EZ3A 3VS1A 2HWOA 4BGQA 4WRGA 1ZARA 3EMGA 4L42A 4A9UA 3MVLA 3D2IA 4LOPA 4AW1A 3A4OX 1YHSA 5ITAA 4FEXA 4DTAA 5T3QA 4UN0C 4RX5A 5LWMA 5CEIA 5L2TA 4B4LA 4P7EA 4YTIA 4BZDA 1OIYA 4XG3A 5HX8A 3TUDA 5BVFA 5ETFA 3ZBXA 1H1RA 2PWLA 4GFOA 3C0GA 4ZSJA 1PXMA 5I0BA 4XV3A 3MV5A 2IWIA 2PMNX 3MFUA 4JQEA 5FP6A 3HL7A 1DAYA 4YO6A 5JN2A 3QX2A 2X0GA 1YDRE 4GT5A 5A4CA 2W1ZA 1P4FA 1Q3WA 3FMNA 2QOOA 4WSYA 4M66A 3TJCA 3MB6A 3A7HA 2CGWA 2EWAA 3FJQE 1KE7A 4NJDA 5EFQA 3PE2A 5EG3A 2ONLA 3QUEA 2WMRA 4F0FA 5EQYA 4FV3A 3EFLA 5DFPA 3SOCA 1FBNA 4D0WA 2XJ0A 4HYUA 4FYNA 1Q97A 4HCUA 3KU2A 2C4GA 5KBQA 2VNWA 5IA2A 2WTIA 4UZDA 4YZDA 3ZSGA 2PVFA 5AUUA 4RQKA 4ZJIA 4M69A 4OUCA 5JFWA 5IZFA 4RPVA 3TV6A 3W8LA 2GFCA 4YC8A 3FLSA 2P55A 4PUZA 2YM5A 2ITQA 4Y72A 4FV5A 1OL5A 3QF9A 4RIWB 5AUVA 4BKZA 3NUXA 3V5TA 2VTHA 4DTBA 4QMWA 2W1DA 1GZ8A 3LQ5A 4RBLA 5C4LA 5JFXA 2O3PA 4XMOA 5K0KA 3NW5A 3QD4A 4Z7HA 2BTRA 4B0GA 3ZSIA 2Y4PA 3DBDA 1Z9XA 4UMRA 1XR1A 5J1VA 3UYTA 4EEVA 5A6OA 3DXQA 2XS0A 3R8LA 4WT6A 3FKNA 3LLAA 5KHWA 1V0BA 3U4UA 5DBXA 5KUPA 3ZC6A 3PVWA 3VUHA 3ACJA 5CYIA 4A06A 2OI4X 4PDSA 4L53A 4RA5A 3QYZA 4C34A 3QHRA 3GVUA 4BI0A 4KIPA 3F7WA 4YJTA 3COIA 3ZRLA 3H3CA 4F63A 5LVMA 2JBPA 4ZTRA 2BTSA 3O51A 5HE1A 3TT0A 5HTBA 4DEGA 3LMIA 5L2IA 3KRWA 2PVNA 5FBNC 3WZDA 2C0IA 3BBWA 2GSFA 4G6NA 4J98A 3R22A 3Q5ZA 4RC4A 3LM5A 4CQEA 4U7ZA 2WEVA 2YWVA 4RVTA 2QURA 4DLJA 2VX0A 2XKCA 2WTKC 1FGIA 1H08A 1KWPA 4FSTA 3SRVB 5DT0A 5E1SA 1PXOA 2B1PA 2WGJA 5IH4A 1G5SA 2I0YA 3GQIA 3ZO1A 3HRCA 2Y8OA 4LGDA 3OCGA 4WG3A 3HX4A 2XNMA 4RLKA 2BIYA 2R64A 4II5A 3COHA 4FV7A 4XG6A 1X8BA 4D0XA 2WQNA 4QRCA 5ANKA 3QQGA 2UVXA 4BKJA 4PTGA 5EQPA 3A61A 4XBRA 1Q8WA 4UWYA 3W1FA 4AUAA 3SW7A 1AD5A 3TNPC 4FKWA 3SKCA 4F0IA 3ATSA 2JD5A 3GCSA 4AFJA 3MSSA 3PDTA 4EH7A 1Q62A 2CSNA 4AS0A 4KIKB 3ORZA 3VNTA 4EWHA 5IQHA 4OAVB 4CQGA 4Z7GA 4QYEA 3P86A 4XS2A 5AV4A 4K33A 4ANOA 4DG0E 4PY1A 4BDAA 3U55A 4J7BA 4QPSA 2VZ6A 4A4XA 3OS3A 5AV3A 2GQRA 5FDPA 3FZ1A 4YNOA 4FKLA 1Q8TA 4UALA 2C6EA 1KOBA 3QYWA 4D2TA 2IO6A 4PPAA 5JEBA 3CE3A 3MA6A 4NFMA 3RPVA 3HV3A 4AZVA 4BDIA 3LFEA 1XHAA 4O0YA 5DYJA 4GU9A 3LJ2A 3FZSA 2SRCA 4PTCA 2FVDA 2DUVA 2FO0A 3UODA 4EK4A 4X3FA 3V5JA 2UZLA 4JS8A 3KXHA 3PVGA 3AT2A 3QA0A 2IVVA 3MYGA 3OTVA 3QZFA 3U9NA 3MVJA 3ZZEA 2B53A 3TL8A 4OTIA 3HLLA 4O6EA 4Q9ZA 4FT3A 5IEYA 4CSVA 3FPMA 1A9UA 3CY2A 2PZPA 3R7GA 1SYKA 4HVIA 3F3WA 1M2RA 3RALA 3BBTB 4O21A 4AE6A 1FMKA 3L9MA 5LVOA 5J7BA 1XO2B 2UZTA 2XK4A 1ZMWA 3B8QA 3R01A 3F2RA 4C3RA 1V0PA 2VTLA 3E92A 5AWMA 3MVMA 4USDA 2W7XA 3CTJA 2FA2A 3BYVA 3TIZA 2HY0A 2QLQA 3DT1A 4XJ0A 3HMPA 4KUJA 3G0EA 2QC6A 5EYCA 3RPSA 2OWBA 2XBJA 4NW5A 4PQNA 4YR8A 1M2QA 4WHZA 2BR1A 4RRVA 4R6VA 4JT3A 2A27A 1Z5MA 4NZWB 2OSCA 3QC9A 4EH3A 2X39A 5KHXA 2YM8A 3LFAA 4P90A 5IMXA 4UMQA 1UNLA 2QI8A 3SOAA 3EL7A 2R3LA 3QD0A 5HNBA 3L9PA 2EU9A 4GSBA 4K1BA 2XNPA 3R9RA 3IW5A 1ERKA 1MUOA 3QTUA 1PXJA 3KVXA 4IAIA 3F3TA 3AGLA 5IKWA 2F2UA 3QKMA 1YOLA 4JG7A 2WMTA 4BGHA 5B2KA 3P23A 1Y8GA 2ETRA 1IAHA 5KZIA 2W1GA 4Y5HA 4IX3A 3TKIA 1OPLA 4FSQA 3ORNA 3ZLSA 4CMTA 4RVKA 1WBWA 2XVDA 3QKLA 3N9XA 4BZNA 3IG7A 4L44A 4LV5A 3V5WA 2HZ4A 4TXCA 2I0HA 2VAGA 3EJ1A 4QD6A 1WAKA 4E26A 5CALA 2WMVA 1KSWA 5C27A 4X0MA 4I4FA 5DT4A 4NTTA 5JFVA 4I6HA 2VX3A 4KBCA 2WZJA 4FL2A 2ITPA 2OJJA 1JLUE 3OUKA 5E4HA 2HOGA 4E1ZA 4YJQA 3UBDA 4I4EA 4GKHA 3QRTA 4E5WA 3HMMA 4V04A 2XEYA 1CMKE 2JITA 4M84A 5EYDA 2IPXA 1UNHA 4ZSGA 3BX5A 1KE5A 1BKXA 4U3YA 3R2YA 5L4QA 4NJ3A 4QP4A 1U4DA 3EN4A 3KRXA 2C1BA 5GZAA 1XBCA 4ZY6A 4G31A 2XRUA 4G5PA 4UXLA 4BI2A 1QPCA 3FC1X 4E6QA 2ZJWA 2ITZA 2PY3A 4DEAA 3NVKI 2BZKB 2R3RA 4DT8A 3EZRA 3VUTA 1GIIA 1J1CA 3QKKA 1YXSA 3FZOA 3NZ0A 4FKTA 4MF1A 4ID7A 3RTPA 4QMLA 4CGAA 1YHWA 2YA9A 2BKZA 5BMMA 3HV5A 1H27A 3DDQA 2XK6A 3PJ3A 3QUDA 2UZNA 4FGBA 1H26A 3R02A 5M55A 4AACA 3SDJA 3H9FA 1M2PA 4EHGA 2V5QA 4QMZA 4EZ5A 4ZTLA 5LMKC 1GNGA 3FI3A 5T6KA 4O7NA 3FQEA 1UWJA 4BDEA 3ENMA 2JKQA 4HCVA 2WTKB 3CJFA 1QMZA 2PZRA 2W1IA 2WMAA 1KV1A 3PXKA 4QT1A 1PMNA 1Q41A 3FI4A 3UJGA 3UC3A 2XRWA 3VUKA 3EH9A 3PZHA 4ENXA 1SVGA 4CTCA 4WD5A 5KKRC 1NY3A 4FYOA 5E9EA 3TN8A 3VF9A 2PPQA 4XUFA 2F9GA 2HELA 4X6RA 1OB3A 2JC6A 4NH1A 4RX7A 4XYFA 4O7ZA 3G33A 4WG4A 3WZEA 4IEBA 5J9ZA 3S00A 2OXDA 4OTHA 4C62A 1MRVA 3DK3A 4ANQA 2J51A 4TYIA 4IWQA 3Q53A 4JQ7A 1U54B 2W9ZB 3DZOA 4FTOA 2ITNA 4IFCA 2F49A 4HVGA 4QTEA 4GCJA 4RVMA 4J71A 4GT3A 4XLIA 5I3OA 4FT0A 3T3VA 3QXPA 4DFBA 1RDQE 4CKIA 4BWPA 2J6MA 3TG1A 3RNIA 3A99A 3HV7A 5M07A 4YZ9A 2NP8A 3G6HA 3PA4A 4EI4A 4FSUA 2IG7A 5E92A 2CNQA 5AV0A 4D5HA 4L45A 4L46A 1OPKA 4MXXA 2VTOA 2ZDTA 4YSMA 5EDPA 4WOVA 4ACDA 5D9HA 2R3JA 4AAAA 3ZC5A 4IB5A 3V51A 3FMDA 4O1OA 1OITA 2YDKA 4FIHA 4PWNA 4F6SA 4FUYA 3HV4A 2XK3A 2QOQA 1JKKA 1TQPA 3G6GA 5FUTA 3ORMA 2OJIA 2WIPA 3R7IA 4I0TA 3UTOA 4NIFB 4PMMA 5K4IA 1SVEA 3IKAA 3MFSA 4J52A 2C6KA 4L9IA 5C01A 4FZAB 4ZJJA 4MQ1A 3WZKA 1LEZA 4CFXA 1GOLA 4ZP5A 4U42A 4V01A 5KMLA 2XF0A 4QP2A 4OTQA 4O7YA 4FNWA 3EQHA 2GS2A 4PDPA 4AZEA 3EB0A 2CDZA 4GVJA 3FWQA 5JGDA 3IW4A 5BNJA 2QO2A 4MD7E 3SC1A 1JBPE 2OJFE 3D5XA 4KSPA 5AR3A 3KRLA 2OK1A 4KS7A 3MBLA 1OL6A 2UZVA 4FKVA 4MWHA 4JRNA 4FIIA 4ZZMA 4FG7A 3SHEA 3ZH8A 4PTEA 3QUPA 3UMWA 2XIKA 4YURA 3PZEA 3VJOA 4UMTA 5D11A 1PMUA 4EQMA 1H1QA 5I5ZA 4KAOA 5AR8A 2YZLA 4ERWA 1NVQA 2FSLX 2VWZA 3NWWA 4G17A 3LJ0A 1JSTA 1NXKA 4R7HA 3OEFX 1U59A 3AC1A 5ACBC 4IDTA 3W33A 4CVAA 2PU8A 3Q9YA 4JR7A 5JRSA 4DGMA 4YNEA 4OAUC 4BZOA 3IW8A 3I5NA 3FZRA 5KX8A 4PDYA 4QYYA 4FV8A 4W4XA 4ZTQA 4MNEB 4G3EA 3RP9A 2JFMA 5FD2A 2V62A 3PG1A 2UV2A 3PFQA 4IXPA 4JOAA 4YPDA 4BDGA 3MN3A 5E90A 4BHNA 1H0WA 5AP5A 1M7QA 5JZNA 4XRJA 3TI1A 4R3CA 2ZDUA 3TNWA 4QMOA 2QOFA 2B9HA 2Y9QA 2PVJA 4TRLA 3O7LB 3FPQA 3LXPA 1FVTA 2GNLA 3RK9A 3EL8A 1B6CB 4GKIA 2BDWA 3PP1A 4H39A 5HVKA 1XJDA 1ZMUA 2ZAZA 3BYUA 4BDFA 4AA4A 3E8NA 2R3IA 2C6IA 4WNPA 1PXNA 3SA0A 1ZZ2A 4ZSEA 5CSWA 5CAVA 1QPEA 3VS3A 4XG8A 4N70A 3PIXA 4OT6A 4L6QA 3EOCA 3QLFA 4FTRA 2C68A 3FXXA 5JRQA 4U41A 1PYXA 1ZOEA 3UIBA 4KKEA 1IRKA 3BYSA 4QQCA 3MH2A 2HYYA 4IZYA 1Q61A 3UOKA 3VS7A 4IAFA 4ONAA 1H1WA 4EOMA 3VBVA 2ITVA 2E2BA 4Z55A 4JDHA 4QQTA 4XLVA 5AIRA 3CY3A 3FL5A 4QP3A 3LMGA 3WYXA 4DTKA 3L9NA 2J5EA 4GRBA 4GUBA 4QP9A 3ZDUA 3F5UA 5HLPA 5CU6A 5JQ8A 1AQ1A 5KE0A 1BI7A 1DAWA 3GU5A 2RGPA 3FBVA 3ALOA 4O0UA 1LPUA 2QR8A 5EHOA 1GZKA 1GIJA 4AGUA 3LVPA 1XH8A 4O0RA 1NT2A 2G9XA 3I60A 5DMZA 4GH2A 5JFSA 4R78A 5KKRB 2A0CX 1S9IA 2WMXA 4NK9A 2IVSA 5L8KA 4CV9A 4C59A 2VWIA 3DOGA 4XH6A 2C0OA 1WZYA 3RPYA 3PSCA 4KINA 4ZS0A 3QCSA 2CN5A 5IA3A 2XIYA 1PHKA 3LFNA 3PLSA 4R5SA 4FVQA 1PJKA 3FL4A 4IBMA 2GNGA 4A7CA 5EI8A 4HYHA 4FV4A 5LJJA 2RFDA 2YIWA 2JAMA 3QQFA 5CI6A 3GU4A 3ZU7A 4G6LA 4I21A 4L01A 5HTCA 1PKGA 3OF0A 2PZYA 4FL1A 4N57A 3U54A 1XH4A 3OTUA 3PJ1A 4I92A 1O6YA 3R8VA 3BV2A 4EOOA 5J87A 2X8EA 2BDJA 2EXEA 2BAQA 3OBJA 4YJVA 5CY3A 3SLSA 3W8QA 5CEPA 3KXNA 5C8NA 2OJ9A 2R3GA 3F3VA 1QPDA 3QWKA 2XK9A 3ORIA 4DFZE 4EJNA 2RL5A 5HU3A 2PK9A 1GAGA 2HW7A 3DCVA 3TACA 3TJDA 3UNZA 4NT4A 3L1SA 4GYGA 4OBQA 5AUXA 1CKIA 1O9UA 3LXNA 4LOQA 4MD9E 4FTUA 2CKQA 4J96A 4DCEA 3LQ3A 3AOXA 4FEVA 4N0SA 5L2QA 4ZAUA 3JVSA 4C58A 2ITUA 4GK3A 3ZTXA 5C1QB 4BCQA 1E9HA 2R7BA 3HDMA 4L8MA 3Q4CA 5TF9A 3SXFA 3BHTA 4R3PA 5AX9A 4ZXTA 5HICA 2VTRA 2RF9A 3ULIA 3NX8A 5FEEA 3RPRA 3FYKX 2UZOA 2YIYA 2GTNA 4BDDA 3C5IA 4AE9A 4ITJA 4BTMA 3ZMMA 2RFEA 5AV1A 2ZOQA 3EKKA 4YBJA 2X7OA 1NVRA 3C4FA 4TYGA 5JK3A 3OWKA 4C8BA 3FEGA 2ZM4A 2VX1A 3AQVA 3BZ3A 4I6QA 2JFLA 3BHYA 3OHTA 4FI1A 4QMSA 3R83A 2XKFA 3LIJA 3ZUVA 2O0UA 2QKRA 1URWA 2YLEA 4CFVA 3O50A 1OMWA 3NIEA 3VUMA 2YZAA 5D7AA 1IASA 4D4RA 2PVHA 3F6XA 3TEIA 3A8WA 3GGFA 3P1AA 3KQ7A 4PRJA 5AMNA 4APCA 4AU8A 4C3PA 5G6VA 2UVZA 4K9YA 4QQJA 3NMUF 3PVUA 4F7SA 4FT7A 1W0XC 3KC3A 5CLPA 4ZJVA 3NUYA 1PXIA 3E63A 4FTLA 1OUKA 4JG6A 3UDBA 1P2AA 2J50A 2QG5A 3A7GA 2PVYA 4NUSA 3RK7A 4BVUA 2UW6A 5JZJA 4ORKA 4S32A 4JLCA 1PY5A 3BWJA 4HPUE 3EHAA 3BLRA 4TYHA 4DH8A 2QU6A 2WQOA 1F5QA 4D2RA 3CC6A 3FLQA 5M08A 3QC4A 1HCKA 4FEQA 4KIKA 3DTCA 3ZEWA 2BKKA 3BYMA 5HORA 4BR3A 2R3NA 3NCGA 5J1WA 4AG8A 4G16A 3DFCB 4APPA 4EBWA 4YJUA 3M1SA 3DTWA 2JBOA 4U79A 5EYKA 1W7HA 2J0IA 3FHIA 3IECA 3P78A 5M4CA 1SMHA 5HGIA 4CMOA 2GQSA 1NVSA 2GHGA 3BKBA 2QCSA 4HGTA 3BQRA 5FDXA 5C9CA 5EM7A 1H07A 4BCIA 3D83A 1IA9A 2WU6A 2PVLA 5IUGA 3NUAA 3TNQB 3NAXA 4CFFA 4NEUA 2HCKA 3LFSA 3SXSA 4EHZA 3RAKA 3PVBA 2QODA 4IACA 3HVCA 4L3JA 2XNOA 5H9BA 4BCMA 4BCGA 2YCRA 3ZLWA 4BCJA 4CFUA 3GT8A 2QOIA 3KF7A 3N51A 4H1MA 4HPTE 3L9LA 5ETAA 2LAVA 2Z7RA 4BGGA 5JMSA 2I40A 4JI9A 3BRBA 2QNJA 4RFYA 2G15A 3TUCA 4DH3A 4F9AA 3GU7A 3MGYA 2JDTA 2WTJA 3UQFA 3FY2A 3NSZA 5AP0A 4WSQA 4G34A 3UIUA 3ETAA 3R7VA 3PXFA 5CU0A 3AC3A 2IJMA 3DY7A 4XV9A 3S4QA 4AOIA 4DHFA 5BVOA 2FH9A 5IF1A 4XX9A 4EK5A 3H10A 4TL0A 3LZBA 5I9UA 3ATTA 2OF4A 2ONLC 4U0IA 4OTRA 3DKGA 5LVLA 3GU8A 4FUXA 5CAOA 2R3FA 3OMVA 5HI2A 5CF4A 2PUPA 3DA6A 3MESA 3F5PA 2W5BA 5HIDA 5CEQA 3KK9A 3ELJA 1F0QA 2ACXA 3V6SA 5HD7A 3KXZA 3F66A 5CVFA 5FXRA 1IR3A 3F2AA 3RAWA 3R63A 2PTKA 2WMQA 4CZYB 1SNUA 3LQ8A 4J8MA 1H25A 3TDVA 3L8SA 1RQQA 4J1RA 3E93A 5LXMA 3AC2A 3DBFA 4S2ZA 5ICPA 3LCTA 4S33A 2B9IA 4F9WA 4FSYA 4PNIA 1ZYCA 1REJA 3A7FA 1XH6A 3IS5A 4R1VA 3VJNA 1UV5A 4JDJA 5K5XA 4EK6A 3E7OA 3WYYA 4F6UA 5M4UA 5IQBA 4E6CA 3VC4A 4DH7A 2O8YA 4QP1A 4CV8A 5HO6A 2X9FA 5IQDA 2OJGA 3HZTA 4IX6A 4E73A 1NA7A 3QTRA 5DLSA 3BLHA 2VTNA 3Q4TA 3UVPA 2VN9A 3JY0A 4BYJA 5AX3A 3VRZA 3E64A 3KCFA 3PWDA 2IZSA 2HXQA 3MJ2A 4D2VA 4RX9A 3RCJA 4TWPA 4PNKA 4JIKA 2DQ7X 4ZTMA 4WUNA 1H0VA 3V8TA 2C1AA 4CD0A 4IVBA 2A2AA 3R00A 4YU2A 4ZLYA 2R3QA 4D9TA 3NYOA 3GEQA 1ZOHA 4FMQA 3DJ5A 4OLIA 2WMSA 3JR1A 3ODZX 2IVUA 3EYGA 3QRUA 3GFEA 5F94A 3JVRA 3Q6UA 2XYUA 3R28A 4J97A 3I7CA 1TKIA 2H8HA 5A14A 4ANMA 2PMOX 2VTSA 2OG8A 5GJGA 4YHFA 5IISA 4H05A 3WZJA 2XUUA 3BHVA 4PP7A 4TWNA 4AN9A 5IG1A 4ZTNA 3F88A 4XP2A 2C5NA 3JYAA 4ITHA 1M7NA 4HOKA 4MQ2A 5F4NA 3V8SA 3VS6A 5LWNA 3GCUA 5ETIA 2H6DA 3EQIA 3GENA 3R1SA 4FZDB 2Z8CA 3SAYA 3S0OA 4QTDA 5EM8A 2BRGA 2OXXA 3OOMA 4XG9A 3BGQA 4FSMA 4RC3A 3KREA 1M52A 1OVEA 3BU5A 4L3LA 5HIBA 4LM5A 5A4EA 3POZA 4O0XA 5ANIA 3MS9A 3Q32A 2JKOA 3PY3A 5CQWA 2X7FA 3QGYA 3PLAE 2CGVA 1U5QA 2ETMA 2NPQA 1Q8UA 1YWRA 4XNEA 3FMEA 3UYSA 3AT4A 5E8ZA 2PHKA 3DBQA 3VUIA 3R8ZA 1YHVA 2I7QA 5BVNA 4IZ5A 3SVVA 3I0OA 2PZ5A 1ZLTA 4O0VA 2P4IA 4BDKA 4X3JA 1H4LA 5GIOE 4D1XA 3EKNA 5BQ0A 4XEYA 5EI6A 3WIGA 3EFWA 3R73A 4BBMA 3HRBA 3P7AA 1YVJA 2VTTA 4RLLA 4YSJA 4YZNA 3ERKA 4EKKA 3R7UA 3RBWA 1GJOA 4EBVA 3NNWA 3JPVA 3GXLA 4U45A 2XJ2A 3P4KA 4B99A 5JGBA 4TN6A 4X3FC 4W4YA 1DI8A 4QMQA 4FTAA 3FLWA 4HNFA 3RGFA 4F9CA 3Q9WA 2X4FA 3EN5A 2GNFA 2ERZE 3NNUA 3OY3A 3TZMA 3HAMA 2XK7A 4AT4A 3F7ZA 3IW6A 3MH3A 4FOCA 4I5PA 4IAAA 2RKUA 5FP5A 5HBEA 4ASEA 3LAUA 4D4YA 2VGOA 2BRNA 2V0DA 2P0CA 4IWDA 4E5BA 2WB8A 5I3RA 4ASDA 5HO7A 1BMKA 5CWZA 4KIOA 2B4SB 1UVRA 5AM7A 1YRPA 3QQUA 2UVYA 2B9FA 2HZ0A 4NU1A 1BLXA 5CU4A 4CEGA 3AD6A 4AZWA 4WKQA 5CXZA 4CYJA 1OIUA 5M09A 4D28A 1ZRZA 5KMOA 2JKKA 3W10A 3I0QA 5IDNA 3UZTA 2QQ7A 2Y0AA 3OUNB 5D12A 4RSSA 4TPTA 3ZBFA 4JAJA 2F7XE 5IQIA 2YACA 4L00A 4QMUA 3THBA 3F2NA 3NYNA 5AAFA 3MH0A 2C3KA 5J5SA 3E7VA 3D15A 3SGCA 4IC7A 4PPBA 4FBXA 3UP7A 5J79A 3HMOA 5AEPA 3KN6A 4J8NA 2W06A 2AC5A 5M4FA 5CVGA 4UZHA 1QL6A 4D5KA 3DLSA 4D1ZA 3PUPA 2Z02A 5EHYA 4G3CA 3CKWA 4I1ZA 3C4EA 4E4MA 1Y6BA 3QFVA 5IH6A 3FZTA 1Y57A 4N4SA 4CFMA 2X6DA 3VBWA 3KXXA 3F3ZA 5TO8A 1UNGA 3GP0A 4FKOA 3HMIA 1H8FA 1XH9A 4EORA 4ERKA 4ZZOA 4ZZNA 4CLJA 5HU9A 2YISA 4ZS4A 2VTPA 5CT0A 2JLDA 5DOSA 5DWRA 3CTQA 4ZTHA 3W2QA 4M69B 4BIEA 3ZOSA 3GC8A 3EQFA 3EQGA 4IHPA 3TV7A 5AA8A 4UMPA 5BYLA 4IB0A 5F1ZA 3QQHA 4YPSA 2YAKA 3DFAA 1EH4A 2VO7A 4MCVA 2CGUA 2QKWB 3ODYX 4R1YA 4RZVA 4ANNA 2GHMA 3C7QA 3FLNC 3QQKA 5AR2A 5E91A 2CCHA 3R30A 4GK4A 3OFMA 3KY2A 4JBPA 2QOLA 3FUPA 4IWOA 4O91A 3VW6A 1S9JA 3W32A 4OTDA 3FLYA 4EL9A 4KABA 3ORTA 1VEBA 2J0JA 5LVNA 4ACCA 2C5XA 3OW4A 5TOZA 2QHNA 4CLIA 5FTGA 4KSQA 4FT9A 4DT9A 4P5QA 3OVVA 2DS1A 3U6JA 1OM1A 2PULA 5IQAA 5KMIA 3C50A 2EB3A 3KXMA 3R71A 3CQEA 4MNEA 5DH3A 3RM7A 5C8KA 3RMFA 4EYMA 3OXIA 2ITYA 3TZ7A 4GW8A 4DC2A 1T46A 5IUHA 4DGLC 2OZOA 3GOPA 1WVYA 3RJCA 5CSHA 2ITTA 1YI3A 2JAVA 3KMMA 5FM2A 2R4BA 3LXKA 3FXZA 1REKA 5AA9A 2IN6A 3DK6A 4OBOA 3A7JA 4EJ7A 2B52A 4FZFB 3MVHA 3GCQA 3QTQA 3Q52A 5E8VA 3NS9A 1CTPE 3WILA 1G8SA 4U5JA 1RW8A 4A9RA 2YM6A 3NPCA 3NRMA 1Q8YA 3B2WA 4E6DA 2J0KA 4QNAA 2WKMA 2BIKB 3KFAA 1MRYA 1U5RA 2YABA 2R3KA 3V6RA 5HE2A 3P79A 4MEDA 4ZMFA 4XOZA 4YGAA 2YAAA 4LGHA 3DQXA 1XBBA 4R5YA 4X2FA 5H8EA 3R9DA 3VS5A 2OZAB 2X1NA 2PUUA 3O0GA 4IVDA 5K4JA 3LJ1A 4K77A 4RJ6A 4DA5A 3EFKA 2QHMA 5LCKA 2C6OA 4UYAA 4GJ3A 4ACHA 5CANA 4QP7A 4QMXA 2JIUA 5HKMA 4C0TA 4AP7A 4F7LA 2B55A 3AC5A 4PPCA 3DU8A 3C9WA 3W55A 3BPRA 3D94A 5L2SA 1OBDA 2VWYA 4MTAA 4EONA 4I20A 5FGKA 1Q24A 5KMNA 4C02A 3LHJA 4JQ8A 4E20A 4C4JA 4F9YA 3SW4A 1DM2A 3ZO3A 4H1JA 2RG5A 2WOTA 5C4KA 4U97A 3Q2JA 3TUBA 2XCKA 2YCQA 2YIXA 1J3HA 3D7TA 1JQHA 5EH0A 3FI8A 4EOSA 3O17A 5BVEA 3OWJA 5GJFA 2W1FA 5EDQA 5L6OA 4MYGA 2QLUA 4OR5A 4P5ZA 2CCIA 4NFNA 3VBYA 5EKNA 2V22A 4IZ7A 2PUNA 2FSMX 5J95A 2X6EA 4YJRA 4O83A 5HESA 3R6XA 3DBEA 4AT5A 3H9OA 4MWIA 3E5AA 4O0SA 4JR3A 4H58A 2OFVA 1WBTA 4AOTA 2OIDA 4FV1A 4KD1A 1OL1A 4TNBA 2OO8X 4TZRA 1H24A 2QO7A 3BU6A 5FXSA 5CVHA 3NAYA 4BI1A 1XH7A 3K5VA 3RAIA 4X3FB 2JDRA 2YWPA 3I5ZA 3O23A 4DH1A 4XG7A 4OGRA 2R3OA 1STCE 1WVXA 1BL6A 5DR6A 5HD4A 4MHAA 2VWWA 1AGWA 4I6BA 2YCSA 3F82A 3VF8A 4IH8A 3PXZA 5TE0A 2I1MA 2BROA 4IM2A 2GU8A 2J0MB 4AW5A 5TKDA 5HNGA 4RJ7A 4AN3A 2WQBA 4YBKA 4V05A 1YXVA 4KNBA 3Q9XA 3U87A 3H0ZA 3NYXA 3WF9A 2XCHA 1CKPA 3H9RA 3UIXA 4U40A 2X2KA 5DVRA 3BGZA 4WA9A 3L8PA 5CEKA 3FQSA 4NWMA 3K2LA 4HW7A 5M56A 4ZMEA 4LRKA 2G1TA 4IZAA 4FTNA 4GJ2A 4F99A 2JDOA 2HY81 4RA4A 3U4WA 4AQCA 2AUHA 2O63A 4O6LA 3OT8A 4I24A 1OECA 3CQUA 2JDVA 4FK6A 1QCFA 3R0TA 2X2MA 3KMWA 4WNKA 4A9TA 1SVHA 4C4GA 1OBGA 1KOAA 3G9LX 3LCOA 4YP8A 1YOMA 2CLQA 3WE8A 3PPKA 4LQMA 5B0XA 4BCKA 4EOPA 4DEIA 5FEQA 3GCVA 5ANOA 4FKUA 3D5VA 2WPAA 2B0QA 4G6OA 1PYEA 2C6LA 3TTIA 3P0MA 3BU3A 3DAJA 2WD1A 4EHEA 4EQCA 3ZO2A 5L8LA 4O7LA 3HDNA 1FPUA 4M15A 2C3JA 4NCTA 4FTQA 4DFXE 2C3LA 3N4UA 4XCUA 4A07A 3COKA 4ZIMA 4LL0A 3ZDIA 4AOJA 4TTHB 3FKLA 4DG2E 2W96B 4J95A 2OLCA 3BLQA 1DS5A 1G3NA 2WFYA 3QA8A 4LUEA 1JKLA 1WBPA 4ZTSA 3RZBA 4IM0A 2RFNA 2UW7A 4LRJA 3RPOA 3ULZA 1J7LA 5IQEA 4O1PA 1FVVA 4FV0A 4DINA 3G2FA 5GJDA 3ITZA 3DS6A 2CKOA 3RWQA 2IVTA 4QYGA 2VTAA 4Y73A 3PRIA 2VD5A 4GT4A 5GHVA 1OKWA 2O64A 2WAJA 2IZUA 2R7IA 3OG7A 1YXUA 4LV8A 4MX9A 4YZMA 4DE4A 4FZ7A 3LKMA 5BYYA 2WOUA 5GIPE 4IE9A 1YWVA 3TTJA 1TQMA 1U46A 4WUAA 3QWJA 4MVFA 3NGAA 4GG7A 4X6QC 4AGCA 4BYIA 3CS9A 3ZFYA 2YITA 5HIEA 1HOWA 5EW9A 4YTHA 2XP2A 2EXCX 2JIVA 4FX3A 2P3GX 5ANDA 3A8XA 3FMJA 5HVYA 2I0VA 4UMUA 5A4TA 3KL8A 4EOJA 3RZFA 2GDOA 4BBEA 2PE2A 5AIKA 4EH4A 5DEWA 4UY9A 3H30A 5B7VA 5TT7A 4L67A 4D2PA 2G01A 2W4JA 1O6LA 4YTCA 3VS0A 2E9NA 3DKFA 3R7YA 4RWKA 3NIZA 3IGOA 4QP6A 4RG0A 5IA1A 1LEWA 3E3BX 3TKUA 3QALE 5A46A 5KMMA 4JL9A 4QO9A 3NW7A 4H3QA 5DT3A 2VO0A 4KWPA 4ANLA 1V0OA 3RNYA 4JX3A 4FG8A 4YMJA 4KRDA 4IADA 1NW1A 3PXRA 3SD0A 4YHTA 1CKJA 5CSPA 1FVRA 2C5OA 4DFUA 4BWXA 3KULB 5CU2A 3MY1A 3R1NA 4YHJA 3PRFA 3W2RA 3ZRMA 4AT3A 2GHLA 3ORXA 3CP9A 5HNIX 2O65A 5BVKA 3F5GA 3P7BA 3AC8A 2C5YA 4QOXA 3NR9A 4MBIA 3TIYA 3ENHA 3CPCA 2GFSA 4JRVA 1MRUA 2DWBA 3R8PA 3GUBA 2CN8A 4KRCA 4LG4A 5F9EA 1A06A 2VUWA 4QTAA 5HBHA 5M44A 3TNHA 3F3UA 3PJCA 2UZUE 1YI6A 3FKOA 3IK3A 3RINA 3PY1A 3ZEPA 3E62A 2YLFA 2WEIA 4FG9A 4MXZA 3I6UA 2XM8A 4H36A 3VO3A 1PXPA 3BE9A 4MXAA 2BFXA 4L68A 3VQHA 4B8MA 3E8EA 4DF3A 1M17A 4EOKA 1IA8A 2C6TA 3CR0A 3CJGA 3QTSA 3R21A 3LFBA 3TM0A 2G2FA 3D14A 3R2BA 4W9XA 3ID6C 2PYWA 1APME 2UZBA 3HEGA 3D2KA 4HGEA 5E8XA 3NDMA 2VO6A 4GG5A 4QMNA 4B9DA 2Y4IC 2E9UA 2IZRA 4BCPA 1T45A 4FKQA 4M97A 2FYSA 1H1SA 1Q8ZA 3BI6A 2I0EA 3CCNA 4C4EA 1J1BA 3HA6A 5J5TA 4L7FA 4V0GB 4R8QA 5IH5A 4EUUA 5IU2A 1A48A 4R3RA 5AM6A 4RIWA 4CNHA 4EK8A 4QMYA 2YERA 1YWNA 4YLJA 3QTXA 4G5JA 2CJMA 3BHUA 3LCSA 1YOJA 1YXTA 1ZY5A 2XKDA 2YJSA 3MTLA 3FV8A 5D41A 2WMWA 3KXGA 5FTOA 2ZVAA 2VNYA 3IDCA 3KEXA 3QCYA 4RIXB 2WELA 2NNWB 1PMEA 3OZ6A 4O82A 2UW3A 3HECA 4I41A 2PMIA 2WMBA 3R04A 1VYZA 1WVWA 2Q0BA 3AGMA 1UA2A 3CSVA 4IC8A 3NCZA 4FKIA 4M12A 4N6ZA 1R78A 4ACMA 4M3QA 3PA5A 4O2ZA 3DV3A 3OCTA 3EQDA 4ZLOA 1PMVA 3OXTA 2BPMA 4OTFA 5AR5A 4EUTA 1FQ1B 2OICA 2PVKA 3M2WA 4RT7A 5C03A 3TZ8A 3WF5A 4JBOA 3VAPA 3AMYA 3IO7A 5DHJA 2R3HA 4NKAA 1ZWSA 3HP2A 1J7UA 2QONA 4JBVA 4CZTA 1WCCA 5BVDA 4FKPA 2X7GA 1P4OA 3COMA 3T8OA 4BN1A 2W0JA 3OD6X 3R7EA 3V8WA 5EHLA 4KA3A 3VRYA 3VBTA 4Y95A 3LFDA 4BWKA 3OW3A 5GZ9A 3K54A 2I6LA 4HVHA 2XA4A 4DLIA 2YN8A 3LFFA 1W84A 2WNTA 2BZHB 4I23A 4OT5A 4Q9SA 4RIYB 4YJPA 3BQCA 3SRVA 1WBVA 4DG3E 3R9HA 3KVWA 5CQUA 3FZPA 3G0FA 3GC0A 2P2HA 4XP0A 3FMMA 1W83A 2G2IA 5KZ0A 3RAHA 3W18A 4EYJA 4F7JA 1ZXEA 3QXOA 4FVPA 4HYIA 4Y83A 3DDPA 3FXWA 5JH6A 2W1CA 3C4CA 5DG5A 5EOBA 4DH5A 4ASZA 4MXYA 5KNJA 3NNXA 2OIQA 3R8UA 2QOCA 4AXAA 3G15A 3DAKA 3KCKA 4YC6A 3ZLYA 1F3MC 2XZSA 4GIIA 4YJNA 5CAUA 1UU3A 1BL7A 3ORPA 4N6YA 4IFGA 4BDCA 1KE8A 2OU7A 3QTWA 4O2PA 2EUFB 4S34A 4MKCA 4GIHA 4KIQA 5EOLA 1GZNA 3GFWA 3JY9A 4HZRA 3QU0A 4QMVA 4JX7A 2VWVA 4FKSA 4OTWA 1ZMVA 2UZDA 4PP9A 3C5UA 3MFTA 4U9AA 4PL4A 5HCZA 4UX9A 1W82A 2X8DA 2VWBA 4I94A 2UW4A 4FSRA 4GL9A 5HHWA 4EQUA 5BX0A 4IJPA 5IEXA 3SV0A 4JDIA 4IDVA 2PMLX 5HG5A 3LE6A 3D5UA 3UQCA 5IA0A 4UWBA 5DN3A 4AZSA 4D58A 2VU3A 3FC2A 1OL7A 2WTVA 3CQWA 3ZZWA 4UV0A 3DQWA 3T9IA 3H0YA 4OW8A 1VYWA 2BVAA 3B2TA 4I3ZA 3VN9A 1SM2A 3FE3A 4EKLA 4G3FA 3OBGA 4KB8A 2A19B 3POOA 3L8VA 2RG6A 5DRDA 4HGLA 2GCDA 5ANJA 5ANGA 3FSKA 5CTPA 1XBAA 4RWJA 4XOYA 3FHRA 2OH0E 4G9RA 4MF0A 5E1EA 3S1HA 3SG9A 2XMYA 4FTKA 3FMKA 3UVQA 3BEAA 2WTWA 3VW8A 2BMCA 3Q60A 4DFLA 1KUTA 2PUIA 4F70A 5D7VA 3D5WA 5IQFA 4M0ZA 4FSNA 4LFIA 2V7OA 3BHHA 4XV1A 5CSXA 4MXCA 4Z9LA 3O8UA 1PXKA 2PVMA 4HJOA 3VQUA 5IUIA 2VV9A 4E8AA 3DGKA 4YUQA 4RIOA 4D4VA 2CMWA 4FOBA 5IQGA 2EB2A 1OGUA 2NO3A 3BIZA 2YIRA 4KKHA 1UWHA 3T3UA 3T9TA 3ZS5A 5AAGA 1ZYLA 3ANQA 4TT7A 2UW5A 5C26A 2NRUA 1YDSE 1JAMA 4M67A 4BBFA 3F9NA 2WQMA 2B54A 3EZVA 2CHLA 2Z7LA 3DJ6A 3DBCA 3PIYA 5E8UA 4WIHA 3RVGA 4C35A 2JDSA 4WO5A 3BE2A 4KBKA 2E9PA 2HZIA 2OF2A 3I1AA 1BYGA 2HW6A 4I22A 2XNGA 3QZIA 4O0WA 4C57A 4EC8A 2VWXA 4UWCA 3GI3A 5AP4A 3RWPA 1UKIA 4RGJA 4O81A 3TWJA 4BCHA 4MBLA 3RK5A 1JKTA 4ANSA 4CT2A 4ZSLA 3EQRA 5CENA 2WIHA 4AZTA 3EQPA 4FV6A 4IB3A 4QMMA 3CIKA 3ORKA 3G51A 4S30A 4FVRA 4NM0A 4WG5A 4G2FA 5AUZA 2Y4IB 3TCPA 5B2LA 2XJ1A 2J2IB 5HTIA 4PMTA 4K2RA 3LLTA 4EH6A 4FTMA 3UPZA 1E1VA 2YDIA 3HYHA 2W17A 4R7BA 3DXNA 3KRJA 4IAKA 1SNXA 2KULA 3KF4A 2GMXA 3MA3A 3PPJA 5C8MA 5HLNA 3IOPA 1RE8A 1MP8A 4CG9A 2C47A 2XK8A 4TY1A 4O7VA 5JGAA 3A60A 4BB4A 3WF7A 4ZSAA 4OTGA 3EQBA 1M14A 5E8YA 2YIQA 3V5QA 5KMJA 4NW6A 1LR4A 3F5XA 3E8DA 3BCEA 3NLBA 4E4XA 3DLZA 3UNKA 2ZV7A 4KKGA 2Z2WA 4TYJA 3OXZA 4XG2A 3F61A 2YM7A 3TV4A 5F95A 3VUGA 4TWCA 3EQCA 3ACKA 3MI9A 3EN6A 4F09A 5CXHA 2UZEA 2GTMA 2XYNA 3V04A 5D1JA 1YDTE 2C3IB 4GMYA 4WBOA 3LW0A 5T68A 1R39A 1OZ1A 4DGNA 4FK3A 4FNZA 5HX6A 5BUIA 5HEZA 1R0EA 3QCQA 3RCDA 4D4SA 2ETKA 3Q6WA 4CFWA 5A4QA 5EQEA 3SX9A 5CEOA 3ZM9A 4LMUA 1TQIA 5AFVA 4X2NA 4XHKB 3V3VA 2KTYA 4P2KA 1Y8YA 5BYZA 4L52A 2PE1A 3LXLA 4BIBA 3TNIA 4DEBA 5I9YA 5KCVA 1OPJA 2VGPA 3UO5A 2C30A 5CZIA 5TR6A 1LUFA 3PWYA 4CCBA 5BVWA 5IPJA 2X9EA 4UBAA 2ZYBA 3DPKA 3G9NA 4I5CA 4HVDA 2YDJA 3TXOA 1ZYSA 2OZAA 3A62A 4MH7A 4DBNA 4CG8A 3MIYA 3HUBA 4A4OA 3UOJA 4C2VA 2EXMA 3NUPA 3QTIA 1Q3DA 4EOQA 1GZOA 1P5EA 1YXXA 1XWSA 4ENYA 3AMAA 4K0YA 4FGRA 5A54A 4BTJA 2WMUA 2HXLA 1IEPA 5EI2A 4ALVA 3C4XA 3VULA 4AN2A 2R9SA 5CU3A 4BF2A 5DEYA 2HWPA 4IIRA 4TYHB 3GB2A 3P7CA 4YLLA 4J53A 5ANEA 3ROYA 5M51A 4KS8A 3CD3A 2BAJA 2GNHA 3MTFA 3OP5A 3W2PA 5L8JA 3F69A 4FTCA 4BFMA 5JQ5A 4X2JA 3QQLA 3U6IA 3UNJA 1YQJA 3N4VA 2WHBA 3QTZA 1U54A 2R5TA 4Z16A 4C37A 3QHWA 2UZWE 5HCYA 4XG4A 4D55A 4EH9A 1PRYA 2BZIB 3DNEA 3B8RA 4WNMA 4TNDA 5KMKA 1SZMA 4DN5A 4C4IA 3HGKA 4Q2AA 2Y6MA 3ZO4A 2W1HA 3LMHA 4FODA 5AR4A 4DFYA 3R9OA 3PXYA 3QRIA 4ALWA 4DGOA 5D10A 4I5HA 5HG7A 4Y8DA 1I44A 5AP6A 3HKOA 5DRBA 4AWIA 3GCPA 3QD3A 1IAJA 1H1PA 2P2IA 2J0LA 2CNVA 4O38A 4F64A 1W98A 5IQCA 4JG8A 2OXYA 3OT3A 1JPAA 1ZYJA 4QTBA 4U43A 1HCLA 5G1XA 4F1TA 1YW2A 5AADA 5GZ8A 3AD5A 4QPMA 2GNJA 5DR2A 1MQ4A 2ZV8A 5DI1A 5K3YA 3K5UA 4MXOA 3ZXZA 4C38A 4ACGA 2JKMA 2BRHA 5E7RA 3ZM4A 2PL0A 3LPBA 5FLFA 1H28A 4AW2A 2X2LA 2OKRA 2XNBA 3OROA 4JDKA 4RJ5A 3PIZA 4NIFA 4TYEA 4X2GA 4HVSA 3I79A 5CF5A 3HUCA 2CLXA 2W99B 3CLYA 4E6AA 3UGCA 4UB7A 3M42A 4X21A 5JKGA 3Q2MA 4MBJA 3GU6A 3HRFA 3PYYA 5AAEA 4FIGA 4LYNA 4A9YA 3EYHA 5M57A 4FNXA 4QPAA 2H96A 3O8PA 2X4ZA 3V5LA 3BV3A 3FSFA 2FUMA 2F4JA 4IW0A 4CCUA 3G5DA 4MD8E 4L3PA 1ZZLA 4M8TA 1CM8A 4F7NA 1ZAOA 3C1XA 3Q9ZA 5M06A 3QL8A 4D2SA 3QRJA 4AZFA 3VBQA 4BTFA 1CDKA 4G3DA 3U8WA 2C0TA 4YJOA 4NKSA 2W9FB 4FTJA 2P33A 4BCFA 4RJ8A 4WBBB 3A7IA 4ARKA 1Q4LA 3UC4A 4C61A 1L3RE 3IOKA 4MNFA 5BUJA 1V1KA 4FZ6A 5BUEA 1KE9A 1BX6A 2EVAA 5EKOA 5H2UA 1FMOE 3KMUA 4RWLA 3EN9A 2BDFA 3MW1A 1WMKA 3DK7A 3UO6A 1Q5KA 2BRBA 1OI9A 2UUEA 3W2CA 3BYOA 5AUYA 3L8XA 4BHZA 5IA5A 4DBXA 4EH8A 5EW8A 1UU8A 2WO6A 1RJBA 4JAIA 4U8ZA 4DFNA 3I7BA 4LL5A 5DNRA 3UZRA 1GIHA 1I09A 1Y91A 3AC4A 4FKJA 5LCJA 3JUHA 3OWLA 5HLWA 4GU6A 4PMPA 3FQHA 4QTCA 4BKYA 5L6WL 1P14A 4CTBA 3UIMA 5EDRA 4HNIA 2ZB0A 4PL5A 5E8TA 2HZNA 2OGVA 2W5AA 3C4ZA 2YM3A 3KRRA 2NRYA 3E3PA 2J9MA 2OW3A 3O71A 4PMSA 3UE4A 2REIA 5B2MA 3LOKA 5FEDA 3ZONA 4M68A 2VWUA 5IEVA 5AR7A 2VO3A 3PJ8A 2HENA 2UW8A 3LM0A 3QCXA 4X2KA 4C4FA 1H00A 4E93A 3PP0A 5DE2A 5EM5A 4E3CA 5CF8A 5LVPA 2XNEA 3UOHA 4NM3A 3FMLA 1WBSA 3RHKA 5GNKA 4QMTA 4XBUA 5FM3A 4RWIA 4JIAA 1JNKA 3QX4A 4NM7A 4F0GA 5K5NA 3ZXTA 3R1QA 1G8AA 3FMHA 1FGKA 3QLGA 1OL2A 3UVRA 1ZY4A 4D1SA 4EC9A 4U44A 4A9SA 4LMNA 3UP2A 4CT1A 4DCAA 3ALNA 4F4PA 4EOLA 1FINA 2GS7A 4PDOA 1ZYDA 4K18A 4O7RA 4YC3A 2WU7A 5I4NA 3KULA 2O5KA 2ESMA 2RFSA 2XM9A 2XIZA 3Q3BA 2YM4A 1B39A 3QRKA 1K2PA 4IWPA 4UEUA 4XP3A 1WBOA 1XH5A 2XBAA 3A2CA 5CX9A 3ROCA 3MWUA 3VBXA 3VWAA 1TVOA 3WARA 3I4BA 5HBJA 4FEUA 2YHVA 3Q4UA 4ZEGA 4F08A 2R0IA 5ETCA 5AUTA 3GNIB 4FV2A 5J9LA 5GINE 3GOKA 3O2MA 5HZNA 5LMKA 3UZPA 2QD9A 3ZUTA 4FSZA 5A4LA 5J7HA 4O86A 2IW6A 2PE0A 4RJ4A 5CT7A 3S3IA 3LCKA 1VR2A 2CKEA 4M13A 2F2CB 4Q5HA 4GS6A 5DR9A 5AP1A 1IG1A 1VJYA 4AGWA 2BHEA 2VTMA 3II5A 3FDNA 4G3GA 2Q83A 2R3PA 3NUNA 5AP7A 2C6DA 4K8AA 4U3ZA 4W8EA 5CNNA 4ANBA 4PF4A 4QP8A 4CKJA 4F1MA 3DB8A 3QQJA 4JJRA 3Q4ZA 4U80A 3PPZA 5AP3A 2CNUA 5K9IA 3CEKA 4CXAA 4AW0A 4TKSA 2BFYA 2AC3A 2O2UA 2FSOX 5HQ0A 5M53A 2YJRA 5FBOA 4FKRA 3OEZA 4L7SA 4EH5A 4H3PA 4FIJA 4M0YA 2OFUA 5I9VA 5E8WA 4GFGA 3ZUUA 2QG7A 3TDWA 4O84A 2RIOA 3AD4A 4IB1A 2XNNA 4RQVA 4XRLA 3QBNA 3VUDA 4J99A 4A4LA 4EH2A 3PSBA 5HG9A 3CBLA 3D7ZA 5CSVA 2W4OA 3MB7A 4V0GA 4EK3A 3MY0A 2JGZA 2WQEA 2A1AB 1UKHA 1JVPP 2HIWA 3VS2A 4F1OA 2V7AA 4OBPA 2QR7A 2W5HA 1O6KA 5LOHA 4QYFA 3KK8A 4ZY5A 4RC2A 1OKYA 4FR4A 4RVLA 5LMAA 4E5AX 2ZV2A 4EWQA 4IX5A 5I9WA 4RIXA 5EW3A 4Z3VA 1PF8A 4YZBA 3CKXA 3DB6A 3W2SA 5J9YA 5L3AA 3R9NA 1W8CA 2LGCA 2W05A 3H4JA 4TW9A 5HE0A 1E1XA 4CRLA 4RMZA 3S95A 4JBQA 4W8DA 3OOGA 2J4ZA 3VHEA 3VHKA 4P4CA 3ZLXA 4FE2A 1ZOGA 4BC6A 3D4QA 2GQGA 1JWHA 3FLZA 3TZ9A 4GVAA 3FY0A 2Y7JA 3KB7A 4WNOA 5A3XA 3AG9A 3ANRA 3A4PA 3KN5A 5M4IA 2XIXA 4FKGA 1R0PA 5HE3A 3N4TA 3W2OA 3RI1A 1WBNA 4BICA 4RFMA 2Z7QA 3NUSA 4FL3A 3FAAA 3P9JA 3NNVA 2ITXA 4W4WA 4O96A 3R7OA 5KO1A 4NCTC 4F6WA 4RJ3A 3AXWA 1Z57A 2B9JA 4KBAA 3DKOA 3GC9A 4IMYA 4Y46A 3C13A 4RIYA 4ZOGA 4FIFA 4BCNA 4BDBA 3FYJX 5H8BA 3S2PA 2F7ZE 3ZRKA 5I9XA 2ITOA 4DGGA 2VTQA 2R0UA 4BIDA 4B6LA 5LQFA 4IVCA 4MK0A 3EN7A 3C0HA 4G9CA 4AFEA 4Q5EA 3MFRA 4CRSA 4BDHA 3DXPA 4DITA 4ZY4A 3CGOA 3NYVA 4FT5A 5H3QA 2PVRA 3HNGA 3TKHA 3VIDA 5KBRA 4EZ7A 1ATPE 2J90A 3OWPA 1PKDA 3Q5IA 2QOHA 3MJ1A 3O8TA 5CZHA 2HK5A 4O7WA 3OCSA 3UO4A 2E9VA 3QD2B 5E8SA 4LUDA 3QZGA 4OTPA 2QOBA 4BDJA 4TWOA 2FB8A 1PW2A 5CAPA 2W1EA 4BY9E 4LGGA 2XH5A 2RSVA 3UOLA 1LP4A 5DA3A 3O7LD 4I5MA 4C33A 4DEHA 4X7QA 3MPAA 1YKRA 4NSTA 2F57A 2FSTX 3BWFA 4F9BA 3RM6A 4H3BA 3DJ7A 3HAVA 4C7TA 2QOKA 4E4NA 1KE6A 1B38A 3D9VA 4GFMA 1Y6AA 2OH4A 3W16A 3EIDA 2QVSE 5JT2A 2ZV9A 3EWHA 4C36A 2R2PA 3P08A 4IJ9A 5DPVA 5AV2A 5CF6A 2PSQA 4S31A 4BTKA 1OKVA 3HV6A 4O22A 5FQDC 1OUYA 3E87A 4CFNA 2FGIA 4CKRA 3SG8A 3BEGA 3ET7A 2Q0NA 4K6ZA 3AMBA 1R3CA 1VZOA 3C4WA 4D9UA 1UU9A 2VTJA 1ND4A 1XQZA 1JKSA 4BCOA 4HYSA 2H34A 4O27B 5AJQA 5AP2A 4ZLZA 4CMUA 3KKVA 4YLKA 5HVJA 2IZTA 4AF3A
chains in the Genus database with same CATH superfamily
2C69A 4CYIA 3IGGA 3DZQA 3K3JA 3UPXA 3JS2A 4PV0A 2ZMCA 5CEMA 3WI6A 3CD8A 5CASA 2ITWA 2X8IA 3NEWA 1OIRA 4IVAA 1H01A 2XIRA 3KGAA 4QQ5A 2GNIA 3WBLA 4USFA 2VRXA 1YI4A 2BAKA 3K3IA 3MH1A 4LI5A 4FNYA 2JIIA 3IONA 3MPTA 3RKBA 5CAQA 5ACKA 4JNWA 4PX6A 4U6RA 4EOIA 3WIKA 2QU5A 3D7TB 4HCTA 3UMXA 3REPA 3OC1A 4GK2A 2QO9A 4M14A 3WOWA 1J7IA 3WE4A 2BCJA 3GQLA 3W0RA 5JSMA 2F7EE 3GBZA 1Q99A 4RX8A 3HP5A 2Z60A 3HA8A 4HZSA 4DAWA 2CGXA 3U9CA 3ZSHA 2GS6A 2DYLA 4ITIA 3UG2A 2C6MA 3R8MA 5FRIA 2UW9A 3M11A 2ZM3A 2V55A 4FC0A 4K11A 5FXQA 3MDYA 3GC7A 2ZMDA 3Q04A 2GPHA 3OY1A 4FV9A 2WTDA 4GEOA 4FEWA 2BALA 3PXQA 3QAME 2JEDA 3IDPA 3WF6A 2BZJA 5CI7A 3BELA 1DI9A 2YCFA 4IQ6A 4YZCA 3UQGA 3ZYAA 5A9UA 1OIQA 1BUHA 2OBJA 3C0IA 5LMBA 3MIAA 4PL3A 1J91A 4BL1A 3DNDA 5HCXA 1JSVA 3ZHPC 3PJ2A 3PSDA 3CPBA 1W2CA 3HMNA 3IQ7A 3CXWA 3NW6A 4UXQA 5CNOA 2H9VA 3G90X 3PE1A 4C3FA 3I81A 5IMEA 2AYPA 4L43A 3E88A 1JOWB 4XV2A 5H8GA 4Y85A 4F65A 1URCA 4Y5QA 3V5PA 4D2WA 4I0SA 4DEDA 3JXWA 2XEZA 4YTFA 3LFCA 3I6WA 4YJSA 3ZFXA 2BRMA 3U6HA 4IAYA 3LCDA 3PA3A 2ZB1A 3MY5A 4M7IA 3IW7A 5EK7A 5HO8A 5L2WA 5EYMA 2A4LA 5CS6A 3BGPA 2IW8A 3E8CA 5FWKK 4AGDA 2CKPA 3D0EA 4O0TA 2WTCA 3FI2A 1BI8A 4RZWA 4FF8A 4NTSA 3RHXA 3DKCA 5L6PA 3CTHA 5A6NA 1UU7A 2XB7A 3PTGA 2G2HA 3C51A 2J5FA 3MPMA 4IANA 5HG8A 1WFCA 5K0XA 4NM5A 4W4VA 1R1WA 4GV1A 4O7SA 4AA0A 4EHVA 1PXLA 1KV2A 4IX4A 4USEA 2J7TA 1JSUA 4C2WA 4FIEA 1L8TA 4JXFA 3ZFMA 4GYIA 1GY3A 3NVMB 2X81A 4AX8A 3OCBA 2CPKE 4YO4A 4JVGA 4QMPA 4C4HA 2E9OA 4E4LA 2PUIA 3VVHA 2WXVA 4LOOA 2VTIA 1K9AA 3ORLA 5HOAA 5IA4A 3EFJA 4NYEA 2BUJA 4MAOA 4U81A 4R7IA 4ASXA 1MQBA 1OKZA 1CSNA 5FTQA 4W9WA 4DYMA 4B7TA 4R77A 3KA0A 4AA5A 2UW0A 3NUUA 3P5KA 2XKEA 4UYNA 2BILB 4I93A 5FG8A 5J8IA 2PZIA 3LFQA 5DGZA 4IM3A 2B7AA 3SQQA 3V01A 4O7TA 2C5VA 3VS4A 4FSWA 4G1WA 5F20A 3ZCLA 5BPYA 1FOTA 3WZUA 3UG1A 4I6FA 2Y6OA 4QNYA 4WRSA 4ZK5A 3U51A 4QYHA 4RFZA 2W4KA 5AUWA 2Z7SA 2BHHA 3O96A 3WF8A 4FA2A 5DIAA 5IDPA 4I0RA 2HAKA 3QZHA 1XKKA 1QPJA 2R3MA 3IDBA 3R1YA 5EM6A 4E7WA 4BRXA 1K3AA 4LRMA 3SXRA 3CGFA 5BMSA 3Q96A 4HGSA 5I9ZA 4ALUA 4GUEA 2ERKA 4CZUA 2YEXA 3IPHA 3PY0A 3PG3A 3DAEA 5LARA 4B8LA 4DEEA 4FTTA 2IW9A 4IAZA 3QGWA 2YFXA 3AT3A 4FICA 4NL0A 2OIBA 2ZM1A 4FTIA 4EZ3A 3VS1A 2HWOA 4BGQA 4WRGA 1ZARA 3EMGA 4L42A 4A9UA 3MVLA 3D2IA 4LOPA 4AW1A 3A4OX 1YHSA 5ITAA 4FEXA 4DTAA 5T3QA 4UN0C 4RX5A 5LWMA 5CEIA 5L2TA 4B4LA 4P7EA 4YTIA 4BZDA 1OIYA 4XG3A 5HX8A 3TUDA 5BVFA 5ETFA 3ZBXA 1H1RA 2PWLA 4GFOA 3C0GA 4ZSJA 1PXMA 5I0BA 4DDIA 4XV3A 3MV5A 2IWIA 2PMNX 3MFUA 4JQEA 5FP6A 3HL7A 1DAYA 4YO6A 5JN2A 3QX2A 2X0GA 1YDRE 4GT5A 5A4CA 2W1ZA 1P4FA 1Q3WA 3FMNA 3UDTA 2QOOA 4WSYA 4M66A 3TJCA 3MB6A 3A7HA 2CGWA 4BJJA 2EWAA 3FJQE 1KE7A 4NJDA 5EFQA 3PE2A 5EG3A 2ONLA 3QUEA 2WMRA 4F0FA 5EQYA 4FV3A 3EFLA 5DFPA 3SOCA 1FBNA 4D0WA 2XJ0A 4HYUA 2IEWA 1Q97A 4FYNA 4HCUA 3KU2A 2C4GA 5KBQA 2VNWA 5IA2A 2WTIA 4UZDA 4YZDA 3ZSGA 2PVFA 5AUUA 4RQKA 4ZJIA 4M69A 4OUCA 5JFWA 5IZFA 4RPVA 3TV6A 3W8LA 2GFCA 4YC8A 3FLSA 2P55A 4PUZA 2YM5A 2ITQA 4Y72A 4FV5A 1OL5A 3QF9A 4RIWB 5AUVA 4BKZA 4AXCA 3NUXA 3V5TA 2VTHA 4DTBA 4QMWA 2W1DA 1GZ8A 3LQ5A 4RBLA 5C4LA 5JFXA 2O3PA 4XMOA 5K0KA 3NW5A 3QD4A 4Z7HA 2BTRA 4B0GA 3ZSIA 2Y4PA 3DBDA 1Z9XA 4UMRA 1XR1A 5J1VA 3UYTA 4EEVA 5A6OA 3DXQA 2XS0A 3R8LA 4WT6A 3FKNA 3LLAA 5KHWA 1V0BA 3U4UA 5DBXA 5KUPA 3ZC6A 4O4FA 3PVWA 3VUHA 3ACJA 5CYIA 4A06A 2OI4X 4PDSA 4L53A 4RA5A 3QYZA 4C34A 3QHRA 3GVUA 4BI0A 4KIPA 3F7WA 4YJTA 3COIA 3ZRLA 3H3CA 4F63A 5LVMA 2JBPA 4ZTRA 2BTSA 3O51A 5HE1A 3TT0A 5HTBA 4DEGA 3LMIA 5L2IA 3KRWA 2PVNA 5FBNC 3WZDA 2C0IA 3BBWA 2GSFA 4G6NA 4J98A 3R22A 3Q5ZA 4RC4A 3LM5A 4CQEA 4U7ZA 2WEVA 2YWVA 4RVTA 2QURA 4DLJA 2VX0A 2XKCA 2WTKC 1FGIA 1H08A 1KWPA 4FSTA 3SRVB 5DT0A 4JMQA 5E1SA 1PXOA 2B1PA 2WGJA 5IH4A 1G5SA 2I0YA 3GQIA 3ZO1A 3HRCA 2Y8OA 4LGDA 3OCGA 4WG3A 3HX4A 2XNMA 4RLKA 2BIYA 2R64A 4II5A 3COHA 4FV7A 4XG6A 1X8BA 4D0XA 2WQNA 4QRCA 5ANKA 3QQGA 2UVXA 4BKJA 4PTGA 5EQPA 3A61A 4XBRA 1Q8WA 4UWYA 3W1FA 4AUAA 3SW7A 1AD5A 3TNPC 4FKWA 3SKCA 4FRFA 4F0IA 3ATSA 2JD5A 3GCSA 4AFJA 3MSSA 3PDTA 4EH7A 1Q62A 2CSNA 4AS0A 4KIKB 3ORZA 3VNTA 4EWHA 1XMLA 5IQHA 4OAVB 4CQGA 4Z7GA 4QYEA 3P86A 4XS2A 5AV4A 4K33A 4ANOA 4DG0E 4PY1A 4BDAA 3U55A 4J7BA 4QPSA 2VZ6A 4A4XA 3OS3A 5AV3A 2GQRA 5FDPA 3FZ1A 4YNOA 4FKLA 1Q8TA 4UALA 4AXDA 2C6EA 1KOBA 3QYWA 4D2TA 2IO6A 4PPAA 5JEBA 3CE3A 3MA6A 4NFMA 3RPVA 3HV3A 4AZVA 4BDIA 3LFEA 1XHAA 4O0YA 5DYJA 4GU9A 3LJ2A 3FZSA 2SRCA 4PTCA 2FVDA 2DUVA 2FO0A 3UODA 4EK4A 4X3FA 3V5JA 2UZLA 4JS8A 3KXHA 3PVGA 3AT2A 3QA0A 2IVVA 3MYGA 3OTVA 3QZFA 3U9NA 3MVJA 3ZZEA 2B53A 3TL8A 4OTIA 3HLLA 4O6EA 4Q9ZA 4FT3A 5IEYA 4CSVA 3FPMA 1A9UA 3CY2A 2PZPA 3R7GA 1SYKA 4HVIA 3F3WA 1M2RA 3RALA 3BBTB 4O21A 4AE6A 1FMKA 3L9MA 5LVOA 5J7BA 1XO2B 2UZTA 2XK4A 1ZMWA 3B8QA 3R01A 3F2RA 4C3RA 1V0PA 2VTLA 3E92A 5AWMA 3MVMA 4USDA 2W7XA 3CTJA 2FA2A 3BYVA 3TIZA 2HY0A 2QLQA 3DT1A 4XJ0A 3HMPA 4KUJA 3G0EA 2QC6A 5EYCA 3RPSA 2OWBA 2XBJA 4NW5A 4PQNA 4YR8A 1M2QA 4WHZA 2BR1A 4RRVA 4R6VA 4JT3A 2A27A 1Z5MA 4NZWB 2OSCA 3QC9A 4EH3A 2X39A 5KHXA 2YM8A 3LFAA 4P90A 5IMXA 4UMQA 1UNLA 2QI8A 3SOAA 3EL7A 2R3LA 3QD0A 5HNBA 3L9PA 2EU9A 4GSBA 4K1BA 2XNPA 3R9RA 3IW5A 1ERKA 1MUOA 3QTUA 1PXJA 3KVXA 4IAIA 3F3TA 3AGLA 5IKWA 2F2UA 3QKMA 1YOLA 4JG7A 2WMTA 1G8KA 4BGHA 5B2KA 3P23A 1Y8GA 2ETRA 1IAHA 5KZIA 2W1GA 4Y5HA 4IX3A 3TKIA 1OPLA 4FSQA 3ORNA 3ZLSA 4CMTA 4RVKA 1WBWA 2XVDA 3QKLA 3N9XA 4BZNA 3IG7A 4L44A 4LV5A 3V5WA 2HZ4A 4TXCA 2I0HA 2VAGA 3EJ1A 4QD6A 1WAKA 4E26A 5CALA 2WMVA 1KSWA 5C27A 4X0MA 4I4FA 5DT4A 4NTTA 5JFVA 4I6HA 2VX3A 4KBCA 2WZJA 4FL2A 2ITPA 2OJJA 1JLUE 3OUKA 5E4HA 2HOGA 3NFGB 4E1ZA 4YJQA 3UBDA 4I4EA 4GKHA 3QRTA 4E5WA 3HMMA 4V04A 2XEYA 2XARA 1CMKE 2JITA 4M84A 5EYDA 2IPXA 1UNHA 4ZSGA 3BX5A 1KE5A 1BKXA 4U3YA 3R2YA 5L4QA 3PUFC 4NJ3A 4QP4A 1U4DA 3EN4A 3KRXA 2C1BA 5GZAA 1XBCA 4ZY6A 4G31A 2XRUA 4G5PA 4UXLA 4BI2A 1QPCA 3FC1X 4E6QA 2ZJWA 2ITZA 2PY3A 4DEAA 3NVKI 2BZKB 2R3RA 4DT8A 3EZRA 4QDEA 3VUTA 1GIIA 1J1CA 3QKKA 1YXSA 3FZOA 3NZ0A 4FKTA 4MF1A 4ID7A 3RTPA 4QMLA 4CGAA 1YHWA 2YA9A 2BKZA 5BMMA 3HV5A 1H27A 3DDQA 2XK6A 3PJ3A 3QUDA 2UZNA 4FGBA 1H26A 3R02A 5M55A 4AACA 3SDJA 3H9FA 1M2PA 2NYAA 4EHGA 2V5QA 4QMZA 4EZ5A 4ZTLA 5LMKC 1GNGA 3FI3A 5T6KA 4O7NA 3FQEA 1UWJA 4BDEA 3ENMA 2JKQA 4HCVA 2WTKB 3CJFA 1QMZA 2PZRA 2W1IA 2WMAA 1KV1A 3PXKA 4QT1A 1PMNA 1Q41A 3FI4A 3UJGA 3UC3A 2XRWA 3VUKA 3EH9A 3PZHA 4ENXA 1SVGA 4CTCA 4WD5A 5KKRC 1NY3A 4FYOA 5E9EA 3TN8A 3VF9A 2PPQA 4XUFA 2F9GA 2HELA 4X6RA 1OB3A 2JC6A 4NH1A 4RX7A 4XYFA 4O7ZA 3G33A 4WG4A 3WZEA 4IEBA 5J9ZA 3S00A 2OXDA 4OTHA 4C62A 1MRVA 3DK3A 4ANQA 2J51A 4TYIA 4I6LA 4IWQA 4QDVA 3Q53A 4JQ7A 1U54B 2W9ZB 3DZOA 4FTOA 2ITNA 4IFCA 2F49A 4HVGA 4QTEA 4GCJA 4RVMA 4J71A 4GT3A 4XLIA 5I3OA 4FT0A 3T3VA 3QXPA 4DFBA 1RDQE 4CKIA 4BWPA 2J6MA 3TG1A 3RNIA 3A99A 1VLRA 4DHZA 3HV7A 5M07A 4YZ9A 2NP8A 3G6HA 3PA4A 4EI4A 4FSUA 2IG7A 5E92A 2CNQA 5AV0A 4D5HA 4L45A 4L46A 1OPKA 4MXXA 2VTOA 2ZDTA 4YSMA 5EDPA 4WOVA 4ACDA 5D9HA 2R3JA 4AAAA 3ZC5A 4IB5A 3V51A 3FMDA 4O1OA 1OITA 2YDKA 4FIHA 4PWNA 4F6SA 4FUYA 3HV4A 2XK3A 2QOQA 1JKKA 1TQPA 3G6GA 5FUTA 3ORMA 2OJIA 2WIPA 3R7IA 4I0TA 3UTOA 4NIFB 4PMMA 5K4IA 1SVEA 3IKAA 3MFSA 4J52A 2C6KA 4L9IA 5C01A 4FZAB 4ZJJA 4MQ1A 3WZKA 1LEZA 4CFXA 1GOLA 4ZP5A 4U42A 4V01A 5KMLA 2XF0A 4QP2A 4OTQA 4O7YA 4FNWA 3EQHA 2GS2A 4PDPA 4AZEA 3EB0A 2CDZA 4GVJA 3FWQA 5JGDA 3IW4A 5BNJA 2QO2A 4MD7E 3SC1A 1JBPE 2OJFE 3D5XA 4KSPA 5AR3A 3KRLA 2OK1A 4KS7A 3MBLA 1OL6A 2UZVA 4FKVA 4MWHA 4JRNA 4FIIA 4ZZMA 4FG7A 3SHEA 3ZH8A 1OGYA 4PTEA 3QUPA 3UMWA 2XIKA 4YURA 3PZEA 3VJOA 4UMTA 5D11A 1PMUA 4EQMA 1H1QA 5I5ZA 4KAOA 5AR8A 2YZLA 4ERWA 1NVQA 2FSLX 2VWZA 3NWWA 4G17A 3LJ0A 1JSTA 1NXKA 4R7HA 3OEFX 1U59A 3AC1A 5ACBC 4IDTA 3W33A 4CVAA 2PU8A 3Q9YA 4JR7A 5JRSA 4DGMA 4YNEA 4OAUC 4BZOA 3IW8A 3I5NA 3FZRA 5KX8A 4PDYA 4QYYA 4FV8A 4W4XA 4ZTQA 4MNEB 4G3EA 3RP9A 2JFMA 5FD2A 2V62A 3PG1A 2UV2A 3PFQA 4IXPA 4JOAA 4YPDA 4BDGA 3MN3A 5E90A 4BHNA 1H0WA 5AP5A 1M7QA 5JZNA 4XRJA 3TI1A 4R3CA 2ZDUA 3TNWA 4QMOA 2QOFA 2B9HA 2Y9QA 2PVJA 4TRLA 3O7LB 3FPQA 3LXPA 1FVTA 2GNLA 3RK9A 3EL8A 1B6CB 4GKIA 2BDWA 3PP1A 4H39A 5HVKA 1XJDA 1ZMUA 2ZAZA 3BYUA 4BDFA 4AA4A 3E8NA 2R3IA 2C6IA 4WNPA 1PXNA 3SA0A 1ZZ2A 4ZSEA 5CSWA 5CAVA 1QPEA 3VS3A 4XG8A 4N70A 3PIXA 4OT6A 4L6QA 3EOCA 3QLFA 4FTRA 2C68A 3FXXA 5JRQA 4U41A 1PYXA 1ZOEA 3UIBA 4KKEA 1IRKA 3BYSA 1TFFA 4QQCA 3MH2A 2HYYA 4IZYA 1Q61A 3UOKA 3VS7A 4IAFA 4ONAA 1H1WA 4EOMA 3VBVA 2ITVA 2E2BA 4Z55A 4JDHA 4QQTA 4XLVA 5AIRA 3CY3A 3FL5A 4QP3A 3LMGA 3WYXA 4DTKA 3L9NA 2J5EA 4GRBA 4GUBA 4QP9A 3ZDUA 3F5UA 5HLPA 5CU6A 5JQ8A 1AQ1A 5KE0A 1BI7A 1DAWA 3GU5A 2RGPA 3FBVA 3ALOA 4O0UA 1LPUA 2QR8A 5EHOA 1GZKA 1GIJA 4AGUA 3LVPA 1XH8A 4O0RA 1NT2A 2G9XA 3I60A 5DMZA 4GH2A 5JFSA 4R78A 5KKRB 2A0CX 1S9IA 2WMXA 4NK9A 2IVSA 5L8KA 4CV9A 4C59A 2VWIA 3DOGA 4XH6A 2C0OA 1WZYA 3RPYA 3PSCA 4KINA 4ZS0A 2X0QA 3QCSA 2CN5A 5IA3A 2XIYA 1PHKA 3LFNA 3PLSA 4R5SA 4FVQA 1PJKA 3FL4A 4IBMA 2GNGA 4A7CA 5EI8A 4HYHA 4FV4A 5LJJA 2RFDA 2YIWA 2JAMA 3QQFA 5CI6A 3GU4A 3ZU7A 4G6LA 4I21A 4L01A 5HTCA 1PKGA 3OF0A 2PZYA 4FL1A 4N57A 3U54A 1XH4A 3OTUA 3PJ1A 4I92A 1O6YA 3R8VA 3BV2A 4EOOA 5J87A 2X8EA 2BDJA 2EXEA 2BAQA 3OBJA 4YJVA 5CY3A 3SLSA 3W8QA 5CEPA 3KXNA 5C8NA 2OJ9A 2R3GA 3F3VA 1QPDA 3QWKA 2XK9A 3ORIA 4DFZE 4EJNA 2RL5A 5HU3A 2PK9A 1GAGA 2HW7A 3DCVA 3TACA 3TJDA 3UNZA 4NT4A 3L1SA 4GYGA 3AKKA 4OBQA 5AUXA 1CKIA 1O9UA 3LXNA 4LOQA 4MD9E 4FTUA 2CKQA 4J96A 4DCEA 3LQ3A 3UDZA 3AOXA 4FEVA 4N0SA 5L2QA 4ZAUA 3JVSA 4C58A 2ITUA 4GK3A 3ZTXA 5C1QB 4BCQA 1E9HA 2R7BA 3HDMA 4L8MA 3Q4CA 5TF9A 3SXFA 3BHTA 4R3PA 5AX9A 4ZXTA 5HICA 2VTRA 2RF9A 3ULIA 3NX8A 5FEEA 3RPRA 3FYKX 2UZOA 2YIYA 2GTNA 4BDDA 3C5IA 4AE9A 4ITJA 4BTMA 3ZMMA 2RFEA 5AV1A 2ZOQA 3EKKA 4YBJA 2X7OA 1NVRA 3C4FA 4TYGA 5JK3A 3OWKA 4C8BA 3FEGA 2ZM4A 2VX1A 3AQVA 3BZ3A 4I6QA 2JFLA 3BHYA 3OHTA 4FI1A 4QMSA 3R83A 2XKFA 3LIJA 3ZUVA 2O0UA 2QKRA 1URWA 2YLEA 4CFVA 3O50A 1OMWA 3NIEA 4DDGA 3VUMA 2YZAA 5D7AA 1IASA 4D4RA 2PVHA 3F6XA 3TEIA 3A8WA 3GGFA 3P1AA 3KQ7A 4PRJA 5AMNA 4APCA 4AU8A 4C3PA 5G6VA 2UVZA 4K9YA 4QQJA 3NMUF 3PVUA 4F7SA 4FT7A 1W0XC 3KC3A 5CLPA 4ZJVA 3NUYA 1PXIA 3E63A 4FTLA 1OUKA 4JG6A 3UDBA 1P2AA 2J50A 2QG5A 3A7GA 2PVYA 4NUSA 3RK7A 4BVUA 2UW6A 5JZJA 4ORKA 4S32A 4JLCA 1PY5A 3BWJA 4HPUE 3EHAA 3BLRA 4TYHA 4DH8A 2QU6A 2WQOA 1F5QA 4D2RA 3CC6A 3FLQA 5M08A 3QC4A 1HCKA 4FEQA 4KIKA 3DTCA 3ZEWA 2BKKA 3BYMA 5HORA 4BR3A 2R3NA 3NCGA 5J1WA 4AG8A 4G16A 3DFCB 4APPA 4EBWA 4YJUA 3M1SA 3DTWA 2JBOA 4U79A 5EYKA 1W7HA 2J0IA 3FHIA 3IECA 3P78A 5M4CA 1SMHA 5HGIA 4CMOA 2GQSA 1NVSA 2GHGA 3BKBA 2QCSA 4HGTA 3BQRA 5FDXA 5C9CA 5EM7A 1H07A 4BCIA 3D83A 1IA9A 2WU6A 2PVLA 5IUGA 3NUAA 4AQKA 3TNQB 3NAXA 4CFFA 4NEUA 2HCKA 3LFSA 3SXSA 4EHZA 3RAKA 3PVBA 2QODA 4IACA 3HVCA 4L3JA 2XNOA 5H9BA 4BCMA 1ST4A 4BCGA 2YCRA 3ZLWA 4BCJA 4CFUA 3GT8A 2QOIA 3KF7A 3N51A 4H1MA 4HPTE 3L9LA 5ETAA 2LAVA 2Z7RA 4BGGA 3NFFB 5JMSA 2I40A 4JI9A 3BRBA 2QNJA 4RFYA 2G15A 3TUCA 4DH3A 4F9AA 3GU7A 3MGYA 2JDTA 2WTJA 3UQFA 3FY2A 3NSZA 5AP0A 4WSQA 4G34A 3UIUA 3ETAA 3R7VA 3PXFA 5CU0A 3AC3A 2IJMA 3DY7A 4XV9A 3S4QA 4AOIA 4DHFA 5BVOA 2FH9A 5IF1A 4XX9A 4EK5A 3H10A 4TL0A 3LZBA 5I9UA 3ATTA 2OF4A 2ONLC 4U0IA 4OTRA 3DKGA 5LVLA 3GU8A 4FUXA 5CAOA 2R3FA 3OMVA 5HI2A 5CF4A 2PUPA 3DA6A 2XAMA 3MESA 4AXEA 4AAYA 3F5PA 2W5BA 5HIDA 3AKLA 5CEQA 4LDTA 3KK9A 3ELJA 1F0QA 2ACXA 3V6SA 5HD7A 3KXZA 3F66A 5CVFA 5FXRA 1IR3A 3F2AA 2ZFYA 3RAWA 3R63A 2PTKA 2WMQA 4CZYB 1SNUA 3LQ8A 4J8MA 1H25A 3TDVA 3L8SA 1RQQA 4J1RA 3E93A 5LXMA 3AC2A 3DBFA 4S2ZA 5ICPA 3LCTA 4S33A 2B9IA 4F9WA 4FSYA 4PNIA 1ZYCA 1REJA 3A7FA 1XH6A 3IS5A 4R1VA 3VJNA 1UV5A 4JDJA 5K5XA 4EK6A 3E7OA 3WYYA 4F6UA 5M4UA 5IQBA 4E6CA 3VC4A 4DH7A 2O8YA 4QP1A 4CV8A 5HO6A 2X9FA 5IQDA 2OJGA 3HZTA 4IX6A 4E73A 1NA7A 3QTRA 5DLSA 3BLHA 2VTNA 3Q4TA 3UVPA 2VN9A 3JY0A 4BYJA 5AX3A 3VRZA 3E64A 3KCFA 3PWDA 2IZSA 2HXQA 3MJ2A 4D2VA 4RX9A 3RCJA 4O4BB 4TWPA 4PNKA 4JIKA 2DQ7X 4ZTMA 4WUNA 1H0VA 3V8TA 2C1AA 4CD0A 4IVBA 2A2AA 3R00A 4YU2A 4ZLYA 2R3QA 4D9TA 3NYOA 3GEQA 1ZOHA 4FMQA 3DJ5A 4OLIA 2WMSA 3JR1A 3ODZX 2IVUA 3EYGA 3QRUA 3GFEA 5F94A 3JVRA 3Q6UA 2XYUA 3R28A 4J97A 3I7CA 1TKIA 2H8HA 5A14A 4ANMA 2PMOX 2VTSA 2OG8A 5GJGA 4YHFA 5IISA 4H05A 3WZJA 2XUUA 3BHVA 4PP7A 4TWNA 4AN9A 5IG1A 4ZTNA 3F88A 4XP2A 2C5NA 3JYAA 4ITHA 1M7NA 4HOKA 4MQ2A 5F4NA 3V8SA 3VS6A 5LWNA 3W0MA 3GCUA 5ETIA 2H6DA 3P5JC 3EQIA 3GENA 3R1SA 4FZDB 2Z8CA 3SAYA 3S0OA 4QTDA 5EM8A 2BRGA 2OXXA 3OOMA 4XG9A 3BGQA 4FSMA 4RC3A 3KREA 1M52A 1OVEA 3BU5A 4L3LA 5HIBA 4LM5A 5A4EA 3POZA 4O0XA 5ANIA 3MS9A 3Q32A 2JKOA 3PY3A 5CQWA 2X7FA 3QGYA 3PLAE 2CGVA 1U5QA 2ETMA 2NPQA 1Q8UA 1YWRA 4XNEA 3FMEA 3UYSA 3AT4A 5E8ZA 2PHKA 3DBQA 3VUIA 3R8ZA 1YHVA 2I7QA 5BVNA 4IZ5A 3SVVA 1TZDA 3I0OA 2PZ5A 1ZLTA 4O0VA 2P4IA 4BDKA 4X3JA 1H4LA 5GIOE 4D1XA 3EKNA 5BQ0A 4XEYA 5EI6A 3WIGA 3EFWA 3R73A 4BBMA 3HRBA 3P7AA 1YVJA 2VTTA 4RLLA 4YSJA 4YZNA 3ERKA 4EKKA 3R7UA 3RBWA 1GJOA 4EBVA 3NNWA 3JPVA 3GXLA 4U45A 2XJ2A 3P4KA 4B99A 5JGBA 4TN6A 4X3FC 4W4YA 1DI8A 4QMQA 4FTAA 3FLWA 4HNFA 3RGFA 4F9CA 3Q9WA 2X4FA 3EN5A 2GNFA 2ERZE 3NNUA 3OY3A 3TZMA 3HAMA 2XK7A 4AT4A 3F7ZA 3IW6A 3MH3A 4FOCA 4I5PA 4IAAA 2RKUA 5FP5A 5HBEA 4ASEA 3LAUA 4D4YA 2VGOA 2BRNA 2V0DA 2P0CA 4IWDA 4E5BA 2WB8A 5I3RA 4ASDA 5HO7A 1BMKA 5CWZA 4KIOA 2B4SB 1UVRA 5AM7A 1YRPA 3QQUA 2UVYA 2B9FA 2HZ0A 4NU1A 1BLXA 5CU4A 4CEGA 3AD6A 4AZWA 4WKQA 5CXZA 4CYJA 1OIUA 5M09A 4D28A 1ZRZA 5KMOA 2JKKA 3W10A 3I0QA 5IDNA 3UZTA 2QQ7A 2Y0AA 3OUNB 5D12A 4RSSA 4TPTA 3ZBFA 4JAJA 2F7XE 5IQIA 2YACA 4L00A 4QMUA 3THBA 3F2NA 3NYNA 5AAFA 3MH0A 2C3KA 5J5SA 3E7VA 3D15A 3SGCA 4IC7A 4PPBA 4FBXA 3UP7A 5J79A 3HMOA 5AEPA 3KN6A 4J8NA 2W06A 2AC5A 5M4FA 5CVGA 4UZHA 1QL6A 4D5KA 3DLSA 4D1ZA 3PUPA 2Z02A 3UDSA 5EHYA 4G3CA 3CKWA 4I1ZA 3C4EA 4E4MA 1Y6BA 3QFVA 5IH6A 3FZTA 1Y57A 4N4SA 4CFMA 2X6DA 3VBWA