3ZLYA

Crystal structure of mek1 in complex with fragment 8
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
343
structure length
310
Chain Sequence
LELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE KINASE 1
publication title The Use of Virtual Screening and Differential Scanning Fluorimetry for the Rapid Identification of Fragments Active Against Mek1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 100
structure length 310
sequence length 343
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2013-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zlyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zlyA01
2CCHA 4O7NA 2HYYA 3A60A 3BPRA 4CFNA 3GUBA 3ORPA 5HU9A 3OG7A 1QPEA 4NU1A 2ITPA 5AAGA 5H3QA 3CC6A 3L1SA 4H05A 4IAFA 4UMPA 2CKOA 5HQ0A 4WNMA 3PA3A 4BIDA 4EI4A 4LG4A 2ETRA 4ZTHA 4GV1A 3NAYA 4G6NA 4J97A 1MQ4A 3QX2A 5CI7A 4IFCA 4CFWA 2BALA 4IC8A 4ACGA 4ERKA 3LXKA 2PE1A 3O51A 3TTJA 1ERKA 4D0WA 3ZXTA 4BDCA 4QYEA 4F0FA 4V0GA 4DFBA 2PVKA 3NX8A 3MFSA 1ZYLA 4O0WA 3CEKA 3GGFA 4RWIA 4QP3A 4NM3A 4MXZA 4HVIA 5FP5A 4BGGA 5LVPA 4CEGA 4KUJA 2R3NA 3C7QA 3ORIA 4P90A 3R30A 1PMEA 3A7JA 3MPAA 2PZ5A 2UZEA 1PMUA 4UEUA 2VNYA 1WBPA 4LV5A 2W1FA 4WUNA 3ZCLA 2IO6A 3LFAA 1OKZA 4Y72A 4JT3A 5AMNA 5JRSA 4BCFA 1V0OA 5GNKA 3UIMA 4ZS0A 3ZDIA 3A7IA 2XZSA 2QC6A 2R3QA 4L44A 3OOGA 4FKWA 1W0XC 1A9UA 4N6ZA 3UO4A 2XRUA 3FQHA 4ZIMA 2BDJA 5IA2A 4YJQA 5EM7A 4ZY5A 3QALE 1JKLA 3UTOA 5DR2A 5CEIA 3B8QA 3K3IA 3SW7A 4YU2A 3B2TA 3W32A 3AT4A 3ZUVA 4O7TA 2LAVA 1UU3A 3DXPA 2ETMA 2UVYA 3F7WA 4QPMA 4B9DA 1K9AA 4M69B 1MUOA 1ATPE 3A61A 4HYHA 5IG1A 2QOKA 3CJFA 1PRYA 5BVFA 4F7JA 4BTFA 3ROCA 4MAOA 3R8LA 3ID6C 3KK9A 4I5PA 4YJUA 2EWAA 3VHEA 2QNJA 2F49A 3NPCA 5CU3A 2HWPA 1RE8A 4I4EA 3D14A 5LJJA 2ZM4A 3UYTA 4R3CA 3OWKA 5DPVA 1GZOA 1PMNA 4E5AX 3AD6A 5L8LA 2AYPA 3RNIA 3VBWA 1TKIA 5LVNA 2PK9A 3FDNA 2XKDA 4QMSA 2Q0BA 2VWYA 2WEIA 2WD1A 3RM6A 3WIKA 4DLIA 2X1NA 2XJ0A 3BU5A 3ATSA 2AC5A 4J99A 1OPJA 3R9HA 5LXMA 3TKIA 4RWKA 3OZ6A 3G0FA 2ZV2A 5AV4A 5HBJA 2R9SA 2PVRA 3OROA 3R73A 4ASZA 4IE9A 3KULB 4IZ7A 3ZC6A 4BL1A 3UNKA 3OCBA 5LCJA 5HO8A 4TYIA 5EYKA 3M1SA 4IHPA 4FSTA 2BTSA 2WTKB 4M13A 5HE0A 1M17A 3NDMA 5C9CA 3HLLA 5BUEA 4FIIA 4GG5A 5FM2A 1YQJA 2WTIA 4X6RA 3QQHA 2BR1A 5E8YA 3U87A 4AX8A 5FG8A 4LRJA 4ZXTA 5L2QA 1FINA 4H1JA 4BICA 3DXQA 2I40A 3H9FA 3PJ3A 4MNEB 3E88A 3R9OA 4QTDA 2OFVA 4IH8A 2QOIA 5LWMA 2OJFE 3NUYA 4P5ZA 2WOTA 2JD5A 3M2WA 5EM6A 4ZEGA 2JAMA 5JH6A 4GRBA 4EZ5A 4FTAA 5AP0A 4XUFA 4DCAA 1CMKE 3TNHA 4RX7A 3CTQA 3DZOA 3D4QA 2HAKA 3UPZA 1O9UA 4FODA 4ALWA 3UQFA 3NAXA 4BZDA 4QQ5A 2P2HA 4GIHA 3EQRA 2W1HA 2QKWB 4AG8A 2X8DA 3TUDA 3VUMA 3WZJA 2JDOA 3E8DA 4R5SA 5HVJA 4BDFA 4O7YA 4WRGA 4MWHA 4ZY6A 4ARKA 2W99B 5I3OA 4FT0A 4FTQA 4DT8A 3VUTA 5E90A 3PJCA 4ZLZA 2Z7QA 2VO0A 5E8TA 1U5QA 2UZDA 3HV6A 4ZZMA 2YACA 5BMMA 3LFQA 4O81A 1V0PA 3UQGA 2OF2A 2B53A 3UGCA 2WMTA 3CGFA 3COKA 1Q3WA 3TACA 1WBNA 4WO5A 2ITTA 4CGAA 2HZ0A 3QQFA 2PMNX 4BBFA 5KMIA 3GNIB 5CQWA 2ITWA 5AAFA 1WVXA 2W4KA 5HO7A 4RFMA 4I5MA 4X2FA 5HG7A 1WZYA 4YJOA 5DHJA 3PXYA 5IQFA 5LMKC 4DTKA 3IO7A 3GI3A 2HIWA 3PY0A 2KULA 4ONAA 5FTOA 4YJRA 4AU8A 5LMKA 3K2LA 4QNYA 2ACXA 3FMJA 2Y8OA 1IG1A 4YJNA 3V5JA 2J50A 4W9WA 4D58A 3OY1A 4MXAA 4GW8A 4QMLA 4GYIA 5DRBA 4UYAA 3P23A 5HHWA 4BDDA 4TXCA 3MDYA 3AD5A 5J7BA 5CU6A 4O84A 2GNLA 2BUJA 3CJGA 4UZDA 4A06A 5CASA 4NM0A 1Q8WA 2Z60A 3P4KA 4OTRA 4V0GB 4O27B 2CNQA 4FKRA 3CS9A 4D0XA 1PJKA 2WO6A 4RC2A 5HG9A 1IEPA 4ZJJA 1BL7A 2X2LA 3R6XA 4KD1A 2YM4A 4E93A 3SX9A 2BAKA 3ZLSA 3FMEA 3QTRA 2A27A 3TZ9A 5IKWA 4NL0A 2BZIB 1H8FA 2NO3A 1TQIA 1Z57A 2C5XA 1H1PA 4QPSA 3PVWA 4XOYA 5FEEA 3CD3A 2ITXA 3LZBA 4JDIA 1R3CA 3CP9A 3T9IA 3R7IA 2HZIA 4LGDA 4WKQA 3UO6A 2O64A 2BZHB 2QOLA 2XIYA 3HX4A 3V51A 2XIZA 3AC4A 4DF3A 3GXLA 4FEUA 4E4XA 4DTBA 1WVWA 2GCDA 4PDYA 2QG5A 4C3RA 3TCPA 3OXZA 3GC7A 3O8UA 5KUPA 5A14A 4PMTA 4FUYA 1WBOA 3K3JA 4KAOA 2B4SB 5BVOA 2UW5A 2YIYA 3BHUA 3ENMA 4EQUA 3FLQA 4RRVA 5FDPA 1PXIA 4GT4A 3R7EA 3QD2B 2W1IA 3OCTA 4Y46A 2PZIA 3HUCA 1CM8A 3DU8A 4EOPA 3O7LD 4C0TA 2JDRA 4CZYB 3ZFYA 3M11A 3DB8A 2PVMA 5AUXA 3QRIA 1HCLA 2H9VA 3MFRA 3UP2A 4S32A 3ACJA 3QC4A 3NUXA 5AV1A 2G15A 2ZOQA 2CN8A 3G6HA 4FMQA 1OM1A 2JGZA 2VTQA 5AV3A 4CZTA 4Y83A 4YTIA 4BGHA 4OAUC 2JBPA 1OIUA 4J52A 2WTWA 3N4TA 4S30A 4GVJA 4AW2A 4CCBA 4QP7A 4FV8A 3MIYA 3A7FA 3I4BA 2RL5A 1OGUA 5JQ5A 2C5YA 3UMWA 4I23A 3TDWA 3KY2A 5M51A 1H4LA 1BMKA 2C3JA 2QOHA 3LFDA 2XEYA 5CX9A 2UW9A 2DS1A 4QMZA 3W16A 4FSYA 4CKIA 5HE1A 3LQ3A 1H01A 2QHMA 5EKOA 4A4XA 3OEZA 4EC9A 1YWVA 3QF9A 3GU4A 3BHYA 4DH5A 4OTFA 3QU0A 5IA1A 5CU4A 3KMWA 1IAHA 5HD4A 3QRJA 1DAWA 3P7BA 4D5KA 4E26A 5DR9A 4EH5A 3QHWA 3DV3A 3P08A 4II5A 2XUUA 3A99A 5CWZA 5HESA 1CDKA 2QU6A 3FLNC 3ZO4A 3W8QA 4AGDA 4MYGA 4F65A 3F3VA 3PJ2A 4AN9A 3FI8A 3UIUA 5HCZA 5IF1A 5DG5A 3UZTA 1YOLA 2CPKE 4LRKA 1JSVA 3R7OA 4AWIA 4BKYA 2QR7A 2WU6A 1JQHA 3EKKA 1G3NA 4CMTA 4F9YA 3SQQA 4BVUA 4RFYA 2YM5A 4DEGA 5BVKA 2F7XE 3IW5A 3FZOA 4YURA 4ZLYA 2Q83A 3NUAA 2Z7RA 3HV7A 3NCZA 4RQKA 5FEDA 4IZ5A 3TUCA 5BPYA 4BCIA 4BTMA 4RIXB 1F0QA 5HX8A 4U8ZA 1M14A 3GCPA 3MH3A 4MKCA 4BDKA 5CAQA 3RP9A 4UY9A 2C3IB 2X4ZA 2YIQA 4ALUA 5GIOE 3PIXA 2WEVA 3R1YA 3RHXA 5CNOA 1J7IA 4O86A 4DBXA 2XM9A 3MB7A 4IWPA 3G9LX 5A4QA 5I9ZA 1IA9A 4HYIA 1GZNA 1P4OA 2CJMA 1SVGA 4XP0A 4I4FA 1HOWA 4BFMA 2Y4IB 4PDOA 3VS3A 4IAZA 4QMVA 4FGRA 4JIAA 3U9NA 4X3FC 2J5EA 4U44A 1ZLTA 1YWNA 4K2RA 3E3BX 4N0SA 4WRSA 3WF6A 3PY3A 3ZSHA 4EK3A 3O8TA 4X3FA 2IJMA 4YNEA 5E8WA 1DM2A 3DFAA 4I41A 1XH4A 2XJ2A 5HVYA 4A7CA 4RC3A 4EZ3A 5CEOA 4PPAA 4AGCA 3PFQA 1SNXA 3E7VA 4LFIA 4TTHB 3I0OA 3FXXA 5CXZA 5CSVA 2C68A 5CNNA 5JZNA 5HOAA 4EJ7A 5F94A 3DOGA 3F3UA 3LQ5A 3ZU7A 2RIOA 4BCPA 4YTCA 1U59A 2ONLC 2VX0A 2WQMA 4JBOA 3S95A 4I5CA 4IWQA 3PXRA 4OGRA 2IVSA 2X2KA 3CGOA 4EH2A 2ONLA 3KVWA 4CKRA 2E9UA 4XEYA 4WNPA 2GFSA 4O0VA 1H28A 4EK5A 4KIKA 4CFUA 4XOZA 3ERKA 3N4VA 3ZSGA 2BCJA 3NW5A 2R2PA 2B54A 2B9JA 3F61A 3LPBA 3GCSA 4K18A 2HY81 2ZMDA 3BGQA 1Q61A 2FVDA 3CPBA 3RPVA 1CKJA 3MH2A 4Q9SA 4YHFA 2YWVA 3AGLA 5M06A 3CCNA 3W8LA 3BYSA 2B7AA 2C5OA 2BVAA 3DGKA 1UV5A 5K5XA 4LMUA 5ETCA 2HOGA 2PUNA 4M8TA 2GSFA 2JKMA 2XB7A 5F4NA 4DITA 2PYWA 1Q41A 3AG9A 1VZOA 5L4QA 1IRKA 4NFMA 4TNBA 5HLWA 3W18A 5GJFA 3V3VA 3QQLA 3Q9ZA 5TOZA 3LMGA 1JOWB 1YW2A 3D5XA 4FV3A 4TW9A 3WARA 1YI4A 1AD5A 2OJ9A 3R2YA 2BAQA 1OL1A 1QL6A 3R0TA 3BQCA 3N9XA 4CFFA 4EONA 4Z7GA 3N4UA 5AP2A 2OIQA 2PL0A 2R3PA 2W17A 4EWHA 3W2SA 5AUVA 4FZDB 3BLRA 2HCKA 2VTSA 1XH7A 3ELJA 2ZJWA 4G17A 4KIOA 3HUBA 4XG4A 3G33A 3AMYA 4L46A 4P4CA 5KMNA 1VEBA 1Y6BA 1Q5KA 2FYSA 4FV9A 3ZZWA 3PVGA 5FWKK 3VUIA 4C4EA 2VWUA 5DRDA 3DQXA 4W4VA 4IIRA 1JNKA 1NXKA 5HNBA 2VUWA 2YM3A 4RSSA 3VQHA 1P4FA 3RALA 4TY1A 4EQMA 2HK5A 3UVPA 4C36A 5EFQA 1URWA 3QGWA 3RPSA 4WOVA 1TQPA 3DNDA 2YCRA 4O0UA 4WD5A 4O0SA 5HCXA 3ZSIA 4IQ6A 3DNEA 2E9NA 3FLSA 4D9TA 3W2OA 2SRCA 3LJ2A 5J9ZA 3QZFA 4XG2A 1JPAA 2YWPA 5M53A 2ERZE 4NFNA 3V6SA 3SG8A 2PMOX 1ND4A 3ORTA 2EVAA 2J51A 4F70A 4RX9A 2W1DA 2CKEA 4RJ4A 5IDPA 3RPYA 3DAKA 4MEDA 2WKMA 4YBJA 5EW8A 2UVXA 3POZA 5FQDC 5B2KA 5KX8A 3REPA 3D5WA 3PP0A 4C8BA 4F9BA 3PPKA 3FLWA 4GT3A 4IB3A 2BPMA 4HYSA 2GDOA 1H08A 2X4FA 4ZSJA 3PVUA 4ITJA 5AUZA 2J0IA 3V8TA 4BBEA 4O7SA 5HIEA 3TV6A 2YCSA 2BFXA 2PTKA 5CF5A 4MXOA 3U51A 4DINA 1WBVA 2GS2A 2P3GX 5FP6A 5CAUA 3QLGA 3C4CA 4R3PA 4QP9A 2UZLA 1MRVA 2GQSA 4TT7A 1FVVA 1YI6A 1U5RA 5EM8A 4PMPA 2XRWA 1PMVA 3ORXA 2RFSA 3PSCA 5EDQA 3RAIA 1REJA 2YCFA 3Q53A 2PSQA 3C4EA 4KABA 3R9DA 3V8WA 3BBWA 4ASDA 4H3PA 4ZMFA 1WFCA 3ACKA 5IQBA 4U42A 2Z8CA 3CD8A 4PDSA 1Q8UA 3TT0A 4MBLA 3WZUA 4UMUA 2CGXA 2X0GA 4EH8A 1Y6AA 3QUEA 3AC5A 4QP6A 4AOIA 4RBLA 2HWOA 4EH7A 3H4JA 3NCGA 4J98A 1A06A 4BHNA 2QOCA 4HGSA 4YLJA 3JS2A 2B52A 3OOMA 4G1WA 1R0PA 3MESA 3C50A 3U54A 1PHKA 2ZV7A 5HNIX 4D4VA 4DH7A 3QTXA 4IM3A 2GS6A 4C4IA 4X3FB 2GNHA 3V04A 3LFFA 4UZHA 2GFCA 2QODA 3R7YA 2C5VA 3FKNA 2QONA 3F3TA 1NT2A 2BFYA 3L8VA 5E8ZA 1RQQA 2VTMA 2C6MA 4JOAA 3SOAA 3FZ1A 4ANSA 1PKDA 4FKLA 3UODA 4F99A 3PZHA 3R8VA 2BTRA 2Q0NA 4NWMA 1OVEA 4EZ7A 4D5HA 3D15A 4IJPA 4JL9A 3GCQA 3WI6A 3LMIA 4FL1A 4R77A 3ZS5A 2C6TA 2BRBA 2CSNA 2VX1A 4TWPA 4C58A 1QPJA 2G2HA 5ANEA 5EH0A 3ZMMA 4GJ2A 5JGDA 2WELA 2BKZA 3DBEA 3CQUA 1OPKA 2YERA 3HMNA 3E62A 4GEOA 4TYHA 3LKMA 2QO7A 2QR8A 3QXPA 3DKCA 3ZXZA 2H8HA 4DEHA 3KCKA 5LVMA 4AFJA 1M2RA 2EUFB 4U40A 3NWWA 4HGLA 5C4LA 5HE3A 3P9JA 5CZIA 2O5KA 1BUHA 4DGNA 4BCGA 4G31A 3AT3A 4AZEA 1EH4A 2GNJA 2XK9A 3NW6A 4FKIA 1PXNA 3PIYA 3R8PA 1T45A 3RCJA 5IA5A 4DGGA 5IH4A 4FK6A 2FGIA 5D41A 4ZSEA 3VNTA 4DFZE 3O8PA 2XH5A 4M14A 3TV4A 5A3XA 4KSQA 4DFNA 4UN0C 1UA2A 2RKUA 4ZTQA 3NVKI 1K2PA 2G01A 3ZONA 3VN9A 3NYNA 5ETIA 5AR3A 5HKMA 4BY9E 3ZH8A 4TRLA 5JSMA 2B9HA 3DBFA 3NGAA 3NRMA 4D4SA 5GINE 4ZTLA 1P14A 3O71A 5IQHA 2CLXA 1KE6A 1W84A 3TI1A 4DA5A 2YDJA 3TIZA 2J0MB 5CQUA 4DAWA 2YIWA 1GAGA 2ZM1A 4UXQA 4BCNA 5M56A 2YEXA 2YAKA 4QMUA 4EHVA 5JGAA 5AA8A 4AE9A 2IW9A 4OR5A 2C69A 3NMUF 4UMQA 4J95A 1XWSA 4M67A 2VTJA 4NTTA 3G0EA 3EQFA 2QU5A 2QCSA 2Z7LA 3TN8A 5I5ZA 4JR3A 2XCHA 3ROYA 4Z55A 4X21A 3EHAA 3A7GA 3IGOA 3UMXA 5GZ8A 4GH2A 4DFUA 2O0UA 4WG3A 4GMYA 2R4BA 4E20A 4LI5A 5A6NA 4YLKA 5J5TA 4JLCA 5KMMA 3S00A 3OWLA 3QA0A 3IS5A 4HVGA 2Y6MA 2XYNA 5CU2A 3DK6A 5D7VA 4CQEA 3ORKA 4R7IA 4Y73A 2C0IA 3LM5A 4FV2A 4EKKA 2P55A 2R3LA 3EQGA 1UU8A 1WCCA 4XHKB 1BX6A 4MBIA 1GIHA 2FSTX 4JQ8A 4YTHA 3DJ5A 3BEGA 5BNJA 2F2CB 1FGKA 3JY0A 3ZEWA 4B8MA 4E6AA 5L2SA 1Q4LA 3PLAE 2XNOA 4QD6A 2VU3A 4AA0A 3CQWA 1OECA 2VO7A 4KBKA 4MXXA 3KF4A 4FKPA 2O8YA 2ZM3A 5J87A 4RX8A 3SLSA 4NEUA 3GU7A 4U43A 4XRJA 1TQMA 1NVQA 5ANIA 3U6HA 1OUKA 2HXQA 1YHVA 3JUHA 5IEXA 2YDKA 4DTAA 1W7HA 3E7OA 3MBLA 5LWNA 3ALOA 4PNIA 5EDPA 5AP6A 4GJ3A 5KCVA 2ZYBA 1PY5A 1OI9A 3MJ2A 5E92A 3GCUA 2OH4A 4UXLA 3SDJA 2GMXA 2BZKB 2XKCA 3OTVA 4L7SA 5K0KA 5TO8A 4D2TA 1Y8YA 5A4TA 2PZPA 3FY2A 4C3PA 1LPUA 3GC9A 3VBYA 3G15A 5IPJA 4D1XA 5DVRA 5DEYA 4QMPA 4BGQA 4L42A 3KXHA 3C4ZA 4GIIA 3Q5IA 1XH6A 2BHEA 4C02A 4OBQA 5HG5A 3V5WA 3I6UA 3MJ1A 3FYJX 4DG3E 4DFXE 4IADA 1KUTA 1JWHA 3GFEA 1MRUA 4K77A 2XBAA 4JNWA 2ZMCA 2BHHA 5EG3A 2W1EA 2C6EA 3KL8A 4HZRA 4XJ0A 3UOHA 5KMLA 2G2IA 2Y6OA 3LJ0A 5HTCA 4QT1A 4U79A 4EOKA 2UZNA 3ZM9A 4DE4A 4KA3A 4RJ8A 4XMOA 3UBDA 4CG9A 4C62A 3OF0A 2H34A 3DLZA 4CLJA 2ERKA 2C47A 5GZ9A 4EHGA 4GUEA 4IX5A 3ZRKA 3Q52A 1OKYA 2R5TA 3QRUA 5C8MA 3GBZA 1OIRA 5DIAA 3FYKX 4BDIA 5DR6A 2F7ZE 3V5PA 4M7IA 3HMOA 4RA4A 1WBTA 3R04A 3Q2JA 1CKIA 4IC7A 4ZSLA 4L9IA 4IAKA 2X6EA 4BIBA 4EK4A 3RHKA 2PVFA 2QOFA 5JMSA 5E91A 2BRGA 2W96B 4FSZA 3ZO3A 1HCKA 3E8EA 4GU6A 3LMHA 5IQGA 3B8RA 2J2IB 3D0EA 3QQGA 3NYXA 4XBRA 4FIHA 3UOLA 4FKOA 4D2RA 5CI6A 5IMEA 4MH7A 4ZJIA 3MPTA 2XKFA 3RWPA 3ZOSA 3BCEA 4R1YA 5M57A 4WIHA 5M4CA 2ITOA 2WFYA 3HMMA 3NUNA 3R63A 1GJOA 3E93A 4IDVA 2NP8A 1GIJA 3VULA 3ZFXA 5L6OA 3IW6A 3NNXA 3AGMA 3IW8A 4YZBA 5CF6A 3COHA 4U3ZA 2HZ4A 4O96A 2WU7A 4AT3A 4X6QC 4BC6A 3VW8A 4ID7A 4MHAA 2VWZA 2YIXA 1ZY4A 2J0JA 3I7BA 3OWJA 4JS8A 3GB2A 3NZ0A 2ZB1A 3EZRA 3VBVA 5IH6A 5AUTA 2LGCA 4QMQA 4PL3A 4C57A 4IB5A 5ACKA 4O0RA 3U8WA 4BTKA 2V7OA 3ZDUA 2ITQA 3QQKA 4IWOA 2PMIA 4I22A 4GUBA 5FD2A 3VWAA 2UW4A 2GNFA 3PXZA 5DWRA 4RX5A 5JFXA 5KMKA 5M07A 4FG7A 1XKKA 2JIUA 3BHHA 4UWYA 3S1HA 4V05A 1YXUA 2W0JA 3MFTA 2UV2A 1U54A 2DQ7X 4QNAA 4CMUA 2YITA 3FC1X 5HGIA 5IQEA 4RIYA 4APCA 4BKJA 2XK8A 3LIJA 4HPTE 4XV9A 1KE5A 4FKQA 4QMTA 2BRMA 5KHXA 3NEWA 4G9RA 5LCKA 4YZMA 5AUYA 3P86A 2JEDA 2RG5A 2W5AA 2WQNA 2BIKB 2X39A 4EYMA 4M68A 4C4HA 4MVFA 3MYGA 4TWCA 3Q4UA 3PTGA 4UALA 3BLQA 3F7ZA 1FBNA 2XBJA 4G34A 3PSBA 2UW8A 5TT7A 3SRVA 3EFLA 3GU8A 5EKNA 4ZTSA 3QX4A 1YOJA 4IWDA 1LEZA 5GIPE 3VBXA 2R7BA 4E8AA 4ZK5A 2XNMA 4O0TA 3BI6A 2GHLA 3WF5A 1XO2B 3I5NA 3UDBA 2JIVA 2F9GA 4YZ9A 2I0EA 3LOKA 4S34A 1YHSA 4FTCA 4L01A 4WUAA 4JG7A 4OTQA 5HBHA 4CCUA 4I6QA 2C1AA 5AV2A 4Y5QA 4BBMA 3FMNA 3F3WA 3LCKA 3NUSA 5JZJA 2FUMA 3A7HA 2W1ZA 4RWLA 4KS8A 2FO0A 3O96A 4K6ZA 3COMA 3PY1A 4YC3A 2VWXA 5KKRB 1QMZA 5J95A 3FXZA 3ZBXA 4EBWA 3MPMA 4RWJA 2X8IA 2R7IA 1ZOEA 2QLQA 3NUPA 5J1WA 4P5QA 3E63A 4FL2A 4LMNA 2X7OA 4ERWA 4BWPA 5CAOA 4XLIA 4F9AA 3HAVA 3FMLA 2EU9A 4FTOA 1ZXEA 4KBAA 3T9TA 3VRYA 4CV8A 4I94A 4DLJA 5JK3A 2XYUA 1M52A 4R8QA 1R0EA 3KRXA 4JBQA 3TZMA 3DBDA 2YCQA 3LAUA 4GFMA 4JRVA 4KSPA 4O38A 5GJDA 4AOTA 4KS7A 1H00A 2YDIA 4MXCA 4NM5A 4FKVA 3QTUA 1ZARA 3QGYA 1Z9XA 5D10A 2QD9A 3POOA 1Y57A 3LLAA 5M55A 1ZWSA 3L8PA 3MY0A 3QZGA 2QKRA 5IUHA 3RK5A 3HDMA 5DT3A 5J1VA 1L3RE 2YAAA 3HA6A 3UC4A 3LFNA 4AZSA 3QTZA 2W4JA 4XG3A 2WMVA 4R5YA 4RZVA 2WNTA 3ETAA 4Y85A 4YPSA 5LMBA 3OT3A 4L53A 5M4UA 5BVNA 4AXAA 2Y0AA 4ALVA 4KRDA 4K0YA 3FI3A 2JFMA 3OUNB 4FV7A 2WTJA 2OZAA 3U4UA 5A54A 2IG7A 3MH1A 1Y8GA 1O6YA 4EOOA 4XLVA 3FWQA 3QUPA 2GHMA 1M7NA 4CRSA 4IDTA 3U6JA 2ITZA 5H8BA 3M42A 1SMHA 3Q6UA 4FEQA 4E6CA 4LUEA 3R02A 2XK6A 2EXMA 4RPVA 4L00A 2IVVA 2CGWA 2WOUA 4R3RA 3WIGA 3ZO1A 5AUWA 1H1RA 4B4LA 2W5HA 2GQGA 3H0YA 5TE0A 5BVWA 3W2QA 3SD0A 2GNGA 4X2GA 5AV0A 4FTTA 3I79A 1OBGA 2CN5A 2R3GA 3VBQA 5A4EA 4IBMA 3LW0A 4IAIA 4D4RA 4FZFB 4AW1A 4F6SA 4Z3VA 3AC8A 4IMYA 4IFGA 3SV0A 5J5SA 3DBQA 3T3VA 5E8UA 2CNVA 5AR8A 4H58A 1J1BA 2P2IA 3Q96A 5DEWA 4NJ3A 3JYAA 3OUKA 3EN7A 3TDVA 2W06A 4LOPA 2CDZA 2XNBA 3VS7A 3R9RA 2X2MA 3KQ7A 4FSQA 4M12A 3GFWA 4PL4A 3DS6A 4FGBA 5ETAA 4I6FA 1KV1A 2HZNA 3BQRA 4PX6A 5J9LA 4E7WA 1A48A 5EI2A 2G9XA 3DFCB 2IZSA 4CTCA 3ANQA 3FKLA 3LFEA 3OD6X 4O2ZA 4RC4A 4XG6A 5LOHA 4I0TA 3F2RA 3GOKA 1FGIA 3D7ZA 4BIEA 3NS9A 5AEPA 4Q9ZA 4CFXA 3ZM4A 2HY0A 3FMHA 5HX6A 3PPZA 4FIGA 4MD9E 4QP1A 4YJVA 4BZNA 3LCTA 3CTHA 4I3ZA 4HZSA 5F20A 1M2PA 4AN3A 3B2WA 1FOTA 3F5GA 4EH9A 3FUPA 5CSXA 4Q5HA 2O2UA 4EEVA 3D7TA 2IZTA 3AC2A 3H0ZA 4JG8A 3BE9A 3QD3A 1Q99A 3QTWA 2VTPA 2ZDTA 3IDCA 4FEWA 1FVRA 2P0CA 1XBBA 3FQEA 3DK3A 4QRCA 2Z7SA 3MY5A 5JGBA 2HENA 4ZP5A 2DWBA 5HTBA 4NUSA 3AXWA 4RJ6A 3VUDA 5HU3A 1AQ1A 3D83A 3F5XA 1YI3A 3O7LB 2W4OA 4NK9A 3C13A 2YM7A 3QRKA 4QQCA 4RMZA 5BYZA 4ITIA 3UC3A 4B8LA 3FSFA 4QYHA 5ANDA 4PMSA 2HXLA 2WB8A 3NNUA 5D9HA 4TKSA 3AMAA 2XIRA 3BX5A 4JQEA 5J8IA 3SKCA 4WNKA 4DBNA 4NIFA 3F2NA 4OT5A 4X7QA 4XV1A 4LL0A 3TZ8A 1JBPE 4K8AA 4ITHA 1NVSA 1BI7A 2EXCX 1ZRZA 4BWKA 4CD0A 4D55A 4EHEA 4Z9LA 2R0UA 4O6LA 2VD5A 3LCDA 5L2IA 2IPXA 4NH1A 5EHYA 5BUJA 3PG1A 2YJSA 3Q4TA 5AAEA 5AADA 2B9FA 4A07A 3GC0A 4C2VA 3UIXA 4AA5A 2C1BA 4CFVA 3C0GA 2FSLX 5L8KA 4GKIA 3FL5A 2QVSE 2QLUA 1Q3DA 3ANRA 3E64A 3EB0A 3GOPA 2W9ZB 4G3DA 3RCDA 4O1PA 4BCOA 4CTBA 4EHZA 3MH0A 3NYVA 4E3CA 4LL5A 4OBOA 4DCEA 2OIDA 3PJ1A 4L43A 4BYIA 1MQBA 4KKHA 2E2BA 4XP3A 3UOKA 4ANMA 3EOCA 2UZTA 3ULIA 4AF3A 5IISA 4FT5A 5HO6A 3JVRA 1OZ1A 2PWLA 3KN5A 1DAYA 4RJ5A 3CR0A 2WTVA 3KA0A 4HPUE 4CXAA 2ZAZA 1ZYCA 2V22A 3FL4A 4MWIA 4RIWA 4FR4A 3F6XA 2UW7A 3IG7A 3BV2A 4H36A 3T3UA 3T8OA 2C0TA 3NR9A 2GU8A 4DH1A 3Q32A 3FKOA 3Q60A 2JDTA 4EH3A 3QCQA 5IUGA 1RJBA 4FIJA 2YM8A 3NUUA 3D9VA 2A0CX 3KN6A 2PMLX 2WMAA 3TL8A 3I5ZA 3R71A 3SHEA 2HW7A 2XKEA 3PE2A 5C8KA 5DOSA 4E4MA 3OC1A 4GCJA 5J7HA 2QG7A 4O83A 1XH8A 4IB0A 3CPCA 3PZEA 4HW7A 3TEIA 5LVLA 3PXFA 4HCTA 1Y91A 3MN3A 4D2VA 3ZLXA 1PXKA 1YDSE 5EI8A 4AA4A 1NW1A 3RZFA 1VYZA 2VTOA 1BYGA 5HICA 1PW2A 3DPKA 3ORZA 4UYNA 2WIHA 3W2CA 5EQPA 3NIZA 4AACA 4AZVA 4FI1A 3PWDA 1YDTE 3QWKA 2OLCA 1GIIA 1LP4A 1LR4A 3OEFX 4RVLA 4XX9A 1OKVA 3OMVA 3PDTA 4FKUA 4BDGA 3QWJA 4YJSA 2C4GA 3QTQA 3OY3A 4CT2A 5CVFA 4QMYA 2JITA 4L68A 3CLYA 3DCVA 4NCTC 5L6WL 2FA2A 2IW6A 2OFUA 3AC3A 3C51A 3CTJA 3D2KA 2GTMA 4GS6A 4JI9A 4CT1A 3F82A 3EYHA 4C35A 2YISA 4DEBA 3P0MA 2PPQA 3NVMB 4NCTA 3EIDA 3TM0A 5M09A 2QO9A 4WBOA 3HMIA 4U45A 5K9IA 3FJQE 5EHOA 4NKAA 5B0XA 4O7ZA 1YXXA 3QKLA 4GG7A 4YO4A 4LQMA 4PDPA 2ZV9A 2XM8A 1YDRE 1G8AA 2VNWA 3RZBA 4NTSA 3VS4A 3DJ6A 1NVRA 3IECA 3VS1A 4YP8A 4C4JA 3F88A 3Q9WA 3BGPA 1MP8A 4Q2AA 2C3LA 2C30A 4IJ9A 5T3QA 4QO9A 3WZDA 4DFYA 2XK7A 4S2ZA 4YLLA 4DEEA 3GT8A 2RSVA 3Q2MA 4RVKA 2OJGA 4NZWB 2OJJA 4PQNA 4RGJA 4F0IA 3NSZA 4IANA 3PJ8A 5AM7A 3QQUA 3R9NA 1QCFA 3PWYA 3HP5A 4ENYA 5IQAA 4ZSAA 3FHRA 1W83A 2O65A 4WNOA 4XV2A 4I6HA 4YGAA 3QCYA 5GJGA 3I1AA 4USEA 2AUHA 4YPDA 4HGEA 3HYHA 5CY3A 5CVHA 3HDNA 3O2MA 4ZSGA 1ZOHA 3E5AA 2JDSA 4OTDA 1XHAA 4ASEA 3P5KA 3PSDA 2IN6A 2ITVA 3Q4CA 4RQVA 5B2LA 4GT5A 4M97A 4YZNA 4B7TA 1SVHA 3KFAA 4F7NA 4FTJA 3RNYA 2E9VA 2X8EA 4YC6A 3VJOA 3OVVA 3H9OA 2VTRA 3TWJA 4FZ7A 3KCFA 4V04A 4QYGA 2CNUA 3OW4A 5C27A 5KO1A 5TF9A 2XA4A 3H10A 4W4YA 3R28A 2WGJA 3ZZEA 3FI2A 4NIFB 4EQCA 1H27A 4G5PA 3V5TA 1GNGA 2B55A 5LMAA 4LYNA 3EN6A 5CEQA 3WOWA 1H1SA 2Z2WA 1STCE 2UW3A 1MRYA 2A2AA 3DB6A 4O2PA 2R0IA 2UZVA 3UG1A 4O7LA 4N6YA 1BKXA 1LEWA 2F4JA 5A4LA 5FEQA 3ZYAA 4WG5A 3VVHA 4IVAA 1ZZLA 3HMPA 4FA2A 3G2FA 2WMQA 3DTCA 2R3RA 3L9MA 5FRIA 4CFMA 2X9EA 3HZTA 3U6IA 3DJ7A 2YABA 4ZZNA 3UO5A 4E6QA 4UMRA 3ODZX 1T46A 1Q62A 2A4LA 4L3LA 2VAGA 4LV8A 2UZWE 3LVPA 2UZUE 4KKGA 3K5VA 1DI9A 2PVJA 2IWIA 4K1BA 2OWBA 4BN1A 4Z16A 3QQJA 5L6PA 4D2PA 1K3AA 3QL8A 4FV6A 3C1XA 2BZJA 3R1QA 2OXXA 4IX6A 4UX9A 1PYXA 3BHTA 3UZRA 3AC1A 5CTPA 3LJ1A 4M0ZA 4PV0A 3R8ZA 4KIKB 4PL5A 3FI4A 1P2AA 4PTCA 5F95A 4F09A 5IZFA 2O3PA 4KBCA 1B39A 4QP4A 1OITA 3LXNA 2FSMX 4G5JA 3DQWA 3O50A 5CANA 3GC8A 4IAYA 1ZMUA 4M69A 4E5BA 2VZ6A 2R3HA 3G5DA 4QMWA 3BWFA 3VC4A 3PP1A 4M15A 3KXZA 4E4NA 5B2MA 1QPDA 4MQ2A 5K4IA 4H3BA 3A8WA 3LE6A 3ORNA 5IEYA 2XCKA 3OS3A 3R2BA 3NYOA 1GOLA 3ET7A 4ZTNA 2W9FB 2FB8A 1Z5MA 3BYOA 5EM5A 4N70A 4U80A 2RFEA 4YR8A 3LFBA 4MQ1A 4EUUA 4AOJA 2VX3A 4WBBB 3HRCA 4AT4A 4MNFA 4UMTA 3BYVA 3JPVA 3UIBA 4X2KA 5DFPA 2E9OA 5FBNC 4APPA 2OXDA 3Q6WA 4YMJA 2VWVA 1Q97A 3I6WA 3FQSA 4QP2A 2OW3A 2BROA 3TUBA 3KULA 4OTHA 4OBPA 2WTKC 3QKKA 2WMBA 2J90A 5AFVA 1H1WA 4EOMA 4F6UA 2F2UA 2UW0A 3SA0A 1YOMA 1ZAOA 4M84A 4ZTMA 4BR3A 1SVEA 1IA8A 3CIKA 3HV3A 4GL9A 2OKRA 4ZOGA 2OSCA 2Y7JA 2WPAA 3PYYA 4FL3A 3C0HA 3ZHPC 3UOJA 4BDEA 3JY9A 4HCVA 2XNEA 3GP0A 3QYZA 1ZY5A 4GU9A 3KREA 4O21A 5EDRA 3RK7A 2VO3A 2B0QA 2XVDA 3G90X 4DG0E 4MNEA 2H96A 4ACHA 3L8XA 3UNJA 2RG6A 3KXGA 4FYNA 1BLXA 2ETKA 2XNGA 3QFVA 2IW8A 2QHNA 2ESMA 1KE8A 2VV9A 3AD4A 3EMGA 3MI9A 4JX3A 3RGFA 3V5LA 3RWQA 3WYXA 5HCYA 4NYEA 3PLSA 5D7AA 4WSQA 3OFMA 3U4WA 4ACDA 3H9RA 4OLIA 4FVPA 4XH6A 4BDHA 2PY3A 5CENA 3SXSA 3IW7A 4HCUA 5C1QB 3BEAA 4HJOA 5G1XA 4F63A 4FT7A 4JAJA 4W4WA 4I0SA 4U9AA 4NT4A 5AIRA 5C4KA 4QPAA 3R01A 5L8JA 4AZWA 1J1CA 3HNGA 5BVEA 2PVYA 4AW5A 3DAEA 3KMUA 3H3CA 3DT1A 1Q8TA 2RGPA 5KE0A 1S9JA 4PTEA 1U4DA 2GS7A 3KXMA 3N51A 3QUDA 4L52A 4GSBA 3UP7A 5JFSA 2JLDA 4H39A 5EQYA 1JAMA 3BYUA 4DEDA 3TNWA 3TXOA 3EN4A 5H9BA 5KNJA 3DK7A 4AAAA 1PF8A 1M2QA 3F3ZA 4BCKA 4HVHA 2F57A 4PMMA 2EB3A 3KRJA 4G9CA 4ANQA 4FTNA 4V01A 3Q5ZA 3P78A 4QTCA 1YXVA 5EYMA 3VS5A 5L2TA 1S9IA 4DC2A 4GKHA 4Q5EA 4FKGA 3OT8A 3BBTB 2B1PA 4EOJA 3MV5A 2Y4PA 4CLIA 4BHZA 2BKKA 4YJPA 4YNOA 1ZOGA 2GHGA 2XF0A 3C5IA 5HD7A 4K33A 5ETFA 4CSVA 4FEXA 1I44A 4MXYA 4QOXA 1WMKA 2C6LA 1OB3A 4IZYA 3AT2A 4RFZA 2PZYA 5TKDA 3W55A 2GQRA 5IMXA 1M7QA 3JR1A 4YZCA 3UQCA 1UWHA 5EYCA 4I92A 3DKFA 2QOQA 4YHTA 4JDKA 4EC8A 3EZVA 4FYOA 2PHKA 3RVGA 5F1ZA 3SC1A 2PVHA 4U5JA 5IA4A 3EL8A 3F5PA 4BCHA 2X7FA 4FBXA 1KOBA 3RINA 2PU8A 2IVTA 3BHVA 4L3JA 5ICPA 2NRUA 3P7CA 4FTIA 2X9FA 1YKRA 3R8MA 4DHFA 1W8CA 5JRQA 1J7LA 3IGGA 4NKSA 5IEVA 5C01A 3VW6A 2F7EE 2R3OA 2CGVA 4EH6A 2YFXA 4OTPA 5H8EA 5JQ8A 2I0HA 5FLFA 3S3IA 1OL5A 2VTIA 3PUPA 5EYDA 3EQIA 5HI2A 5BMSA 1F3MC 4ZJVA 4TL0A 3PA4A 3TIYA 5IH5A 1H0VA 1LUFA 4FSNA 3UVQA 4FV0A 1YRPA 4RIOA 3KGAA 3DTWA 4G3GA 4EOIA 4JQ7A 1E1XA 2CCIA 4USFA 4TYHB 3K54A 3TG1A 4ENXA 3G51A 4NJDA 3PXKA 1KE7A 4ANLA 4O0YA 4JXFA 2Y9QA 5AP5A 3RAKA 2WTCA 5JEBA 2CHLA 2FSOX 3ZTXA 4OTWA 3TZ7A 4L6QA 4D9UA 2QURA 4QYFA 4N57A 5IQIA 5DMZA 4XP2A 2DUVA 4UV0A 4O7WA 3KRRA 4K11A 2VTTA 2H6DA 3A8XA 4BI0A 3BU6A 3I81A 4GK3A 4XNEA 5CS6A 5DNRA 2VGPA 4QMOA 2OIBA 3UE4A 1Q8ZA 2ITYA 3ORLA 3I60A 3FAAA 4P2KA 4CMOA 3DZQA 3SAYA 4A4OA 2ZV8A 3QBNA 4FV1A 4IEBA 4J7BA 5FGKA 4YUQA 5CAVA 4BI2A 5T68A 3EL7A 4KB8A 2BDWA 4FOCA 4EKLA 2OU7A 4B0GA 3R1SA 4G6OA 1UWJA 3OBGA 4I6BA 4UWBA 4D1ZA 5C03A 2J4ZA 3MGYA 2UW6A 5I3RA 2CKQA 3NNVA 4S33A 3FY0A 4EL9A 4YJTA 1SM2A 5DA3A 4ZS4A 2JC6A 5FXSA 1GZ8A 3QHRA 4FICA 4XG9A 4BDBA 5BUIA 2X6DA 4O7RA 4J53A 1U46A 4DH8A 4AS0A 2WMWA 3DBCA 1PXOA 5E1SA 3CSVA 1V1KA 3EWHA 3RM7A 3IKAA 3F9NA 4C7TA 5DE2A 3U55A 5HIDA 5HTIA 5FDXA 4O22A 4AZTA 4C38A 4AE6A 4UB7A 3R22A 2PULA 2J0LA 3VS2A 1WVYA 5HORA 5CXHA 2BIYA 2VGOA 2XK3A 3FLYA 3VIDA 4R7HA 2VRXA 5E8VA 3FE3A 3ORMA 5EW9A 4HOKA 4I24A 4ZY4A 3DAJA 3FZRA 3ZRLA 3ZEPA 3QZIA 4BDAA 4IZAA 2YJRA 3EN9A 3S2PA 3LCSA 4EOQA 4O91A 1F5QA 2PVNA 2CLQA 2WXVA 3QA8A 3CKWA 3RPRA 5I9XA 4BCQA 5A4CA 3LHJA 5IA0A 4DT9A 5KMOA 4W9XA 2QQ7A 4EOSA 5LQFA 3DA6A 5DBXA 3PA5A 2XIKA 4TN6A 2RFNA 4DGOA 3GQLA 4R6VA 4W8EA 4JJRA 2WMUA 3RJCA 4DYMA 2X7GA 2XK4A 2RF9A 5AR4A 3ENHA 3LFSA 1YVJA 5AWMA 5AR5A 3BELA 3R7VA 3MIAA 4U6RA 2YZAA 2VWIA 2P33A 3F66A 3ODYX 4RIXA 4FVQA 3UVRA 4JDHA 3H30A 3EQDA 4IVCA 2J6MA 4DFLA 4JRNA 4CNHA 5AX9A 5CVGA 3MVMA 1H07A 2C6IA 2YIRA 4FG8A 3GQIA 4G16A 1JKKA 4QQJA 4X3JA 2OG8A 4YSMA 3A4OX 1PXJA 2Y4IC 3PRFA 4AGUA 3BZ3A 3CQEA 3Q3BA 3L8SA 4AZFA 3IPHA 4CQGA 3MS9A 4IM0A 4L8MA 3TJCA 4GYGA 4KRCA 2R3MA 1R39A 5AIKA 3RAHA 3RI1A 3QTSA 5JFWA 4FC0A 3C0IA 5AR7A 3CBLA 2V62A 4I1ZA 1R78A 2G1TA 1FQ1B 2PVLA 2VTAA 2YA9A 4J1RA 4L67A 3W10A 4BDJA 5CSWA 4W4XA 3VQUA 3D2IA 1J3HA 4Y95A 1E1VA 3EQHA 4XRLA 5I9UA 4FSMA 3NW7A 4FSWA 5KBRA 1CKPA 4FZ6A 4AN2A 3DXNA 4EJNA 4J71A 5KBQA 3D94A 3QAME 4J96A 3C4WA 4WSYA 2J5FA 3WILA 3A62A 1ZYSA 5FUTA 3O17A 4BB4A 4F9CA 3PPJA 4QTEA 3HV5A 4TWNA 4IX3A 3HECA 3KU2A 1JSUA 3VBTA 3VJNA 4BRXA 3HA8A 4E5WA 2WTDA 3ZC5A 5K4JA 4WT6A 4ZMEA 3K5UA 3R83A 3QLFA 4C3FA 5D11A 1Q8YA 3KEXA 2WZJA 3RAWA 5EQEA 2C3KA 3OBJA 1IASA 2O63A 5DGZA 5E8XA 4IACA 4YO6A 5I9VA 4BCMA 4FSUA 3UG2A 4JR7A 4PPBA 4R78A 1R1WA 2PE2A 2C6DA 1RDQE 2BILB 3UZPA 3QYWA 2VO6A 3BYMA 1KSWA 2UVZA 4FX3A 3VUGA 4BCJA 5I0BA 1W82A 3CXWA 3RBWA 4FTRA 3FC2A 4L3PA 4TYGA 3KXXA 5A9UA 3S0OA 5E9EA 1REKA 4RJ3A 3TJDA 4ANNA 3E92A 2ZB0A 5HLPA 5I9WA 1SZMA 3C5UA 3QXOA 4CYIA 1H26A 1XBAA 3ZUTA 4FE2A 4FK3A 4I93A 3NLBA 3FEGA 3KRLA 5E4HA 3ZFMA 1UU9A 4C61A 4EWQA 3KMMA 4Z7HA 3PRIA 4CG8A 5L2WA 4FZAB 2YZLA 5FXRA 3F5UA 1J7UA 5A6OA 1YXSA 4YZDA 3TNQB 1V0BA 5IA3A 3QTIA 5EOBA 4M66A 3UJGA 1XQZA 4OAVB 3OXIA 3MFUA 2CKPA 3JXWA 5CAPA 2GPHA 1PXMA 4EORA 3LCOA 3OWPA 3QD0A 4C2WA 3MVLA 4E1ZA 1AGWA 4Y5HA 4F7SA 3A2CA 5HE2A 3WBLA 4G3EA 5EI6A 4FSRA 4PTGA 3IQ7A 3HKOA 4TPTA 1JSTA 4AFEA 3FHIA 1OMWA 2XIXA 5M4IA 2E9PA 5M08A 4EBVA 3PIZA 3HP2A 1BL6A 4FT3A 3HGKA 3W1FA 5JN2A 4FNWA 5EK7A 2YHVA 1U54B 5HBEA 5HIBA 3R7GA 2VWWA 4HGTA 4RIYB 2ITUA 1OL6A 3U9CA 4KKEA 4X2NA 1UNLA 2RFDA 4PP7A 3AOXA 4MD8E 4WA9A 4FTLA 2IZRA 4J8NA 3KXNA 3R00A 3WF8A 4AQCA 4F4PA 5HZNA 3FBVA 2WMSA 4O6EA 2VTHA 2OO8X 3MY1A 4ZLOA 5CEKA 3PXQA 4B99A 2BAJA 3VHKA 4H1MA 5T6KA 4AT5A 3SRVB 4IX4A 4LM5A 4YC8A 2VTLA 4EK8A 5JFVA 5CT7A 3MVJA 5K5NA 4GK4A 4CZUA 1O6KA 3F2AA 5LARA 4D2WA 3TTIA 2XEZA 3FXWA 4U7ZA 4DN5A 1H0WA 4H3QA 4OW8A 3HRBA 5FXQA 4QMMA 4S31A 5HNGA 3LM0A 2I0YA 2I1MA 5K0XA 5ITAA 4HNFA 4F08A 2C6OA 5BQ0A 3G6GA 5AX3A 2CMWA 2YM6A 5F9EA 2XMYA 4LUDA 2EXEA 4LRMA 4GVAA 5CEPA 4NW5A 3Q4ZA 3E8NA 4TZRA 3V6RA 3R8UA 1ZZ2A 2XNPA 3RTPA 2V7AA 3UNZA 5KZIA 2JKOA 5FM3A 3VAPA 4A9UA 4PWNA 4C4FA 4JX7A 2OJIA 2OICA 1XH9A 4QMXA 2EB2A 3VUHA 4RA5A 1PXLA 3C4XA 5DH3A 4JBPA 4FV5A 4F1TA 3SGCA 5BX0A 4IVDA 2GTNA 4L7FA 4QQTA 4A4LA 4R1VA 5KHWA 2C6KA 2WQOA 3JVSA 3EN5A 2OXYA 3W2PA 2WHBA 2XS0A 3KKVA 3P7AA 2UUEA 4KIPA 3ZLWA 4AW0A 2HW6A 3DKOA 5EOLA 3DLSA 4P7EA 4F64A 4F6WA 4HVDA 4I0RA 2FH9A 3BRBA 4MD7E 5DLSA 3RK9A 3FSKA 5HG8A 5M44A 1OL7A 4MTAA 2WMXA 4XYFA 5CSPA 3ULZA 2JFLA 4FUXA 4LOQA 3MA6A 4UWCA 3EKNA 5ANKA 1WAKA 3D5UA 3AMBA 2GNIA 4AUAA 3VS6A 5CU0A 1VYWA 4PUZA 5C8NA 2I0VA 4XCUA 2X81A 2V5QA 1GZKA 2OZAB 2PZRA 5AUUA 4DH3A 4RLLA 4GK2A 2JBOA 4M0YA 2OH0E 4I21A 1YHWA 4X2JA 3QKMA 1L8TA 4MBJA 1VR2A 3QC9A 3KRWA 3TNIA 5EW3A 2G2FA 5IUIA 3EFWA 3VS0A 4ASXA 1X8BA 3Q9XA 4A9TA 5B7VA 4QTAA 4JVGA 4FIEA 3L9PA 4YHJA 3KK8A 4NW6A 5BYLA 3HV4A 5JKGA 1ZMVA 5FTGA 4PRJA 3COIA 4DG2E 4ZTRA 4OT6A 4HVSA 3GENA 5TR6A 2XNNA 2Z02A 4QYYA 4FV4A 5AP4A 3GVUA 3GCVA 3SXRA 2VWBA 5A46A 3QCSA 4OUCA 2J7TA 4D28A 2WAJA 3IK3A 4U3YA 4RG0A 3R1NA 3VRZA 3W2RA 2OF4A 3DDPA 5ANOA 1SNUA 4ZAUA 2YLFA 4BZOA 3DKGA 4ANBA 5HLNA 4BI1A 2WMRA 4QTBA 4XV3A 4C59A 3DDQA 3OP5A 3P79A 3PVBA 4PY1A 4RJ7A 2WQBA 2R3FA 2VN9A 4DEAA 1KOAA 4G6LA 4DGLC 3EH9A 3FZPA 4MK0A 1FMOE 4PPCA 1ZYDA 4FKTA 3BKBA 3HL7A 5IDNA 2W1CA 3P1AA 3HEGA 3WYYA 4A9RA 5CF4A 4KIQA 1UKHA 3PE1A 4U41A 1G5SA 3FMKA 3Q9YA 1OPLA 3FLZA 4L45A 4E6DA 2QO2A 1H1QA 3UPXA 1I09A 4FG9A 4UBAA 5AP7A 5HVKA 2XJ1A 1O6LA 3EJ1A 4EYJA 3R7UA 5HEZA 3QZHA 4QMNA 1KWPA 1XH5A 4FTMA 4TYJA 1OBDA 1ZMWA 3LQ8A 1B6CB 5CF8A 3D7TB 4A9YA 3HAMA 3DY7A 2C0OA 4JDJA 4F1OA 3E8CA 4FKSA 3FPMA 5KMJA 1PKGA 2V0DA 4KINA 4ACCA 4HYUA 4U81A 5LVOA 3HVCA 3OW3A 3PG3A 4CVAA 4FOBA 3C9WA 5H2UA 4RT7A 2C5NA 2QOOA 3LXLA 3GU6A 5DT4A 1UKIA 4BWXA 3EFJA 4WG4A 4E73A 5I9YA 5ANGA 3UYSA 1BI8A 3W33A 4DEIA 2W7XA 2YN8A 4F7LA 4IXPA 5CALA 2JKQA 4EOLA 3BU3A 3BLHA 5CLPA 2NNWB 1ZYJA 2I6LA 3V01A 5BVDA 3KF7A 2PUIA 1UU7A 4RVMA 3A4PA 3AQVA 1YXTA 4JIKA 5CZHA 4IW0A 4F9WA 3EQBA 2R3KA 3O23A 4IM2A 4C4GA 5FTQA 1PYEA 3FZSA 3O0GA 4A9SA 5IQCA 5AM6A 2PUUA 1TVOA 2OBJA 2WIPA 3ALNA 3KB7A 3VF8A 3WZKA 3VUKA 4ANOA 3IONA 4W8DA 3V8SA 4TYEA 4LOOA 4TNDA 3FZTA 3SXFA 3THBA 3OHTA 3V5QA 3ZRMA 2IZUA 3IDPA 3F69A 1G8SA 3I0QA 4O1OA 3ZO2A 2ITNA 3FMDA 3FV8A 5E1EA 4D2SA 1OL2A 4HNIA 5CEMA 4MX9A 3SVVA 2WQEA 3VF9A 2PE0A 3TKUA 3OCSA 3BGZA 1VJYA 1IR3A 4FVRA 4I5HA 3C4FA 4TWOA 1UVRA 5BYYA 4FT9A 5IU2A 1GY3A 1NY3A 3IOPA 5L3AA 4IB1A 4ORKA 5GHVA 1H25A 2OK1A 3IDBA 4K9YA 3MSSA 3S4QA 4XS2A 5ACBC 3RMFA 4OTIA 5K3YA 1UNGA 2JAVA 2B9IA 5AP3A 2AC3A 2R64A 3ZLYA 4CYJA 5I4NA 4JAIA 5AJQA 3LLTA 2J0KA 4E4LA 1H24A 4IVBA 4YBKA 1APME 4FNXA 1YWRA 2R3IA 1OIQA 1XJDA 1JKTA 4RIWB 3FMMA 3MVHA 4OTGA 1URCA 4O7VA 1DI8A 3TKHA 3IOKA 4Y8DA 3EQCA 1OKWA 4EUTA 3QD4A 5D1JA 2I7QA 1CSNA 4D4YA 2KTYA 2OI4X 5AA9A 5E8SA 1OUYA 5D12A 3R21A 4RLKA 4CV9A 4YSJA 5CT0A 1XR1A 3E87A 1PXPA 4PF4A 1JKSA 1FMKA 4FKJA 1XBCA 2W05A 4CKJA 4WHZA 5ANJA 3SG9A 1CTPE 5H8GA 3MTLA 5C26A 4FTUA 2BRHA 1KE9A 5E7RA 3LFCA 3ZUUA 1J91A 2NPQA 1IAJA 3MA3A 4G2FA 2UZBA 2XP2A 3EFKA 3GU5A 3QCXA 4MF0A 4BYJA 3L9LA 4U97A 3L9NA 3KC3A 2ZVAA 4FIFA 5EHLA 2NRYA 4C34A 5M4FA 2W5BA 3SOCA 4X0MA 5JT2A 2A19B 4MCVA 3IW4A 3WF9A 2R3JA 3G9NA 4YTFA 4MF1A 3ZBFA 5GZAA 5AP1A 3BV3A 4U0IA 2OGVA 3I7CA 4KNBA 5CYIA 4NM7A 5DI1A 3WF7A 3Q04A 4GFGA 1DS5A 4RVTA 4BF2A 4AP7A 3WE4A 3CKXA 4FNZA 4D1SA 4LGHA 2W1GA 4JG6A 5G6VA 3OCGA 4BTJA 3KVXA 4EH4A 4O82A 4R7BA 4FTKA 5KZ0A 3NIEA 4ZZOA 3QRTA 4N4SA 4USDA 5AR2A 3CE3A 3ITZA 1B38A 2YLEA 4BKZA 3II5A 1JLUE 4G3CA 3GEQA 1KV2A 1P5EA 4J8MA 4F0GA 2V55A 4I20A 1UNHA 3WZEA 1WBWA 1FVTA 4M3QA 2QOBA 5DYJA 3TV7A 2QI8A 3OTUA 5IQDA 3BWJA 1E9HA 3TNPC 2CGUA 3CY2A 4FEVA 1W98A 3FPQA 3SW4A 5CSHA 5J79A 4RZWA 2ZDUA 1WBSA 4B6LA 2BDFA 5DN3A 3OXTA 1JVPP 1RW8A 2JKKA 4G3FA 2JIIA 4C33A 4XG7A 4NSTA 4DGMA 3MW1A 4PNKA 4C37A 4EK6A 3CY3A 3BIZA 3MB6A 1QPCA 1NA7A 3EYGA 4KWPA 4PP9A 5DT0A 2VTNA 2BMCA 2OZOA 4JBVA 3RKBA 4QP8A 3EQPA 2HELA 2P4IA 3WE8A 1FPUA 4FF8A 3LXPA 3E3PA 2BRNA 3BE2A 3MWUA 4F1MA 5J9YA 4GFOA 4FNYA 2DYLA 4XBUA 4CRLA 3MTFA 3RPOA 4IAAA 4O0XA 4ACMA 1OIYA 2IVUA 5FBOA 4AGWA 2J9MA 2JDVA 3NNWA 3HRFA 3VO3A 4XG8A 3ATTA 2REIA 2A1AB 1SYKA 5KKRC 2PUPA 3D5VA 2UZOA 4LGGA 1Q24A
chains in the Genus database with same CATH superfamily
2CCHA 4O7NA 2HYYA 3A60A 3BPRA 4CFNA 3GUBA 3ORPA 5HU9A 3OG7A 1QPEA 4NU1A 2ITPA 5AAGA 5H3QA 3CC6A 3L1SA 4H05A 4IAFA 4UMPA 2CKOA 5HQ0A 4WNMA 3PA3A 4BIDA 4EI4A 4LG4A 2ETRA 3TMOA 4ZTHA 4GV1A 3NAYA 4G6NA 4J97A 1MQ4A 3QX2A 5CI7A 4IFCA 4CFWA 2BALA 4IC8A 4ACGA 4ERKA 3LXKA 2PE1A 3O51A 3TTJA 1ERKA 4D0WA 3ZXTA 4BDCA 3TYKA 4QYEA 4F0FA 4V0GA 4DFBA 2PVKA 3NX8A 3MFSA 1ZYLA 4O0WA 3CEKA 3GGFA 4RWIA 4QP3A 4NM3A 4MXZA 4HVIA 5FP5A 4BGGA 5LVPA 4CEGA 4KUJA 2R3NA 3C7QA 3ORIA 4P90A 3R30A 1PMEA 3A7JA 3MPAA 2PZ5A 2UZEA 1PMUA 4UEUA 2VNYA 1WBPA 1G8KA 4LV5A 2W1FA 4WUNA 3ZCLA 2IO6A 3LFAA 1OKZA 4Y72A 4JT3A 5AMNA 5JRSA 4BCFA 1V0OA 5GNKA 3UIMA 4ZS0A 3ZDIA 3A7IA 2XZSA 2QC6A 2R3QA 4L44A 3OOGA 4FKWA 1W0XC 1A9UA 4N6ZA 3UO4A 2XRUA 3FQHA 4ZIMA 2BDJA 5IA2A 4YJQA 5EM7A 4ZY5A 3QALE 1JKLA 3UTOA 5DR2A 5CEIA 3B8QA 3K3IA 3SW7A 4YU2A 3B2TA 3W32A 3AT4A 4QDEA 3ZUVA 4O7TA 2LAVA 1UU3A 3DXPA 2ETMA 2UVYA 3F7WA 4QPMA 4B9DA 1K9AA 4M69B 1MUOA 1ATPE 3A61A 4HYHA 5IG1A 2QOKA 3CJFA 1PRYA 5BVFA 4F7JA 4BTFA 3ROCA 2ZFYA 4MAOA 3R8LA 3ID6C 3KK9A 4I5PA 4YJUA 2EWAA 3VHEA 2QNJA 2F49A 3NPCA 5CU3A 2HWPA 1RE8A 4AXFA 4I4EA 3D14A 5LJJA 2ZM4A 3UYTA 4R3CA 3OWKA 5DPVA 1GZOA 1PMNA 4E5AX 3AD6A 5L8LA 2AYPA 3RNIA 3VBWA 1TKIA 5LVNA 2PK9A 3FDNA 2XKDA 4QMSA 2Q0BA 2VWYA 2WEIA 2WD1A 3RM6A 3WIKA 4DLIA 2X1NA 2XJ0A 3BU5A 3ATSA 2AC5A 4J99A 1OPJA 3R9HA 5LXMA 3TKIA 4RWKA 3OZ6A 3G0FA 2ZV2A 5AV4A 5HBJA 2R9SA 2PVRA 3OROA 3R73A 4ASZA 4IE9A 3KULB 4IZ7A 3ZC6A 4BL1A 3UNKA 3OCBA 5LCJA 5HO8A 4TYIA 5EYKA 3M1SA 4IHPA 4FSTA 2BTSA 2WTKB 4M13A 5HE0A 1M17A 3NDMA 5C9CA 3HLLA 5BUEA 4FIIA 4GG5A 5FM2A 1YQJA 2WTIA 4X6RA 3QQHA 2BR1A 5E8YA 3U87A 4AX8A 5FG8A 4LRJA 4ZXTA 5L2QA 1FINA 4H1JA 4BICA 3DXQA 2I40A 3H9FA 3PJ3A 4MNEB 3E88A 3R9OA 4QTDA 2OFVA 4IH8A 2QOIA 5LWMA 2OJFE 3NUYA 4P5ZA 3AKJA 2WOTA 2JD5A 3M2WA 5EM6A 4ZEGA 2JAMA 5JH6A 4GRBA 4EZ5A 4FTAA 5AP0A 4XUFA 4DCAA 1CMKE 3TNHA 4RX7A 3CTQA 3DZOA 3D4QA 2HAKA 3UPZA 1O9UA 4FODA 4ALWA 3UQFA 3NAXA 4BZDA 4QQ5A 2P2HA 4GIHA 3EQRA 2W1HA 2QKWB 4AG8A 2X8DA 3TUDA 3VUMA 3WZJA 2JDOA 3E8DA 4R5SA 5HVJA 4BDFA 4O7YA 4WRGA 4MWHA 4ZY6A 4ARKA 2W99B 5I3OA 4FT0A 4FTQA 4DT8A 3VUTA 5E90A 3PJCA 4ZLZA 2Z7QA 2VO0A 5E8TA 1U5QA 2UZDA 3HV6A 4ZZMA 2YACA 5BMMA 3LFQA 4O81A 1V0PA 3UQGA 2OF2A 2B53A 3UGCA 2WMTA 3CGFA 3COKA 1Q3WA 3TACA 1WBNA 4WO5A 2ITTA 4CGAA 2HZ0A 3QQFA 2PMNX 4BBFA 5KMIA 3GNIB 5CQWA 2ITWA 5AAFA 1WVXA 2W4KA 5HO7A 4RFMA 4I5MA 4X2FA 5HG7A 1WZYA 4YJOA 5DHJA 3PXYA 5IQFA 5LMKC 4DTKA 3IO7A 3GI3A 2HIWA 3PY0A 2KULA 4JMQA 4ONAA 5FTOA 4YJRA 4AU8A 5LMKA 3K2LA 4QNYA 2ACXA 3FMJA 2Y8OA 1IG1A 4YJNA 2XALA 3V5JA 2J50A 4W9WA 4D58A 3OY1A 4MXAA 4GW8A 4QMLA 4GYIA 5DRBA 4UYAA 3P23A 5HHWA 4BDDA 4TXCA 3MDYA 3AD5A 5J7BA 5CU6A 4O84A 2GNLA 2BUJA 3CJGA 4UZDA 4A06A 5CASA 4NM0A 1Q8WA 2Z60A 3P4KA 4OTRA 4V0GB 4O27B 2CNQA 4FKRA 3CS9A 4D0XA 1PJKA 2WO6A 4RC2A 5HG9A 1IEPA 4ZJJA 1BL7A 1W2CA 2X2LA 3R6XA 4KD1A 2YM4A 4E93A 3SX9A 2BAKA 3ZLSA 3FMEA 3QTRA 2A27A 3TZ9A 5IKWA 4NL0A 2BZIB 1H8FA 2NO3A 4O4CA 1TQIA 1Z57A 2C5XA 1H1PA 4QPSA 3PVWA 4XOYA 5FEEA 3CD3A 2ITXA 3LZBA 4JDIA 1R3CA 3CP9A 3T9IA 3R7IA 2HZIA 4LGDA 4WKQA 3UO6A 2O64A 2BZHB 2QOLA 2XIYA 3HX4A 3V51A 2XIZA 3AC4A 4AXCA 4DF3A 3GXLA 4FEUA 4E4XA 4DTBA 1WVWA 2GCDA 4PDYA 2QG5A 4C3RA 3TCPA 3OXZA 3GC7A 3O8UA 5KUPA 5A14A 4PMTA 4FUYA 1WBOA 3K3JA 4KAOA 2B4SB 5BVOA 2UW5A 2YIYA 3BHUA 3ENMA 4EQUA 3FLQA 4RRVA 5FDPA 1PXIA 4GT4A 3R7EA 3QD2B 2W1IA 3OCTA 4Y46A 2PZIA 3HUCA 1CM8A 3DU8A 4EOPA 3O7LD 4C0TA 2JDRA 4CZYB 3ZFYA 3M11A 3DB8A 2PVMA 5AUXA 3QRIA 1HCLA 2H9VA 3MFRA 3UP2A 4S32A 3ACJA 3QC4A 3NUXA 5AV1A 2G15A 2ZOQA 2CN8A 3G6HA 4FMQA 1OM1A 2JGZA 4BJJB 2VTQA 5AV3A 4CZTA 4Y83A 4YTIA 4BGHA 4OAUC 2JBPA 1OIUA 4J52A 2WTWA 3N4TA 4S30A 4GVJA 4AW2A 4CCBA 4QP7A 4FV8A 3MIYA 3A7FA 3I4BA 2RL5A 1OGUA 5JQ5A 2C5YA 3UMWA 4I23A 3TDWA 3KY2A 5M51A 1H4LA 1BMKA 2C3JA 4DDGA 2QOHA 3LFDA 2XEYA 5CX9A 2UW9A 2DS1A 4QMZA 3W16A 4FSYA 4CKIA 5HE1A 3LQ3A 1H01A 2QHMA 5EKOA 4A4XA 3OEZA 4EC9A 1YWVA 3QF9A 3GU4A 3BHYA 4DH5A 4OTFA 3QU0A 5IA1A 5CU4A 3KMWA 1IAHA 5HD4A 3QRJA 1DAWA 3P7BA 4D5KA 4E26A 5DR9A 4EH5A 3QHWA 3DV3A 3P08A 3BL9A 4II5A 2XUUA 3A99A 5CWZA 5HESA 1CDKA 2QU6A 3FLNC 3ZO4A 3W8QA 4AGDA 4MYGA 4F65A 3F3VA 3PJ2A 4AN9A 3FI8A 3UIUA 5HCZA 5IF1A 5DG5A 3UZTA 1YOLA 2CPKE 4LRKA 1JSVA 3R7OA 4AWIA 4BKYA 2QR7A 2WU6A 1JQHA 3EKKA 1G3NA 4CMTA 4F9YA 3SQQA 4BVUA 4RFYA 2YM5A 4DEGA 5BVKA 2F7XE 3IW5A 3FZOA 4YURA 4ZLYA 2Q83A 3NUAA 2Z7RA 3HV7A 3NCZA 4RQKA 5FEDA 4IZ5A 3TUCA 5BPYA 4BCIA 4BTMA 4RIXB 1F0QA 5HX8A 4U8ZA 1M14A 3GCPA 3MH3A 4MKCA 4BDKA 5CAQA 3RP9A 4UY9A 2C3IB 2X4ZA 2YIQA 4ALUA 5GIOE 3PIXA 2WEVA 3R1YA 3RHXA 5CNOA 1J7IA 4O86A 4DBXA 2XM9A 3MB7A 4IWPA 3G9LX 5A4QA 5I9ZA 1IA9A 4HYIA 1GZNA 1P4OA 2CJMA 1SVGA 4XP0A 4I4FA 1HOWA 4BFMA 2Y4IB 4PDOA 3VS3A 4IAZA 4QMVA 4FGRA 4JIAA 3U9NA 4X3FC 2J5EA 4U44A 1ZLTA 1YWNA 4K2RA 3E3BX 4N0SA 4WRSA 3WF6A 3PY3A 3ZSHA 4EK3A 3O8TA 4X3FA 2IJMA 4YNEA 5E8WA 1DM2A 3DFAA 4I41A 1XH4A 2XJ2A 5HVYA 4A7CA 4RC3A 4EZ3A 5CEOA 4PPAA 4AGCA 3PFQA 1SNXA 3E7VA 4LFIA 4TTHB 3I0OA 3FXXA 5CXZA 5CSVA 2C68A 5CNNA 5JZNA 5HOAA 4EJ7A 5F94A 3DOGA 3F3UA 3LQ5A 3ZU7A 2RIOA 4BCPA 4YTCA 1U59A 2ONLC 2VX0A 2WQMA 4JBOA 3S95A 4I5CA 4IWQA 3PXRA 4OGRA 2IVSA 2X2KA 3CGOA 4EH2A 2ONLA 3KVWA 4CKRA 2E9UA 4XEYA 4WNPA 2GFSA 4O0VA 1H28A 4EK5A 4KIKA 4CFUA 4XOZA 3ERKA 3N4VA 3ZSGA 2BCJA 3NW5A 2R2PA 2B54A 2B9JA 3F61A 3LPBA 3GCSA 4K18A 3UDTA 2HY81 2ZMDA 3BGQA 1Q61A 2FVDA 3CPBA 3RPVA 1CKJA 3MH2A 4Q9SA 4YHFA 2YWVA 3AGLA 5M06A 3CCNA 3W8LA 3BYSA 2B7AA 2C5OA 2BVAA 3DGKA 1UV5A 5K5XA 4LMUA 5ETCA 2HOGA 2PUNA 4M8TA 2GSFA 2JKMA 2XB7A 5F4NA 4DITA 2PYWA 1Q41A 3AG9A 1VZOA 5L4QA 1IRKA 4NFMA 4TNBA 5HLWA 3W18A 5GJFA 3V3VA 3QQLA 3Q9ZA 5TOZA 3LMGA 1JOWB 1YW2A 3D5XA 4FV3A 4TW9A 3WARA 1YI4A 1AD5A 2OJ9A 3R2YA 2BAQA 1OL1A 1QL6A 3R0TA 3BQCA 3N9XA 4CFFA 4EONA 4Z7GA 3N4UA 5AP2A 2OIQA 2PL0A 2R3PA 2W17A 4EWHA 4AXDA 3W2SA 5AUVA 4FZDB 3BLRA 2HCKA 2VTSA 1XH7A 3ELJA 2ZJWA 4G17A 4KIOA 3HUBA 4XG4A 3G33A 3AMYA 4L46A 4P4CA 5KMNA 1VEBA 1Y6BA 1Q5KA 2FYSA 4FV9A 3ZZWA 3PVGA 5FWKK 3VUIA 4C4EA 2VWUA 5DRDA 3DQXA 4W4VA 4IIRA 1JNKA 1NXKA 5HNBA 2VUWA 2YM3A 4RSSA 3VQHA 1P4FA 3RALA 4TY1A 4EQMA 2HK5A 3UVPA 4C36A 5EFQA 1URWA 3QGWA 3RPSA 4WOVA 1TQPA 3DNDA 2YCRA 4O0UA 4WD5A 4O0SA 5HCXA 3ZSIA 4IQ6A 3DNEA 2E9NA 3FLSA 4D9TA 3W2OA 2SRCA 3LJ2A 5J9ZA 3QZFA 4XG2A 1JPAA 2YWPA 5M53A 2ERZE 4NFNA 3V6SA 3SG8A 2PMOX 1ND4A 3ORTA 2EVAA 2J51A 4F70A 4RX9A 2W1DA 2CKEA 4RJ4A 5IDPA 3RPYA 3DAKA 4MEDA 2WKMA 4YBJA 5EW8A 2UVXA 3POZA 5FQDC 5B2KA 5KX8A 3REPA 3D5WA 3PP0A 4C8BA 4F9BA 3PPKA 3FLWA 4GT3A 4IB3A 2BPMA 4HYSA 2GDOA 1H08A 2X4FA 4ZSJA 3PVUA 4ITJA 5AUZA 2J0IA 3V8TA 4BBEA 4O7SA 5HIEA 3TV6A 2YCSA 2BFXA 2PTKA 5CF5A 4MXOA 3U51A 4DINA 1WBVA 2GS2A 2P3GX 5FP6A 5CAUA 3QLGA 3C4CA 4R3PA 4QP9A 2UZLA 1MRVA 2GQSA 4TT7A 1FVVA 1YI6A 1U5RA 5EM8A 4PMPA 2XRWA 1PMVA 3ORXA 2RFSA 3PSCA 5EDQA 3RAIA 1REJA 2YCFA 3Q53A 2PSQA 3C4EA 4KABA 3R9DA 3V8WA 3BBWA 4ASDA 4H3PA 4ZMFA 1WFCA 3ACKA 5IQBA 4U42A 2Z8CA 3CD8A 4PDSA 4I6LA 1Q8UA 3TT0A 4MBLA 3WZUA 4UMUA 2CGXA 2X0GA 4EH8A 1Y6AA 3QUEA 3AC5A 4QP6A 4AOIA 4RBLA 2HWOA 4EH7A 3H4JA 3NCGA 4J98A 1A06A 4BHNA 2QOCA 4HGSA 4YLJA 3JS2A 2B52A 3OOMA 4G1WA 1R0PA 3MESA 3C50A 3U54A 1PHKA 2ZV7A 5HNIX 4D4VA 4DH7A 3QTXA 4IM3A 2GS6A 4C4IA 4X3FB 2GNHA 3V04A 3LFFA 4UZHA 2GFCA 2QODA 3R7YA 2C5VA 3FKNA 2QONA 3F3TA 1NT2A 2BFYA 3L8VA 5E8ZA 1RQQA 2VTMA 2C6MA 4JOAA 3SOAA 3FZ1A 4ANSA 1PKDA 4FKLA 3UODA 4F99A 3PZHA 3R8VA 2BTRA 2Q0NA 4NWMA 1OVEA 4EZ7A 4D5HA 3D15A 4IJPA 4JL9A 3GCQA 3WI6A 3LMIA 4FL1A 4R77A 3ZS5A 2C6TA 2BRBA 2CSNA 2VX1A 4TWPA 4C58A 1QPJA 2G2HA 5ANEA 5EH0A 3ZMMA 4GJ2A 5JGDA 2WELA 2BKZA 3DBEA 2YERA 1OPKA 3CQUA 3HMNA 3E62A 4GEOA 4TYHA 3LKMA 2QO7A 2QR8A 3QXPA 3DKCA 3ZXZA 2H8HA 4DEHA 3KCKA 5LVMA 4AFJA 1M2RA 2EUFB 4U40A 3NWWA 4HGLA 5C4LA 5HE3A 3P9JA 5CZIA 2O5KA 1BUHA 4DGNA 4BCGA 4G31A 3AT3A 4AZEA 1EH4A 2GNJA 2XK9A 3NW6A 4FKIA 1PXNA 3PIYA 3R8PA 1T45A 3RCJA 5IA5A 4DGGA 5IH4A 4FK6A 2FGIA 5D41A 4ZSEA 3VNTA 4DFZE 3O8PA 2XH5A 4M14A 3TV4A 5A3XA 4KSQA 4DFNA 4UN0C 1UA2A 2RKUA 4ZTQA 3NVKI 1K2PA 2G01A 3ZONA 3VN9A 3NYNA 5ETIA 5AR3A 5HKMA 4BY9E 3ZH8A 3AKKA 4TRLA 5JSMA 2B9HA 3DBFA 3NGAA 3NRMA 4D4SA 5GINE 4ZTLA 1P14A 3O71A 5IQHA 2CLXA 1KE6A 1W84A 3TI1A 4DA5A 2YDJA 3TIZA 2J0MB 5CQUA 4DAWA 2YIWA 1GAGA 2ZM1A 4UXQA 4BCNA 5M56A 2YEXA 2YAKA 4QMUA 4EHVA 5JGAA 5AA8A 4AE9A 2IW9A 4OR5A 2C69A 3NMUF 4UMQA 4J95A 1XWSA 4M67A 2VTJA 4NTTA 3G0EA 3EQFA 2QU5A 2QCSA 2Z7LA 3TN8A 5I5ZA 4JR3A 2XCHA 3ROYA 4Z55A 4X21A 3EHAA 3A7GA 3IGOA 3UMXA 5GZ8A 4GH2A 4DFUA 2O0UA 4WG3A 4GMYA 2R4BA 4E20A 4LI5A 5A6NA 4YLKA 5J5TA 4JLCA 5KMMA 3S00A 3OWLA 3QA0A 3IS5A 4HVGA 2Y6MA 2XYNA 5CU2A 3DK6A 5D7VA 4CQEA 3ORKA 4R7IA 4Y73A 2C0IA 3LM5A 4FV2A 4EKKA 2P55A 2R3LA 3EQGA 1UU8A 1WCCA 4XHKB 1BX6A 4MBIA 1GIHA 2FSTX 4JQ8A 4YTHA 3DJ5A 3BEGA 5BNJA 2F2CB 1FGKA 3JY0A 3ZEWA 4B8MA 4E6AA 5L2SA 1Q4LA 4QDVA 2XNOA 3PLAE 4QD6A 2VU3A 4AA0A 3CQWA 1OECA 2VO7A 4KBKA 4MXXA 3KF4A 4FKPA 2O8YA 2ZM3A 5J87A 4RX8A 3SLSA 4NEUA 3GU7A 4U43A 4XRJA 1TQMA 1NVQA 5ANIA 3U6HA 1OUKA 2HXQA 1YHVA 3JUHA 5IEXA 2YDKA 4DTAA 1W7HA 3E7OA 3MBLA 5LWNA 3ALOA 4PNIA 5EDPA 5AP6A 4GJ3A 5KCVA 2ZYBA 1PY5A 1OI9A 3MJ2A 5E92A 3GCUA 2OH4A 4UXLA 3SDJA 2GMXA 2BZKB 2XKCA 3OTVA 4L7SA 5K0KA 5TO8A 4D2TA 1Y8YA 5A4TA 2PZPA 3FY2A 4C3PA 1LPUA 3GC9A 3VBYA 3G15A 5IPJA 4D1XA 5DVRA 5DEYA 4QMPA 4BGQA 4L42A 3KXHA 3C4ZA 4GIIA 3Q5IA 1XH6A 2BHEA 4C02A 4OBQA 5HG5A 3V5WA 3I6UA 3MJ1A 3FYJX 4DG3E 4DFXE 4IADA 1KUTA 1JWHA 3GFEA 1MRUA 4K77A 2XBAA 4JNWA 2ZMCA 2BHHA 5EG3A 2W1EA 2C6EA 3KL8A 4HZRA 4XJ0A 3UOHA 5KMLA 2G2IA 2Y6OA 3LJ0A 5HTCA 4QT1A 4U79A 4EOKA 2UZNA 3ZM9A 4DE4A 4KA3A 4RJ8A 4XMOA 3UBDA 4CG9A 4C62A 3OF0A 2H34A 3DLZA 4CLJA 2ERKA 2C47A 5GZ9A 4EHGA 4GUEA 4IX5A 3ZRKA 3Q52A 1OKYA 2R5TA 3QRUA 5C8MA 3GBZA 2XAOA 1OIRA 5DIAA 3FYKX 4BDIA 2X0QA 2F7ZE 5DR6A 3V5PA 4M7IA 3HMOA 4RA4A 1WBTA 3R04A 3Q2JA 1CKIA 4IC7A 4ZSLA 4L9IA 4IAKA 2X6EA 4BIBA 4EK4A 3RHKA 2PVFA 2QOFA 5JMSA 5E91A 2BRGA 2W96B 4FSZA 3ZO3A 1HCKA 3E8EA 4GU6A 3LMHA 5IQGA 3B8RA 2J2IB 3D0EA 3QQGA 3NYXA 4XBRA 4FIHA 3UOLA 4FKOA 4D2RA 5CI6A 5IMEA 4MH7A 4ZJIA 3MPTA 2XKFA 3RWPA 3ZOSA 3BCEA 4R1YA 5M57A 4WIHA 5M4CA 2ITOA 2WFYA 3HMMA 3NUNA 3R63A 1GJOA 3E93A 4IDVA 2NP8A 1XMMA 1GIJA 3VULA 3ZFXA 5L6OA 3IW6A 3NNXA 3AGMA 3IW8A 4YZBA 5CF6A 3COHA 4U3ZA 2HZ4A 4O96A 2WU7A 4AT3A 4X6QC 4BC6A 3VW8A 4ID7A 4MHAA 2VWZA 2YIXA 1ZY4A 2J0JA 3I7BA 3OWJA 1XMLA 4JS8A 3GB2A 3NZ0A 2ZB1A 3EZRA 3VBVA 5IH6A 5AUTA 2LGCA 4QMQA 4PL3A 4C57A 4IB5A 4MUQA 5ACKA 4O0RA 3U8WA 4BTKA 2V7OA 3ZDUA 3W0PA 2ITQA 3QQKA 4IWOA 2PMIA 4I22A 4GUBA 5FD2A 3VWAA 2UW4A 2GNFA 3PXZA 5DWRA 4RX5A 5JFXA 5KMKA 5M07A 4FG7A 1XKKA 2JIUA 3BHHA 4UWYA 3S1HA 4V05A 1YXUA 2W0JA 3MFTA 2UV2A 1U54A 2DQ7X 4QNAA 4CMUA 2YITA 3FC1X 5HGIA 5IQEA 4RIYA 4APCA 4BKJA 2XK8A 3LIJA 4HPTE 4XV9A 1KE5A 4FKQA 4QMTA 2BRMA 5KHXA 3NEWA 4G9RA 5LCKA 4YZMA 5AUYA 3P86A 2JEDA 2RG5A 2W5AA 2WQNA 2BIKB 2X39A 4EYMA 4M68A 4C4HA 4MVFA 3MYGA 4TWCA 3Q4UA 3PTGA 4UALA 3BLQA 3F7ZA 1FBNA 2XBJA 4G34A 3PSBA 2UW8A 5TT7A 3SRVA 3EFLA 3GU8A 5EKNA 4ZTSA 3QX4A 3W0OA 1YOJA 4IWDA 1LEZA 5GIPE 3VBXA 2R7BA 4E8AA 2IEWA 4ZK5A 2XNMA 4O0TA 3BI6A 2GHLA 3WF5A 1XO2B 3I5NA 3UDBA 2JIVA 2F9GA 4YZ9A 2I0EA 3LOKA 4S34A 1YHSA 4FTCA 4L01A 4WUAA 3KIOC 4JG7A 4OTQA 5HBHA 4CCUA 4I6QA 2C1AA 5AV2A 4Y5QA 4BBMA 3FMNA 3F3WA 3LCKA 3NUSA 5JZJA 2FUMA 3A7HA 2W1ZA 4RWLA 4KS8A 2FO0A 3O96A 4K6ZA 3COMA 3PY1A 4YC3A 2AEGA 2VWXA 5KKRB 1QMZA 5J95A 3FXZA 3ZBXA 4EBWA 3MPMA 4RWJA 2X8IA 2R7IA 1ZOEA 2QLQA 3NUPA 5J1WA 4P5QA 3E63A 4FL2A 4LMNA 2X7OA 4ERWA 4BWPA 5CAOA 4XLIA 4F9AA 3HAVA 3FMLA 2EU9A 4FTOA 1ZXEA 4KBAA 3T9TA 3VRYA 4CV8A 4I94A 4DLJA 5JK3A 2XYUA 1M52A 4R8QA 1R0EA 3KRXA 4JBQA 3TZMA 3DBDA 2YCQA 3LAUA 4GFMA 4JRVA 4KSPA 4O38A 5GJDA 4AOTA 4KS7A 1H00A 2YDIA 4MXCA 4NM5A 4FKVA 3QTUA 1ZARA 3QGYA 1Z9XA 5D10A 2QD9A 3POOA 1Y57A 3LLAA 5M55A 1ZWSA 3L8PA 3MY0A 3QZGA 2QKRA 5IUHA 3RK5A 3HDMA 5DT3A 5J1VA 1L3RE 2YAAA 3HA6A 3UC4A 3LFNA 4AZSA 3QTZA 2W4JA 4XG3A 2WMVA 4R5YA 4RZVA 2WNTA 3ETAA 4Y85A 4YPSA 5LMBA 3OT3A 4L53A 5M4UA 3W0RA 5BVNA 4AXAA 2Y0AA 4ALVA 4KRDA 4K0YA 3FI3A 2JFMA 3OUNB 4FV7A 2WTJA 1W2DA 3AKLA 2OZAA 3U4UA 5A54A 2IG7A 3MH1A 1Y8GA 1O6YA 4EOOA 4XLVA 3FWQA 3QUPA 2GHMA 1M7NA 4CRSA 4IDTA 3U6JA 2ITZA 5H8BA 3M42A 1SMHA 1OGYA 4LDTA 3Q6UA 4FEQA 4E6CA 3VONA 4LUEA 3R02A 2XK6A 2EXMA 4RPVA 4L00A 2IVVA 2CGWA 2WOUA 4R3RA 3WIGA 3ZO1A 5AUWA 4FJVA 1H1RA 4B4LA 2W5HA 2GQGA 3H0YA 5TE0A 1TFFA 5BVWA 3W2QA 3SD0A 2GNGA 4X2GA 5AV0A 4FTTA 3I79A 1OBGA 2CN5A 2R3GA 2AQXA 3VBQA 5A4EA 4IBMA 3LW0A 4IAIA 4D4RA 4FZFB 4AW1A 4F6SA 4Z3VA 3AC8A 4IMYA 4IFGA 3SV0A 5J5SA 3DBQA 3T3VA 5E8UA 2CNVA 5AR8A 4H58A 1J1BA 4DHZA 2P2IA 3Q96A 5DEWA 4NJ3A 3JYAA 3OUKA 3EN7A 3TDVA 2W06A 4LOPA 2CDZA 2XNBA 3VS7A 3R9RA 4AXEA 2X2MA 3KQ7A 4FSQA 4M12A 3GFWA 4PL4A 3DS6A 4FGBA 5ETAA 4I6FA 1KV1A 2HZNA 3BQRA 4PX6A 5J9LA 4E7WA 1A48A 5EI2A 2G9XA 3DFCB 2IZSA 4CTCA 3ANQA 3FKLA 3LFEA 3OD6X 4O2ZA 4RC4A 4XG6A 5LOHA 4I0TA 3F2RA 3GOKA 1FGIA 3D7ZA 4BIEA 3NS9A 5AEPA 4Q9ZA 4CFXA 3ZM4A 2HY0A 3FMHA 5HX6A 3PPZA 4FIGA 4MD9E 4QP1A 4YJVA 4BZNA 3LCTA 3CTHA 4I3ZA 4HZSA 5F20A 1M2PA 4AN3A 3B2WA 1FOTA 3F5GA 4EH9A 3FUPA 5CSXA 4Q5HA 2O2UA 4EEVA 3D7TA 2IZTA 3AC2A 3H0ZA 4JG8A 3BE9A 3QD3A 1Q99A 3QTWA 2VTPA 2ZDTA 3IDCA 4FEWA 1FVRA 2P0CA 1XBBA 3FQEA 3DK3A 4QRCA 2Z7SA 3MY5A 5JGBA 2HENA 4ZP5A 2DWBA 5HTBA 4NUSA 3AXWA 4RJ6A 3VUDA 5HU3A 1AQ1A 3D83A 3F5XA 1YI3A 3O7LB 2W4OA 4NK9A 3C13A 2YM7A 3QRKA 4QQCA 4RMZA 5BYZA 4ITIA 3UC3A 4B8LA 3FSFA 4QYHA 5ANDA 4PMSA 2HXLA 2WB8A 3NNUA 5D9HA 4TKSA 3AMAA 2XIRA 3BX5A 4JQEA 5J8IA 3SKCA 4WNKA 4DBNA 4NIFA 3F2NA 4OT5A 4X7QA 4XV1A 4LL0A 3TZ8A 1JBPE 4K8AA 4ITHA 1NVSA 1BI7A 2EXCX 1ZRZA 4BWKA 4CD0A 4D55A 4EHEA 4Z9LA 2R0UA 4O6LA 2VD5A 3LCDA 5L2IA 2IPXA 4NH1A 5EHYA 5BUJA 3PG1A 2YJSA 3Q4TA