3ZLYA

Crystal structure of mek1 in complex with fragment 8
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
343
structure length
310
Chain Sequence
LELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Use of Virtual Screening and Differential Scanning Fluorimetry for the Rapid Identification of Fragments Active Against Mek1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE KINASE 1
total genus 100
structure length 310
sequence length 343
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2013-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zlyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zlyA01
5AUWA 2G1TA 1UU8A 4RWIA 5JEBA 4YO4A 4P2KA 2GNGA 2WMXA 3LFSA 3VUMA 1UKHA 4DH7A 3KRXA 1PXJA 2R3IA 4PDPA 2E2BA 5DT4A 1WMKA 3Q96A 4AA4A 3A4PA 3PJ1A 4YHTA 4TZRA 5IUIA 3H30A 4V01A 4Y95A 4DGGA 5H9BA 4WKQA 5CEMA 1YRPA 2J5FA 2B9IA 4FVQA 4BI2A 4U81A 1YVJA 2G2IA 3ALOA 3VRYA 4H05A 3IGGA 5EK7A 1YOJA 4WHZA 4L7FA 3ZC6A 2C5YA 4O38A 3PSCA 4F08A 4E4MA 1Y6AA 2JFMA 3ZU7A 1MRVA 2QLUA 4W4YA 5CY3A 2VWXA 2IW8A 3W16A 4C57A 5JGDA 1XKKA 4U41A 4X3FC 3AGLA 3AC2A 4XG9A 4CZUA 3RPSA 4E93A 2XYUA 5AX9A 4PDOA 4S30A 4EH9A 3VHEA 3PVUA 5J1WA 4HW7A 4EH8A 3E3BX 4Z3VA 4QMOA 4GIIA 1RDQE 3C1XA 3P5KA 4IJPA 2BHHA 3P86A 3AC8A 5EHLA 4BCPA 4HYIA 4EH6A 5CAUA 3EN5A 2GFSA 4ZTMA 1GZKA 3QKLA 2WTWA 3IGOA 2PUPA 4I93A 4K2RA 5ANGA 4DFZE 3TUCA 4BHNA 4RA5A 4F99A 4NH1A 5IQCA 2X1NA 3Q2JA 3W2CA 3ZEWA 4FV1A 3PXQA 3QZHA 5CZHA 5DPVA 4EH4A 2WMBA 5AUUA 4QMNA 3Q6WA 1XBAA 4MNEA 5BYZA 1FMKA 4KKHA 3HRCA 5BPYA 4L6QA 4JQ7A 4ZXTA 5HD4A 4PY1A 1J1CA 4RSSA 5FXRA 2QO7A 4PL4A 5J8IA 4FSWA 4ACMA 4BCOA 4I22A 4FBXA 5FM3A 3F5PA 3G9LX 4WD5A 3PXRA 3UG2A 4AXAA 4IB5A 4Q2AA 4BBEA 4B8LA 5HCYA 4YHFA 2BRMA 2B52A 2XCHA 1IG1A 4FIHA 5KMOA 3C4XA 3WF7A 1I44A 4BCNA 4TWNA 1NVRA 3QA0A 2W7XA 3A99A 3OWJA 4KBKA 4L00A 4YJTA 3CLYA 4ZMFA 5A4LA 4EWQA 5IDPA 5CU0A 2OW3A 2VTJA 3AC3A 3DZQA 3VJOA 1VZOA 2B54A 2W96B 3L8XA 4U3ZA 3TI1A 4QO9A 2W5AA 3HEGA 1V0BA 3FKLA 3LCSA 4M97A 4OTDA 5JKGA 2ZV9A 1ZMUA 3A7FA 3P1AA 2ZM1A 4FIFA 5JRSA 2QOCA 4BBFA 3DV3A 4PL3A 3QGYA 3QCQA 4XG6A 4RC3A 3R0TA 4QRCA 4YZNA 3WZEA 4MXXA 1IRKA 5IA4A 3LJ0A 4EI4A 2OG8A 3UZRA 5ETAA 4LRKA 3ZLXA 3NNVA 2ESMA 2DWBA 2YWPA 5DLSA 4GUEA 3R9DA 4K0YA 3BHUA 1M14A 4U7ZA 2GQSA 5BMMA 2XZSA 3LE6A 3C7QA 3FPMA 3WILA 4XV2A 4JG7A 3JY0A 2LAVA 2EVAA 4QP3A 1SYKA 1Y6BA 3PPZA 5EHOA 3AMAA 5JZJA 3OP5A 2YISA 4F7JA 3ZO2A 5AAFA 3MIAA 2EWAA 4OTGA 3UO5A 4GL9A 3W8QA 5C4LA 3UG1A 4XG4A 5IDNA 3IKAA 2WIHA 4M3QA 5FTGA 2PUNA 2I40A 2OZAB 4LGHA 3CKWA 1FGIA 4DH8A 5HNBA 2YACA 4AG8A 2I1MA 5AIKA 5FUTA 5AR3A 3KXGA 3JVRA 4FUXA 2BCJA 3D83A 4QMYA 3CXWA 5HTBA 2XKEA 2WO6A 3GENA 3TL8A 4Z55A 4KRCA 4EOLA 3R2YA 1H1PA 2HZ0A 2CNQA 3ET7A 4ZAUA 4UZHA 1JSVA 2GNHA 4MQ1A 2WD1A 4U6RA 2WQMA 4UN0C 3OCGA 3L9NA 2HYYA 3ZO4A 1PMUA 1JBPE 4LRJA 3NUSA 4U5JA 3C5IA 5IEYA 4XBUA 3VBXA 3VBTA 2J4ZA 4U3YA 1IA9A 1J7IA 1G3NA 3V51A 3RKBA 5DEWA 4QMPA 5CSPA 2J51A 1J91A 1PXKA 4UYAA 2PE2A 3TUBA 2EUFB 2UZBA 4EUUA 4HPTE 3BZ3A 4IWQA 2X7FA 5D10A 2ZOQA 4FNZA 4NK9A 4AW2A 3GOKA 5KHXA 3Q52A 4Q5EA 4JX7A 3VF9A 4JR3A 2O63A 3OS3A 1OIRA 3CEKA 5LXMA 3SG8A 1OI9A 4Y83A 3NIZA 1OL5A 4FGBA 4S32A 2ZB0A 4DG3E 3MY1A 4UMUA 3RAKA 5FDXA 2C6EA 3FLZA 3C0IA 3I7CA 5BVWA 4AUAA 3R7GA 4AWIA 4FTCA 2PVHA 1L8TA 5AR7A 4X3FB 3PIZA 4YP8A 4BCGA 4JDHA 1H1WA 2DQ7X 3KRWA 3QC9A 3PLSA 5ETFA 3QZIA 3W2OA 4FT0A 2JKKA 2OI4X 3D7ZA 3TIZA 5E8SA 3LVPA 5I9XA 2XKDA 4FNXA 4RZVA 4M66A 3S4QA 3SD0A 5KO1A 2RGPA 3UVRA 4DYMA 5D41A 3IQ7A 4DAWA 1QPJA 3COIA 5AUYA 2B55A 3SKCA 4MYGA 3THBA 2R3FA 3BGQA 5IA1A 1SM2A 2JDSA 2YM3A 3CQUA 4PL5A 5DEYA 3VS4A 4BICA 3F5XA 4HOKA 4NKAA 5CYIA 2C4GA 3QC4A 3ZDIA 3ATTA 3DAEA 4PWNA 4RG0A 2JIVA 4IH8A 4FX3A 4AGDA 3DXPA 4GW8A 4BDGA 2EXCX 4XHKB 3JPVA 1ZYCA 1TQPA 5DIAA 3W10A 4O6EA 3F7WA 3TKHA 3U6IA 4L43A 4BWPA 2YEXA 4D1SA 3CKXA 4EL9A 2X39A 5M4IA 2C6OA 1Q62A 3K54A 1W84A 4ZS0A 3RJCA 3ZUUA 2BAJA 3PVBA 3Q9WA 4HCTA 4ERKA 3R01A 5GIPE 4I5MA 2XVDA 4D5KA 3S95A 4RX7A 3SVVA 4NYEA 5GZAA 4GFMA 3MFTA 4BYJA 3V5PA 4C58A 2F7XE 3P7BA 4QP2A 2GHGA 2UUEA 3B8QA 3BU3A 4C59A 1FQ1B 3BYUA 4YC3A 4R7HA 2RFSA 4AE6A 4BIDA 3KREA 1YHVA 3LMHA 1KE8A 2WQNA 3GT8A 5EOBA 4A9SA 2ITOA 1YWNA 2X8DA 3QXOA 5BVNA 3LAUA 4GK3A 3CD8A 4ZK5A 4XP2A 4BDEA 3BGZA 4U79A 3GFEA 4PPAA 5L2IA 3JS2A 4Y85A 1U46A 3BGPA 1OVEA 2XA4A 2YAAA 2VTAA 2VTOA 1APME 4R5YA 5HO7A 3KQ7A 3CTJA 5J5SA 2H8HA 3OY3A 4J1RA 3EQHA 2PE0A 5CQWA 5DVRA 1ZZLA 4C33A 4EQUA 4QP7A 4W9WA 3ZZEA 3PY0A 2XNGA 1UU9A 3QD4A 1ZMWA 2WMRA 3FXWA 4EC8A 2R3NA 4KB8A 3KB7A 3BPRA 4W9XA 2VX0A 3CTQA 3M1SA 5DOSA 2R3MA 4DN5A 5CANA 2CLQA 3GB2A 3GP0A 3WZDA 4C7TA 1Y8YA 3R73A 2PZPA 3GVUA 2KULA 4F1MA 1WBSA 4BDBA 4EK6A 1F0QA 1WBNA 4OTHA 4PNKA 4UMPA 5GJGA 3QTXA 5I9WA 3B2TA 3BQRA 2XIKA 3VS1A 2CKOA 4WNMA 3GCUA 1Q24A 4K1BA 5IA5A 3O50A 2WFYA 4FEWA 3QTUA 2QOQA 3EYHA 3K2LA 4MF1A 4E20A 3F9NA 2ZV2A 5M56A 4TWOA 4FV3A 4I21A 5TR6A 3TJCA 4YLJA 2OJIA 3ENHA 1VYZA 1YXSA 1OBDA 4I6FA 1KSWA 4QQTA 5AAEA 3ZS5A 4JQEA 3OT8A 4BDCA 3FE3A 4XS2A 4K9YA 5C1QB 2GFCA 5A4QA 5I9VA 4YTFA 1ZOEA 3F3UA 3BYSA 4RQVA 4CYJA 4FYOA 2QHMA 2W5HA 3R30A 3ANQA 1UU3A 3RALA 4OTRA 4YTHA 3AD6A 3E5AA 4LOPA 2JKQA 2VWWA 4I6HA 4YJNA 2RFNA 2X4FA 3C9WA 4UB7A 5FLFA 5CASA 4ZLZA 3NIEA 3VC4A 4GFGA 3D9VA 1Y57A 2QCSA 3ANRA 3RPVA 1NVSA 2OJ9A 1CM8A 2CGWA 2W5BA 3KGAA 1YXTA 2Z8CA 2C47A 3LOKA 2WIPA 1KE6A 2F9GA 4FV8A 4IFGA 4FEXA 3PZHA 4KS7A 3NDMA 3QCYA 2UVZA 2HZ4A 4EKLA 3R9HA 3V5TA 5EI6A 4D4YA 2X4ZA 1IR3A 2OFVA 3QWKA 3EQIA 3R8ZA 5JGBA 2X2LA 1R39A 4EZ3A 3U9CA 4Q9ZA 4U97A 2R64A 2XUUA 2RFEA 2C6TA 3BQCA 4I5PA 1KOBA 2FYSA 3UOKA 4BY9E 3ZRMA 3HAVA 4M69A 4D9TA 4I1ZA 4M84A 4O21A 3BX5A 4KD1A 5CU4A 1UNHA 4ZSLA 3TV4A 3U51A 4TN6A 4F6UA 5E92A 5AP1A 3TNPC 3GCVA 3OBJA 2QKRA 1M17A 3F69A 1YDRE 1H26A 3BU6A 3F88A 1QPCA 3EQBA 4MNFA 4ZZMA 3UMXA 3NYXA 5C8NA 1MQBA 2R9SA 3VN9A 5DHJA 2YJRA 1PXIA 4FE2A 3BWFA 5ANKA 2YIRA 3AOXA 3DBQA 1G5SA 2W17A 3PY3A 1ZRZA 3RPRA 5KMIA 3QZFA 1H28A 3KY2A 4HVIA 5HKMA 2PTKA 3BHHA 4GKIA 4WA9A 3PIXA 5K4IA 1H0WA 4PPCA 3PWDA 4RQKA 1Z57A 3LPBA 3NNWA 3MH1A 3PE1A 5AMNA 5CI7A 2EB3A 4IAFA 4C4FA 3LMGA 4RFZA 5M4CA 2X0GA 2I0VA 3QRIA 4WNPA 4DGMA 4H1MA 4QNAA 3ZXZA 1Z9XA 5F94A 3SHEA 3V04A 4LOQA 4QTDA 1VR2A 4FKGA 3HMNA 4YO6A 2VD5A 3TT0A 3VULA 2R4BA 3DK7A 4AW0A 1Q97A 2PUUA 3FQSA 3E7OA 4IVAA 3R7UA 3CD3A 4DA5A 3SLSA 5JFXA 5AR4A 3WZUA 1ZZ2A 2XJ0A 3NS9A 1H0VA 5D11A 3VS6A 3IK3A 1R1WA 4FV7A 3O7LD 4D4VA 3EQCA 4JL9A 4RC4A 2XYNA 5DA3A 5EI8A 1L3RE 4C38A 4XUFA 2UW5A 4HZRA 2W9FB 2VV9A 3DTCA 4JJRA 3SXSA 4FV2A 4G6OA 3G0EA 4DEBA 2QONA 4YSMA 3WF6A 4XX9A 3BYMA 2A0CX 3DJ7A 3I5ZA 5KKRB 4ZTQA 1YWVA 2UZDA 3OXTA 2X7GA 3UIBA 4APCA 3SA0A 3R7OA 3UVQA 3GBZA 1NXKA 4NFMA 3SQQA 4BF2A 4EOMA 4FIJA 1NVQA 5FD2A 4CLIA 2XNPA 5HGIA 3FXZA 3A7JA 4RX8A 4J7BA 4A7CA 4FZAB 2W4OA 2W1GA 5H8GA 5KNJA 3GOPA 3HV3A 5HHWA 5JFVA 1PKGA 2WTIA 3S3IA 3KXNA 5HLWA 3OY1A 4TRLA 3BCEA 4XOYA 2UW7A 4EOPA 4F65A 2GS6A 2BRNA 4AP7A 3D0EA 4LOOA 1W0XC 5AIRA 3DLSA 3EZRA 3H9OA 3LCDA 5LVMA 3BLHA 4N6ZA 4QYEA 5E9EA 3PA3A 2ACXA 1M7NA 5CEOA 4I5HA 4YTCA 2WTKB 2Y6OA 3R6XA 3L8SA 4FA2A 4IAKA 4ZSEA 5M51A 4YJPA 5I9YA 5IQIA 2WEVA 4F0FA 1S9IA 1YOMA 4BTKA 4AX8A 4HJOA 2C0IA 4AA5A 1JKSA 2HOGA 4WT6A 2W4JA 4F9CA 4EQMA 3EQPA 3PZEA 1AGWA 1XBBA 2HY0A 4MCVA 5A6OA 2VO3A 3D14A 3IG7A 5DMZA 2XNNA 2R3RA 3PVWA 3ZOSA 5E1SA 4PF4A 2QG7A 2JDVA 3UYSA 4FYNA 3SDJA 3BU5A 4EHEA 3R9RA 4IADA 4IAIA 3H9RA 4EK4A 2RG6A 3UVPA 4LMUA 2J2IB 1I09A 2UVXA 3NNXA 1SVEA 2O5KA 1OPJA 3Q2MA 1JPAA 1BLXA 3FZRA 4UY9A 2PZRA 3ZFYA 3NAXA 4FV0A 4TT7A 4BZOA 1GJOA 3CS9A 4W4WA 2C6LA 5JGAA 1Y91A 3EKNA 3VUDA 2Z60A 4B8MA 3FKOA 4FG8A 2VTHA 4RC2A 2ETKA 4JDIA 5HESA 5LMAA 4A06A 3N4UA 4RGJA 4EOSA 4IX3A 2ZM4A 2ZM3A 2OIBA 1YXVA 2IVVA 4N70A 3V6SA 4CD0A 4EOQA 3U6HA 2VTLA 4KBAA 2Z02A 5EQYA 2XIZA 2P3GX 4JIAA 4MD9E 5DRDA 2OJJA 4PRJA 3DJ6A 3VS3A 5I4NA 2X81A 5AV3A 1B6CB 1WVWA 3E88A 4F9BA 1YHSA 2UW6A 3R1QA 4G5JA 4I4EA 5I9UA 2YCSA 4HGSA 4EOKA 4L68A 5M4UA 3MTFA 5CQUA 2IJMA 4JLCA 1GZOA 3R9NA 2BZHB 3ZLSA 2YN8A 2XIRA 1H1QA 1KE5A 1WBPA 4YLLA 2CGXA 3EYGA 2VWBA 5BVFA 3BEAA 4OTQA 5IKWA 4Z7GA 2QODA 4IFCA 3FC2A 4HGEA 4CRLA 5HIEA 4IZ5A 3DNDA 5EM8A 4AN9A 5KMJA 2FA2A 3L9LA 5D1JA 1STCE 2RL5A 3FV8A 2FGIA 2GHMA 4D58A 3R8MA 3VUKA 2XBJA 3VIDA 3UMWA 3AG9A 3VBQA 4A9RA 3RZBA 4FSRA 4M67A 5CENA 4TL0A 3R28A 4F4PA 5IEXA 3ZM9A 4I92A 4IQ6A 4OAVB 4UALA 1ZWSA 4RIXB 2HZNA 4YJVA 5HLNA 2XK6A 2J5EA 2R3KA 3HV6A 4OBQA 4QT1A 4QTCA 5JSMA 2C6DA 4O2PA 3TG1A 4GYGA 3KXHA 2UW9A 4FODA 3OW4A 1ZYLA 3AMBA 4A4XA 2XNEA 1KV1A 3ZLWA 4DC2A 4HCVA 1M2RA 2X9EA 4IWOA 4O1OA 4R3PA 4TWCA 4FI1A 5CT0A 2YDKA 4K33A 4ZJIA 3MW1A 3FPQA 4BCMA 4D2TA 4O81A 2YABA 3VS0A 4CXAA 3HUCA 5ANIA 1W8CA 4I0SA 5HG5A 3JVSA 5K4JA 1IASA 2W99B 1Q99A 3QKKA 4NUSA 3ODZX 3RCJA 4EOIA 2AUHA 4V05A 4XMOA 5GJDA 4D4SA 1Q8TA 3VF8A 3TN8A 3R8UA 2W1EA 4RJ4A 5DNRA 1DI9A 2UW8A 4I24A 4MKCA 4XRLA 4USFA 2X6DA 4WBBB 4DFXE 2WMQA 4FG9A 3QL8A 4J8MA 4FG7A 3W32A 1UVRA 3C50A 1K3AA 1BL6A 5KHWA 2RSVA 4FZFB 4C4GA 3QX2A 4FSZA 3UQGA 5BVOA 4FT3A 4LUDA 3NCGA 1BI7A 2NRUA 3FL5A 3MH3A 3G51A 4MWIA 3VUGA 2QQ7A 2XIYA 4KIQA 4UZDA 5H2UA 2OLCA 5IQGA 4HGLA 4JG8A 5BVEA 4DH3A 4Y5HA 3UPZA 3DKGA 4UX9A 1U5QA 4O27B 3RAIA 3RHXA 5A4EA 2Z7SA 5J7BA 2F7EE 2PE1A 3RBWA 3AMYA 3ZMMA 2C69A 3P0MA 3BRBA 5CZIA 2PK9A 4EH7A 2XS0A 4RMZA 4WSQA 3F3VA 4MXAA 3G2FA 4DHFA 2GNLA 3TDWA 4MXOA 4D2SA 4DTAA 2B7AA 4ACCA 1R3CA 3NUAA 1J1BA 3V5QA 4F9YA 3DA6A 4GK4A 4ALWA 2A19B 2WOTA 2OZAA 5A4CA 2JITA 3OBGA 2XRUA 3VRZA 3Q32A 5CAPA 4L3JA 3G15A 2WMVA 4DT9A 4XV3A 2PPQA 3AD5A 4PUZA 4D28A 3F2RA 5EW3A 2BRBA 2QOBA 4O7RA 3R8PA 1LEWA 2ITWA 4RIWB 1WBOA 3A7HA 4I20A 3ZO1A 4LFIA 2OWBA 3DBDA 1J7LA 4D0XA 3RAWA 3ACKA 5HE2A 3ORIA 4FSYA 4G9RA 4ACGA 2PSQA 4UBAA 5AP5A 3SC1A 4KIPA 2DUVA 3ULIA 4BWXA 5BX0A 3KF4A 4YZCA 4O0TA 1NY3A 5L3AA 5TO8A 3BV3A 4FTRA 4ZEGA 3QU0A 3O8UA 2YIQA 3PXYA 4H39A 3QLGA 5CT7A 3UIMA 3VUIA 1OIYA 2GS7A 5EDPA 4ENYA 2XIXA 3A8XA 4KKGA 3D2KA 4OUCA 3F2AA 3UOLA 5IZFA 2F7ZE 1M2PA 3TZ7A 1BKXA 1X8BA 2RG5A 5FEEA 4X0MA 4PP9A 4C36A 4QPSA 3FLWA 5EH0A 3KMMA 5GZ8A 2IG7A 1YW2A 3QYZA 4ASEA 4XLIA 2YIXA 3HL7A 3L8VA 1DS5A 3Q9XA 4NZWB 1U59A 4ENXA 4FOCA 4QQCA 3O71A 2H6DA 5F20A 1OBGA 4AT4A 1PY5A 1GIHA 3O7LB 3DOGA 4AF3A 5LCJA 3LFFA 4IWPA 2JD5A 3QA8A 4O1PA 5FRIA 1IA8A 3CE3A 2IW6A 4GYIA 5DGZA 2JEDA 4CNHA 4F64A 3FY0A 4P5ZA 2IZRA 4UYNA 4YMJA 4EZ5A 2W1ZA 3GUBA 4KIKB 3WARA 5L6OA 2W1IA 5LVOA 2I0EA 1E9HA 4NIFA 5EKOA 3SOCA 1REKA 4QMSA 4EK8A 4ZIMA 3T9TA 5CU2A 3UODA 4TYIA 3C51A 4OAUC 4E8AA 3PIYA 4NL0A 2VTQA 3EZVA 2XB7A 1TQMA 2VNYA 5E90A 5A14A 3C0GA 2OICA 4FTLA 2QHNA 2ONLC 4LGGA 4XCUA 5EQEA 4FKTA 2JBOA 2J6MA 3OXZA 4AFEA 1UKIA 5L4QA 3E87A 3QHWA 3O2MA 4FV6A 3Q53A 4G3GA 4A4OA 3FLNC 5CEQA 4U8ZA 3COHA 2QG5A 3NVKI 3ZHPC 5M57A 5IH5A 3UP2A 4HVSA 3DKFA 2PVLA 2HAKA 2YIYA 4FSMA 1H25A 1CSNA 4PDYA 4OTFA 3FHIA 2OBJA 4JDKA 2P4IA 3HA8A 4JS8A 3FSFA 2ITXA 3BEGA 3IOPA 3NRMA 4QNYA 3TDVA 5E4HA 2ITTA 5BYYA 3O96A 4YJSA 1PJKA 5BVDA 5TKDA 2PU8A 4ASDA 3UNZA 1J7UA 5HG7A 3RP9A 5FXSA 4KWPA 4LV8A 1QPEA 4JAIA 4NIFB 4RJ5A 4DFYA 4KINA 2NPQA 2X2KA 3QHRA 4C3PA 1OMWA 1CTPE 1U54A 2J50A 3PP0A 4BDIA 2ZJWA 2WEIA 3PJ8A 4DT8A 4IC7A 3UP7A 2Y6MA 4PP7A 4RZWA 2W4KA 2BRGA 3PE2A 3QCXA 3WF8A 2OZOA 3C4ZA 4ZTSA 5HCZA 3ORTA 4AZFA 2ZAZA 3MPMA 4XP0A 5FEDA 5AEPA 5HG9A 2OO8X 2PWLA 3T8OA 3A7IA 3QRUA 2VZ6A 4CMOA 4W4XA 4QD6A 1Q8UA 3F61A 4RIOA 4AU8A 1R0PA 2FUMA 2NO3A 3QWJA 4U9AA 4E6AA 5CI6A 5AP3A 2Y7JA 4E4NA 1BMKA 4RLLA 3CPBA 3I60A 2QD9A 3CQWA 3PPJA 3VQUA 2ZDTA 3Q4TA 2WTDA 5ACBC 2JLDA 4K18A 5DI1A 4MD7E 1OITA 4PDSA 2CCIA 2HELA 5ANOA 4RIWA 1A9UA 4FTAA 3KEXA 2CNUA 3EFJA 2RIOA 2WTJA 3P08A 4E5AX 1WCCA 4FC0A 1PMEA 3FMLA 3LXLA 5J9LA 4BC6A 4EHGA 3FI3A 4FNWA 1Q61A 4BCJA 4DEAA 1P14A 4I4FA 2FSMX 3ZFMA 5FEQA 4AOJA 3UTOA 4OW8A 2WAJA 1SNUA 4MWHA 4IM2A 4TYHA 2BROA 2BDJA 3PG1A 1U4DA 4IVBA 5EM5A 4ONAA 3VO3A 2ZMCA 4D2PA 3CIKA 3IS5A 4X2FA 4DFLA 2AC3A 4ITHA 4FL2A 2X2MA 4IB1A 4J53A 4C37A 1XJDA 2C3IB 2BDWA 4WNOA 3PP1A 2PULA 3A8WA 4KIKA 2HENA 3KK9A 3DQXA 3G6HA 3ORXA 4EOOA 2NNWB 3PDTA 3PXFA 3LXNA 4IIRA 4EHVA 4IDVA 2QVSE 3VW6A 4PTEA 4C8BA 4IWDA 4Q5HA 1V0OA 3Q5ZA 5DYJA 1PW2A 3TKUA 3RM6A 1H08A 4FTOA 4GRBA 4U40A 5AUVA 1DAYA 2V62A 4FKSA 2E9NA 4CG8A 4GUBA 1W98A 2AC5A 5CX9A 5B7VA 4JVGA 2WPAA 3ACJA 5LVNA 3EQRA 1UNLA 4ZMEA 4U43A 4IVCA 3MI9A 3Q5IA 3HP2A 4E4LA 1VEBA 4MEDA 2YM5A 4ANBA 1RJBA 4UMTA 1W83A 2P33A 3WZKA 4HYUA 3E63A 3FMHA 5AP0A 2UW3A 5A9UA 4J97A 5TOZA 2EXEA 2HWPA 3SW4A 3FLYA 4IX6A 2CGVA 3MB6A 4ZP5A 3TCPA 2C30A 2QOOA 2Y8OA 3CQEA 2CMWA 2YFXA 3ORZA 2ZVAA 4GG7A 3BYVA 1BYGA 3LCTA 4MVFA 4MBLA 5HE3A 3R9OA 4DBNA 3OOMA 3MY5A 4ZTNA 3GNIB 5AADA 4IAYA 5HX8A 4MF0A 3KKVA 3R7IA 2YIWA 3NSZA 1PXOA 1ZAOA 3FYKX 2W1DA 3I81A 4JBQA 2Q0BA 3NUYA 4X3FA 4ZTRA 3POOA 3HKOA 3LFDA 3LM5A 2VO0A 2R7IA 3GU4A 1OIQA 2WHBA 4NKSA 5EYKA 4X7QA 2YCFA 1OIUA 2WMWA 3ID6C 2BIYA 3GCPA 5HCXA 3VW8A 3KCKA 2OXXA 4HZSA 4PTCA 3IDPA 3NCZA 2X7OA 3PVGA 3D5WA 3QZGA 4O7YA 1PMVA 3EB0A 1YOLA 3RINA 3PLAE 2W1CA 2Y4PA 5HICA 5CU6A 4LQMA 3HLLA 2IVSA 4F0IA 4FKOA 2PUIA 3MTLA 4U42A 5CWZA 2YERA 3HDMA 3TNHA 4BZDA 3F5UA 3S1HA 5M4FA 4GS6A 4I0RA 4RWKA 4BWKA 3R7VA 5K0KA 4Y8DA 2CDZA 3SXFA 4BI0A 5KBQA 3UGCA 4FK6A 3ZH8A 3FSKA 4RJ6A 4FKJA 2YITA 4PTGA 1PYEA 2X6EA 2JIIA 2B4SB 4MQ2A 2Z7RA 3HDNA 4RFYA 1YXUA 5E91A 3V3VA 3W2SA 5C01A 5KMMA 4KA3A 5CEKA 2E9UA 4YPSA 4NWMA 2ITPA 2I0HA 1AD5A 1ZYDA 4RVMA 4FEUA 5DE2A 3TJDA 3DJ5A 3PPKA 5L6PA 5L8LA 4CSVA 2R3QA 3E3PA 3EFLA 3R00A 3ZC5A 4AAAA 4BL1A 2A1AB 2IZSA 1FVVA 3HAMA 4WUAA 3IW8A 5HG8A 5D7VA 5HBHA 4PMSA 4LG4A 2EXMA 5AX3A 4BIEA 3JR1A 1TVOA 3GC0A 3DB6A 3QAME 4IM0A 3TZMA 3WZJA 3BI6A 3DS6A 4GT3A 1XWSA 3MGYA 4YTIA 3A62A 4D2RA 4R7IA 3HVCA 4CFNA 2JKMA 3HRFA 2F2CB 3RK9A 3QD0A 4LRMA 4BIBA 4E3CA 4CG9A 4I94A 1BL7A 1JVPP 1PMNA 3TTIA 4DGOA 4FL1A 1W82A 1WFCA 2JDOA 5L2SA 3R71A 1PXMA 4H58A 4Q9SA 4WRSA 4MXZA 3MDYA 3OD6X 3RNYA 3VS7A 4ARKA 3ALNA 4CMTA 2R0UA 4F6WA 3E7VA 3LCOA 3P4KA 4E4XA 4BVUA 2CN8A 4PV0A 4TPTA 5LWNA 3CR0A 4CFWA 2GDOA 3FZOA 3ZSHA 4AN2A 3FI2A 5HIBA 3OOGA 2I0YA 2YDIA 2W06A 4KIOA 3ORLA 4X6QC 2PZ5A 1G8AA 5IH6A 2QR7A 5LWMA 4AW1A 3HUBA 2F2UA 2OJFE 4E73A 3QALE 4I0TA 5E8XA 4DGNA 4G3EA 4HNIA 2YWVA 1FVRA 3QTZA 3KK8A 2LGCA 3AC1A 4DFUA 2XCKA 2BDFA 1QPDA 4O0VA 4FEVA 4FOBA 3I5NA 5CS6A 3OWLA 3ZSGA 3CJGA 3ULZA 5CF8A 3EQDA 4EK5A 4HYHA 2XM8A 4CKIA 3W2RA 5DRBA 3HMPA 1DI8A 2C0OA 4YJQA 3LLAA 1H27A 2ZV7A 1XO2B 1MUOA 4O6LA 3WBLA 4J99A 5JMSA 4DTKA 4BTFA 3EH9A 4GIHA 2R5TA 4D5HA 4O82A 1JOWB 2BR1A 2UV2A 1PXNA 1RW8A 4F0GA 3FI8A 3H0ZA 3A2CA 3BELA 3UE4A 4RRVA 4FKWA 4FKVA 4RJ3A 1FBNA 4R77A 4CLJA 4KBCA 1O6YA 3U54A 3ZRKA 4AGCA 4DLIA 4YSJA 1WBWA 4CV8A 3QRJA 2C6KA 4B7TA 3GC9A 4ANQA 4JRVA 3I79A 4BN1A 5D9HA 3GU7A 5AA9A 3SRVB 5FGKA 3MV5A 5FTQA 5T68A 5FBNC 3VUHA 3TV6A 3V8TA 2WZJA 5EDQA 2E9VA 3ITZA 3TACA 2VU3A 5IG1A 4LM5A 3LM0A 5AUTA 2GU8A 4IXPA 2KTYA 3VBVA 1UU7A 5DR9A 3C0HA 4QMWA 4ERWA 1S9JA 4DEEA 3FEGA 4KSPA 3D5UA 4EYJA 2ITQA 4NCTA 4GJ3A 2JDTA 4LUEA 4FGRA 4F1OA 2UZNA 2X8EA 1SMHA 3W18A 2IWIA 1H01A 2V5QA 3DB8A 3FWQA 4DCEA 3I6WA 2X8IA 3LZBA 5AP7A 4TW9A 4DCAA 4L3PA 4CFVA 3RWPA 4C0TA 4I23A 2YZAA 5AAGA 2C6IA 1OPLA 1OKWA 4FSNA 4M13A 3QUDA 5E1EA 3I0QA 3MSSA 5IQBA 5J87A 3IDCA 3ERKA 4FVRA 3FI4A 1XHAA 4ZLOA 3TEIA 4IMYA 2R7BA 3AT2A 3U4WA 2YAKA 3CGFA 4B99A 3NVMB 2YM7A 2VTNA 2QOIA 1F5QA 5EFQA 3G0FA 4GVJA 5J1VA 4Y46A 5AV4A 4TKSA 3Q6UA 1GIJA 1EH4A 3FAAA 3FZPA 5F4NA 3FUPA 2OF2A 2QU6A 1ZY4A 4V0GB 4ZZOA 5FQDC 1H00A 5IUGA 3OUKA 4E26A 4YR8A 4UV0A 5ETIA 2IN6A 4WBOA 5LVPA 3QYWA 2QO2A 3WIGA 4GVAA 3ZUVA 4E1ZA 3ZO3A 2YM6A 3HMMA 4D1XA 5IH4A 4CCBA 1KE7A 1V0PA 2PVMA 1CMKE 3RK7A 1YDTE 5E8YA 3WYYA 3PJ2A 4O7SA 3R1SA 4WSYA 4CZYB 2WQBA 4O7NA 3GQIA 5LVLA 3MH2A 4C4JA 3NNUA 2DYLA 4ZZNA 3LJ2A 1P5EA 4XOZA 2WB8A 4AACA 3C13A 3LFQA 3R2BA 3LFBA 3LXPA 4ID7A 3R22A 4II5A 2B9JA 5JFWA 3NUUA 5JT2A 1YI3A 4G9CA 4IDTA 3CTHA 5HVYA 3HV7A 3NEWA 3WYXA 1QCFA 4FKRA 3S00A 3OCTA 4CTCA 5E8ZA 3ROYA 5CF5A 4PMTA 2UZWE 4FTTA 2VX1A 3DDQA 2YM4A 3SOAA 4LYNA 4TNBA 4GFOA 2CJMA 2XM9A 1M2QA 1Q41A 1RE8A 1PRYA 3MN3A 4XJ0A 3EN4A 3DK6A 3UPXA 4FKUA 1JLUE 3RAHA 2HXLA 5ANDA 2VWYA 4O0RA 3D15A 1H1SA 2JBPA 2BRHA 4ITJA 1OKYA 4R8QA 3WE4A 3ENMA 1FVTA 1FGKA 3ZM4A 5EYMA 5J5TA 3PFQA 2WU6A 2WGJA 3SW7A 3RPOA 2RFDA 1SZMA 3F5GA 4RX9A 4V04A 1NT2A 2J0JA 5JZNA 5CVHA 4IHPA 3PY1A 4PMMA 4M69B 3F3TA 3LCKA 3R7EA 3KVXA 2VGOA 4MXYA 4YZBA 2UZVA 5H8BA 5HE0A 4ZJJA 2WOUA 2C1AA 3JY9A 4FMQA 5C8MA 3VNTA 4IVDA 4BCIA 2C5OA 2C5XA 3KN6A 3MIYA 5K0XA 2PVNA 4FZ6A 5I5ZA 1OUKA 4F7NA 2OIQA 5CXHA 3O51A 3BKBA 3FQEA 3QRTA 4GT4A 3UZTA 2VX3A 3WIKA 4J95A 5GJFA 2BMCA 4WOVA 5ANJA 2HXQA 2BKKA 5TF9A 3CPCA 5CU3A 4AZTA 4HVHA 2GQGA 3C4EA 4BR3A 2R3OA 2WTVA 1K2PA 2C5NA 1P2AA 3FMMA 2PZIA 5AJQA 2XNOA 1Z5MA 2QKWB 3QCSA 3VBYA 4QTAA 2XRWA 3PXKA 4RVTA 4TTHB 3IDBA 3PSBA 4ITIA 4LI5A 3ORKA 4JBPA 4C3RA 3EFWA 4JBOA 2ITZA 4O86A 3P79A 2ZYBA 4BGQA 2G15A 2UZEA 3II5A 4WO5A 3CGOA 2PL0A 3OFMA 2YA9A 5IA3A 3HZTA 4K77A 4P5QA 3RZFA 2VO7A 3RNIA 4JT3A 2B0QA 4RWJA 3AT3A 2R2PA 4AT3A 2VN9A 3BIZA 3V6RA 4YNOA 2GNIA 4DTBA 2W1FA 2C3KA 2WMTA 1REJA 5AR2A 1JWHA 4GU6A 3R02A 4MBJA 3W2PA 3OROA 2FSLX 4FV4A 1GZ8A 2WMSA 5AM6A 3U8WA 4X6RA 2VTPA 3FHRA 4ZJVA 2C68A 1M52A 3O23A 4K8AA 3VBWA 3HNGA 4FKPA 3OCBA 4KKEA 5KZIA 3AT4A 3DXQA 2XK8A 1FOTA 4FTIA 3QUPA 3SRVA 4O0SA 3Q9ZA 5AWMA 3MVJA 4C62A 3FMEA 4W4VA 4M0ZA 3W8LA 4BFMA 4CZTA 4FTKA 5KX8A 3RM7A 2PVRA 3HECA 4QPMA 1KUTA 4AOIA 3D94A 2W1HA 3QD3A 5C4KA 3AC5A 3HA6A 3DPKA 5I0BA 4FR4A 1OL2A 2CKQA 3NMUF 3AQVA 5C9CA 2V7OA 3Q4CA 2Q0NA 3MFUA 4IANA 4LGDA 4MXCA 2PMLX 3O0GA 3RCDA 1URWA 3PG3A 4OLIA 3UDBA 4O7WA 3CCNA 4H3PA 4O0XA 4F9AA 4DH5A 4P90A 5CTPA 4YHJA 2REIA 3KN5A 3QQLA 1OKVA 4KUJA 3HV4A 5JQ8A 4ASXA 4GT5A 2HCKA 2JC6A 4FTJA 3RMFA 3ATSA 2ZMDA 4D2WA 3LQ5A 4G6LA 4QMLA 4D2VA 4YU2A 4FVPA 4U44A 4NTSA 3K3IA 5IUHA 4R3RA 3LQ8A 4KSQA 3COKA 4OBOA 4AZVA 2IZUA 3GXLA 4L42A 4UWBA 3NUNA 5DT0A 2YDJA 2GPHA 1Y8GA 4G17A 4J8NA 2C1BA 2FO0A 4NM5A 1XH4A 3DAJA 4GEOA 3F7ZA 4NU1A 4XP3A 1IEPA 5EG3A 5EI2A 3N51A 4C2WA 3WF5A 4QMVA 4QYFA 3FBVA 5HU9A 4UXQA 4HGTA 4H1JA 3R21A 4JQ8A 4E7WA 4O7TA 2R3PA 4L45A 5K9IA 2CHLA 4FKIA 4EWHA 4F1TA 4O83A 3GU8A 3ZUTA 4ZS4A 4F7SA 4RWLA 5AP6A 1WVXA 5CAVA 1J3HA 4EH3A 4IZ7A 4E6DA 4TXCA 3QD2B 5M09A 5F9EA 1OM1A 4RT7A 4C4HA 4D1ZA 1SVHA 4FSTA 4A07A 5IU2A 2HW6A 4KNBA 3KCFA 3LFEA 4E6QA 5HX6A 4ZY6A 4C61A 4JOAA 1ZXEA 2ZV8A 2R3LA 2VTSA 3AD4A 3RK5A 3W55A 5I9ZA 3QKMA 4RBLA 4Y5QA 5EQPA 5D12A 5IA2A 1YXXA 4G3DA 2A2AA 3PXZA 2YM8A 4K11A 3K5VA 4XG8A 3NUXA 3OUNB 1F3MC 3FDNA 3FLSA 3I7BA 2FVDA 5L8JA 4GSBA 4RIXA 5CSHA 3JXWA 4BGHA 3U6JA 3QBNA 1TKIA 2QOFA 1XH7A 3DBFA 3NGAA 3OC1A 3LKMA 1H4LA 3VWAA 3TKIA 3E62A 4O7LA 3QTQA 1ZMVA 2W0JA 4QYHA 4D9UA 3QGWA 3FMNA 2PMIA 5T3QA 4GK2A 4R3CA 3PTGA 1JSUA 4DFBA 3SGCA 2PHKA 4P7EA 2PVYA 2VWVA 4KABA 4M7IA 3ZXTA 4AE9A 3SG9A 4O7ZA 3OEZA 4OTWA 4A4LA 5A4TA 3QX4A 1PXLA 2UZLA 2YHVA 3B8RA 3R1YA 4L3LA 2HWOA 4RPVA 5AP4A 5EDRA 1ND4A 2YCRA 3DKCA 3DQWA 4BDJA 4F6SA 3EN9A 3ZEPA 3G5DA 4AFJA 2YLEA 1GOLA 5AM7A 5HLPA 4AZEA 1OL7A 4DINA 2CKPA 5M08A 3E8NA 2BAQA 2O3PA 4QQJA 3NPCA 3DKOA 5E8TA 1IAJA 3OWPA 4EONA 4CVAA 3O8TA 1PXPA 2IPXA 3EN6A 3KRJA 5IQHA 3QQJA 4NEUA 2BIKB 3S2PA 3OZ6A 3UBDA 3OT3A 3NX8A 3A60A 3D5VA 4FV9A 3V5WA 3Q3BA 4J98A 2CN5A 4J96A 5EOLA 2H9VA 4YBKA 3D7TB 5FDPA 3UQCA 2O0UA 4U80A 5B2KA 4ZY4A 5B2LA 5EM6A 2C5VA 3BE9A 5FXQA 1OL6A 4CFFA 4PX6A 4IX5A 4QP6A 2PYWA 3BLRA 1B39A 4XG3A 4L9IA 4UWYA 3CY2A 4RJ7A 4YNEA 3KFAA 3QQFA 3ZBFA 1IAHA 3I0OA 2IVTA 3DBCA 3R8VA 2O65A 4M15A 4Z7HA 1Q4LA 3T3VA 4FSUA 4QPAA 5HTCA 4M0YA 3KRLA 5DT3A 5AR8A 3MFSA 3OHTA 4R1YA 1OKZA 2HIWA 4G1WA 4IE9A 4EYMA 3MVMA 2NP8A 2A27A 3I4BA 4AZWA 1JKKA 4B9DA 4BCFA 1OB3A 1KV2A 4WUNA 4ZTLA 4FIIA 5I3OA 3TWJA 1WBTA 4YGAA 5I3RA 2OJGA 4IAZA 3FMJA 4YJUA 3HV5A 3E8DA 2G9XA 4TYHB 5CSXA 4AA0A 3IPHA 3KMUA 4PMPA 3UNKA 4DFNA 5H3QA 3FJQE 5L6WL 3MJ1A 4N57A 2R3GA 3S0OA 2GNJA 5J95A 4S34A 4CEGA 3ZSIA 3SX9A 3U4UA 2VWUA 4O84A 4YJOA 3BV2A 4QTBA 4U45A 2UVYA 4NCTC 4QQ5A 5G6VA 3DFAA 3LJ1A 4L67A 3IW6A 1T45A 3R1NA 4BDDA 4BKJA 2GCDA 2UZOA 2V55A 4MD8E 4EORA 4XG2A 3REPA 5IMXA 5KMNA 4HNFA 4ZSJA 4I6BA 5GNKA 2VO6A 4KAOA 4F09A 5LMKA 2P2HA 3PJ3A 3ZZWA 3FY2A 1P4FA 2QURA 4XRJA 2QU5A 3AXWA 4W8EA 1XBCA 4JIKA 5AR5A 2P2IA 5M55A 4ANOA 5HQ0A 1XR1A 3KULB 2UW0A 3ZCLA 4D0WA 4D55A 5CXZA 2WQOA 3F66A 1FMOE 1H8FA 4RVKA 3QF9A 5LQFA 3MVLA 4QMXA 3UOHA 2G2FA 3QXPA 4EUTA 5E8UA 2ETRA 3ZYAA 1E1VA 3PRFA 4B0GA 5A46A 4KRDA 4DEHA 3W33A 3TV7A 3ZRLA 3GI3A 3LMIA 4KS8A 2HZIA 3EKKA 2OK1A 4HPUE 2XJ1A 4FV5A 4MTAA 4EOJA 1SNXA 2CNVA 3VAPA 2VWIA 1OGUA 4FZDB 4L44A 2C3JA 5ANEA 5IF1A 4BI1A 3TIYA 3QLFA 4C34A 3T9IA 3MY0A 5GZ9A 4ALUA 3FZSA 5IQDA 3MH0A 3TUDA 3KA0A 3PRIA 3F3WA 4RVLA 5A6NA 2QNJA 3H0YA 1ZOHA 4QP8A 3DNEA 5HE1A 4Z16A 2JIUA 4MAOA 5FG8A 3G33A 4R5SA 4BB4A 1YKRA 4YPDA 4G34A 3D4QA 2BFXA 3RTPA 3UOJA 4FTNA 3KRRA 3KVWA 4BYIA 4C3FA 3DBEA 4CQEA 5BUJA 2PVJA 3GQLA 4FNYA 3IW4A 2F49A 5AV0A 3LHJA 2XK9A 4EK3A 4PQNA 4UMRA 1NA7A 3TNQB 4L8MA 4DEGA 5C8KA 4N6YA 4ASZA 3BWJA 4OGRA 4OTPA 4FT7A 5LARA 3R83A 4EJNA 5GIOE 3BE2A 3G6GA 3QQGA 3OTVA 2VTTA 4JI9A 2BALA 5CSVA 3NYOA 4IAAA 4NM7A 3EFKA 4O0UA 2ZB1A 4HVGA 1GZNA 1ZY5A 5GHVA 4C2VA 5CAOA 4O22A 3QRKA 4AW5A 5CEPA 1OL1A 2R3JA 3BLQA 4QMTA 4OT5A 3QFVA 4JRNA 2ERZE 5L2QA 5L2TA 1A06A 3W1FA 3D5XA 3FXXA 2G2HA 3BBWA 4GJ2A 3VJNA 2QR8A 3VQHA 4BRXA 5ITAA 3F3ZA 1PKDA 5EW8A 3H10A 4QTEA 3QTSA 4N0SA 3DXNA 1JQHA 1UA2A 2QLQA 2WMAA 4NJDA 3DZOA 1AQ1A 2SRCA 1URCA 4WG5A 4K6ZA 5EM7A 3C4CA 5HTIA 4O91A 2ITVA 4AOTA 1ZLTA 2ITYA 3U55A 5BQ0A 2Z2WA 4NW5A 3QQHA 4LV5A 1FPUA 2VNWA 1YQJA 3FKNA 3IW5A 1WAKA 3HMIA 3DDPA 2GS2A 2A4LA 5DH3A 2JDRA 3TZ8A 4BTJA 2BUJA 3DT1A 2WTCA 4RLKA 1DM2A 3CC6A 2WQEA 4EJ7A 3G90X 5AV2A 1OUYA 4L7SA 2I6LA 4Z9LA 2O8YA 4D4RA 2CSNA 1Q8WA 4R6VA 1HCKA 2J7TA 4CT2A 1HCLA 5JRQA 1JAMA 3GC8A 3CSVA 1B38A 5BNJA 4G3CA 4P4CA 1MRUA 4ZSAA 3PYYA 4M14A 5AUXA 4IACA 3M2WA 1GNGA 3N4VA 3R7YA 5CF6A 2WMUA 4X3JA 4DH1A 2J0LA 3LXKA 3CP9A 4G2FA 4ZLYA 2RKUA 2OKRA 3HMOA 3V01A 3VVHA 3KU2A 5C03A 5J9YA 5IQFA 2JAVA 5HORA 5M06A 1XH6A 5JK3A 3OF0A 4E5WA 3UNJA 3Q9YA 3SV0A 2PVFA 3DFCB 1LR4A 2QC6A 1MP8A 4IB3A 3TXOA 4B6LA 3AC4A 5HIDA 2JKOA 2G01A 3KXMA 2XP2A 4JG6A 4AQCA 4MBIA 4X2GA 4IB0A 2C6MA 4ORKA 4NM0A 1UNGA 3MBLA 3E8CA 2FB8A 3RWQA 5B2MA 4ZSGA 4CKJA 3Q4UA 5HBJA 4QMUA 4ANMA 4EEVA 2FSOX 4OR5A 3MPAA 4BCKA 2VRXA 2BFYA 1RQQA 5EYCA 4BTMA 4QYYA 4BHZA 4HYSA 5LMBA 4FKQA 3ORNA 2JAMA 2PMNX 1TQIA 3MJ2A 2F4JA 3WOWA 3QQKA 5HD7A 4DEDA 2CPKE 2J0IA 4ANSA 3PUPA 2B9FA 2HW7A 1GIIA 3LFAA 4R7BA 3K5UA 3RGFA 4NJ3A 2XF0A 3G9NA 1UV5A 5BYLA 3CBLA 3MA6A 3OEFX 1CDKA 4UXLA 5IMEA 2OF4A 3Q60A 2ITNA 3FMDA 5ETCA 4CFXA 4FUYA 5CF4A 3KULA 5LJJA 5G1XA 3E92A 2WELA 1OECA 5FBOA 4BKYA 4IZYA 4YLKA 3TTJA 4ACDA 4LMNA 5ICPA 3JUHA 5B0XA 2XK7A 1XH9A 2OIDA 2XNBA 2F57A 2IO6A 1ATPE 4DF3A 2QO9A 3MB7A 3NW5A 3GCSA 2UZTA 4FIEA 3EHAA 1QMZA 3FQHA 4N4SA 4TWPA 4DLJA 5M07A 4EQCA 3FLQA 5BUEA 3EQGA 2GMXA 2XMYA 4MK0A 3DK3A 1XQZA 4IW0A 4RJ8A 4A9UA 5IPJA 2H34A 2XH5A 5K5XA 4WRGA 4RIYA 5L2WA 2QOLA 2XKFA 3U9NA 2GNFA 4FEQA 4ZTHA 4JNWA 3U87A 2PVKA 2R3HA 1XH8A 2XK4A 3FZ1A 2GSFA 3EN7A 5CVGA 5TT7A 3ZTXA 4J71A 5K5NA 5EYDA 3BHTA 4FKLA 4DG0E 4EKKA 1BI8A 3A4OX 3TM0A 4IC8A 4E5BA 4QP1A 5BUIA 3IW7A 4G3FA 4XG7A 3QTIA 4TNDA 4OT6A 4OBPA 2PZYA 2B9HA 2NRYA 4FICA 2XK3A 2YJSA 2VWZA 1LP4A 4O0WA 5DBXA 3PA4A 4F7LA 2BZIB 3M11A 3NWWA 4C4EA 1PHKA 1HOWA 4XEYA 2VAGA 4DGLC 5KCVA 3LW0A 4X2JA 2BZJA 2OGVA 2VGPA 3D7TA 4PNIA 3P7AA 2BTRA 2OXDA 2IVUA 3DU8A 2J9MA 3EWHA 4IM3A 4BZNA 4YJRA 4FSQA 4TYJA 3FYJX 2P0CA 4ANLA 3H9FA 4R1VA 3NR9A 5IA0A 1KE9A 5TE0A 3NYVA 1ZARA 3L1SA 4QMZA 4ZY5A 1YHWA 1YDSE 3V5JA 4GV1A 3V8SA 5JFSA 5FTOA 2V22A 5HVKA 4HCUA 3SXRA 4JX3A 4YBJA 3W2QA 4L53A 3ZLYA 4Y72A 4CKRA 5E7RA 4OTIA 3BHYA 4L52A 5BVKA 5KE0A 2IW9A 4EH2A 5CAQA 4NM3A 5HVJA 3ROCA 4DITA 4S33A 4GCJA 5KMLA 3LFNA 5F1ZA 4CFUA 4FTQA 4CFMA 3EIDA 3M42A 5DN3A 4G6NA 3HP5A 1H24A 4YC6A 4UWCA 2XNMA 3TZ9A 4YZ9A 5KBRA 3NLBA 4MHAA 4TY1A 5J79A 5JN2A 5HU3A 2H96A 3C4FA 3EQFA 4RIYB 3QTWA 2W05A 2Q83A 5C27A 3BBTB 4I3ZA 3EMGA 2WTKC 4BDFA 3QTRA 4JAJA 4W8DA 2WXVA 3F6XA 3RVGA 4H3QA 3KF7A 5FWKK 3IOKA 3COMA 1R78A 4AGWA 5KMKA 1M7QA 3UIXA 1JNKA 3DCVA 3ODYX 3OG7A 2WKMA 3P7CA 1ZOGA 4CQGA 4CV9A 4YURA 3E93A 3MS9A 4YZMA 1LPUA 3OXIA 4JXFA 4CT1A 4YUQA 3I6UA 4CYIA 2DS1A 2GTMA 3DTWA 5DR6A 5C26A 1V1KA 3F82A 3O8PA 3RHKA 2AYPA 3E64A 4CRSA 1K9AA 4X21A 3EL8A 4DBXA 3T3UA 3HYHA 5LCKA 4GMYA 2Y9QA 3QQUA 2O64A 4J52A 4XYFA 5KUPA 1UWJA 3JYAA 2J90A 3OCSA 5A3XA 4WIHA 5HNGA 5AUZA 2QOHA 4GU9A 3WE8A 2VUWA 3NYNA 4ALVA 4DG2E 4O96A 5CSWA 3SAYA 3VS2A 3EL7A 1SVGA 5LMKC 4BDKA 4E6CA 4C35A 3UQFA 2UZUE 3Q04A 4NW6A 2ONLA 3GCQA 4S31A 4APPA 4CMUA 5J9ZA 2VTRA 4M12A 4FT9A 4LL5A 3MVHA 2GQRA 4JBVA 4CGAA 3LIJA 4QP4A 4FL3A 3WF9A 2UW4A 3GEQA 4I5CA 3OVVA 3NUPA 5AV1A 4NT4A 3RI1A 1ERKA 3IO7A 3KC3A 4EHZA 3ORPA 1Q8ZA 3C5UA 5DFPA 2XJ2A 4FZ7A 4WG3A 3L8PA 3OMVA 4IJ9A 2FSTX 5CNOA 4NFNA 2V7AA 3HGKA 3BHVA 4WG4A 1KWPA 2XBAA 2JFLA 3UO6A 5IISA 4USDA 3LQ3A 2C0TA 5E8WA 2OFUA 4ACHA 3IONA 3N9XA 3DY7A 4RFMA 4IZAA 1WVYA 3PWYA 4MNEB 5DWRA 1A48A 4X2NA 5FP5A 1NW1A 1BUHA 1W7HA 4Y73A 4H36A 1BX6A 1YWRA 3BYOA 3E8EA 4X2KA 2BILB 4F63A 2P55A 3GGFA 1U5RA 2RF9A 4ANNA 3AGMA 3ETAA 2FH9A 3FC1X 3KXXA 5HEZA 1DAWA 4B4LA 3FMKA 4YZDA 2HY81 1GAGA 2IZTA 5AA8A 1KOAA 4L46A 4HVDA 4UEUA 1H1RA 3LFCA 4H3BA 2OU7A 2VTIA 3PJCA 4G31A 4BCHA 1JSTA 4FK3A 3P9JA 2V0DA 3PA5A 3UJGA 2GTNA 2ZDUA 2J0KA 1VJYA 3DGKA 3MFRA 3NZ0A 5IQEA 4QOXA 4USEA 1YI6A 3GC7A 1XH5A 2W9ZB 4JDJA 1LEZA 3MPTA 1VYWA 4DEIA 5EW9A 5IQAA 2CGUA 2PY3A 5M44A 3NAYA 5LOHA 4A9TA 4IEBA 4AZSA 3CJFA 4XV9A 1G8SA 5AFVA 3A61A 3B2WA 1Q5KA 4CCUA 3CY3A 3POZA 2R0IA 3R04A 1YI4A 4XH6A 3ORMA 3V5LA 4A9YA 4F70A 5M53A 4FT5A 4TYEA 4S2ZA 4G5PA 5F95A 3VS5A 2BVAA 3ZONA 3NW7A 2PMOX 2BTSA 1FINA 2EB2A 4MX9A 4UMQA 1T46A 1WBVA 4XLVA 1R0EA 2Z7QA 3R63A 4BDHA 3N4TA 3LLTA 4IX4A 1MQ4A 3OWKA 4FF8A 4QP9A 4AGUA 3P23A 5L8KA 2XEZA 2YZLA 5FP6A 1Q3WA 2OH4A 4YC8A 1LUFA 4EZ7A 5HOAA 3KL8A 3UC3A 5DG5A 1MRYA 4QMQA 3OW3A 4EC9A 2E9OA 2O2UA 5J7HA 1O6LA 3A7GA 2Y0AA 1WZYA 2BHEA 3TNIA 3UO4A 3I1AA 2YCQA 3H3CA 2X9FA 2HK5A 5JH6A 4I41A 2I7QA 1ZYSA 2OXYA 3UZPA 2CCHA 4L01A 4DE4A 4U0IA 4C02A 3OTUA 4XBRA 4FTMA 1CKIA 5DR2A 2BKZA 1QL6A 2C3LA 1JKLA 2OH0E 5CVFA 5K3YA 3V8WA 3KMWA 5D7AA 4AN3A 4EBVA 4BBMA 3Q4ZA 3FL4A 3P78A 4BKZA 3UYTA 3ZBXA 1GY3A 5HBEA 3UC4A 5KKRC 4O7VA 3L9PA 2ITUA 2WU7A 3WI6A 2ETMA 5T6KA 4RX5A 5CNNA 3ZDUA 2XEYA 4QMMA 3GU5A 4WNKA 4TYGA 4CTBA 4ZOGA 4IBMA 4BDAA 2Y4IB 5KZ0A 1U54B 4C4IA 4R78A 2J0MB 1ZYJA 4QYGA 3EJ1A 2BPMA 5HNIX 3MESA 3KXZA 4RA4A 1UWHA 2B53A 4FIGA 3F2NA 2QOKA 5A54A 4AS0A 3MWUA 2BAKA 3PSDA 3IECA 3NW6A 2ERKA 3C4WA 1E1XA 3ZFXA 3DAKA 3QUEA 4GH2A 1JKTA 2Z7LA 4MH7A 4I6QA 5AP2A 4EBWA 2OSCA 2VTMA 4O0YA 5ACKA 5EKNA 1PF8A 1CKPA 1PYXA 3HX4A 3D2IA 4BCQA 2WNTA 2E9PA 2GHLA 3ELJA 4AT5A 4LL0A 5BMSA 2B1PA 3H4JA 5CEIA 2CKEA 3FZTA 5EHYA 1Q3DA 2QI8A 5HO6A 3R8LA 4M8TA 1O9UA 4GG5A 4XNEA 4NSTA 5CALA 1Q8YA 3EOCA 4O2ZA 3VUTA 2YLFA 1O6KA 2JGZA 4M68A 2XKCA 5IEVA 4G16A 4XV1A 4JR7A 5H8EA 3MA3A 4NTTA 4EH5A 1CKJA 5JQ5A 5HO8A 1OZ1A 1P4OA 4GKHA 5HI2A 4FTUA 4F9WA 2Y4IC 5E8VA 5CLPA 4BGGA 5GINE 2BZKB 3RPYA 3VHKA 3O17A 3GU6A 3K3JA 3L9MA 5HZNA 1OPKA 4V0GA 1H07A 2EU9A 3UIUA 2CLXA 3GFWA 3TNWA 3MYGA 3HRBA 3DLZA 4PPBA 5FM2A
chains in the Genus database with same CATH superfamily
5AUWA 2G1TA 1UU8A 4RWIA 5JEBA 4YO4A 4P2KA 2GNGA 2WMXA 3LFSA 3VUMA 1UKHA 4DH7A 3KRXA 1PXJA 2R3IA 4PDPA 2E2BA 5DT4A 1WMKA 3Q96A 4AA4A 3UDZA 3A4PA 3PJ1A 4YHTA 4TZRA 5IUIA 3H30A 4V01A 4Y95A 4DGGA 5H9BA 4WKQA 5CEMA 1YRPA 2J5FA 2B9IA 4FVQA 4BI2A 4U81A 1YVJA 2G2IA 3ALOA 3VRYA 4H05A 3IGGA 5EK7A 1YOJA 4WHZA 4L7FA 3ZC6A 2C5YA 4O38A 3PSCA 4F08A 4E4MA 1Y6AA 2JFMA 3ZU7A 1MRVA 2QLUA 4W4YA 5CY3A 2VWXA 2IW8A 3W16A 4C57A 5JGDA 1XKKA 4U41A 4X3FC 3AGLA 3AC2A 4XG9A 4CZUA 3RPSA 4E93A 2XYUA 5AX9A 4PDOA 4S30A 4EH9A 3VHEA 3PVUA 5J1WA 4HW7A 4EH8A 3E3BX 4Z3VA 4QMOA 4GIIA 1RDQE 3C1XA 3P5KA 4IJPA 2BHHA 3P86A 3AC8A 5EHLA 4BCPA 4HYIA 4EH6A 5CAUA 3EN5A 2GFSA 4ZTMA 1GZKA 3QKLA 2WTWA 3IGOA 2PUPA 4I93A 4K2RA 5ANGA 4DFZE 3TUCA 4BHNA 4RA5A 4F99A 4NH1A 5IQCA 2X1NA 3Q2JA 3W2CA 3ZEWA 4FV1A 3PXQA 3QZHA 5CZHA 5DPVA 4EH4A 2WMBA 5AUUA 4QMNA 3Q6WA 1XBAA 4MNEA 5BYZA 1FMKA 4KKHA 3HRCA 5BPYA 4L6QA 4JQ7A 4ZXTA 5HD4A 4PY1A 1J1CA 4RSSA 5FXRA 2QO7A 1W2DA 4PL4A 5J8IA 4FSWA 4ACMA 4BCOA 4I22A 4FBXA 5FM3A 3F5PA 3G9LX 4WD5A 3PXRA 3UG2A 4AXAA 4IB5A 4Q2AA 4BBEA 4B8LA 5HCYA 4YHFA 2BRMA 2B52A 2XCHA 1IG1A 4FIHA 5KMOA 3C4XA 3WF7A 1I44A 4BCNA 4TWNA 1NVRA 3QA0A 2W7XA 3A99A 3OWJA 4KBKA 4L00A 4YJTA 3CLYA 4ZMFA 5A4LA 4EWQA 5IDPA 5CU0A 2OW3A 2VTJA 3AC3A 3DZQA 3VJOA 1VZOA 2B54A 2W96B 3L8XA 4U3ZA 3TI1A 4QO9A 2W5AA 3HEGA 4FJVA 1V0BA 3FKLA 3LCSA 4M97A 4OTDA 5JKGA 2ZV9A 1ZMUA 3A7FA 3P1AA 2ZM1A 4FIFA 5JRSA 2QOCA 4BBFA 3DV3A 4PL3A 3QGYA 3QCQA 4XG6A 4RC3A 3R0TA 4QRCA 4YZNA 3WZEA 4MXXA 1IRKA 5IA4A 3LJ0A 4EI4A 2OG8A 4QDEA 3UZRA 5ETAA 4LRKA 3ZLXA 3NNVA 2ESMA 2DWBA 2YWPA 5DLSA 4GUEA 3R9DA 4K0YA 3BHUA 1M14A 4U7ZA 2GQSA 5BMMA 2XZSA 4O4EA 3LE6A 3C7QA 3FPMA 3WILA 4XV2A 4JG7A 3JY0A 2LAVA 2EVAA 4QP3A 1SYKA 1Y6BA 3PPZA 5EHOA 3AMAA 5JZJA 3OP5A 2YISA 4F7JA 3ZO2A 5AAFA 3MIAA 2EWAA 4OTGA 3UO5A 4GL9A 3W8QA 5C4LA 3UG1A 4XG4A 5IDNA 3IKAA 2WIHA 4M3QA 5FTGA 2PUNA 2I40A 2OZAB 4LGHA 3CKWA 1FGIA 4DH8A 5HNBA 2YACA 4AG8A 2I1MA 5AIKA 5FUTA 5AR3A 3KXGA 3JVRA 4FUXA 2BCJA 3D83A 4QMYA 3CXWA 5HTBA 2XKEA 2WO6A 3GENA 3TL8A 4Z55A 4KRCA 4EOLA 3R2YA 1H1PA 2HZ0A 2CNQA 3ET7A 4ZAUA 4UZHA 1JSVA 2GNHA 4MQ1A 2WD1A 4U6RA 2WQMA 4UN0C 3OCGA 3L9NA 2HYYA 3ZO4A 1PMUA 1JBPE 4LRJA 3NUSA 4U5JA 3C5IA 5IEYA 4XBUA 3VBXA 3VBTA 2J4ZA 4U3YA 1IA9A 1J7IA 1G3NA 3V51A 3RKBA 5DEWA 4QMPA 5CSPA 2J51A 1J91A 1PXKA 4UYAA 2PE2A 3TUBA 2EUFB 2UZBA 4EUUA 4HPTE 3BZ3A 4IWQA 2X7FA 5D10A 1W2FA 2ZOQA 4FNZA 4NK9A 1XMLA 4AW2A 3GOKA 5KHXA 3Q52A 4Q5EA 4JX7A 3VF9A 4JR3A 2O63A 3OS3A 1OIRA 3CEKA 5LXMA 3SG8A 1OI9A 4Y83A 3NIZA 1OL5A 4FGBA 4S32A 2ZB0A 4DG3E 3MY1A 4UMUA 3RAKA 5FDXA 2C6EA 3FLZA 3C0IA 3I7CA 5BVWA 4AUAA 3R7GA 4AWIA 4FTCA 2PVHA 1L8TA 5AR7A 4X3FB 3PIZA 4YP8A 4BCGA 4JDHA 1H1WA 2DQ7X 3KRWA 3QC9A 3PLSA 5ETFA 3QZIA 3W2OA 4FT0A 2JKKA 2OI4X 3D7ZA 3TIZA 5E8SA 3LVPA 5I9XA 2XKDA 4FNXA 4RZVA 4M66A 3S4QA 3SD0A 5KO1A 2RGPA 3UVRA 4DYMA 5D41A 3IQ7A 4DAWA 1QPJA 3COIA 5AUYA 2B55A 3SKCA 4MYGA 3THBA 2R3FA 3BGQA 5IA1A 1SM2A 2JDSA 2YM3A 3CQUA 4PL5A 5DEYA 3VS4A 4BICA 3F5XA 4HOKA 4NKAA 5CYIA 2C4GA 3QC4A 3ZDIA 3ATTA 3DAEA 4PWNA 4RG0A 2JIVA 4IH8A 4FX3A 4AGDA 3DXPA 4GW8A 4BDGA 2EXCX 4XHKB 3JPVA 1ZYCA 1TQPA 5DIAA 3W10A 4O6EA 2XANA 3F7WA 3TKHA 3U6IA 4L43A 4BWPA 2YEXA 4D1SA 3CKXA 4EL9A 2X39A 5M4IA 2C6OA 1Q62A 3K54A 1W84A 4ZS0A 3RJCA 3ZUUA 2BAJA 3PVBA 3Q9WA 4HCTA 4ERKA 3R01A 5GIPE 4I5MA 2XVDA 4D5KA 3S95A 4RX7A 3SVVA 4NYEA 5GZAA 4GFMA 3MFTA 4BYJA 3V5PA 4C58A 2F7XE 3P7BA 4QP2A 2GHGA 2UUEA 3B8QA 3BU3A 4C59A 1FQ1B 3BYUA 4YC3A 4R7HA 2RFSA 4AE6A 4BIDA 3KREA 1YHVA 3LMHA 1KE8A 2WQNA 3GT8A 5EOBA 4A9SA 2ITOA 1YWNA 2X8DA 3QXOA 5BVNA 3LAUA 4GK3A 3CD8A 4ZK5A 4XP2A 4BDEA 3BGZA 4U79A 3GFEA 4PPAA 5L2IA 3JS2A 4Y85A 1U46A 3BGPA 1OVEA 2XA4A 2YAAA 2VTAA 2VTOA 1APME 4R5YA 5HO7A 3KQ7A 3CTJA 5J5SA 2H8HA 3OY3A 4J1RA 3EQHA 2PE0A 5CQWA 5DVRA 1ZZLA 4C33A 4EQUA 4QP7A 4W9WA 3ZZEA 4DHZA 3PY0A 2XNGA 1UU9A 3QD4A 1ZMWA 2WMRA 3FXWA 4EC8A 2R3NA 4KB8A 3KB7A 3BPRA 4W9XA 2VX0A 3CTQA 3M1SA 5DOSA 2R3MA 4DN5A 5CANA 2CLQA 3GB2A 3GP0A 3WZDA 4C7TA 1Y8YA 3R73A 2PZPA 3GVUA 2KULA 4F1MA 1WBSA 4BDBA 4EK6A 1F0QA 1WBNA 4OTHA 4PNKA 4UMPA 5GJGA 3QTXA 5I9WA 3B2TA 3BQRA 3ML1A 2XIKA 3VS1A 2CKOA 4WNMA 3GCUA 1Q24A 4K1BA 5IA5A 3O50A 2WFYA 4FEWA 3QTUA 2QOQA 3EYHA 3K2LA 4MF1A 4E20A 3F9NA 2ZV2A 5M56A 4TWOA 4FV3A 4I21A 5TR6A 3TJCA 4YLJA 2OJIA 3ENHA 1VYZA 1YXSA 1OBDA 4I6FA 1KSWA 4QQTA 5AAEA 3ZS5A 4JQEA 3OT8A 4BDCA 3O5AA 3FE3A 4XS2A 4K9YA 5C1QB 2GFCA 5A4QA 5I9VA 4YTFA 1ZOEA 3F3UA 3BYSA 4RQVA 4CYJA 4FYOA 2QHMA 2W5HA 3R30A 3ANQA 1UU3A 3RALA 4OTRA 4YTHA 3AD6A 3E5AA 4LOPA 2JKQA 2VWWA 3PUFC 4I6HA 4YJNA 2RFNA 2X4FA 3C9WA 4UB7A 5FLFA 5CASA 4ZLZA 3NIEA 3VC4A 4GFGA 3D9VA 1Y57A 2QCSA 3ANRA 3RPVA 1NVSA 2OJ9A 1CM8A 2CGWA 2W5BA 3KGAA 1YXTA 2Z8CA 2C47A 3LOKA 2WIPA 1KE6A 2F9GA 4FV8A 4IFGA 4O4DA 3PZHA 4KS7A 4FEXA 3NDMA 3QCYA 2UVZA 2HZ4A 4EKLA 3R9HA 3V5TA 5EI6A 4D4YA 2X4ZA 1IR3A 2OFVA 3QWKA 3EQIA 3R8ZA 5JGBA 2X2LA 1R39A 4EZ3A 3U9CA 4Q9ZA 4U97A 2R64A 2XUUA 2RFEA 2C6TA 3BQCA 4I5PA 1KOBA 2FYSA 3UOKA 4BY9E 3ZRMA 3HAVA 4M69A 4D9TA 4I1ZA 4M84A 4O21A 3BX5A 4KD1A 5CU4A 1UNHA 4ZSLA 3TV4A 3U51A 4TN6A 4F6UA 5E92A 5AP1A 3TNPC 3GCVA 3OBJA 2QKRA 1M17A 3F69A 1YDRE 1H26A 3PFYA 3BU6A 3F88A 1QPCA 3EQBA 4MNFA 4ZZMA 3UMXA 3NYXA 5C8NA 1MQBA 2R9SA 3VN9A 5DHJA 2YJRA 1PXIA 4FE2A 3BWFA 5ANKA 2YIRA 3AOXA 3DBQA 1G5SA 2W17A 3PY3A 1ZRZA 3RPRA 5KMIA 3QZFA 1H28A 3KY2A 4HVIA 5HKMA 2PTKA 3BHHA 4GKIA 4WA9A 3PIXA 5K4IA 1H0WA 4PPCA 3PWDA 4RQKA 1Z57A 3LPBA 3NNWA 3MH1A 3PE1A 5AMNA 5CI7A 2EB3A 4IAFA 1VLRA 4C4FA 3LMGA 4RFZA 5M4CA 2X0GA 2I0VA 3QRIA 4WNPA 4DGMA 4H1MA 4QNAA 3ZXZA 1Z9XA 5F94A 3SHEA 3V04A 4LOQA 4QTDA 1VR2A 4FKGA 3HMNA 4YO6A 2VD5A 3TT0A 3VULA 2R4BA 3DK7A 4AW0A 1G8JA 1Q97A 2PUUA 3FQSA 3E7OA 4IVAA 3R7UA 3CD3A 4DA5A 3SLSA 5JFXA 5AR4A 3WZUA 1ZZ2A 2XJ0A 3NS9A 1H0VA 5D11A 3VS6A 3IK3A 1R1WA 4FV7A 3O7LD 4D4VA 3EQCA 4JL9A 4RC4A 2XYNA 5DA3A 5EI8A 1L3RE 4C38A 4XUFA 2UW5A 4HZRA 2W9FB 2VV9A 3DTCA 4JJRA 3SXSA 4FV2A 4G6OA 3G0EA 4DEBA 2QONA 4YSMA 3WF6A 4XX9A 3BYMA 2A0CX 3DJ7A 3I5ZA 5KKRB 4ZTQA 1YWVA 2UZDA 3OXTA 2X7GA 3UIBA 4APCA 3SA0A 3R7OA 3UVQA 3GBZA 1NXKA 4NFMA 3SQQA 4BF2A 4EOMA 4FIJA 1NVQA 5FD2A 4CLIA 2XNPA 5HGIA 3FXZA 3A7JA 4RX8A 4J7BA 4A7CA 4FZAB 2W4OA 2W1GA 5H8GA 5KNJA 3GOPA 3HV3A 5HHWA 5JFVA 1PKGA 2WTIA 3S3IA 3KXNA 5HLWA 3OY1A 4TRLA 3BCEA 4XOYA 2UW7A 4EOPA 4F65A 2GS6A 2BRNA 4AP7A 3D0EA 4LOOA 1W0XC 5AIRA 3DLSA 3EZRA 3H9OA 3LCDA 5LVMA 3BLHA 4N6ZA 4QYEA 5E9EA 3PA3A 2ACXA 1M7NA 5CEOA 4I5HA 4YTCA 2WTKB 2Y6OA 3R6XA 3L8SA 4FA2A 4IAKA 4ZSEA 5M51A 4YJPA 5I9YA 5IQIA 2WEVA 4F0FA 1S9IA 1YOMA 4BTKA 4AX8A 4HJOA 2C0IA 4AA5A 1JKSA 2HOGA 4WT6A 2W4JA 3BLAA 4F9CA 4EQMA 3EQPA 3PZEA 1AGWA 1XBBA 2HY0A 4MCVA 5A6OA 2VO3A 3D14A 3IG7A 5DMZA 2XNNA 2R3RA 3PVWA 3ZOSA 5E1SA 4PF4A 2QG7A 2JDVA 3UYSA 4FYNA 3SDJA 3BU5A 4EHEA 3R9RA 4IADA 4IAIA 3H9RA 4EK4A 2RG6A 3UVPA 4LMUA 2J2IB 1I09A 2UVXA 3NNXA 1SVEA 2O5KA 1OPJA 3Q2MA 1JPAA 1BLXA 3FZRA 4UY9A 2PZRA 3ZFYA 3NAXA 4FV0A 4TT7A 4BZOA 1GJOA 3CS9A 4W4WA 2C6LA 5JGAA 1Y91A 3EKNA 3VUDA 2Z60A 4B8MA 3FKOA 4FG8A 2VTHA 4RC2A 2ETKA 4JDIA 5HESA 5LMAA 4A06A 2XALA 3N4UA 4RGJA 4EOSA 4IX3A 2ZM4A 2ZM3A 2OIBA 1YXVA 2IVVA 4N70A 3V6SA 4CD0A 4EOQA 3U6HA 2VTLA 4KBAA 2Z02A 5EQYA 2XIZA 2P3GX 4JIAA 4MD9E 5DRDA 2OJJA 4PRJA 3DJ6A 3VS3A 5I4NA 2X81A 5AV3A 1B6CB 1OGYA 1WVWA 3E88A 4F9BA 1YHSA 2UW6A 3R1QA 4G5JA 4I4EA 5I9UA 2YCSA 4HGSA 4EOKA 4L68A 5M4UA 3MTFA 4QEBA 5CQUA 2IJMA 4JLCA 1GZOA 3R9NA 2BZHB 3ZLSA 2YN8A 2XIRA 1H1QA 1KE5A 1WBPA 4YLLA 2CGXA 3EYGA 2VWBA 5BVFA 3BEAA 4OTQA 5IKWA 4Z7GA 2IEWA 2QODA 4IFCA 3FC2A 4HGEA 4CRLA 5HIEA 4IZ5A 3DNDA 5EM8A 4AN9A 5KMJA 2FA2A 3L9LA 5D1JA 1STCE 2RL5A 3FV8A 2FGIA 2GHMA 4D58A 3R8MA 3VUKA 2XBJA 3VIDA 3UMWA 3AG9A 3VBQA 4A9RA 3RZBA 4FSRA 4M67A 5CENA 4TL0A 3R28A 4F4PA 5IEXA 3ZM9A 4I92A 4IQ6A 4OAVB 4UALA 1ZWSA 4RIXB 2HZNA 4YJVA 5HLNA 2XK6A 2J5EA 2R3KA 3HV6A 4OBQA 4QT1A 4QTCA 5JSMA 2C6DA 4O2PA 3TG1A 4GYGA 3KXHA 2UW9A 4FODA 3OW4A 1ZYLA 3AMBA 4A4XA 2XNEA 1KV1A 3ZLWA 4DC2A 4HCVA 1M2RA 2X9EA 4IWOA 4O1OA 4R3PA 4TWCA 4FI1A 5CT0A 2YDKA 4K33A 4ZJIA 3MW1A 3FPQA 4BCMA 4D2TA 4O81A 2YABA 3VS0A 4CXAA 3HUCA 5ANIA 1W8CA 4I0SA 5HG5A 3JVSA 5K4JA 1IASA 2W99B 1Q99A 3QKKA 4NUSA 3ODZX 3RCJA 4EOIA 2AUHA 4V05A 4XMOA 5GJDA 4D4SA 1Q8TA 3VF8A 3TN8A 3R8UA 2W1EA 4RJ4A 5DNRA 1DI9A 2UW8A 4I24A 4MKCA 4XRLA 4USFA 2X6DA 4WBBB 4DFXE 2WMQA 4FG9A 3W0NA 3QL8A 4J8MA 4FG7A 3W32A 1UVRA 3C50A 1K3AA 1BL6A 5KHWA 2RSVA 4FZFB 4C4GA 3QX2A 4FSZA 3UQGA 5BVOA 4FT3A 4LUDA 3NCGA 1BI7A 2NRUA 3FL5A 3MH3A 3G51A 4MWIA 3VUGA 2QQ7A 2XIYA 4KIQA 4UZDA 5H2UA 2OLCA 5IQGA 4HGLA 4JG8A 5BVEA 4DH3A 4Y5HA 3UPZA 3DKGA 4MUQA 4UX9A 1U5QA 4O27B 3RAIA 3RHXA 5A4EA 2Z7SA 5J7BA 2F7EE 2PE1A 3RBWA 3AMYA 3ZMMA 2C69A 3P0MA 3BRBA 5CZIA 2PK9A 4EH7A 3TYKA 2XS0A 4RMZA 4WSQA 3F3VA 4MXAA 3G2FA 4DHFA 2GNLA 3TDWA 4MXOA 4D2SA 4DTAA 2B7AA 4ACCA 1R3CA 3NUAA 1J1BA 3V5QA 4F9YA 3DA6A 4GK4A 4ALWA 2A19B 2WOTA 2OZAA 5A4CA 2JITA 3OBGA 2XRUA 3VRZA 3Q32A 5CAPA 4L3JA 3G15A 2WMVA 4DT9A 4XV3A 2PPQA 3AD5A 4PUZA 4D28A 3F2RA 5EW3A 2BRBA 2QOBA 4O7RA 3R8PA 1LEWA 2ITWA 4RIWB 1WBOA 3A7HA 4I20A 3ZO1A 4LFIA 2OWBA 3DBDA 1J7LA 4D0XA 3RAWA 3ACKA 5HE2A 3ORIA 4FSYA 4G9RA 4ACGA 2PSQA 4UBAA 5AP5A 3SC1A 4KIPA 2DUVA 3ULIA 4BWXA 5BX0A 3KF4A 4YZCA 4O0TA 3W0MA 1NY3A 5L3AA 5TO8A 3BV3A 4FTRA 4ZEGA 3QU0A 3O8UA 2YIQA 3PXYA 4H39A 3QLGA 5CT7A 3UIMA 4QDVA 3VUIA 1OIYA 2GS7A 5EDPA 4ENYA 2XIXA 3A8XA 4KKGA 3D2KA 4OUCA 3F2AA 3UOLA 5IZFA 2F7ZE 1M2PA 3TZ7A 1BKXA 1X8BA 2RG5A 5FEEA 4X0MA 4PP9A 4C36A 4QPSA 3FLWA 2NYAA 5EH0A 3KMMA 5GZ8A 2IG7A 1YW2A 3QYZA 4ASEA 4XLIA 2YIXA 3HL7A 3L8VA 1DS5A 3Q9XA 4NZWB 1U59A 4ENXA 4FOCA 4QQCA 3O71A 2H6DA 5F20A 1OBGA 3NFGB 4AT4A 1PY5A 1GIHA 3O7LB 3DOGA 4AF3A 5LCJA 3LFFA 4IWPA 2JD5A 3QA8A 4BJJB 4O1PA 5FRIA 1IA8A 3CE3A 2IW6A 4GYIA 5DGZA 2JEDA 4CNHA 4F64A 3FY0A 4P5ZA 2IZRA 4UYNA 4YMJA 4EZ5A 2W1ZA 3GUBA 4KIKB 3WARA 5L6OA 2W1IA 5LVOA 2I0EA 1E9HA 4NIFA 5EKOA 3SOCA 1REKA 4QMSA 4EK8A 4ZIMA 3T9TA 5CU2A 3UODA 4TYIA 3C51A 4OAUC 4E8AA 3PIYA 4NL0A 2VTQA 3EZVA 2XB7A 1TQMA 2VNYA 5E90A 5A14A 3C0GA 2OICA 4FTLA 2QHNA 2ONLC 4LGGA 4XCUA 5EQEA 4FKTA 2JBOA 2J6MA 3OXZA 4AFEA 1UKIA 5L4QA 3E87A 3QHWA 3O2MA 4FV6A 3Q53A 4G3GA 4A4OA 3FLNC 5CEQA 4U8ZA 3COHA 2QG5A 3NVKI 3ZHPC 5M57A 5IH5A 3UP2A 4HVSA 3DKFA 2PVLA 2HAKA 2YIYA 4FSMA 1H25A 1CSNA 4PDYA 4OTFA 3FHIA 2OBJA 4JDKA 2P4IA 3HA8A 4JS8A 3FSFA 2ITXA 3BEGA 3IOPA 3NRMA 4QNYA 3TDVA 5E4HA 2ITTA 5BYYA 3O96A 4YJSA 1PJKA 5BVDA 5TKDA 2PU8A 4ASDA 3UNZA 1J7UA 5HG7A 3RP9A 5FXSA 4KWPA 4LV8A 1QPEA 4JAIA 4NIFB 4RJ5A 4DFYA 4KINA 2NPQA 2X2KA 3QHRA 4C3PA 1OMWA 1CTPE 1U54A 2J50A 3PP0A 4BDIA 2ZJWA 2WEIA 3PJ8A 4DT8A 4IC7A 3UP7A 2Y6MA 4PP7A 4RZWA 2W4KA 2BRGA 3PE2A 3QCXA 3WF8A 2OZOA 3C4ZA 4ZTSA 5HCZA 3NFFB 3ORTA 4AZFA 2ZAZA 3MPMA 4XP0A 5FEDA 5AEPA 5HG9A 2OO8X 2PWLA 3T8OA 3A7IA 3QRUA 2VZ6A 4CMOA 4W4XA 4QD6A 1Q8UA 3F61A 4RIOA 4AU8A 1R0PA 2FUMA 2NO3A 3QWJA 4U9AA 4E6AA 5CI6A 5AP3A 2Y7JA 4E4NA 3BL9A 1BMKA 4AAYA 4RLLA 3CPBA 3I60A 2QD9A 3CQWA 3PPJA 3VQUA 2ZDTA 3Q4TA 2WTDA 5ACBC 2JLDA 4K18A 5DI1A 4MD7E 1OITA 4PDSA 2CCIA 2HELA 5ANOA 4RIWA 1A9UA 4FTAA 4FRFA 3KEXA 2CNUA 3EFJA 2RIOA 2WTJA 3P08A 4E5AX 1WCCA 4FC0A 1PMEA 3FMLA 3LXLA 5J9LA 4BC6A 4EHGA 3FI3A 4FNWA 1Q61A 4BCJA 4DEAA 1P14A 4I4FA 2FSMX 3ZFMA 5FEQA 4AOJA 2XAMA 3UTOA 4OW8A 2WAJA 1SNUA 4MWHA 1TFFA 4IM2A 4TYHA 2BROA 2ZFYA 2BDJA 3PG1A 1U4DA 4IVBA 5EM5A 4ONAA 3VO3A 2ZMCA 4D2PA 3CIKA 3IS5A 4X2FA 4DFLA 2AC3A 4ITHA 4FL2A 2X2MA 4IB1A 4J53A 4C37A 1XJDA 2C3IB 2BDWA 4WNOA 3PP1A 2PULA 3A8WA 4KIKA 2HENA 3KK9A 3DQXA 3G6HA 3ORXA 4EOOA 2NNWB 3PDTA 3PXFA 3LXNA 4IIRA 4EHVA 4IDVA 2QVSE 3VW6A 4PTEA 4C8BA 4IWDA 4Q5HA 1V0OA 3Q5ZA 5DYJA 1PW2A 3TKUA 3AKJA 3RM6A 1H08A 4FTOA 4GRBA 4U40A 5AUVA 1DAYA 2V62A 4FKSA 2E9NA 4CG8A 4GUBA 1W98A 2AC5A 5CX9A 5B7VA 4JVGA 2WPAA 3ACJA 5LVNA 3EQRA 1UNLA 4ZMEA 4U43A 4IVCA 3MI9A 3Q5IA 3HP2A 4E4LA 1VEBA 4MEDA 2YM5A 4ANBA 1RJBA 4UMTA 1W83A 2P33A 3WZKA 4HYUA 3E63A 3FMHA 5AP0A 2UW3A 5A9UA 4J97A 5TOZA 2EXEA 2HWPA 3SW4A 3FLYA 4IX6A 2CGVA 3MB6A 4ZP5A 3TCPA 2C30A 2QOOA 2Y8OA 3CQEA 2CMWA 2YFXA 3ORZA 2ZVAA 4GG7A 3BYVA 1BYGA 3LCTA 4MVFA 4MBLA 5HE3A 3R9OA 4DBNA 3OOMA 3MY5A 4ZTNA 3GNIB 5AADA 4IAYA 5HX8A 4MF0A 3KKVA 3R7IA 2YIWA 3NSZA 1PXOA 1ZAOA 3FYKX 2W1DA 3I81A 4JBQA 2Q0BA 3NUYA 4X3FA 4ZTRA 3POOA 3HKOA 3LFDA 3LM5A 2VO0A 2R7IA 3GU4A 1OIQA 2WHBA 4NKSA 5EYKA 4X7QA 2YCFA 1OIUA 2WMWA 3ID6C 2BIYA 3GCPA 5HCXA 3VW8A 4AXCA 3KCKA 2OXXA 4HZSA 4PTCA 3IDPA 3NCZA 2X7OA 3PVGA 3D5WA 3QZGA 4O7YA 1PMVA 3EB0A 1YOLA 3RINA 3PLAE 2W1CA 2Y4PA 5HICA 5CU6A 4LQMA 3HLLA 2IVSA 4F0IA 4FKOA 2PUIA 3MTLA 4U42A 5CWZA 2YERA 3HDMA 3TNHA 4BZDA 3F5UA 3S1HA 5M4FA 4GS6A 4I0RA 4RWKA 4BWKA 3R7VA 5K0KA 4Y8DA 2CDZA 3SXFA 4BI0A 5KBQA 3UGCA 4FK6A 3ZH8A 3FSKA 4RJ6A 4FKJA 2YITA 4PTGA 1PYEA 2X6EA 2JIIA 2B4SB 4MQ2A 2Z7RA 3HDNA 4RFYA 1YXUA 5E91A 3V3VA 3W2SA 5C01A 5KMMA 3VONA 4KA3A 5CEKA 2E9UA 4YPSA 4NWMA 2ITPA 2I0HA 1AD5A 1ZYDA 2IF8A 4RVMA 4FEUA 5DE2A 3TJDA 3DJ5A 3PPKA 5L6PA 5L8LA 4CSVA 2R3QA 3E3PA 3EFLA 3R00A 3ZC5A 4AAAA 4BL1A 2A1AB 2IZSA 1FVVA 3HAMA 4WUAA 3IW8A 5HG8A 5D7VA 5HBHA 4PMSA 4LG4A 2EXMA 5AX3A 4BIEA 3JR1A 1TVOA 3GC0A 3DB6A 3QAME 4IM0A 3TZMA 3WZJA 3BI6A 3DS6A 4GT3A 1XWSA 3MGYA 4YTIA 3A62A 4D2RA 4R7IA 3HVCA 4CFNA 2JKMA 3HRFA 2F2CB 3RK9A 3QD0A 4LRMA 4BIBA 4E3CA 4CG9A 4I94A 1BL7A 1JVPP 1PMNA 3TTIA 4DGOA 4FL1A 1W82A 1WFCA 2JDOA 5L2SA 3R71A 1PXMA 4H58A 4Q9SA 4WRSA 4MXZA 3MDYA 3OD6X 3RNYA 3VS7A 4ARKA 3ALNA 4CMTA 2R0UA 4F6WA 3E7VA 3LCOA 3P4KA 4E4XA 4BVUA 2CN8A 4PV0A 4TPTA 5LWNA 3CR0A 4CFWA 2GDOA 3FZOA 3ZSHA 4AN2A 3FI2A 5HIBA 3OOGA 2I0YA 2YDIA 2W06A 4KIOA 3AKLA 3ORLA 4X6QC 2PZ5A 1G8AA 5IH6A 2QR7A 5LWMA 4AW1A 3HUBA 2F2UA 2OJFE 4E73A 3QALE 4I0TA 5E8XA 4DGNA 4G3EA 4HNIA 2YWVA 1FVRA 3QTZA 3KK8A 2LGCA 3AC1A