3ZLYA

Crystal structure of mek1 in complex with fragment 8
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
343
structure length
310
Chain Sequence
LELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE KINASE 1
publication title The Use of Virtual Screening and Differential Scanning Fluorimetry for the Rapid Identification of Fragments Active Against Mek1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 100
structure length 310
sequence length 343
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2013-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zlyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zlyA01
4O7TA 1SVGA 1QMZA 3ZXZA 4O7LA 4FKJA 2PUPA 1Y8GA 4A4XA 2GPHA 1F3MC 4UV0A 2IG7A 3L8PA 3ZS5A 1H01A 5BUEA 5KMOA 1JKSA 2I1MA 1BX6A 2IN6A 3HX4A 4LQMA 4WBOA 3SVVA 3UJGA 3FYJX 4FV5A 2A27A 3F88A 2WAJA 4CQGA 3SRVA 5IH4A 2A4LA 4C02A 4M84A 4EWQA 2BRGA 3CD3A 3CIKA 4MXYA 5CZHA 4CRLA 3OWLA 1PYEA 4BCHA 4TKSA 2W9ZB 3LIJA 1BUHA 3Q4TA 2VX0A 2ZM1A 5E8UA 4N0SA 2RFEA 3G51A 4YBKA 5F20A 4EH4A 4EK4A 3FZSA 4L45A 5HD7A 2YWVA 1ZYSA 4BKYA 3POZA 4F65A 2JKOA 2VTMA 3QUDA 2Y6OA 4GK2A 4UEUA 4F70A 4UMUA 1CM8A 2OKRA 2Y7JA 2WMSA 2BZJA 2XNEA 4U97A 5GJFA 2GNLA 3N4VA 2ZMCA 4O6EA 3EKNA 4P90A 2J9MA 4XLVA 2X7FA 2ETRA 5ITAA 1SMHA 2BRHA 2W1ZA 3NNWA 4LOQA 4AZFA 4MD7E 4I4EA 3QXOA 4ANSA 4PDYA 1FGIA 3SW7A 3DKOA 4ZSEA 1YDRE 2QOCA 1M2QA 3KXMA 5GIPE 3DBEA 2VTSA 3KXGA 5A4EA 5KZIA 5A4LA 4USFA 3KXXA 5IG1A 4Q9SA 4OAUC 5K5NA 5AA9A 4BDEA 4OLIA 2CSNA 4FKTA 4J1RA 2BALA 3PUPA 2W1EA 4FZ6A 3QD4A 4HYUA 4QD6A 5CU6A 3TTJA 3WE4A 4EOIA 2PMNX 4YLLA 4F0IA 5EM8A 2F2CB 3NYNA 4EZ5A 4EOOA 4ZY4A 1W84A 5JGAA 1Q24A 3LJ0A 2CGXA 1CTPE 1Q8WA 4RIXA 1UVRA 3MVLA 2BPMA 3PY1A 4G3DA 4I0SA 2J0KA 4KABA 4KWPA 5JN2A 3MVHA 3QX2A 4IX3A 4O27B 4TYJA 3ORMA 4QP6A 4JVGA 4XH6A 5AAEA 3LLAA 3FPMA 2ZB0A 3R02A 4RA4A 5KHXA 5JFXA 4IAIA 4V04A 4BVUA 4GYIA 3GT8A 4ZY5A 3UO6A 3SG9A 2ZJWA 4Y95A 1TQPA 2VWWA 3V5WA 4AA4A 5JZJA 4OTGA 5HO6A 5BUIA 3Q5ZA 2ITXA 1YDSE 3MDYA 4F1MA 2XCHA 3RAIA 3PPKA 2WQMA 5KMJA 4GFOA 4JOAA 4XUFA 4YSMA 3LPBA 5L8JA 5C27A 5CU2A 4C59A 4DGOA 3C0HA 3K5VA 4F9YA 4N4SA 4KSPA 2QVSE 3KMMA 4NFMA 3ID6C 3GU5A 4O7RA 4U0IA 3BELA 4O91A 3C7QA 4NT4A 2WQEA 1OITA 3FLQA 5TT7A 1Y6AA 4GT5A 3BU6A 2W5HA 4J99A 4TN6A 2OI4X 4QP8A 1U59A 2W4KA 4RIWA 4L00A 4NL0A 1UWHA 2VWYA 3B2TA 5AUTA 4XG2A 5EHYA 1ZOEA 2R64A 3I60A 3JY0A 1RDQE 3CTQA 2HK5A 5I0BA 2AYPA 3B2WA 1U5RA 2VZ6A 3MB6A 3DQXA 3QTWA 4DGMA 2B7AA 3KA0A 3WE8A 4FVQA 3QQFA 4G5JA 3OCTA 3R8PA 4GKIA 3LXLA 3DXNA 5D10A 5ACKA 4U7ZA 1UKIA 3OW4A 2Y4IC 5EDRA 3R7VA 4HNIA 4QP1A 4AG8A 4IVBA 3U54A 3ODZX 5HO8A 3FSKA 3FUPA 5EI2A 4GJ3A 2ITPA 3RNYA 3TJDA 4AU8A 4UB7A 3CPCA 4AT3A 4ASDA 4DH7A 1DM2A 2YIXA 5E1EA 4FMQA 4FSNA 5EKOA 4CLIA 3DZOA 1Y57A 4EBWA 3COHA 1ZYLA 2JLDA 2W0JA 3KRXA 3MTFA 3O8UA 4K18A 4UN0C 2NNWB 3VQUA 2JFLA 5TR6A 3NSZA 4U45A 3Q9YA 4D4YA 4C33A 1PXIA 2EB3A 1NVQA 3ORIA 4RT7A 1PY5A 4K0YA 4MQ1A 3LFAA 3W2QA 1YOJA 4JQ7A 3VUHA 1ZAOA 4RX8A 3NAXA 4L43A 3GQLA 3FJQE 4BIDA 5IQCA 3C51A 2OGVA 4MNEB 4BIEA 1Q5KA 2WMXA 2C6OA 4N6ZA 4C3FA 4KS8A 1YHWA 1YDTE 2GDOA 2UZWE 4BI2A 2QOBA 3CQEA 4KBAA 5ANEA 2WOUA 3ACKA 4YHJA 3FXXA 1R39A 2C6EA 3DNDA 2UZDA 3QD3A 2PVYA 3ITZA 5A3XA 1M17A 3AC2A 3ORXA 4L3LA 2B9IA 3R9RA 3DFCB 3MJ1A 4FTOA 4XBUA 4EH9A 3UZPA 4FIIA 4CFNA 3R6XA 2ITQA 3BGZA 4EK3A 3VULA 3R1QA 4CV9A 2HY0A 3RALA 2PZPA 2VGOA 3V5TA 4F0GA 4YUQA 4RC4A 5HNBA 4O0WA 4LL0A 1KE8A 3VS0A 4KKGA 2QI8A 2YAKA 5EH0A 5DR2A 4YC8A 2A0CX 2VUWA 2BDFA 5ANKA 4GT4A 5CT0A 4LGDA 1XH9A 2YIQA 4O7YA 4MTAA 2PUUA 1BI8A 3Q04A 4N70A 4BWXA 3HLLA 2C3LA 4HZRA 4XHKB 2HW6A 4E6QA 2R0IA 4K6ZA 3H9RA 2QNJA 4I6HA 1JWHA 2AC5A 1OIUA 3WI6A 4KRDA 3PLAE 3PZEA 3DTCA 2XNMA 1Z5MA 2PE2A 3TV6A 4USEA 3H10A 3MPMA 3TV4A 4G3EA 4YLJA 4F6UA 1OGUA 4QYEA 1YWNA 4KRCA 2QOQA 3T9TA 3ZMMA 5JFWA 1ZXEA 3ET7A 5EYKA 5KHWA 3ZSIA 4MH7A 1LP4A 4IAAA 4PUZA 4Y46A 5DFPA 4S30A 5IEXA 2X0GA 3HAVA 2ZAZA 1JKTA 3FHRA 2OG8A 2W1HA 1XH5A 5IISA 1YHVA 3OHTA 3V5QA 3VN9A 4QMXA 3ZM9A 4XS2A 3VBTA 2XNGA 3BV2A 4Z55A 3PVBA 2R3FA 4FF8A 1FVTA 2IWIA 2I7QA 2W7XA 3MPAA 3OG7A 5HLPA 4CFUA 4ZTLA 1KE9A 3OOMA 4NM5A 2WMTA 4XMOA 1PXMA 5EYCA 4O96A 3FKLA 3FI2A 1HCKA 4I6FA 4MKCA 2BTSA 3VS3A 1U54B 3LFNA 3DBQA 3BYVA 4CNHA 3D14A 5FLFA 2BDWA 1GOLA 3S1HA 3NDMA 2PVNA 4J98A 2Y4IB 4F9AA 3IW8A 3CLYA 5A4CA 5KMIA 2YDIA 2C47A 5DGZA 2A2AA 4WIHA 4RIYA 3NAYA 4H39A 2PK9A 4U79A 3WF7A 2I0YA 3KCFA 2HW7A 3GEQA 3ERKA 2Z7LA 4U44A 3E62A 3PWYA 3RI1A 1NVSA 1VR2A 2XJ2A 4RPVA 4XG6A 5HBEA 3COMA 3ZEPA 2VX1A 2X4ZA 3O51A 1H28A 2BDJA 3KN5A 2R3HA 4K33A 4D4SA 4RX5A 3P23A 3TZ8A 3UYTA 4JLCA 2HZ0A 3PY3A 3MFSA 3OWKA 2VN9A 3FMJA 2JKMA 3SD0A 4AN3A 3MESA 3I0QA 5GIOE 4C3RA 4YZMA 4IWOA 4U41A 3KKVA 4CFXA 2QOOA 3CSVA 2BROA 2GFSA 3FQHA 4DN5A 3QX4A 1OB3A 3KL8A 4AGDA 4IQ6A 1MQ4A 2XIXA 4ASEA 2Y0AA 2RL5A 4U5JA 5GINE 5AR3A 2WFYA 4C4EA 2YZAA 2CMWA 5I3OA 3EOCA 4F6WA 4NYEA 2WKMA 4ID7A 3R63A 3LQ8A 2IW6A 4JDHA 4EI4A 1PXLA 5L2SA 4RMZA 4AZTA 5CAOA 4S34A 3MFTA 4DH8A 5H8BA 2C3IB 2XKCA 4IHPA 1TVOA 1PKDA 3ANQA 3EQBA 5I3RA 1UU7A 3WIGA 4B8MA 3QYZA 5CS6A 1H0WA 4QPAA 4BCIA 4D2SA 1KUTA 1BKXA 4DHFA 2YCRA 3UOHA 2F7ZE 1JKLA 3UIUA 3ZUTA 5G1XA 4PNIA 5CSHA 4QMPA 5BVOA 1WCCA 4I22A 2YM4A 2UUEA 1A9UA 1CMKE 3GFWA 5L2QA 3VWAA 3CGOA 1JSTA 3LFCA 3F7WA 3R00A 3ZSGA 4IDVA 2JC6A 1HOWA 4Y5HA 3SDJA 4F9CA 3A62A 3G9NA 4YJUA 3KRLA 5AP5A 4CZUA 4IX6A 5LWMA 2W99B 4NIFA 4YZBA 1M52A 1REJA 3C0IA 4G3FA 4ZS0A 4EKKA 3BKBA 4TW9A 4XP2A 3KF7A 1FGKA 4R1VA 3HMOA 5AUUA 3S0OA 2C6DA 1VEBA 3G15A 3NNXA 4MF1A 2SRCA 3P79A 2IPXA 2CN8A 4F9BA 4FNWA 4ANQA 4IMYA 3L9NA 3GC0A 3D0EA 4FV3A 1MP8A 3KQ7A 3GP0A 4O38A 2OIBA 5EHLA 3VC4A 4YC3A 2HXLA 3PJCA 2XA4A 4FSMA 3EL8A 2OU7A 3PIZA 4BZOA 2GHGA 3UQFA 2JBPA 4FV2A 4Q2AA 3KC3A 2XUUA 4PTGA 1UNGA 1GZNA 3TXOA 2G2FA 3OS3A 1NXKA 3PSCA 4R7IA 2W1FA 5BVFA 3EN6A 4HGSA 4A9TA 4D4RA 3RPVA 2Z8CA 1B38A 4IEBA 3TEIA 3OTVA 4IZAA 2NRUA 2PMIA 1E1VA 3JXWA 3N51A 4K8AA 5CVGA 4CQEA 5L2WA 4HGEA 3A60A 2C6IA 3FKOA 2ACXA 4JR7A 4TNDA 5IQGA 2QO9A 4IC8A 4FKUA 3KXZA 4CD0A 1IAHA 1XKKA 4EJNA 2V62A 3Q6UA 3QTIA 1YXTA 1M2RA 3WZDA 3U8WA 2BAQA 3F69A 3DK3A 4B99A 5LWNA 2Y9QA 5KE0A 3ZH8A 3VUTA 1YXXA 2XS0A 4C35A 4YJTA 3LM0A 1AGWA 5CEPA 5KMMA 2Z7QA 3FAAA 1YRPA 4J96A 3ORPA 2CCHA 4R8QA 5AR5A 5DRBA 3TI1A 3ORNA 1L8TA 4A7CA 4ZS4A 2X4FA 4FKQA 4EOLA 3DS6A 3EL7A 3Q9XA 3LCKA 1FMKA 4LUDA 5IMEA 5KNJA 4HJOA 2YABA 3QD2B 4D9UA 3D7TB 4JX3A 4E20A 2J50A 3R7YA 2QHMA 4EQCA 3MW1A 5E8WA 3TDWA 4ANBA 4DGLC 1H4LA 5K5XA 3U55A 5JQ8A 4C4JA 3PJ1A 4G34A 5EOLA 1MRYA 4ZTSA 3V6SA 2UW7A 2RG5A 4GUEA 3RINA 5HVYA 5DG5A 3FXWA 3QLFA 4LYNA 2F9GA 4XJ0A 2VTLA 2XJ0A 3H9FA 3EIDA 2VTOA 5D41A 3U9NA 2JBOA 2QU6A 3ELJA 1QPCA 3O50A 3PIYA 2WU6A 4CFVA 4CXAA 5A4TA 1DAYA 3V5PA 4KIPA 4I3ZA 1BYGA 4IACA 3GC8A 5DT3A 1R78A 1WVXA 2OW3A 4J97A 3ZXTA 3MIYA 2XYNA 3HMMA 1F0QA 3KF4A 4DH3A 3D15A 2BCJA 3IK3A 2X7OA 3FC2A 3R22A 3RWPA 2UZEA 2FYSA 3ROYA 1V0PA 5AR2A 4YBJA 3JYAA 4BDHA 3LW0A 5HNIX 3DDPA 3PXYA 3KULA 3NYVA 4UMQA 3E8CA 3BHTA 1P4OA 4HYHA 4HYSA 4QQTA 5AADA 1KOAA 4WT6A 2YFXA 2VWVA 3EFKA 3P7BA 2Q0BA 4DFUA 3SXFA 3C4ZA 5DA3A 4RLKA 4X3JA 5FEQA 3SRVB 5CU3A 4F7NA 5B2LA 5I9XA 1T46A 5LOHA 3Q60A 2JITA 4AN2A 5M57A 2C5OA 3MI9A 1PF8A 4BCQA 4G31A 3IW4A 3PPJA 3QQHA 4ITIA 3BLRA 5BVDA 5E8SA 2PVJA 2CHLA 5HCZA 3H4JA 2NO3A 2IO6A 1OI9A 3JY9A 3EKKA 3FWQA 3FMHA 2PZYA 3TUDA 3TKIA 1SM2A 4G16A 4EH2A 4E26A 2X8DA 1GIHA 5L8LA 4FL2A 4I94A 4ITHA 5HVJA 5IA1A 5DBXA 4YSJA 2LAVA 5LCJA 4BDBA 4ZSAA 1ZY5A 3PXFA 3UODA 4MXAA 3M1SA 4AXAA 2OIDA 1OPKA 4AGUA 2OF2A 5HICA 3QCSA 4U43A 2QOLA 3LE6A 4M0YA 4QMSA 3AC4A 4JG6A 4HCVA 2FSTX 4IVDA 3L8VA 4JDKA 5JK3A 3P86A 3S2PA 5M53A 3QTQA 5HOAA 3K3JA 3W2CA 4GS6A 3P1AA 5CALA 4I41A 2ITYA 1UNLA 1E9HA 3OFMA 4YC6A 2IVTA 2CKEA 1IRKA 3DV3A 2CKPA 2X6EA 4MBIA 2R3PA 3QBNA 3VUMA 4AGWA 4CCUA 4CSVA 5M07A 3SV0A 1OM1A 1SYKA 3W16A 4RIXB 4WA9A 4E6CA 3BYUA 3OD6X 3WOWA 5BYZA 3F7ZA 2WMQA 4LI5A 4BRXA 3FYKX 2XP2A 4DTAA 3K54A 4FT9A 4FIFA 4OBOA 5E7RA 4I6BA 4JRNA 1WBTA 1YI3A 2UV2A 2JAMA 3AMAA 3MS9A 4O22A 4AE6A 3DJ7A 4CRSA 3MB7A 1QPJA 1UU8A 3PXKA 4G6LA 5HTCA 1RE8A 4CFMA 5ANOA 4L7SA 1IEPA 2UZNA 1XJDA 3PJ8A 1SNUA 1S9IA 3WZEA 4V01A 3ZO2A 4X21A 3QTZA 3GOKA 5E1SA 3U4UA 1Q8ZA 4XCUA 4IWPA 4KIOA 3W2OA 5AUWA 2H9VA 5IEYA 3NGAA 3O7LB 4KIKA 3OVVA 3EMGA 3FMKA 3W8QA 5E92A 4WG5A 2CLXA 5T3QA 2ETMA 3RZBA 4OGRA 4D2TA 4HVGA 5HTBA 4D2PA 4FNXA 3H30A 5DNRA 2XIZA 4L67A 3BIZA 4GVJA 3GFEA 4W8EA 5DHJA 4PNKA 3SOCA 3KREA 2R3MA 4O7ZA 2WGJA 3R7GA 4RIWB 3QRUA 3MH0A 4FYNA 5B2KA 3EQGA 4OTIA 5AIKA 4AZWA 3R01A 4RVLA 5CT7A 3FMDA 4BDDA 3VUIA 4BI0A 5AUXA 2BRMA 2WTVA 1PHKA 5IQFA 1GIJA 5AIRA 4K2RA 4R5YA 3PE2A 4QMUA 3BHUA 4ALVA 1LEZA 2J6MA 2AC3A 2HZNA 2VNWA 3DOGA 3RK9A 3DQWA 2BMCA 4BDFA 4W4YA 3HMPA 2BIYA 4LRKA 2UW3A 3H0ZA 5DEWA 2OXDA 1KWPA 2XNNA 3BYSA 3G33A 4FI1A 4IVCA 4BDKA 1O6LA 4ZP5A 4RWJA 4AX8A 4ACMA 1ZLTA 2J0IA 3EHAA 3TTIA 5D1JA 3Q53A 4YP8A 3CPBA 4FSTA 5AR8A 4M69A 4RA5A 5CSVA 2ZV2A 3K3IA 4NTTA 1M2PA 1ZMWA 4Y85A 3JVSA 1H26A 3DKCA 3KVWA 4IH8A 2UZTA 2QHNA 2WMBA 3K2LA 4FX3A 2JDVA 3F82A 4HPTE 4IBMA 4HCTA 4D4VA 4F09A 4GU9A 1H1RA 3FQSA 3GCQA 2X1NA 4FL3A 3THBA 5FP6A 5LCKA 3EQFA 2X9FA 2YITA 4HVHA 3HNGA 2ESMA 1Y91A 2H34A 4IWQA 3LFBA 3R9HA 4O1OA 4FG7A 4FT7A 4OW8A 3UP2A 3PVWA 2WMUA 2XIYA 4KA3A 4TRLA 2PYWA 4A4LA 2P4IA 3QALE 4G1WA 3BI6A 5AP6A 5HHWA 4I21A 5TOZA 3TCPA 3O8PA 3SG8A 2UW4A 4OUCA 2X9EA 4IWDA 3DBFA 4XYFA 4WKQA 4FEWA 2R7IA 2WELA 3LJ1A 4QP2A 3QTXA 5DEYA 4CYIA 5CAQA 4G5PA 3HUCA 3HP5A 2VV9A 4NJ3A 4DTKA 5KMKA 3QTSA 4I4FA 3IW7A 4D2WA 4O1PA 2A1AB 3BLHA 4F6SA 2WHBA 4R78A 2CN5A 4M14A 2JDTA 3EYGA 3UE4A 4P5QA 5E91A 4DCEA 2GS2A 4DF3A 3LFFA 2VWZA 2VU3A 2XK9A 1IG1A 3S3IA 4B9DA 2O63A 3COKA 4CTCA 1ZYJA 2JFMA 5EKNA 2DS1A 3R73A 3TUBA 4GVAA 3Q3BA 4KKEA 5HZNA 5A54A 2HZ4A 5HESA 2F7EE 4FODA 4JBPA 5IQHA 2OICA 2H96A 1UWJA 3DPKA 2UVZA 3WIKA 4L3PA 3VJNA 3WF9A 3ZYAA 5LMKC 5IDNA 2PMOX 3A7GA 4KINA 4L44A 2EUFB 5FM3A 4WSQA 5EYMA 3SKCA 4F7LA 1JSUA 2OZAA 2VRXA 3HGKA 3I0OA 4MXXA 4BWPA 5DR6A 4WRSA 2JIUA 3HDNA 5CSWA 4DEGA 2G9XA 2O2UA 2ZDTA 2PY3A 5FXRA 2C5VA 2V0DA 2Y8OA 3OT3A 3IPHA 5T6KA 3VBXA 2YHVA 3PFQA 1WBPA 4O0RA 3C9WA 5HU9A 2YWPA 4DINA 5JZNA 3DNEA 4LGGA 4IZ5A 5JFSA 3DB8A 2BRNA 3E87A 4L8MA 2BHEA 1OIQA 2HXQA 2C6LA 5CF6A 5JEBA 2EXMA 4G3GA 4M67A 4ZSGA 4ZSLA 5J5SA 2GU8A 4PMTA 3HRBA 3W33A 3AQVA 4B8LA 3QCYA 1WVYA 4CEGA 5M51A 4JBOA 5IA3A 4I20A 2J5EA 4FT5A 4BCFA 3QWJA 5B0XA 2FSMX 4MBJA 3KVXA 4R3RA 5HIBA 5HNGA 1S9JA 3E8DA 1V0BA 4PPBA 3R83A 3TT0A 4ACGA 4R7HA 4H3BA 1YWRA 2ERKA 4EOSA 3MWUA 2RG6A 1QL6A 1GJOA 2R0UA 4Q5EA 3T8OA 4DLJA 4E4LA 4EHGA 4YU2A 4DAWA 5KMNA 4ORKA 4MVFA 5IUHA 3PLSA 3ANRA 3LLTA 3E88A 4XP0A 4YTHA 2W9FB 4PMMA 4BTFA 4NKSA 5D9HA 4B6LA 4NZWB 3RHXA 3TNQB 4HGLA 3V8SA 3W2SA 3NVKI 4FICA 3F5GA 1PMNA 3I79A 4RIYB 4UWYA 2NRYA 1H0VA 3CS9A 2X81A 5BYLA 4ZJJA 3POOA 3UG2A 2WZJA 3MY5A 4DFLA 2ITUA 5HI2A 4Z7GA 4F1OA 1OKWA 1Q8YA 3BQRA 2LGCA 4KBKA 3I6WA 1PW2A 2VTNA 4JRVA 1WZYA 3II5A 2OLCA 3UO4A 2FSLX 3QCXA 2YCFA 3L9MA 4MQ2A 2RSVA 2PE0A 4H36A 4C0TA 4O82A 4EUTA 4QYGA 3AT4A 3MY0A 1OL1A 5CENA 2VNYA 1PYXA 1OMWA 1GIIA 2OJFE 4L01A 4V0GA 3EQPA 1NY3A 1VYWA 2WO6A 5EW8A 5J9ZA 3G6HA 3N4TA 2X2KA 3A61A 4JBVA 4FBXA 1L3RE 2C6KA 1Z57A 1RJBA 4PPCA 2X7GA 4L46A 2B0QA 4NK9A 3ZLYA 4RGJA 3VUGA 2O5KA 5HD4A 3FSFA 4IE9A 1CKJA 5B2MA 1BL6A 3MIAA 3DKGA 4FNYA 5IQAA 2Z60A 3I1AA 4LGHA 5CSPA 3Q96A 4G17A 2XKDA 3O8TA 4EZ3A 3DK7A 4DE4A 4BCJA 4YNOA 5AV0A 2QOFA 2W17A 5EM6A 3NYOA 5I9VA 2VWBA 3OY3A 4BCGA 4C36A 3OROA 4D0XA 5ANIA 3R9DA 4W4WA 2XBAA 4FG9A 2J2IB 4GMYA 2WMRA 3PA5A 4BGHA 1KSWA 2R7BA 2VTRA 4UY9A 1A06A 5LVLA 3ZOSA 4ENXA 3RTPA 3F61A 4M68A 4BZNA 4XG7A 2FH9A 4XRJA 4BGQA 5EYDA 4W9XA 3SA0A 4MXZA 3R30A 1FPUA 4EHVA 4DEAA 3BBTB 4ZOGA 4DYMA 3MTLA 5M4FA 1OBDA 3UNJA 1R0PA 3OXZA 4DT9A 2PVKA 1Y6BA 3DDQA 4NIFB 4N57A 1H08A 3U6HA 4EH8A 4U40A 2ITTA 1YI6A 3TN8A 3LVPA 3ZZWA 3E63A 3C13A 4MCVA 2GNGA 1W98A 3EQHA 1ZZ2A 2IZSA 3AXWA 3MV5A 4Y5QA 4IFCA 3RAHA 5BMSA 3TZ7A 4XG4A 4IX5A 5FGKA 3PJ2A 2BTRA 4J53A 4GK4A 5E4HA 3OWPA 4C4GA 1CKPA 4BTMA 5FUTA 3TNIA 3FI3A 3I4BA 3EN4A 2OJGA 3LCTA 4C3PA 3WF6A 4AZEA 4E4XA 3A8XA 4QT1A 1YW2A 4RJ5A 4Y83A 4WRGA 1LR4A 4QTBA 1YXSA 4Q5HA 4IANA 3EZRA 3DJ5A 4HW7A 2F4JA 3ORLA 1YVJA 3CBLA 5AX3A 2DWBA 4BC6A 4BWKA 3GI3A 4RWIA 2E2BA 1SVEA 1LEWA 4ZJVA 3NNUA 3UG1A 3D94A 4BYIA 4IDTA 2ZV7A 4NFNA 2C1BA 2X2MA 5LVPA 2YCSA 1JSVA 3ACJA 3LCSA 2P0CA 2PZRA 3OTUA 4YPSA 5CAUA 5JMSA 5KBQA 2OH4A 4O0SA 3HKOA 4IM3A 1OKVA 4FV9A 3O71A 2XKEA 2PZ5A 3I7CA 3NCGA 5ANJA 3BX5A 4EOPA 3VS5A 3GGFA 2J0LA 5D7AA 2HYYA 4J95A 3PA4A 3UNKA 4WUAA 4X6QC 5HCXA 1T45A 2GHLA 3FL4A 4RJ6A 5CEKA 2QCSA 5M4CA 3HV7A 1ND4A 1ZOGA 4IM0A 3FXZA 4QMQA 4R3PA 1G5SA 3E92A 3EN9A 5IQBA 2WMWA 3UMWA 5JKGA 1ZZLA 4PMSA 4U42A 5ETIA 5AUYA 4DC2A 1JQHA 2WTIA 4IJPA 2REIA 3TJCA 3QHRA 3LCDA 3NW6A 4XV2A 5I5ZA 4FNZA 3V8TA 3EFWA 4RC3A 5HG9A 4FIEA 1Q3WA 5J87A 2BFXA 4DLIA 3Q9ZA 3PY0A 3QF9A 3R1SA 3A7IA 1FVRA 3C4WA 4TWCA 2CLQA 2CNUA 3DXPA 3QQJA 4O7VA 3VF9A 3LCOA 5FTGA 4M97A 4EWHA 1M7QA 3U6JA 3MFRA 2UZOA 4PDPA 2C68A 3UC4A 2IZUA 4FV8A 2C3JA 4F08A 3LMHA 2V22A 5HBJA 4QMOA 4QRCA 4QPSA 4E5BA 1OBGA 2YISA 4NSTA 3IGOA 5FD2A 4O7WA 2E9OA 2C3KA 4J8NA 4RLLA 4APPA 2CKOA 5IQIA 4WSYA 4RX7A 3R1NA 4E73A 3UBDA 1TQIA 4E5AX 3KXNA 2EB2A 4AQCA 4ASXA 2XEZA 4GSBA 4O21A 4FTCA 4S32A 4R5SA 4R6VA 3O0GA 4DEIA 3CTJA 3T3UA 4NW5A 3FKNA 1CDKA 4ACCA 1DI9A 3DJ6A 3ZRLA 5FG8A 3S00A 4G2FA 3KULB 3PRFA 3VS4A 3ZO3A 4C62A 2E9VA 3LM5A 3M2WA 3IS5A 3QGWA 2W05A 4JL9A 3E3PA 4F4PA 3B8RA 4FKSA 2HOGA 4PV0A 4YHFA 2NPQA 4MNFA 5K0XA 5AAGA 4QTCA 2E9PA 2QO7A 3RPRA 1CKIA 2W1GA 1FMOE 2ITOA 4CKRA 4QQ5A 4RC2A 2QLUA 4FYOA 2VO6A 5JFVA 2OK1A 5EM5A 3PSBA 4MBLA 5J7HA 5KUPA 4GFGA 4M66A 1O9UA 2CGUA 3JPVA 3EQRA 3G2FA 4BCMA 4YTCA 4HCUA 2PHKA 2PVFA 5AP1A 2Z7SA 4WD5A 4Y72A 1WMKA 4D5KA 5E8ZA 3HYHA 2WXVA 3ROCA 3R7OA 4FZFB 3KN6A 5L6PA 1FOTA 4N6YA 4ALUA 3ZBXA 3D83A 3NUPA 4I92A 5C8NA 4RWKA 5HKMA 5BPYA 4ERWA 5E9EA 1IAJA 3VUKA 2QKWB 4MYGA 4NM7A 4CFWA 2VO7A 4QO9A 5HIEA 3EWHA 3L1SA 3L9PA 4IAZA 4M12A 4FK6A 2WU7A 5KX8A 2G15A 3I5NA 4E4NA 3CD8A 5G6VA 4A9UA 2XF0A 2EU9A 3VW6A 5FEDA 2R2PA 4I23A 4GKHA 4UWCA 4YURA 3H9OA 4O0TA 2XIKA 4DBNA 3BLQA 4FV1A 3HEGA 5KBRA 3C5IA 4CZYB 3PXRA 4RJ8A 4TL0A 3EFJA 3F2RA 3SHEA 3KRWA 2O3PA 2YM3A 4X2GA 2YA9A 5LMKA 3M42A 5IKWA 4AUAA 2R5TA 3VBWA 2BZKB 3IO7A 3NW5A 4JT3A 4J7BA 2XYUA 3FY0A 3GCVA 5KO1A 1MQBA 2IVVA 3AG9A 3QHWA 3WF5A 3ZLXA 5AFVA 4RSSA 4CT2A 5M08A 1XH8A 2QLQA 5JQ5A 3QKLA 1JAMA 4FSZA 2OXYA 1H27A 3AD5A 4RQVA 3VVHA 5CVFA 4JX7A 5AV4A 3MBLA 3SLSA 4FSUA 4WG3A 1Q62A 2W5AA 3FZTA 4S2ZA 2P3GX 3ZSHA 4JXFA 3E5AA 4QMNA 5FXSA 1PJKA 3UVQA 4G6NA 3WILA 2VTTA 1R0EA 2FVDA 1OL7A 2RIOA 3OOGA 3C4EA 5DT4A 1OL2A 5FDPA 4TYHA 3ZRKA 2ZYBA 4KNBA 1ZY4A 1VJYA 1H24A 4FEXA 1W8CA 5IH6A 4G9RA 2ITNA 3D2KA 4JS8A 5DPVA 3TKHA 2I0HA 4YNEA 3R7IA 5CF8A 3QQUA 4FIJA 4A9RA 4HYIA 4NJDA 4BZDA 1UV5A 3IDCA 3PP1A 5TO8A 3I5ZA 4DH1A 1P5EA 1Q99A 2H8HA 3VBQA 5LMAA 4OTQA 4I5MA 3VS2A 4DEEA 3JVRA 3ZCLA 3AD6A 3QZHA 1GAGA 5DYJA 2VTIA 3UIXA 4HVSA 3E7OA 3Q9WA 4GV1A 3VUDA 5GJGA 3PP0A 2H6DA 3P08A 4ZXTA 1WBSA 1DAWA 3ZUUA 2BUJA 1P14A 2UZBA 1B6CB 4JDJA 3TUCA 2YIYA 2XCKA 3QXPA 3QD0A 4USDA 2IJMA 4YZDA 5HG7A 5LARA 4CKIA 1QPEA 2RFNA 2XKFA 3D5VA 4FV7A 2J5FA 3PSDA 4II5A 4QMYA 4D5HA 4FKOA 4BHZA 4M69B 1KE5A 2A19B 4UMTA 4LV5A 2BFYA 3E8EA 4AOTA 3F3WA 4MXCA 4CFFA 4EEVA 4PDOA 3SOAA 2B54A 4JDIA 2EWAA 5GZ9A 3LHJA 4ALWA 4IVAA 2PMLX 4CYJA 3P5KA 3MH2A 5H8GA 2HELA 5C9CA 1J7IA 2I0EA 4JNWA 4JJRA 5IMXA 2GHMA 2R3KA 3FZOA 4XP3A 2YZLA 4AACA 3QZGA 2EXEA 4GRBA 4DH5A 2XB7A 4JBQA 3OC1A 1PMEA 2BAKA 5EQYA 4WOVA 5M44A 3FEGA 4FKLA 4U80A 3FPQA 4PTCA 3SAYA 1PXKA 5IU2A 1JLUE 4O0UA 3A7HA 1R3CA 4E6DA 2UVYA 5DWRA 5EDPA 1V0OA 4TWPA 4D9TA 4EH3A 2C5NA 4UX9A 3LQ3A 4CT1A 1HCLA 1ZMUA 4BI1A 3VS1A 2R3OA 3O23A 2CGWA 3EB0A 5HE1A 3BV3A 4WO5A 4X3FA 4PF4A 3ZFXA 3RWQA 3CQWA 4D28A 4DITA 1ZMVA 5I4NA 3F66A 4AA0A 4O7NA 2PE1A 2VTHA 2JGZA 2YJRA 3NWWA 3WZJA 3GU4A 3NVMB 1U5QA 4F0FA 3HV6A 5IA2A 2X8EA 1MRUA 1OIRA 3VRZA 5LMBA 2ZMDA 3GCSA 4MXOA 4EHEA 3CY2A 4XG9A 4Q9ZA 2VO0A 5LXMA 3KRJA 4MD9E 2I6LA 4A07A 1FQ1B 5AWMA 5AAFA 4FIGA 2OZAB 3LOKA 2PUIA 3R9NA 5EG3A 3MVMA 3RM6A 3O17A 3TWJA 4FA2A 3BHYA 4QNAA 4X7QA 1KV1A 3ZLWA 5TF9A 4OTRA 5J1WA 5J79A 5IUIA 2X39A 4EC9A 3L9LA 3UO5A 3C4FA 4JI9A 2ZOQA 4LUEA 4RRVA 5HE2A 4WNOA 2DYLA 2OF4A 2FB8A 2ONLC 3ZM4A 3A4PA 3H3CA 4FTMA 4AFJA 4FKRA 5CTPA 2BIKB 3R8MA 5FQDC 1KOBA 4U3YA 4L6QA 2UW5A 2VX3A 2XRUA 4LFIA 3MA3A 4FKWA 3CY3A 3ZFMA 3EQCA 2FSOX 2B55A 3FDNA 4C58A 4WHZA 4ZZOA 1J3HA 3CC6A 3AD4A 1RQQA 3G90X 4CTBA 4O2PA 2PUNA 5AR4A 4AAAA 3AC5A 3DKFA 3FI4A 4F64A 4FL1A 5IA4A 3JS2A 4X0MA 5A14A 2IZTA 3UZRA 2DUVA 1DI8A 3F3VA 4PRJA 5AR7A 3ZU7A 2X6DA 4TY1A 4O0VA 5GNKA 1JNKA 3CQUA 4IB3A 3OEFX 4ZY6A 1IA9A 4E93A 4RJ7A 4O84A 2JD5A 4FZAB 4UMPA 3S95A 5AEPA 4CZTA 1GZOA 1I44A 5F4NA 4UXQA 2ZV8A 4BDGA 4ZMEA 4FKPA 4IZ7A 5CQUA 4PP9A 3OCGA 3ORZA 3SQQA 1ZYCA 4BB4A 4CMOA 4E6AA 4R7BA 1YQJA 1NVRA 3LFDA 4PWNA 3VHKA 2I40A 2PVMA 3CJFA 3QLGA 3LXNA 4BCKA 4ERKA 5CASA 3UVPA 2C0OA 5F9EA 2WTDA 2HZIA 3NUYA 3R0TA 2JEDA 4GG5A 2JAVA 5LJJA 5L2IA 2XNPA 4V0GB 3CJGA 1OPLA 3AMYA 2HY81 1K2PA 2DQ7X 4ZLZA 3W55A 4NM0A 1O6KA 3S4QA 3CKXA 3Q2MA 2WMAA 4YJSA 2XZSA 4WG4A 1W83A 4LOPA 3PJ3A 4EQUA 3PRIA 4FGRA 3BWJA 4RFMA 3G6GA 5AP2A 4DBXA 5J9LA 4LL5A 3QYWA 4YPDA 3NEWA 3ZHPC 4JQ8A 1DS5A 3IW6A 2PPQA 5JRQA 3D4QA 1K9AA 3FLNC 3ZBFA 3AMBA 4X2JA 4E1ZA 4FKVA 1XHAA 3PIXA 3R71A 2XNOA 4C57A 4FV0A 2NP8A 5E8YA 3VJOA 3R8LA 3TL8A 4ZLYA 5H8EA 2J51A 1P2AA 4EKLA 2HAKA 5M56A 4WUNA 2WEIA 1H25A 3A8WA 1WAKA 2FA2A 2OWBA 2UW6A 3OMVA 4AFEA 3BEAA 3UTOA 4C4HA 1A48A 2ZVAA 3DGKA 5GHVA 4DFNA 4FEQA 5AUZA 2B1PA 3QQLA 3FMLA 2J90A 2VO3A 3E64A 5HLWA 1KE6A 3U4WA 4TZRA 4WNPA 4GUBA 2YIWA 1WVWA 3A7FA 4XOYA 2XK3A 5HEZA 3MPTA 4ACDA 5DT0A 5JGBA 3DY7A 2RGPA 4OT6A 4OBPA 3ZFYA 4L68A 5H2UA 4QQJA 4AT5A 3VQHA 4NU1A 4UZHA 2YM8A 3OT8A 4R77A 1XR1A 2Y4PA 4PDSA 5DR9A 2B9JA 5LVMA 2XM8A 4BCNA 2WNTA 4IB5A 5ANGA 4EK8A 1IA8A 2WTJA 4IB0A 3IOPA 4GIIA 4K11A 2C6TA 4QTAA 3QAME 5HCYA 3UIMA 4O86A 5EI6A 2XVDA 3FLSA 2YCQA 4GG7A 3DK6A 5CU4A 2VD5A 5HLNA 3PE1A 3NUXA 3QFVA 4L9IA 5CWZA 3Q4CA 3EZVA 3OY1A 3TIYA 3RVGA 1SVHA 1XBAA 1H07A 2QQ7A 2R3RA 3MFUA 4W4XA 4Z3VA 5A9UA 3HAMA 4G6OA 5EW3A 4ZLOA 5IH5A 4UXLA 5ACBC 5ICPA 4BKZA 5K9IA 2QONA 2JDRA 5AMNA 2BZIB 3SGCA 1X8BA 4ZIMA 3NLBA 3LFSA 3OCSA 2PULA 4H58A 1OECA 1W82A 3W2RA 4EUUA 5HG5A 4MEDA 3BWFA 1IASA 5CY3A 3RAKA 4ZMFA 4XV3A 4U3ZA 4L42A 5ETCA 3FC1X 2G1TA 3KCKA 5M09A 3R2BA 3PTGA 2B53A 4JQEA 3MVJA 5D7VA 5ETAA 2C4GA 1OUYA 5HVKA 1J1BA 5E8TA 4C61A 4L7FA 4JG8A 5FEEA 1ATPE 4RQKA 3ZDUA 2CNVA 3RHKA 2XIRA 3DAJA 2PWLA 2W96B 4FUYA 4U9AA 4OTDA 3QC4A 5AP4A 5FWKK 3VIDA 3CTHA 4KAOA 1G8AA 4QP7A 2OO8X 2J7TA 4H1JA 3WYXA 4S31A 3Q4UA 3V3VA 3F3TA 2YN8A 3WZUA 4E5WA 4EORA 5HQ0A 2RKUA 1UU9A 3IOKA 3CEKA 4FV6A 1ZWSA 3P4KA 4OR5A 3CE3A 4M15A 4K9YA 5IA0A 2GNFA 3KXHA 1XH7A 2R3NA 3L8XA 5FM2A 3QWKA 4EYJA 3BCEA 4J71A 3A7JA 1W0XC 1YI4A 2WB8A 3AT3A 3HZTA 4XV9A 4QYYA 1YWVA 5AV3A 2XRWA 5FXQA 3QRTA 5E90A 2VWIA 4O83A 5KZ0A 4A9SA 3DTWA 2YACA 5FTQA 3E7VA 2YM6A 4TYEA 3UDBA 1M14A 4G3CA 5K3YA 2GCDA 1XH6A 2F7XE 4WNKA 3FZRA 4FK3A 5E8XA 4DFBA 4X2KA 4KD1A 3T9IA 3N9XA 4FTUA 2J0MB 3DLSA 3PA3A 4FTRA 5F95A 3VRYA 1J1CA 3ZDIA 1OPJA 4CVAA 3Q6WA 4ONAA 4IADA 4BDAA 1MRVA 4FVRA 5CEIA 2UW9A 3NRMA 3OCBA 3RZFA 3UPXA 2PVHA 4L52A 4R1YA 3Q5IA 5AV1A 4IAFA 3V04A 3RKBA 3VS6A 4GL9A 2YEXA 2CKQA 1YXUA 4FT0A 4BDJA 3V8WA 3KB7A 3UQCA 4FEVA 3TDVA 3OBJA 5L8KA 2E9UA 5CEOA 3BRBA 3F3ZA 1G8SA 5AUVA 2GS7A 4BBEA 4L53A 4FTNA 3R8VA 2CCIA 2WQNA 2OSCA 3AC8A 3DT1A 3OUKA 4M8TA 4RX9A 3OBGA 4F99A 4KSQA 3HRCA 4AW5A 3TNWA 2QOIA 1OKYA 4W4VA 4O81A 4DFZE 3RAWA 4B0GA 3DLZA 2BRBA 2YM7A 3TG1A 3BPRA 4ZZNA 2UW8A 4FGBA 3OW3A 2BKKA 5T68A 1Q97A 3PZHA 2Y6MA 2JKQA 3QA0A 5DLSA 4F7JA 5AA8A 3OEZA 4P4CA 4TXCA 5C26A 3NIEA 1GZKA 1OZ1A 3MSSA 4UZDA 3ZTXA 1UNHA 4PL4A 2W06A 3HV4A 4GYGA 3I6UA 2JDOA 3AGLA 5IQEA 5HORA 4FTTA 5C03A 2WTKC 5AP3A 2R3JA 3LKMA 3F5PA 2P2IA 3TIZA 4QMTA 5BNJA 3NIZA 4DT8A 2ZV9A 4YMJA 1VYZA 1PRYA 2R9SA 3PXQA 2XJ1A 3R04A 5DE2A 1QPDA 3T3VA 1REKA 5F1ZA 2GNHA 3NUSA 2G01A 2C5XA 3ZC5A 2VTPA 3JR1A 3FZPA 3ZC6A 4CG8A 3UGCA 4NCTA 3RCDA 4BICA 2GNJA 1LPUA 5BX0A 3RMFA 2QU5A 3D9VA 4TWOA 2OFUA 4X3FC 4M7IA 2C0TA 5BVEA 3P9JA 4C2VA 2WTCA 4GIHA 4NUSA 1ZYDA 2HCKA 5K4JA 2XK4A 1F5QA 1LUFA 2QR7A 3QC9A 3R1YA 4RJ4A 4ASZA 5BUJA 2P55A 4ZEGA 4IX4A 4TYIA 4U8ZA 4MF0A 2ONLA 4NH1A 4IW0A 4F9WA 3PWDA 4KIQA 4U6RA 4BCOA 4JAJA 4ANNA 3GB2A 4AF3A 3CCNA 1NT2A 5C4KA 2X8IA 4HOKA 3ZUVA 4D1XA 3C1XA 4MHAA 5CYIA 3F9NA 3MY1A 3BGQA 4QOXA 4FV4A 4E4MA 4TYHB 5J95A 5IZFA 1GZ8A 3NMUF 3W2PA 5IDPA 2R3GA 1IR3A 4CCBA 3ORTA 2OJ9A 4NW6A 1J7LA 3SXSA 4ACHA 3OXIA 3V01A 2OJIA 4QMZA 5M4UA 3LFQA 5A46A 5DOSA 1JVPP 4RFYA 5EOBA 2E9NA 1BL7A 4FT3A 4QNYA 5LVNA 3BZ3A 3UOLA 1URCA 3REPA 3PG1A 1URWA 4HPUE 2ZM4A 4NTSA 3RCJA 1I09A 3F5XA 4GW8A 2IW9A 4YTIA 2C30A 4DG2E 4ANMA 1XQZA 3PPZA 3COIA 2FUMA 2ERZE 2EXCX 2XMYA 5EI8A 1KE7A 2UZVA 3G9LX 2B9HA 4QYHA 1JOWB 2Q83A 3ALOA 3NYXA 4I5CA 4AWIA 3FMMA 3NUAA 3Q2JA 2YDKA 3EYHA 2JDSA 2JIVA 4UBAA 3MJ2A 3QQKA 3ATTA 3AC3A 4O0YA 2PVRA 3ZONA 1SZMA 2HENA 3GC7A 1FVVA 2VTJA 4UMRA 1QCFA 3NX8A 3ZEWA 4C34A 4FTAA 3ZZEA 4C4FA 3IDPA 4APCA 4EH5A 5CNOA 4FUXA 3BYOA 3FQEA 2YLEA 2JKKA 4DFYA 3NNVA 2W1CA 1XH4A 4HZSA 4TT7A 5KMLA 1PXJA 4JAIA 4BGGA 3C5UA 1Q41A 4BTKA 4PMPA 3UPZA 4FR4A 3UIBA 1WBNA 3RPOA 5CI7A 3PVUA 5ANDA 3F3UA 2F2UA 3W32A 4JR3A 2KTYA 3OUNB 5FTOA 5L2TA 4QP3A 4ZTMA 2W4JA 1WBVA 4IFGA 4H3QA 4FIHA 3FLZA 3SW4A 3TNPC 3HP2A 4BIBA 4UWBA 5M4IA 1JPAA 4GCJA 4J8MA 4TTHB 4KB8A 4XG3A 4RJ3A 4BR3A 3RGFA 2WTKB 5J9YA 5HIDA 4AN9A 4H05A 1UKHA 4AW0A 4LMUA 4LRJA 4ANOA 4GU6A 2WEVA 2GSFA 3IONA 4EYMA 1GNGA 3ALNA 4TNBA 3GC9A 3RJCA 5HX6A 4CV8A 5EFQA 3NUNA 4I1ZA 3P0MA 4YJQA 3V51A 5JSMA 4IJ9A 1XBBA 2YIRA 2XK7A 4KBCA 3BBWA 1BI7A 5AP0A 5EQEA 1Q61A 4C8BA 4AZVA 4FOBA 4X3FB 3O7LD 3AC1A 3QL8A 2GQRA 5C8MA 2W4OA 4ZTRA 3W8LA 3BGPA 3O96A 4RVMA 5CQWA 5J8IA 3QTRA 3HRFA 4IAYA 3E3BX 2CPKE 3BHHA 3KMWA 4Z9LA 4FKIA 3VAPA 4C38A 3A4OX 2ZM3A 5CVHA 2WOTA 3R28A 5C8KA 3EQDA 4GK3A 4K1BA 4X6RA 1WFCA 4HVIA 3WZKA 4CMTA 3F5UA 4CGAA 3FLWA 1ZARA 5I9UA 4GEOA 4ZTNA 4LM5A 4PY1A 1B39A 4EZ7A 2V7AA 2YERA 4FTKA 4LMNA 1JBPE 5EK7A 2WQOA 3GXLA 1GY3A 5LQFA 1YXVA 3U87A 4DGGA 1YKRA 2PU8A 3HMIA 3AOXA 3TNHA 3FI8A 4RZVA 5L6WL 3GNIB 2QOHA 3D2IA 4BBMA 4YZ9A 4BCPA 4FZDB 5J1VA 2HWOA 3WARA 1ERKA 2W5BA 4OBQA 3MYGA 2F57A 4AZSA 4PX6A 4D58A 3DBDA 3QU0A 2GTNA 5J5TA 4GH2A 4OTPA 4XBRA 1Q8UA 1BLXA 3R8ZA 4JG7A 4NKAA 3LQ5A 4BTJA 4DG3E 3F2AA 2GMXA 4MWHA 4GT3A 1XWSA 3PXZA 2O64A 3QKMA 4Y8DA 4DEHA 2GFCA 1BMKA 5CZIA 3R8UA 2QR8A 5B7VA 3UZTA 2V7OA 5EQPA 5C1QB 2B52A 4AOIA 2QG7A 4EK6A 3ZRMA 1H1SA 4C2WA 3CP9A 2HIWA 4CG9A 3IQ7A 3OWJA 4O2ZA 4BBFA 2WTWA 1ZRZA 2RFDA 4DGNA 3KRRA 2OIQA 3PG3A 5DRDA 2BHHA 3ENMA 1J7UA 4RIOA 3C0GA 4XRLA 2R3IA 5IQDA 4CLJA 2FO0A 3W1FA 4UYAA 1PXPA 3P7AA 3LMIA 3BE9A 4KIKB 4A9YA 3UOKA 4BHNA 2ITWA 4AOJA 4JIKA 3DAKA 2FGIA 3U6IA 3RM7A 1OIYA 3MN3A 1H8FA 4DEDA 5HG8A 3FLYA 5JGDA 3JUHA 2GNIA 4M3QA 3F6XA 4MNEA 4M0ZA 4OTWA 3C50A 4NEUA 4RVTA 5DIAA 1VZOA 4CKJA 3TV7A 4D0WA 4MAOA 4I5HA 3UNZA 5CLPA 3GQIA 5DH3A 3FHIA 3BE2A 3G0EA 1APME 1H1PA 4X2FA 4OAVB 2PSQA 4IB1A 3VS7A 2HWPA 4AP7A 4BN1A 4EHZA 3LZBA 4B7TA 3FV8A 3PDTA 3PYYA 1H00A 3P78A 4G9CA 4IM2A 4K77A 5C4LA 3QRJA 2OXXA 2B4SB 3DA6A 3OF0A 3R7EA 4XV1A 3VW8A 4EQMA 4LRMA 5CNNA 4KUJA 3OXTA 3MH3A 3V6RA 2WPAA 5DN3A 5HO7A 4O7SA 4E3CA 3UOJA 3V5JA 4DG0E 3RPYA 1UU3A 3WBLA 3AT2A 4DFXE 4ENYA 2OH0E 4EONA 2GQGA 3DAEA 4EK5A 2XH5A 3QCQA 2O8YA 1TQMA 4V05A 4YJNA 1Y8YA 3QUEA 2WMVA 3NW7A 4IZYA 5JT2A 5KCVA 2QOKA 3LMGA 3VF8A 2XEYA 1E1XA 3HUBA 4YZCA 2ETKA 3UYSA 2Q0NA 1Q4LA 4B4LA 1XBCA 1PMUA 5AM7A 5CANA 5CXHA 5HE0A 5IUGA 3MA6A 4OTHA 4BDCA 2IVUA 2QKRA 4P2KA 3NUUA 1JKKA 5H3QA 4FG8A 4ANLA 4ZAUA 5FP5A 5EHOA 3BU5A 2IVSA 1PXNA 4IIRA 5HGIA 3CGFA 2VAGA 3GCUA 3IGGA 5C01A 2CDZA 3SX9A 4AS0A 4D2RA 3VBYA 1OVEA 2J0JA 5FRIA 1YOLA 4S33A 3RPSA 5LVOA 3HL7A 3KFAA 3M11A 4MK0A 3C4CA 2BILB 4CMUA 5HTIA 1M7NA 2YJSA 5KKRC 3GU8A 5CF5A 3P7CA 4M13A 3QA8A 3RP9A 3ZO4A 4A06A 3GENA 5DMZA 3U51A 5CU0A 4NM3A 1H1WA 1U54A 4FTIA 5EW9A 4EOQA 4QYFA 3ULIA 5GZAA 3U9CA 3NCZA 4UYNA 3KK9A 3CXWA 2UZUE 3HECA 5E8VA 3VHEA 4AGCA 1G3NA 5DI1A 5FBOA 2W1IA 1EH4A 4PQNA 5CF4A 1Q3DA 3CKWA 5BQ0A 3L8SA 3H0YA 4QMVA 5H9BA 5K0KA 2IZRA 3FL5A 3DBCA 3R7UA 2C69A 4BKJA 5I9WA 4NCTC 4YO6A 4ZK5A 3UMXA 5K4IA 4I0TA 4I24A 1MUOA 4FTJA 2ITZA 2RF9A 3KEXA 4LG4A 5CX9A 4F63A 5A6OA 5I9ZA 5IPJA 2EVAA 2UW0A 3KU2A 3R9OA 4YR8A 4U81A 2CJMA 3SXRA 3WYYA 4Z16A 2WIPA 2R3QA 3QKKA 3CR0A 2OJJA 2XK8A 3QTUA 3UQGA 3B8QA 1WBWA 3KY2A 5EM7A 3BHVA 2BZHB 3MH1A 5BYYA 3ETAA 1NW1A 4XLIA 3MGYA 4PPAA 4RZWA 5JH6A 4DCAA 4I93A 4I6QA 2WQBA 2C1AA 3ULZA 3PVGA 3EH9A 3BU3A 3QGYA 2C5YA 3IECA 4MD8E 2ZDUA 4KS7A 4ARKA 4YTFA 2G2IA 3W10A 3TZ9A 2QC6A 3IW5A 4PTEA 3A2CA 4BFMA 4ZTQA 4C7TA 4D1SA 3NS9A 5DVRA 4ZTHA 2UZLA 2ZB1A 2XNBA 2JIIA 3QZIA 2QURA 4FTQA 4FZ7A 5CI6A 2KULA 4TYGA 4BDIA 5L3AA 3FE3A 3BQCA 4NWMA 3GVUA 3HVCA 3HMNA 3DXQA 4DEBA 3UC3A 3DCVA 3HA6A 2VWXA 3HV5A 1UA2A 1KV2A 3GBZA 3LJ2A 2YM5A 4YJOA 5AP7A 4AE9A 3EQIA 2GQSA 4XEYA 5BVNA 4FTLA 1YHSA 3KMUA 2O0UA 2VTAA 3QUPA 5AX9A 2ITVA 3FMEA 1AQ1A 3UVRA 4D55A 4FE2A 4I0RA 3W18A 2G2HA 1AD5A 2VTQA 2XBJA 3GU6A 5AJQA 4ZSJA 5FBNC 5CEQA 4FSWA 4EOKA 4E8AA 1Z9XA 1R1WA 1U46A 4EH6A 4P7EA 2V55A 4FC0A 2YLFA 3R2YA 3ATSA 2PZIA 4HNFA 2RFSA 4PL3A 5IA5A 2IW8A 4EJ7A 2BVAA 4EH7A 4Z7HA 5I9YA 1P4FA 4XG8A 3UP7A 3ZLSA 4FSQA 2J4ZA 1FINA 3VO3A 2C6MA 4F1TA 3TM0A 2QODA 3RK7A 4L3JA 5CXZA 3N4UA 4W8DA 2C0IA 3A99A 3DB6A 4YO4A 3WF8A 1W7HA 1WBOA 3AGMA 1STCE 3E8NA 3GUBA 4GFMA 4BYJA 5IEVA 5HU3A 3GOPA 3LXKA 4QP9A 4ITJA 3K5UA 2QO2A 3HV3A 2X2LA 4EOMA 4LV8A 5GZ8A 3QRIA 5TE0A 4AT4A 1RW8A 5FDXA 1PMVA 3FY2A 4QMLA 4F7SA 4XX9A 3C4XA 4QP4A 3F2NA 3Q4ZA 3QQGA 5M06A 2OBJA 3NZ0A 4TPTA 3EN7A 3O2MA 3EN5A 5GJDA 3VBVA 3VNTA 4RWLA 2BR1A 4BY9E 2P2HA 4ZJIA 4C37A 4QTEA 3OZ6A 1OL5A 2Z02A 3KGAA 3TZMA 4OT5A 2YDJA 1U4DA 5A6NA 5AV2A 2I0VA 3SC1A 3FMNA 3I7BA 4RBLA 5M55A 3D5WA 4A4OA 5CAPA 5KKRB 4GJ2A 3HDMA 1OUKA 4XNEA 4XOZA 3TACA 4AW1A 1OL6A 1PXOA 1SNXA 2BKZA 4I5PA 3BYMA 4FVPA 4MWIA 4H3PA 3G0FA 1H1QA 1YOMA 2OFVA 3GU7A 2V5QA 1J91A 3LXPA 2OZOA 2VGPA 4IXPA 5AM6A 3EFLA 4EOJA 2QG5A 3I81A 3NR9A 2YAAA 3RK5A 4J52A 4QMMA 3IDBA 1XO2B 3IKAA 3Q32A 4P5ZA 4R3CA 4D2VA 4PP7A 2P33A 4X2NA 3NPCA 5D11A 3ORKA 4E7WA 2PVLA 4QMWA 2CNQA 3LAUA 2BAJA 3HA8A 2GS6A 1K3AA 4RFZA 2XM9A 3FBVA 4JIAA 1ZOHA 2UVXA 2Z2WA 3RNIA 4ZZMA 2W1DA 5TKDA 4W9WA 3ODYX 1O6YA 1Q8TA 3IG7A 2WD1A 2PL0A 4YJVA 5HX8A 4QQCA 5IF1A 1TKIA 5BVKA 4IC7A 4MX9A 4TWNA 4EL9A 4UALA 4YZNA 2AUHA 5F94A 5HBHA 5CSXA 2QD9A 2B9FA 4FSYA 4PL5A 5CEMA 1OKZA 4H1MA 2F49A 3EJ1A 5JRSA 5BVWA 5EDQA 1NA7A 4BF2A 5L6OA 4AW2A 3G5DA 4RVKA 5J7BA 4LOOA 4AA5A 3ZO1A 3D7TA 3BEGA 2GTMA 3E93A 3QZFA 4HGTA 4KKHA 5ETFA 5HE3A 4DA5A 4FKGA 3DZQA 2Z7RA 3Q52A 3R21A 2R4BA 4YHTA 4BL1A 1V1KA 5A4QA 4OTFA 4D1ZA 3DFAA 4RG0A 5L4QA 3V5LA 3DU8A 2VWUA 2CGVA 5BMMA 1CSNA 4FSRA 4Y73A 4YLKA 4O6LA 4WNMA 4C4IA 3D5XA 2WIHA 4HVDA 3ENHA 3QRKA 5D12A 1PKGA 2R3LA 3D7ZA 3LFEA 4O0XA 4YJRA 3RBWA 4EC8A 4YJPA 4QPMA 3FZ1A 2PTKA 4IAKA 3D5UA 4EBVA 4WBBB 4QTDA 4YGAA 4DTBA 5CAVA 3OP5A 3KK8A 3TKUA 2O65A 1FBNA 2XK6A 4FEUA 3GCPA 4FOCA
chains in the Genus database with same CATH superfamily
4O7TA 1SVGA 1QMZA 3ZXZA 4O7LA 4FKJA 2PUPA 1Y8GA 4A4XA 2GPHA 1F3MC 4UV0A 2IG7A 3L8PA 3ZS5A 1H01A 5BUEA 5KMOA 1JKSA 2I1MA 1BX6A 2IN6A 3HX4A 4LQMA 4WBOA 3SVVA 3UJGA 3FYJX 4FV5A 2A27A 3F88A 2WAJA 4CQGA 3SRVA 5IH4A 2A4LA 4C02A 4M84A 4EWQA 2BRGA 3CD3A 3CIKA 4MXYA 5CZHA 4CRLA 3OWLA 1PYEA 4BCHA 4TKSA 2W9ZB 3LIJA 1BUHA 3Q4TA 2VX0A 2ZM1A 5E8UA 4N0SA 2RFEA 3G51A 4YBKA 5F20A 4EH4A 4EK4A 3FZSA 4L45A 5HD7A 2YWVA 1ZYSA 4BKYA 3POZA 4F65A 2JKOA 2VTMA 3QUDA 2Y6OA 4GK2A 4UEUA 4F70A 4UMUA 1CM8A 2OKRA 2Y7JA 2WMSA 2BZJA 2XNEA 4U97A 5GJFA 2GNLA 3N4VA 3W0SA 2ZMCA 4AXEA 4DDIA 4O6EA 3EKNA 4P90A 2J9MA 4XLVA 2X7FA 2ETRA 5ITAA 1SMHA 2BRHA 2W1ZA 3NNWA 4LOQA 4AZFA 4MD7E 4I4EA 3QXOA 4ANSA 4PDYA 1FGIA 3SW7A 3DKOA 4ZSEA 1YDRE 2QOCA 1M2QA 3KXMA 5GIPE 3DBEA 2VTSA 3KXGA 5A4EA 5KZIA 5A4LA 4USFA 3KXXA 5IG1A 4Q9SA 3W0PA 4OAUC 5K5NA 5AA9A 4BDEA 4OLIA 2CSNA 4FKTA 4J1RA 2BALA 3PUPA 2W1EA 4FZ6A 3QD4A 4HYUA 4QD6A 5CU6A 3TTJA 3WE4A 4EOIA 2PMNX 4YLLA 4F0IA 5EM8A 2F2CB 3NYNA 4EZ5A 4EOOA 4ZY4A 1W84A 5JGAA 1Q24A 3LJ0A 2CGXA 1CTPE 1Q8WA 4RIXA 1UVRA 3MVLA 2BPMA 3PY1A 4G3DA 4I0SA 2J0KA 4KABA 4KWPA 5JN2A 3MVHA 3QX2A 4IX3A 4O27B 4TYJA 3ORMA 4QP6A 4JVGA 4XH6A 5AAEA 3LLAA 3FPMA 2ZB0A 3R02A 4RA4A 5KHXA 5JFXA 4IAIA 4V04A 4BVUA 4GYIA 3GT8A 4ZY5A 3UO6A 3SG9A 2ZJWA 4Y95A 1TQPA 2VWWA 3V5WA 4AA4A 4BJJB 5JZJA 4OTGA 5HO6A 5BUIA 3Q5ZA 2ITXA 1YDSE 3MDYA 4F1MA 2XCHA 3RAIA 3PPKA 2WQMA 5KMJA 4GFOA 4JOAA 4XUFA 4YSMA 3LPBA 5L8JA 5C27A 5CU2A 4C59A 4DGOA 3C0HA 3K5VA 4F9YA 4N4SA 4KSPA 2QVSE 3KMMA 4NFMA 3ID6C 3GU5A 4O7RA 4U0IA 3BELA 4O91A 3C7QA 4NT4A 2WQEA 1OITA 3FLQA 5TT7A 1Y6AA 4GT5A 3BU6A 2W5HA 4J99A 4TN6A 2OI4X 4QP8A 1U59A 2W4KA 4O4DA 4RIWA 4L00A 4NL0A 1UWHA 2VWYA 3B2TA 5AUTA 4XG2A 5EHYA 1ZOEA 2R64A 3I60A 3JY0A 1RDQE 3CTQA 2HK5A 5I0BA 2AYPA 3B2WA 1U5RA 2VZ6A 3MB6A 3DQXA 3QTWA 4DGMA 2B7AA 3KA0A 3WE8A 4FVQA 3QQFA 4G5JA 3OCTA 3R8PA 4GKIA 3LXLA 3DXNA 5D10A 5ACKA 4U7ZA 1UKIA 3OW4A 2Y4IC 5EDRA 3R7VA 4HNIA 4QP1A 4AG8A 4IVBA 3U54A 3ODZX 5HO8A 3FSKA 3FUPA 5EI2A 4GJ3A 2ITPA 3RNYA 3TJDA 4AU8A 4UB7A 3CPCA 4AT3A 4ASDA 4DH7A 1DM2A 2YIXA 5E1EA 4FMQA 4FSNA 5EKOA 4CLIA 3DZOA 1Y57A 4EBWA 3COHA 1ZYLA 2JLDA 2W0JA 3KRXA 3MTFA 3O8UA 4K18A 4UN0C 2NNWB 3VQUA 2JFLA 5TR6A 3NSZA 4U45A 3W0RA 3Q9YA 4D4YA 4C33A 1PXIA 2EB3A 1NVQA 3ORIA 4RT7A 1PY5A 4K0YA 4MQ1A 3LFAA 3W2QA 1YOJA 4JQ7A 3VUHA 1ZAOA 4RX8A 3NAXA 3VONA 4L43A 3GQLA 3FJQE 4BIDA 5IQCA 3C51A 2OGVA 4MNEB 4BIEA 1Q5KA 2WMXA 2C6OA 4N6ZA 4C3FA 4KS8A 1YHWA 1YDTE 2GDOA 2UZWE 4BI2A 2QOBA 3CQEA 4KBAA 5ANEA 2WOUA 3ACKA 4YHJA 3FXXA 1R39A 2C6EA 3DNDA 2UZDA 3QD3A 2PVYA 3ITZA 5A3XA 1M17A 3AC2A 3ORXA 4L3LA 4O4CA 2B9IA 3R9RA 3DFCB 3MJ1A 4FTOA 4XBUA 4EH9A 3UZPA 4FIIA 4CFNA 4DHJA 3R6XA 2ITQA 3BGZA 4EK3A 3VULA 3R1QA 4CV9A 2HY0A 3RALA 2PZPA 2VGOA 3V5TA 4F0GA 4YUQA 4RC4A 5HNBA 4O0WA 4LL0A 1KE8A 3VS0A 4KKGA 2QI8A 2YAKA 5EH0A 5DR2A 4YC8A 2A0CX 2VUWA 2BDFA 5ANKA 4GT4A 5CT0A 4LGDA 1XH9A 2YIQA 4O7YA 4MTAA 2PUUA 1BI8A 3Q04A 4N70A 4BWXA 3HLLA 2C3LA 4HZRA 4XHKB 2HW6A 4E6QA 2R0IA 4K6ZA 3H9RA 4I6LA 2QNJA 4I6HA 1JWHA 2AC5A 1OIUA 3WI6A 4KRDA 3PLAE 3PZEA 3DTCA 2XNMA 1Z5MA 2PE2A 3TV6A 4USEA 1G8JA 3H10A 3MPMA 3TV4A 4G3EA 4YLJA 4F6UA 1OGUA 4QYEA 1YWNA 4KRCA 2QOQA 3T9TA 3ZMMA 5JFWA 1ZXEA 3ET7A 5EYKA 5KHWA 3ZSIA 4MH7A 1LP4A 4IAAA 4PUZA 4Y46A 5DFPA 4S30A 5IEXA 2X0GA 3HAVA 2ZAZA 1JKTA 3FHRA 2OG8A 2W1HA 1XH5A 5IISA 1YHVA 3OHTA 3V5QA 3VN9A 4QMXA 3ZM9A 4XS2A 3VBTA 2XNGA 3BV2A 4Z55A 3PVBA 2R3FA 4FF8A 1FVTA 2IWIA 2I7QA 2W7XA 3MPAA 3OG7A 5HLPA 4CFUA 4ZTLA 1KE9A 3OOMA 4NM5A 2WMTA 4XMOA 1PXMA 5EYCA 4O96A 3FKLA 3FI2A 1HCKA 4I6FA 4MKCA 2BTSA 3VS3A 1U54B 3LFNA 3DBQA 3BYVA 4CNHA 3D14A 5FLFA 2BDWA 1GOLA 3S1HA 3NDMA 2PVNA 4J98A 2Y4IB 4F9AA 3IW8A 3CLYA 5A4CA 5KMIA 2YDIA 2C47A 5DGZA 3TMOA 2A2AA 4WIHA 4RIYA 3NAYA 4H39A 2PK9A 4U79A 3WF7A 2I0YA 3KCFA 2HW7A 3GEQA 3ERKA 2Z7LA 4U44A 3E62A 3PWYA 3RI1A 1NVSA 1VR2A 2XJ2A 4RPVA 4XG6A 5HBEA 3COMA 3ZEPA 2VX1A 2X4ZA 3O51A 1H28A 2BDJA 3KN5A 2R3HA 4K33A 4D4SA 4RX5A 3P23A 3TZ8A 3UYTA 4JLCA 2HZ0A 3PY3A 3MFSA 3OWKA 2VN9A 3FMJA 2JKMA 3SD0A 4AN3A 3MESA 3I0QA 5GIOE 4C3RA 4YZMA 4IWOA 4U41A 3KKVA 4CFXA 2QOOA 3CSVA 2BROA 2GFSA 3FQHA 4DN5A 3QX4A 1OB3A 3KL8A 4AGDA 4IQ6A 1MQ4A 2XIXA 4ASEA 2Y0AA 2RL5A 4U5JA 5GINE 5AR3A 2WFYA 4C4EA 2YZAA 2CMWA 5I3OA 3EOCA 4F6WA 4NYEA 2WKMA 4ID7A 3R63A 3LQ8A 2IW6A 4JDHA 4EI4A 1PXLA 5L2SA 4RMZA 4AZTA 5CAOA 4S34A 3MFTA 4DH8A 5H8BA 2C3IB 2XKCA 4IHPA 1TVOA 4DHIB 1PKDA 3ANQA 3EQBA 5I3RA 1UU7A 3WIGA 4B8MA 3QYZA 5CS6A 1H0WA 4QPAA 4BCIA 4D2SA 1KUTA 1BKXA 4DHFA 2YCRA 3UOHA 2F7ZE 1JKLA 3UIUA 3ZUTA 5G1XA 4PNIA 5CSHA 4QMPA 5BVOA 1WCCA 4I22A 2YM4A 2UUEA 1A9UA 1CMKE 3GFWA 5L2QA 3VWAA 3CGOA 1JSTA 3LFCA 4AQKA 3F7WA 3R00A 3ZSGA 4IDVA 2JC6A 1HOWA 4Y5HA 3SDJA 4F9CA 3A62A 3G9NA 4YJUA 3KRLA 5AP5A 4CZUA 4IX6A 5LWMA 2W99B 4NIFA 4YZBA 1M52A 1REJA 3C0IA 4G3FA 4ZS0A 4EKKA 4AXFA 3BKBA 4TW9A 4XP2A 3KF7A 1FGKA 4R1VA 3HMOA 5AUUA 3S0OA 2C6DA 1VEBA 3G15A 3NNXA 4MF1A 2SRCA 3P79A 2IPXA 2CN8A 4F9BA 4FNWA 4ANQA 4IMYA 3L9NA 3GC0A 2IEWA 3D0EA 1MP8A 4FV3A 3KQ7A 3GP0A 4O38A 2OIBA 5EHLA 3VC4A 4YC3A 2HXLA 3PJCA 2XA4A 4FSMA 3EL8A 2OU7A 3PIZA 4BZOA 2GHGA 3UQFA 2JBPA 4FV2A 4Q2AA 3KC3A 2XUUA 4PTGA 1UNGA 1GZNA 3TXOA 2G2FA 3OS3A 1NXKA 3PSCA 4R7IA 2W1FA 5BVFA 3EN6A 4HGSA 4A9TA 4D4RA 3RPVA 2Z8CA 4FJVA 1B38A 4IEBA 3TEIA 3OTVA 4IZAA 2NRUA 2PMIA 1E1VA 3JXWA 3N51A 4K8AA 5CVGA 4CQEA 5L2WA 4HGEA 3A60A 2C6IA 3FKOA 2ACXA 4JR7A 4TNDA 5IQGA 2QO9A 4IC8A 4FKUA 3KXZA 4CD0A 1IAHA 1XKKA 4EJNA 2V62A 3Q6UA 3QTIA 1YXTA 1M2RA 3WZDA 3U8WA 2BAQA 3F69A 3DK3A 4B99A 5LWNA 2Y9QA 5KE0A 3ZH8A 3VUTA 1YXXA 2XS0A 4C35A 4YJTA 2XAOA 3LM0A 1AGWA 5CEPA 5KMMA 2Z7QA 3FAAA 1YRPA 4J96A 3ORPA 2CCHA 4R8QA 5AR5A 5DRBA 3TI1A 3ORNA 1L8TA 4A7CA 4ZS4A 2X4FA 4FKQA 4EOLA 3DS6A 3EL7A 3Q9XA 3LCKA 1FMKA 4LUDA 5IMEA 5KNJA 2IF8A 4HJOA 2YABA 3QD2B 4D9UA 3D7TB 4JX3A 4E20A 2J50A 3R7YA 2QHMA 4EQCA 3MW1A 5E8WA 3TDWA 4ANBA 4DGLC 1H4LA 5K5XA 3U55A 5JQ8A 4C4JA 3PJ1A 4G34A 5EOLA 1MRYA 4ZTSA 3V6SA 2UW7A 2RG5A 4GUEA 3RINA 5HVYA 5DG5A 3FXWA 3QLFA 4LYNA 2F9GA 1TZDA 2VTLA 2XJ0A 3H9FA 4XJ0A 3EIDA 2VTOA 5D41A 3U9NA 2JBOA 2QU6A 3ELJA 1QPCA 3O50A 3PIYA 2WU6A 4CFVA 4CXAA 5A4TA 1DAYA 3V5PA 4KIPA 4I3ZA 1BYGA 4IACA 3GC8A 5DT3A 1R78A 1WVXA 2OW3A 4J97A 3ZXTA 3MIYA 2XYNA 3HMMA 1F0QA 3KF4A 4DH3A 3D15A 2BCJA 3IK3A 2X7OA 3FC2A 3R22A 3RWPA 2UZEA 2FYSA 3ROYA 1V0PA 5AR2A 4YBJA 3JYAA 4BDHA 3LW0A 5HNIX 3DDPA 3PXYA 3KULA 3NYVA 4UMQA 3E8CA 3BHTA 1P4OA 4HYHA 4HYSA 4QQTA 5AADA 1KOAA 4WT6A 2YFXA 2VWVA 3EFKA 3P7BA 2Q0BA 4DFUA 3SXFA 3C4ZA 5DA3A 4RLKA 4X3JA 5FEQA 3SRVB 5CU3A 4F7NA 5B2LA 5I9XA 1T46A 5LOHA 3Q60A 2JITA 4AN2A 5M57A 2C5OA 3MI9A 1PF8A 4BCQA 4G31A 3IW4A 3PPJA 3QQHA 4ITIA 3BLRA 5BVDA 5E8SA 2PVJA 2CHLA 5HCZA 3H4JA 2NO3A 2IO6A 1OI9A 3JY9A 3EKKA 3FWQA 3FMHA 2PZYA 3TUDA 3TKIA 1SM2A 4G16A 4EH2A 4E26A 2X8DA 1GIHA 5L8LA 4FL2A 4I94A 4ITHA 5HVJA 5IA1A 5DBXA 4YSJA 2LAVA 5LCJA 4BDBA 4ZSAA 1ZY5A 3PXFA 3UODA 4MXAA 3M1SA 4AXAA 2OIDA 1OPKA 4AGUA 2OF2A 5HICA 3QCSA 4U43A 2QOLA 3LE6A 4M0YA 4QMSA 3AC4A 4JG6A 4HCVA 2FSTX 4IVDA 3L8VA 4JDKA 5JK3A 3P86A 3S2PA 5M53A 3QTQA 5HOAA 3K3JA 3W2CA 4GS6A 3P1AA 5CALA 4I41A 2ITYA 1UNLA 1E9HA 3OFMA 2A98A 2IVTA 2CKEA 1IRKA 3DV3A 4YC6A 2CKPA 3UDTA 2X6EA 4MBIA 2R3PA 3QBNA 3VUMA 4AGWA 4CCUA 4CSVA 5M07A 3SV0A 1OM1A 1SYKA 3W16A 4RIXB 4WA9A 4E6CA 3BYUA 3OD6X 3WOWA 5BYZA 3F7ZA 2WMQA 4LI5A 4BRXA 3FYKX 2XP2A 4DTAA 3K54A 4FT9A 4FIFA 4OBOA 5E7RA 4I6BA 4JRNA 1WBTA 1YI3A 2UV2A 2JAMA 3AMAA 3MS9A 4O22A 4AE6A 3DJ7A 4CRSA 3MB7A 1QPJA 1UU8A 3PXKA 4G6LA 5HTCA 1RE8A 4CFMA 5ANOA 4L7SA 1IEPA 2UZNA 1XJDA 3PJ8A 1SNUA 1S9IA 3WZEA 4V01A 3ZO2A 4X21A 3QTZA 3GOKA 5E1SA 3U4UA 1Q8ZA 4XCUA 4IWPA 4KIOA 3W2OA 5AUWA 2H9VA 5IEYA 3NGAA 3O7LB 2X0OA 3OVVA 3EMGA 3FMKA 4KIKA 5E92A 3W8QA 4WG5A 2CLXA 5T3QA 2ETMA 3RZBA 4OGRA 4D2TA 4HVGA 5HTBA 4D2PA 4FNXA 3H30A 5DNRA 2XIZA 4L67A 3BIZA 4GVJA 3GFEA 4W8EA 5DHJA 4PNKA 3SOCA 3KREA 2R3MA 4O7ZA 2WGJA 3R7GA 4RIWB 3QRUA 3MH0A 4FYNA 5B2KA 3EQGA 4OTIA 5AIKA 4AZWA 3R01A 4RVLA 5CT7A 3FMDA 4BDDA 3VUIA 4BI0A 5AUXA 2BRMA 2WTVA 1PHKA 5IQFA 1GIJA 5AIRA 4K2RA 4R5YA 3PE2A 4QMUA 3BHUA 4ALVA 1LEZA 2J6MA 2AC3A 2HZNA 2VNWA 3DOGA 3RK9A 3DQWA 2BMCA 4BDFA 4W4YA 3HMPA 2BIYA 4LRKA 2UW3A 3W0NA 3H0ZA 5DEWA 2OXDA 1KWPA 2XNNA 3BYSA 3G33A 4FI1A 4IVCA 4BDKA 1O6LA 4ZP5A 4RWJA 4AX8A 4ACMA 1ZLTA 2J0IA 3EHAA 3TTIA 1OGYA 5D1JA 3Q53A 4YP8A 3CPBA 4FSTA 5AR8A 4M69A 4RA5A 5CSVA 2ZV2A 3K3IA 4NTTA 1M2PA 1ZMWA 4Y85A 3JVSA 1H26A 3DKCA 3KVWA 1W2CA 4IH8A 2UZTA 2QHNA 2WMBA 3K2LA 4FX3A 2JDVA 3F82A 4HPTE 4IBMA 4HCTA 4D4VA 4F09A 4GU9A 1H1RA 3FQSA 3GCQA 2X1NA 4FL3A 3THBA 5FP6A 5LCKA 3EQFA 2X9FA 2YITA 4HVHA 3HNGA 2ESMA 1Y91A 2H34A 4IWQA 3LFBA 3R9HA 4O1OA 4FG7A 4FT7A 4OW8A 3UP2A 3PVWA 2WMUA 2XIYA 4KA3A 4TRLA 2PYWA 4A4LA 2P4IA 3QALE 4G1WA 3BI6A 5AP6A 5HHWA 4I21A 5TOZA 3TCPA 3O8PA 3SG8A 2UW4A 4OUCA 2X9EA 4IWDA 3DBFA 4XYFA 4WKQA 4FEWA 2R7IA 2WELA 2X0PA 3LJ1A 4QP2A 3QTXA 5DEYA 4CYIA 5CAQA 4G5PA 3HUCA 3HP5A 2VV9A 4NJ3A 4DTKA 5KMKA 3QTSA 4I4FA 3IW7A 4D2WA 4O1PA 2A1AB 3BLHA 4F6SA 2WHBA 4R78A 2CN5A 4M14A 2JDTA 3EYGA 3UE4A 4P5QA 5E91A 4DCEA 3P5JC 2GS2A 4DF3A 3LFFA 2VWZA 2VU3A 2XK9A 1IG1A 3S3IA 4B9DA 2O63A 3COKA 4CTCA 1ZYJA 2JFMA 5EKNA 2DS1A 3R73A 3TUBA 4GVAA 3Q3BA 4KKEA 5HZNA 5A54A 2HZ4A 5HESA 2F7EE 4FODA 4JBPA 5IQHA 2OICA 2H96A 1UWJA 3DPKA 2UVZA 3WIKA 4L3PA 3VJNA 3WF9A 3ZYAA 3NFFB 5LMKC 5IDNA 2PMOX 3A7GA 4KINA 4L44A 2EUFB 5FM3A 4WSQA 5EYMA 3SKCA 4F7LA 1JSUA 2OZAA 2VRXA 3HGKA 3I0OA 4MXXA 4BWPA 5DR6A 4WRSA 2JIUA 3HDNA 5CSWA 4DEGA 2G9XA 2O2UA 2ZDTA 2PY3A 5FXRA 2XALA 2C5VA 2V0DA 2Y8OA 3OT3A 3IPHA 5T6KA 3VBXA 2YHVA 3PFQA 1WBPA 4O0RA 3C9WA 5HU9A 2YWPA 4DINA 5JZNA 3DNEA 4LGGA 4IZ5A 5JFSA 3DB8A 2BRNA 3E87A 4L8MA 2BHEA 1OIQA 2HXQA 2C6LA 5CF6A 5JEBA 2EXMA 4G3GA 4M67A 4ZSGA 4ZSLA 5J5SA 2GU8A 4PMTA 3HRBA 3W33A 3AQVA 4B8LA 3QCYA 1WVYA 4CEGA 5M51A 4JBOA 5IA3A 4I20A 2J5EA 4FT5A 4BCFA 3QWJA 5B0XA 2FSMX 4MBJA 3KVXA 4R3RA 5HIBA 5HNGA 1S9JA 3E8DA 1V0BA 4PPBA 3R83A 3TT0A 4ACGA 4R7HA 4H3BA 1YWRA 2ERKA 4EOSA 3MWUA 2RG6A 1QL6A 1GJOA 2R0UA 4Q5EA 3T8OA 4DLJA 4E4LA 4EHGA 4YU2A 4DAWA 5KMNA 4ORKA 4MVFA 5IUHA 3PLSA 3ANRA 3LLTA 3E88A 4XP0A 4YTHA 2W9FB 4PMMA 4BTFA 4NKSA 5D9HA 4B6LA 4NZWB 3RHXA 3TNQB 4HGLA 3V8SA 3W2SA 3NVKI 4FICA 3F5GA 1PMNA 3I79A 4RIYB 4UWYA 2NRYA 1H0VA 3CS9A 2X81A 5BYLA 4ZJJA 3POOA 3UG2A 2WZJA 3MY5A 4DFLA 2ITUA 5HI2A 4Z7GA 4F1OA 1OKWA 1Q8YA 3BQRA 2LGCA 4KBKA 3I6WA 1PW2A 2VTNA 4JRVA 1WZYA 3II5A 2OLCA 3UO4A 2FSLX 3QCXA 2YCFA 3L9MA 4MQ2A 2RSVA 2PE0A 4H36A 4C0TA 4O82A 4EUTA 4QYGA 3AT4A 3MY0A 1OL1A 5CENA 2VNYA 1PYXA 1OMWA 1GIIA 2OJFE 4L01A 4V0GA 3EQPA 1NY3A 1VYWA 2WO6A 5EW8A 5J9ZA 3G6HA 3N4TA 2X2KA 3A61A 4JBVA 4FBXA 1L3RE 2C6KA 4O4EA 1Z57A 1RJBA 4PPCA 2X7GA 4L46A 2B0QA 4NK9A 3ZLYA 4RGJA 3VUGA 2O5KA 5HD4A 3FSFA 4IE9A 1CKJA 5B2MA 1BL6A 3MIAA 3DKGA 4FNYA 5IQAA 2Z60A 3I1AA 4LGHA 5CSPA 3Q96A 4G17A 2XKDA 3O8TA 4EZ3A 3DK7A 4DE4A 4BCJA 4YNOA 5AV0A 3TYKA 2QOFA 2W17A 5EM6A 3NYOA 5I9VA 2VWBA 3OY3A 4BCGA 4C36A 3OROA 4D0XA 5ANIA 3R9DA 4W4WA 2XBAA 4FG9A 2J2IB 4GMYA 2WMRA 3PA5A 4BGHA 1KSWA 2R7BA 2VTRA 4UY9A 1A06A 5LVLA 3ZOSA 4ENXA 3RTPA 3F61A 4M68A 4BZNA 4XG7A 2FH9A 4XRJA 4BGQA 5EYDA 4W9XA 3SA0A 4MXZA 3R30A 1FPUA 4EHVA 4DEAA 3BBTB 4ZOGA 4DYMA 3MTLA 5M4FA 1OBDA 3UNJA 1R0PA 3OXZA 4DT9A 2PVKA 1Y6BA 3DDQA 4NIFB 4N57A 1H08A 3U6HA 4EH8A 4U40A 2ITTA 1YI6A 3TN8A 3LVPA 3ZZWA 3E63A 3C13A 4MCVA 2GNGA 1W98A 3EQHA 1ZZ2A 2IZSA 3AXWA 3MV5A 4Y5QA 4IFCA 3RAHA 5BMSA 3TZ7A 4XG4A 4IX5A 5FGKA 3PJ2A 2BTRA 4J53A 4GK4A 5E4HA 3OWPA 4C4GA 1CKPA 4BTMA 5FUTA 3TNIA 3FI3A 3I4BA 3EN4A 2OJGA 3LCTA 4C3PA 3WF6A 4AZEA 4E4XA 3A8XA 4QT1A 1YW2A 4O4BB 4RJ5A 4Y83A 4WRGA 1LR4A 4QTBA 1YXSA 4Q5HA 4IANA 3EZRA 3DJ5A 4HW7A 2F4JA 3ORLA 1YVJA 3CBLA 5AX3A 2DWBA 4BC6A 4BWKA 3GI3A 4RWIA 2E2BA 1SVEA 1LEWA 4ZJVA 3NNUA 3UG1A 3D94A 4BYIA 4IDTA 2ZV7A 4NFNA 2C1BA 2X2MA 5LVPA 2YCSA 1JSVA 3ACJA 3LCSA 2P0CA 2PZRA 3OTUA 4YPSA 5CAUA 5JMSA 5KBQA 4AXDA 2OH4A 4O0SA 3HKOA 4IM3A 1OKVA 4FV9A 3O71A 2XKEA 2PZ5A 3I7CA 3NCGA 5ANJA 3BX5A 4EOPA 3VS5A 3GGFA 2J0LA 5D7AA 3O5AA 2HYYA 4J95A 3PA4A 3UNKA 4WUAA 4X6QC 5HCXA 1T45A 2GHLA 3FL4A 4RJ6A 5CEKA 2QCSA 5M4CA 3HV7A 1ND4A 1ZOGA 4IM0A 3FXZA 4QMQA 4R3PA 3W0OA 1G5SA 3E92A 3EN9A 5IQBA 2WMWA 3UMWA 5JKGA 1ZZLA 4PMSA 4U42A 5ETIA 5AUYA 4DC2A 1JQHA 2WTIA 4IJPA 2REIA 3TJCA 3QHRA 3LCDA 3NW6A 4XV2A 5I5ZA 4FNZA 3V8TA 3EFWA 4RC3A 5HG9A 4FIEA 1Q3WA 5J87A 2BFXA 4DLIA 3Q9ZA 3PY0A 3QF9A 3R1SA 3A7IA 1FVRA 3C4WA 4TWCA 2CLQA 2CNUA 3DXPA 3QQJA 4O7VA 3VF9A 3LCOA 5FTGA 4M97A 4EWHA 4QEBA 1M7QA 3U6JA 3MFRA 2UZOA 4PDPA 2C68A 3UC4A 2IZUA 4FV8A 2C3JA 4F08A 3LMHA 2V22A 5HBJA 4QMOA 4QRCA 4QPSA 4E5BA 1OBGA 2YISA 4NSTA 3IGOA 5FD2A 4O7WA 2E9OA 2C3KA 4J8NA 4RLLA 4APPA 2CKOA 5IQIA 4WSYA 4RX7A 3R1NA 4E73A 3UBDA 1TQIA 4E5AX 3KXNA 2EB2A 4AQCA 4ASXA 2XEZA 4GSBA 4O21A 4FTCA 4S32A 4R5SA 4R6VA 3O0GA 4DEIA 3CTJA 2X0QA 4NW5A 3FKNA 1CDKA 3T3UA 4ACCA 1DI9A 3DJ6A 3ZRLA 5FG8A 3S00A 4G2FA 3KULB 3PRFA 3VS4A 3ZO3A 4C62A 2E9VA 3LM5A 3M2WA 3IS5A 3QGWA 2W05A 4JL9A 3E3PA 4F4PA 3B8RA 4FKSA 2HOGA 4PV0A 4YHFA 2NPQA 4MNFA 5K0XA 5AAGA 4QTCA 3ML1A 2E9PA 2QO7A 3RPRA 1CKIA 2W1GA 1FMOE 2ITOA 4CKRA 4QQ5A 4RC2A 2QLUA 4FYOA 2VO6A 5JFVA 2OK1A 5EM5A 3PSBA 4MBLA 5J7HA 5KUPA 4GFGA 4M66A 1O9UA 2CGUA 3JPVA 3EQRA 3G2FA 4BCMA 4YTCA 4HCUA 2PHKA 2PVFA 5AP1A 2Z7SA 4WD5A 4Y72A 1WMKA 4D5KA 5E8ZA 3HYHA 2WXVA 3ROCA 3R7OA 4FZFB 3KN6A 5L6PA 1FOTA 4N6YA 4ALUA 3ZBXA 3D83A 3NUPA 4I92A 5C8NA 4RWKA 5HKMA 5BPYA 4ERWA 3NFGB 1IAJA 5E9EA 3VUKA 2QKWB 4MYGA 4NM7A 4CFWA 2VO7A 4QO9A 1XMLA 5HIEA 3EWHA 3L1SA 3L9PA 4IAZA 4M12A 4FK6A 2WU7A 5KX8A 2G15A 3I5NA 4E4NA 3CD8A 5G6VA 4A9UA 2XF0A 2EU9A 3VW6A 5FEDA 2R2PA 4I23A 4GKHA 4UWCA 4YURA 3H9OA 4O0TA 2XIKA 4DBNA 3BLQA 4FV1A 3HEGA 5KBRA 3C5IA