4BHZA

Scaffold focused virtual screening: prospective application to the discovery of ttk inhibitor
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
279
structure length
251
Chain Sequence
QSMSVKGRIYSILKQIGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQQVGTVNYMPPEAIKDISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Scaffold-Focused Virtual Screening: Prospective Application to the Discovery of Ttk Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 251
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bhzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bhzA01
1J1BA 2GNFA 3EQGA 2WGJA 4FZ6A 4TNBA 4FTRA 2OK1A 2C30A 2QOBA 3KRLA 4ZS0A 2OWBA 1CMKE 3S2PA 4QMTA 4RLKA 5KHWA 5KO1A 4ZXTA 3C1XA 3EFWA 5DHJA 5L2WA 3BELA 2AUHA 3BV2A 3WE8A 2RIOA 2XCKA 3JVSA 3ZO1A 3NZ0A 4L00A 4MTAA 4LRMA 2NP8A 4YZNA 2E9NA 3CTQA 3RCDA 1Y8YA 2X81A 2H6DA 3QHWA 4PY1A 4LOOA 3MVJA 3AT3A 1OKZA 3QQUA 4K33A 5I9ZA 3BU5A 4F9CA 4KIKB 4FNWA 1H1SA 5CYIA 4MBLA 4BC6A 3ZOSA 4FKPA 4YZ9A 2IPXA 1OL5A 3OCBA 3BGZA 3C4FA 2YM4A 5H9BA 4E5WA 2QO7A 1JKLA 5F1ZA 2C5NA 3VUGA 5L6PA 5LOHA 2QO9A 2ITQA 5E8SA 4CLJA 5IISA 5M4FA 2PE0A 2C5VA 4FR4A 4G31A 1OVEA 4MXXA 5IA3A 4DLIA 4DG2E 5E92A 3BPRA 2WTDA 4C4FA 3U9CA 3ALNA 1ZYJA 4A07A 1H28A 4MXYA 2W1DA 1KWPA 1TVOA 5AR2A 3EFJA 5BYYA 4ANMA 1PMNA 4RJ3A 1M2PA 2XJ2A 4I5HA 3VRYA 5IDNA 2WTKB 3GT8A 5EHYA 1ZOGA 2XIXA 5I9UA 4FT7A 3T9TA 4ERWA 4W8EA 3SXRA 3CD3A 3Q32A 2X2MA 3SOAA 5HORA 3CTHA 2X4FA 3V8TA 4FKVA 5HOAA 4AZSA 2WHBA 1OITA 2WO6A 3BRBA 4O2ZA 1H08A 4CT2A 1W98A 2HCKA 3D5UA 1JVPP 5EM7A 3FUPA 4HOKA 3SGCA 1PYXA 5J87A 4AU8A 3DAKA 5IEVA 3FZSA 3EKNA 2C3JA 2XNGA 4PPBA 3D7ZA 5HNBA 4DEEA 5L4QA 2C6IA 4GFMA 3CGOA 4WBOA 2DQ7X 4CXAA 4YTCA 2XEZA 4MX9A 1SYKA 2PUIA 2W5HA 4ZJIA 3SX9A 5DMZA 3L9PA 4JQ7A 3ACKA 4BL1A 4CFMA 4ZTRA 3DBCA 3QQGA 1OPLA 4S32A 5TO8A 3OTUA 2QU6A 2C6TA 3R1YA 3W55A 3KFAA 3MJ2A 3ZSIA 3C9WA 3KXHA 2QR7A 2YA9A 3AD5A 3MYGA 4FT9A 1TQPA 2W1GA 3U4WA 1ZMVA 5CU2A 1OIYA 4KIOA 3GU7A 4C58A 3FJQE 4GW8A 4WT6A 3CC6A 5CTPA 4YBJA 2C6DA 3TWJA 5AP1A 4TPTA 3UPXA 1WBSA 3EN5A 3VIDA 3Q2MA 4ZSLA 3WARA 4ARKA 4FSWA 2QO2A 2ETRA 4DFYA 5A6NA 3R71A 2HW6A 3OWKA 2SRCA 4OTPA 2I6LA 4ZP5A 5AR7A 5IU2A 4FT0A 4CNHA 5ACBC 4W8DA 4EOIA 4E93A 4HVHA 5GZAA 2PVNA 5KE0A 2B9FA 3BU6A 4ERKA 2WOUA 4FYOA 4IDTA 4MCVA 3BEAA 3E87A 3IDPA 2Y0AA 2HIWA 4BDFA 4I0SA 4A9TA 3PIZA 4GIIA 3EFLA 3QLFA 4KD1A 4EK5A 3TCPA 2YIQA 4FUYA 3AT2A 3GU6A 4KIQA 5FM2A 4IHPA 4JR7A 4NEUA 4UXLA 3HV3A 4C4HA 5HG7A 2VO6A 3VBYA 3TKIA 2OIBA 2YM5A 4U97A 4P2KA 1EH4A 2YFXA 4O0UA 4YZMA 3WBLA 2W06A 5BVWA 3B8RA 1B38A 3CY3A 4GKHA 4CFNA 2IZSA 3FSFA 3BU3A 2Y8OA 2P2IA 3Q5ZA 2ESMA 4GYGA 4L68A 5FXQA 4AP7A 4BI1A 3O2MA 2JC6A 2IVTA 2W4JA 3QTXA 5ETIA 1GOLA 5AUWA 3CPCA 1W7HA 2XK3A 4TYJA 5CT7A 4DBNA 2VTRA 3L9LA 2W1CA 4D28A 3O0GA 4I5CA 4USFA 5M4IA 3P79A 4ZMFA 3FC2A 3F5PA 4R7HA 2ITZA 3D83A 3F2RA 5AUUA 5B2LA 3HX4A 1Q5KA 5IUIA 2XNBA 1OGUA 3KKVA 3OD6X 1NA7A 1XH7A 2JAMA 4E5AX 5A6OA 4O7NA 3VW8A 3HP2A 4RA4A 5HU9A 3NWWA 3DB8A 3UE4A 1YKRA 3VJOA 4KKHA 4BDKA 4QP9A 3B2TA 4QMWA 3TXOA 3LMGA 5CEOA 2UUEA 3BQCA 2ZV9A 3MV5A 4Q5EA 1DM2A 1UVRA 3PFQA 3EOCA 1URWA 2XYUA 3HLLA 4O7WA 5AADA 4IX3A 5L2TA 4BWXA 4O81A 4TY1A 2ZM4A 3PVUA 4LGDA 1R0EA 2GS7A 3BCEA 4EH5A 1GIJA 1H1QA 5IZFA 2PVFA 3TM0A 2BDFA 5DA3A 3R21A 4W4VA 3QKKA 3BHVA 2LAVA 3RHKA 4C35A 4AGDA 2R3PA 1PYEA 3O7LD 3R7EA 4BDBA 3N4VA 4H3BA 3ZXZA 4AA5A 1YWNA 2UZVA 3OT3A 4LL5A 4Q5HA 4BIBA 4P4CA 2GNGA 2PL0A 3DFCB 4L9IA 4PL4A 4ZOGA 2C3IB 5J95A 4H05A 4W4WA 3R00A 3NUPA 4FKQA 2V0DA 4IC7A 4AOTA 4D55A 5CEKA 2PULA 3H0YA 3QALE 4UY9A 3RMFA 2C6EA 3FI4A 4IACA 1YXSA 4NKSA 2XB7A 1XKKA 2IW6A 3MH3A 3CQUA 4JAIA 3ODZX 1PXJA 1A9UA 3LFDA 3QD2B 5GINE 3COIA 3P7BA 4ITIA 3OCTA 3SKCA 4PTEA 1DI8A 4NU1A 2X8EA 3K5VA 4ZTLA 3V01A 2YJRA 5IA2A 1LUFA 5AP3A 3TKUA 1CTPE 5J1VA 5BQ0A 3TACA 1G8SA 4MXZA 4TWNA 2NRYA 4CKJA 4FL3A 1OI9A 3AXWA 3RK9A 3HAMA 3ENMA 3R8UA 1TQIA 1IA9A 1MP8A 3OHTA 4DTAA 4TTHB 2BDJA 3LJ1A 5KCVA 3ZM4A 3COMA 2R3JA 3DY7A 3C50A 3D7TB 4XBUA 4AWIA 3OEZA 4UMUA 2C5YA 5DNRA 3OUKA 5F95A 3CD8A 3FMKA 1V0OA 5CANA 2VWUA 5E9EA 3QQJA 2BUJA 2CDZA 4I3ZA 3UBDA 4OW8A 3LMHA 3R30A 3DDPA 4FV6A 4D4SA 3DB6A 3JR1A 3VBVA 4B4LA 3F6XA 3L8VA 1H25A 4UMRA 5JT2A 5GJGA 5IQCA 3O7LB 3IK3A 4R78A 2ZV8A 1FVTA 4RC4A 3R63A 4FTOA 2C6LA 2IZUA 1Q24A 4PX6A 3S95A 4BWPA 4CMTA 4L52A 3GOKA 3OW4A 1SVHA 1CDKA 3IW6A 3UVRA 1Q4LA 3D94A 5EYDA 4C3PA 2PE2A 2V22A 3JYAA 1OL1A 2PHKA 2VUWA 3Q9XA 3EJ1A 5EI2A 5TE0A 4AA4A 4EWQA 3FMMA 2P0CA 3DK3A 4CCBA 5K4IA 2KTYA 4CYIA 5CI7A 3FYKX 4A4LA 3DPKA 3FLZA 5IKWA 3MFTA 1MRYA 4CKIA 3LCTA 3AMBA 3PJ2A 3O71A 3MIYA 2CMWA 1I09A 5G6VA 2WMRA 2C3KA 3TJCA 2J0JA 4WBBB 1Z57A 3PP0A 3DJ6A 3I7CA 3LCSA 3DTWA 5HIDA 3AC1A 3R7UA 4O7TA 2RGPA 2YIYA 4KRCA 4BBMA 2PVYA 4NZWB 4IC8A 4BGGA 1CM8A 4FSNA 3DTCA 5AP2A 3R02A 4PUZA 4I24A 4KBCA 3SHEA 4X2JA 5CASA 2PZYA 3BEGA 4RIYA 4N70A 5ACKA 4A9SA 5B0XA 4RPVA 4ANQA 2XUUA 2W5AA 3QAME 4YNOA 4AACA 5J9ZA 4PNIA 3MY0A 1CKJA 3QUEA 4I1ZA 4PP9A 3IGGA 1FVRA 4RWIA 3POOA 2XJ1A 2OW3A 3RHXA 4E20A 4K11A 2WEIA 3JUHA 3PXZA 3RAKA 1KE5A 1LEZA 4FTMA 2C0IA 5AUYA 2I0EA 3UJGA 3NNWA 4AN9A 4ZTHA 5KMLA 4GT3A 2NPQA 4ZEGA 3V3VA 1WFCA 4X3FB 1U59A 2FSMX 2I0VA 5DI1A 3ZUVA 2XM8A 3LZBA 2OF2A 4ZZOA 2X6DA 5EM5A 3R7OA 4BGQA 4CFFA 4LYNA 3F7ZA 5DIAA 4OT6A 5AM7A 1XBBA 4GEOA 4BCIA 3BE9A 4O0WA 4BTKA 3QTUA 4MF0A 3KGAA 4EBVA 3FKNA 3P4KA 4YURA 3E63A 3PJ3A 4RX5A 4BB4A 3MA3A 4YTIA 3VBWA 4BI2A 2HK5A 5EG3A 2BAKA 3V5JA 4EOPA 1JPAA 4RIWA 5JRQA 2PZPA 3HVCA 3C0GA 4WRGA 2VTLA 3E3BX 4UB7A 3ZO4A 1Q8YA 2XM9A 3EN4A 4ZTQA 4ZJJA 3HZTA 3UOKA 4G3GA 4FA2A 2Y4IB 3UYSA 4D2RA 2R3RA 4NT4A 3KA0A 2DYLA 3TJDA 3MVLA 2JAVA 3WZUA 2CPKE 4DGGA 2VO0A 3KC3A 3AC4A 5DN3A 3QLGA 3OEFX 3Q9YA 2YZAA 3TI1A 3A99A 3WZEA 4F0FA 4JIKA 4RVTA 2J9MA 3RALA 4MNEB 5AUXA 3H0ZA 2QURA 5FLFA 3BYMA 3VJNA 4X0MA 3EYGA 3K5UA 4TYIA 1NVQA 1FPUA 4QMSA 4AZTA 4EHZA 1WCCA 1ZOHA 3IS5A 2P33A 5CY3A 1YOJA 2WIHA 4F1MA 3ALOA 3ZRLA 4FTJA 3LJ0A 3WZKA 4DT8A 3EHAA 2IZTA 3ZO3A 2YERA 5A4QA 1PJKA 2UVZA 2ZJWA 2W1ZA 4LMNA 1NT2A 2BZKB 3HMOA 4HYHA 3L8XA 4I6FA 5JGAA 4IEBA 4DITA 2WMBA 3P7AA 4R8QA 4BI0A 1JLUE 4ZIMA 4FGRA 2Z7SA 3ZXTA 3CJFA 1OIQA 2AYPA 4M8TA 2ZB1A 4NUSA 4OBPA 1FMOE 4C7TA 2B1PA 3PLSA 3MPAA 4M68A 4P90A 3RPOA 2YM6A 3W2CA 2J6MA 4XLIA 4OTQA 3OBJA 5B2KA 4F1TA 5FEQA 2QLQA 2ACXA 3D9VA 3QCSA 3DQWA 2XIYA 3RZFA 4EOSA 4UBAA 2QOOA 2R7IA 3OY1A 3RKBA 1J7LA 2BMCA 3HEGA 2OH0E 3O8TA 4DTKA 1TKIA 2WMUA 3KMMA 2C69A 1KE9A 2EB3A 4U43A 4XP2A 4FKIA 5HEZA 5HVYA 4BGHA 5AAEA 3PY3A 4IB1A 4NW6A 4L45A 4LFIA 1XH6A 5A54A 5C8MA 3D5WA 4IWOA 3EZVA 4ZLZA 5L2QA 3ZS5A 4XV9A 5ANEA 2JIUA 3UZTA 4YJTA 2B54A 4CMUA 3PRFA 2JLDA 3UG1A 3FWQA 4YUQA 5TT7A 5DG5A 4YJQA 5HX6A 3MB7A 2O2UA 4BCOA 1V0PA 4CFVA 2C6OA 3DQXA 5HTCA 1H01A 2A1AB 5EM6A 4C36A 4C57A 5I9YA 1H0WA 1BKXA 5M44A 3QFVA 5KKRC 4MQ2A 1P14A 5A4LA 3DOGA 4UWCA 4WSQA 4DN5A 4G6OA 5JSMA 4WG4A 3QRJA 1BMKA 2DWBA 2XK9A 5DRDA 2UZNA 3GP0A 1M14A 2OBJA 4HYUA 3MPTA 3RJCA 4AT5A 4CQEA 4GV1A 3C0HA 3VBQA 1KE6A 3MTFA 3R8ZA 4FNXA 5CT0A 4EUUA 5D7AA 1IAJA 3OG7A 4YP8A 2RKUA 2V55A 1LR4A 3VHEA 2X9FA 2R3NA 2W96B 4FICA 1L8TA 3RWPA 2QOKA 1YDTE 2WMXA 3EQHA 4RBLA 5JZJA 4DF3A 2W1FA 4GFGA 5AP5A 4H1MA 2FSLX 1GZKA 4FIEA 3UO4A 3BYSA 3Q4TA 5AFVA 1PMUA 3ELJA 4FZDB 4JRVA 4S34A 4AW1A 5JFWA 2YIWA 1XO2B 2P3GX 2R3MA 4GK2A 4UMPA 1XQZA 5HTBA 3G15A 2XBAA 3FZTA 3VQUA 1ERKA 5LQFA 2C5OA 4M69B 5KMOA 3KQ7A 5IMEA 5ANJA 3BKBA 5EFQA 3QWKA 3BE2A 4PV0A 5JEBA 3COKA 4PMMA 4O0TA 3KK9A 4L6QA 3VVHA 3W2OA 4ZY4A 1QPJA 4E73A 5AA9A 4FSQA 1Y6AA 2QHMA 3P7CA 3V5TA 4G5PA 1Q62A 4FIIA 4KS8A 2HELA 3TUCA 3HMMA 2CKPA 1SNXA 3OTVA 3LFNA 1YRPA 1DAWA 4M97A 2OJJA 3HA6A 4ACHA 4C33A 3O8UA 3OF0A 5EW8A 4AGWA 4D9TA 3POZA 3QHRA 2ITVA 3MY1A 3PPJA 4QT1A 3U87A 3V8WA 3A61A 4BBEA 3GU5A 1BUHA 3TEIA 2RFEA 1E1VA 4F7JA 2VWBA 4G5JA 4S2ZA 3QX2A 3OCGA 3MFUA 5CALA 1H4LA 2XK8A 5AP6A 4BDJA 1NVRA 4TYGA 2CGXA 3FMNA 3L1SA 4Z16A 2J50A 1FQ1B 3WE4A 5AP4A 5BYZA 4FL2A 1E9HA 4JDJA 4NCTC 4WNOA 2CKQA 5HVKA 3NUAA 2IVUA 3Q3BA 3ZBFA 3DBFA 5EOLA 4BZNA 4E4LA 4QTEA 2HOGA 2GFSA 5E8UA 3RI1A 4AT4A 2JGZA 3Q4ZA 3F2NA 3KRWA 3R2YA 1KV1A 4V05A 5CAOA 2PVJA 5IEYA 2PMIA 3ZO2A 2OZAB 3OT8A 3NUSA 4M13A 4QMYA 5GJDA 1PKGA 3H3CA 3K3JA 2C6KA 2XIRA 5HVJA 3DT1A 3QCQA 2OIDA 3SDJA 4BCPA 2JDOA 5HIBA 3LM5A 4I5MA 4L7SA 5L8LA 4JG6A 3BLQA 1GIIA 5LWMA 4YLKA 4JDIA 1MRVA 3HUCA 5JZNA 3A7FA 5EYCA 3TZMA 2YZLA 2BFYA 4AS0A 2FGIA 2X9EA 3UP2A 1BI8A 1XBAA 4BIEA 2C6MA 1U54A 5J8IA 4Y83A 4X2NA 3TNQB 4GSBA 3ZUUA 3FPMA 4NWMA 4QMVA 4CEGA 5FDPA 4YGAA 4K2RA 1BI7A 4KNBA 4D4RA 4EQUA 3NVMB 4RT7A 3PZHA 4WNKA 3FSKA 2F9GA 3TTJA 4FKGA 4HZRA 3QKMA 3FPQA 2O5KA 4J7BA 2RL5A 2XYNA 4MXAA 4S31A 5E8XA 4NM3A 2W99B 2VX0A 5C1QB 3PXFA 2BVAA 3LVPA 3EIDA 1PXNA 3IQ7A 3OWLA 4FL1A 1L3RE 4FTNA 4AQCA 4QP1A 4BCHA 4FBXA 4HCTA 3K2LA 4L8MA 5KUPA 2OJFE 3LLAA 2A27A 4RVMA 2OXDA 1FGIA 3D0EA 3VS3A 3W18A 3JVRA 5A9UA 4JAJA 3EYHA 3VF8A 4BIDA 4DEHA 3TN8A 5IEXA 1VZOA 2YHVA 4K18A 5F9EA 1J1CA 4NCTA 2C3LA 1ZLTA 3BX5A 4TYHA 1Q97A 2X1NA 3RPYA 3SOCA 5KBRA 4FIFA 4BTJA 5DR6A 5CZHA 2VTSA 3E92A 3ZM9A 3U6IA 3CBLA 2Z8CA 3EQPA 3QUPA 4ZLYA 5KHXA 1ZARA 4QP2A 2B9HA 2BZHB 2VO7A 4FSMA 4U0IA 4DEBA 4FKTA 4NW5A 2VTQA 2W1EA 5K5NA 2UZOA 4FOCA 4I5PA 5BUIA 4FSYA 1OUYA 4YZCA 4HYIA 2ETMA 4MAOA 3N4TA 4FZ7A 3QTSA 2OF4A 4IAKA 4AA0A 3DZOA 4IH8A 1PXPA 4F64A 2VTAA 2IZRA 3A8WA 2XNNA 5M4UA 4L3LA 2C0OA 2QOLA 5D7VA 3DXPA 1J3HA 3FY0A 3N4UA 2Z7RA 4BZDA 4EH8A 3R28A 4FMQA 4DCAA 4LRKA 3PPZA 5K5XA 1P4OA 4U9AA 1MUOA 4NIFA 4G6NA 4PPAA 4HVDA 2VWIA 5IMXA 5B2MA 4EHEA 2BZIB 4MK0A 4NH1A 2CCHA 2XIZA 4RG0A 3VUKA 3KCFA 4RJ5A 2XK7A 4GUEA 1H1PA 3UO6A 1RQQA 2BRHA 4ANBA 4F6SA 4XG9A 1LPUA 4ZSAA 3F3ZA 3P23A 4G34A 3G6GA 2YAAA 3PE1A 4IIRA 5AV0A 3FXXA 4CRLA 4DH1A 2BZJA 4DEIA 3ROCA 3MFSA 2BALA 4XV2A 3W2RA 1M2QA 3T3VA 2R4BA 4MEDA 3V6RA 2YWVA 5JKGA 3N51A 3MA6A 4BN1A 4M3QA 2GNLA 4RFYA 4E6QA 3ULZA 3R22A 2PTKA 2ZDUA 3QXPA 3L8SA 2GHMA 2R3OA 4ANLA 4PNKA 1Y91A 1X8BA 4YJRA 3GC9A 2PUPA 3GB2A 3OCSA 4IAAA 4L3JA 5AWMA 3TIZA 2YM7A 5J7HA 2UW0A 2ITWA 2H9VA 3DKGA 2I0HA 4IZ5A 2PZRA 4RJ7A 4YC3A 1Q41A 4RZVA 2ITNA 3LIJA 3KF4A 4RZWA 5CSXA 4BDDA 4AT3A 4FODA 4F9BA 3GCUA 3NUXA 2CGVA 3IGOA 3QF9A 5JFVA 3AG9A 5CQWA 5HX8A 4MH7A 3O23A 2QKRA 1RJBA 1MQBA 3ODYX 3RPRA 4X6QC 3FLQA 3CCNA 4FOBA 5ETFA 4V01A 4IAFA 5AIRA 4S30A 5M51A 2HY0A 5AUTA 1M17A 4NTTA 4QPMA 3FEGA 4H58A 3ATSA 5HE0A 4EC8A 3ZLSA 2FYSA 3LPBA 3GU8A 2VTHA 3D4QA 4IWQA 2CKEA 4OBQA 2YWPA 4NYEA 4XHKB 3R0TA 4O0YA 2F4JA 3HDMA 3F3WA 4HVSA 2R64A 3BZ3A 1YHVA 2YABA 4FKRA 4FTTA 3SD0A 4BDCA 4YSJA 4AW5A 4XNEA 4EH2A 3EN6A 2C0TA 1W83A 4DGNA 1GY3A 3LE6A 3HECA 5CWZA 5BVFA 4Y72A 4MXCA 2VZ6A 4CKRA 3ZZEA 5J1WA 5CQUA 4QMLA 2J7TA 3SA0A 1SM2A 3BWJA 4L43A 3SC1A 3V6SA 3KEXA 4AXAA 5IG1A 3NNUA 3MB6A 2PMLX 3I0QA 3A7IA 3M11A 4G16A 5E8YA 5C03A 3MPMA 5K3YA 4QYEA 4FKOA 1HCLA 3R8MA 2B9JA 2J5FA 3D2KA 4KRDA 2CCIA 4BHNA 5BVKA 4EH3A 1G8AA 4ACDA 4KSQA 3F5GA 5DPVA 3KMUA 3R9RA 2UZWE 2WEVA 4WHZA 3OW3A 4UEUA 5K9IA 5KMJA 3UP7A 1SNUA 3NAXA 4D1ZA 4CZYB 4F7LA 4EOOA 4FKJA 4GH2A 2RSVA 4LQMA 5E1SA 3R1NA 4M14A 5A4TA 4FKWA 3Q6UA 2YIRA 3KXZA 4FKLA 2OJIA 1S9JA 3REPA 2R3GA 3U6JA 3EB0A 3TZ9A 4IVAA 4CQGA 1UWHA 3VN9A 4F99A 3W2QA 4EWHA 2B53A 4I6HA 4F7NA 2JFMA 1WBNA 3HV4A 4CYJA 3W16A 4NM0A 3O50A 3EQFA 3NR9A 4YC6A 3C5UA 4EC9A 3S3IA 3R9DA 3FMHA 4GS6A 4I93A 5F94A 5HCZA 4Z55A 4ZZNA 4M0YA 3FC1X 4V0GB 3ZU7A 3I0OA 4C62A 3QGYA 3QC9A 3ZDIA 2V62A 2J0LA 2QONA 5H8EA 4R77A 1WMKA 4PRJA 4AW0A 4CZTA 2UV2A 2VTTA 2R0UA 4KINA 4E1ZA 4C37A 2BILB 3OZ6A 5D41A 4EL9A 4KIKA 4C4JA 4EKKA 5CS6A 1ZMUA 2PY3A 3Q9WA 2XCHA 2WAJA 2FA2A 3I5NA 3QTIA 1PXMA 4YJNA 4O2PA 2CN8A 4ENYA 2OI4X 4FTKA 1UKHA 3PYYA 4U3ZA 4ASDA 4PF4A 3ZEPA 3IW5A 1PXKA 2YAKA 4CD0A 3R73A 4FF8A 2XH5A 2HXQA 2X39A 4FEVA 5JK3A 2FH9A 5M08A 4QNYA 3NS9A 5EYKA 5AV2A 3FXWA 4RC2A 4YPSA 4CV8A 5EQYA 3O8PA 3GBZA 3RAHA 3VW6A 4DFNA 5EM8A 3ZH8A 5IH5A 1LP4A 2CNUA 3BLRA 4JIAA 1ZYSA 4K6ZA 4BZOA 5LMKC 3NW5A 1XH5A 3MDYA 3QCYA 4FTIA 4W4YA 4ALWA 4F9YA 2GCDA 2BRGA 4ANSA 4GYIA 5HESA 1ZWSA 2VNYA 3TG1A 1FOTA 1URCA 2OFUA 2PVLA 4TRLA 4DAWA 5JGDA 3R7VA 4JLCA 4CT1A 2WTIA 4IDVA 5GZ8A 1YI6A 5GHVA 2ITPA 3ZFYA 2QI8A 3UC4A 4EQCA 4CG9A 2PMNX 2ERZE 4XV3A 2UVYA 4KSPA 3KRXA 1JAMA 3RP9A 5EI8A 1UNLA 3G9NA 3QTRA 4YC8A 4FSRA 4RA5A 2QCSA 2W9ZB 3EN7A 4FI1A 5DT0A 5FEEA 2W17A 4CSVA 3UQFA 1IASA 2CGUA 4NKAA 1OKYA 3OMVA 2OU7A 3AGLA 2XKEA 2WFYA 3LCDA 5JFXA 3DXQA 4OTHA 4CLIA 4Y5QA 3OVVA 3IDBA 5IQIA 3FI3A 2PUNA 5EQEA 4WD5A 4XX9A 3IO7A 2G01A 3EQDA 4O7VA 3ANQA 4QMZA 5D9HA 3NPCA 4I21A 3LFAA 2PMOX 4C02A 5CAUA 2WELA 4G3DA 2Q0BA 1SZMA 3L9MA 3MVHA 5FBOA 3PXQA 5K0KA 3TIYA 4D2VA 4EI4A 2Z7QA 3WIKA 4DGLC 2XKFA 3R04A 3ZC5A 3RPVA 4QMOA 4YZBA 3MESA 1T46A 1WBWA 4L3PA 4YHJA 4M67A 5HE2A 1PRYA 3A7JA 5DEWA 4X6RA 2BTSA 2WB8A 1YDRE 4CFXA 3VS4A 1XH9A 3OS3A 4O0VA 2C5XA 2OKRA 2ZVAA 4DT9A 3VUDA 2BRNA 2GS6A 3JY0A 2JIIA 3C51A 3QBNA 3H30A 2QU5A 4J53A 4XH6A 4TWPA 5IUHA 3G51A 2PZ5A 3RK7A 4A4XA 1OL2A 1JSVA 3FV8A 1OB3A 4MD8E 3HRBA 5HCYA 3I1AA 1OIUA 3NIZA 5HCXA 3U51A 3MIAA 4FIGA 5LMKA 2R0IA 3G9LX 4E5BA 3ORNA 3T8OA 4BKZA 4EUTA 5L3AA 4C2VA 2B4SB 4LGGA 1VYWA 4O0XA 5HBJA 2WQMA 3AQVA 4J8NA 2QOHA 4FX3A 3QQLA 4NM5A 3T3UA 4YTHA 4HW7A 3S4QA 4O1OA 2JITA 4A4OA 2O63A 4U41A 1FINA 4U44A 5LVMA 2I40A 3ZFXA 3F66A 3IW8A 4KKEA 3SW4A 2XS0A 2XRWA 5DOSA 4ZTSA 2WU7A 5FTQA 3RPSA 1UWJA 2WTVA 4F9AA 4X2FA 4D2PA 2ZYBA 2R3KA 3LCKA 2XNEA 1OKVA 4X2KA 3VBTA 3ZLWA 1Z5MA 2IN6A 3FKOA 2IO6A 2WD1A 3GCSA 3GFEA 3UVPA 2ZAZA 3SXFA 3WF9A 5AX9A 4C0TA 3SG8A 3H9OA 4E26A 3VUMA 3JXWA 4HJOA 3GNIB 2C4GA 1YOMA 4IB0A 5ANKA 2WMAA 4O7ZA 4DFUA 1H24A 3FXZA 4RX7A 4RVKA 5HE1A 2FB8A 4YJPA 4GIHA 2VWWA 2W7XA 5CAVA 3U8WA 5ANIA 4XG7A 3AC8A 4MVFA 4RX8A 4LUEA 4E4MA 3DS6A 4C3RA 4F0IA 4B6LA 2BFXA 4FNYA 4GU9A 5TKDA 1GJOA 5IQBA 3DK6A 4M7IA 2O64A 4WRSA 4Y46A 2OLCA 4BYIA 3DK7A 4ZTNA 3ZFMA 4CMOA 3UGCA 3L8PA 2JDTA 4F1OA 4Z7GA 2BPMA 4OTFA 5IQEA 2VWZA 4V04A 2E9VA 5IUGA 4AG8A 4WUNA 2EVAA 2AC5A 3QZGA 5DT4A 2XRUA 3Q60A 4EHVA 4JQ8A 4BCNA 3WYYA 3K54A 2A4LA 2ITUA 4XOYA 4Z9LA 2OH4A 3ORLA 4C61A 1YI4A 3UC3A 5DH3A 5HBHA 4IB5A 3SRVB 4H3PA 5AP7A 3Q4CA 3BBWA 4NFMA 4YU2A 5AMNA 3U9NA 3KCKA 4IAYA 1OKWA 3ORIA 4JBVA 5AR5A 5LVOA 3NVKI 3LFCA 4LRJA 4R5SA 5E8WA 3KULB 4QP8A 3HMNA 4U81A 1HOWA 5LVLA 3FMEA 3WI6A 3PSDA 3WILA 1WBTA 4QYYA 3DLSA 4GUBA 3QTWA 3R1SA 5AUZA 5GIPE 2JIVA 4UYNA 3QGWA 3ID6C 3QCXA 4RWKA 3F3TA 1YW2A 3GVUA 4GG7A 4UMQA 1DS5A 2UW5A 3S0OA 4AFEA 3LXNA 5CU0A 4XBRA 3AGMA 4R3PA 2PVKA 3ZSGA 3FLSA 3FKLA 1W0XC 4G3CA 5IPJA 5IQGA 1XR1A 4PPCA 5AP0A 3MBLA 2O0UA 1CSNA 1R39A 2E9OA 3ZCLA 4BKJA 2J4ZA 4XG2A 4P7EA 4D5KA 4JOAA 5HG5A 4YTFA 5L2IA 3F3UA 3D7TA 5E91A 3R9OA 3FBVA 4WKQA 3QZIA 3ZLXA 1XJDA 4FV1A 4AZEA 4DEGA 4ONAA 3C7QA 3RTPA 2VTJA 3Q2JA 4BCGA 3D15A 4QQTA 3PY0A 4J98A 4X3FC 4WNMA 5F20A 3ERKA 3D5VA 3RAIA 3V5QA 1RE8A 2Q83A 3ETAA 2H96A 3HP5A 2PZIA 3JPVA 5E1EA 4GL9A 3II5A 3EWHA 2HYYA 4E6AA 3FLYA 4DG0E 4O27B 4ALUA 3NIEA 3R1QA 2GHLA 4TWCA 1CKIA 4XG6A 3UYTA 4BBFA 2XKCA 3EZRA 4E4XA 2B52A 5HE3A 2PVHA 4EK4A 4JX7A 3W10A 2X7OA 3TNPC 2O8YA 5FM3A 4F09A 5CU6A 5CZIA 3QTZA 5D1JA 3I6UA 1UU3A 3DKFA 2J5EA 5C4KA 3RVGA 3IKAA 1P4FA 4JRNA 4R1VA 5FP5A 5HNGA 2Y4IC 4G3FA 2EWAA 5HTIA 4OAVB 4XP3A 5FEDA 2GHGA 4I0RA 4N6ZA 1YWVA 5ANOA 5GIOE 3E8DA 2XBJA 5B7VA 1H00A 4Y5HA 4EJNA 1O6LA 3ULIA 4DA5A 3I4BA 4XUFA 2W05A 5KZ0A 1YHWA 3H9FA 4B8LA 4EH9A 2W9FB 4PTGA 3W1FA 1W82A 3RM6A 2CKOA 1APME 2OJ9A 4ZZMA 3TDVA 2WMQA 3Q4UA 4UZDA 1IG1A 4N4SA 4FV4A 2RFSA 4PDSA 5L8JA 3A62A 4CCUA 4NSTA 1PHKA 2HY81 4IX4A 5HD7A 3KY2A 4O7LA 3UIXA 3GEQA 4CV9A 4EQMA 2PYWA 4FTAA 3HV6A 1F3MC 3DU8A 2RF9A 3G6HA 3ORXA 3UMWA 4PQNA 4FE2A 2YEXA 3A4OX 3PUPA 1KV2A 5BVEA 3BWFA 2UVXA 4HVIA 2XZSA 1OBDA 3KB7A 3LFQA 2PPQA 4W9WA 5T6KA 4GT5A 3I60A 2P2HA 3R2BA 4X3FA 3ZYAA 2C1BA 3AT4A 5FQDC 3TV6A 1DI9A 3R9HA 5KNJA 4CVAA 3I5ZA 4P5QA 4DFXE 4M15A 5IQHA 3DBQA 1BYGA 1M52A 3DZQA 3NW7A 4BF2A 3IG7A 4FNZA 4KBAA 4USDA 5HKMA 3CIKA 3R6XA 2J0MB 3BI6A 3DJ5A 2GNIA 4YO4A 4O91A 4U7ZA 2X8IA 1PF8A 4QTDA 4FYNA 4FVPA 3W8QA 4E8AA 3RCJA 2QG7A 3RINA 3F82A 2OGVA 3K3IA 3JY9A 3AMAA 2PE1A 3NUNA 3NYNA 1ZYDA 5D10A 3ZMMA 5CF4A 2G2FA 4K77A 4FEXA 1P2AA 5HG8A 4FEQA 3Q9ZA 2JBPA 4I20A 3W8LA 1YXXA 3Q52A 4EYMA 4TYEA 4FKUA 5AM6A 3F9NA 4FIHA 2Z2WA 4ZAUA 3E5AA 3PVWA 4NK9A 2GMXA 5D12A 1YWRA 4C4GA 2HXLA 4L42A 1O9UA 5LMBA 3OXIA 2JDVA 4DHFA 4MNEA 4FEUA 4HYSA 4IVCA 5L6WL 3M2WA 2X2LA 3ZZWA 5ICPA 4QRCA 3HNGA 4X21A 5AR3A 4EH4A 4FVQA 3ATTA 4G9CA 4XRLA 3PPKA 4E6DA 4L53A 4UYAA 5I9VA 2YCFA 1S9IA 4O21A 1OUKA 2UW9A 2JDRA 4H39A 2QOFA 4IFGA 2YLFA 3KXGA 4LOQA 4BCFA 1WBVA 2QOIA 4TW9A 3WF6A 5FTGA 5IF1A 3NUYA 3ZC6A 2IJMA 4JG7A 4LOPA 4K1BA 3ROYA 4KBKA 1QMZA 3ZLYA 4JR3A 1WVXA 3SXSA 3LJ2A 3GI3A 4XJ0A 4XCUA 4FSZA 2UW4A 2UW7A 5DLSA 1IR3A 3ACJA 4Z3VA 5EQPA 3LFSA 4GCJA 3NRMA 4O7SA 4I0TA 5GJFA 4YBKA 2V7OA 2BIKB 2P4IA 2GNJA 3QZHA 5LARA 4FUXA 3TNHA 1E1XA 4QYGA 5J9YA 2F7ZE 4DH3A 3AMYA 4L01A 1B39A 5A3XA 3DAEA 3G0FA 3BBTB 2NNWB 5AV4A 3Q5IA 1F0QA 2YDIA 3VUTA 4D58A 1VEBA 4LV5A 1ZOEA 4QMXA 5EKNA 4G17A 3UDBA 1XH8A 5CU3A 4LGHA 2ZDTA 3R83A 5IH6A 4FT3A 2OG8A 2XNMA 5DEYA 4LUDA 3FQEA 4JX3A 5FXRA 5J5SA 5EKOA 2VWYA 4D2WA 4QOXA 5DYJA 4BHZA 1TQMA 1LEWA 2QR8A 2WMSA 4GK4A 4Q9ZA 3MSSA 4BCQA 5KMIA 4AGCA 5K4JA 3GCVA 3QRTA 3OROA 3TV7A 4FG8A 2ERKA 2JKKA 3LXKA 3PY1A 3T9IA 3WYXA 2I0YA 2BKZA 4GFOA 5HNIX 5LXMA 2QQ7A 1UV5A 2QOQA 3BV3A 3E62A 1U4DA 1Q3DA 4IWDA 4AAAA 4K0YA 4DG3E 4Y95A 2XKDA 2XNOA 2KULA 5JQ8A 3VULA 2YLEA 1MRUA 2G2HA 5J5TA 2VTNA 2WMWA 3A60A 4IZYA 4O0RA 3VAPA 3ZDUA 4BKYA 1Q61A 4C8BA 2A2AA 5BUJA 2BROA 2ETKA 1P5EA 3PJ8A 2F49A 1ZAOA 4JL9A 4XMOA 4PWNA 4RMZA 3ZHPC 4D4YA 4OT5A 5E90A 3E88A 4C4EA 4F9WA 4QMQA 5HU3A 4M66A 4UXQA 4U45A 5HO6A 4RQKA 4J52A 4ZY6A 3R8VA 4HGSA 2OFVA 3RM7A 3AD6A 4YJSA 5T3QA 4CFUA 2F7EE 4ACCA 3C5IA 2RG6A 2VTOA 2HZ4A 2BR1A 4KA3A 2XIKA 2A0CX 5C8KA 2FSTX 2XA4A 3VS1A 1KOBA 1OPJA 2VTPA 3DXNA 1YOLA 1UNHA 4O6LA 4KB8A 2B0QA 1PKDA 4ZSJA 5JH6A 3BGPA 3PSCA 4M69A 3PG1A 2R9SA 2R3IA 5AV3A 2QODA 4FSUA 4AN3A 2IG7A 4IAZA 4TWOA 2OJGA 2R5TA 3G33A 2X8DA 4EH6A 1R78A 3C4XA 4WSYA 5A4CA 3UIBA 4I4FA 4U3YA 3NSZA 2F57A 4W9XA 3UVQA 5KX8A 4RIXB 5CSPA 5FRIA 4EZ5A 4O96A 3RGFA 3C0IA 3EQRA 4DEAA 3QQKA 4HPTE 1SVGA 5AAGA 5EK7A 4TN6A 5BNJA 1JOWB 3RNIA 4O1PA 1UU9A 4U79A 3CSVA 1O6YA 4CG8A 3RNYA 4RJ8A 4ZLOA 4H36A 4XLVA 1NY3A 5CNOA 3UG2A 5BYLA 4C59A 1GZ8A 5CSHA 5AUVA 4DFBA 3EFKA 3FDNA 4D9UA 4NJ3A 1J7IA 2JD5A 3OOMA 4WG5A 5M06A 4FSTA 3NNVA 2I1MA 3GCQA 3NYVA 3DLZA 4HCUA 3B2WA 4X7QA 5AV1A 1WAKA 1H07A 3CEKA 3ENHA 3PXKA 5KZIA 3KRJA 3PVGA 4KIPA 4OGRA 2QOCA 3LQ8A 4BCMA 5TF9A 3FZOA 3CQEA 3HV7A 3WF5A 4J8MA 2XP2A 3VBXA 4IANA 4JQEA 2FSOX 3OUNB 3D14A 5IA4A 2OZAA 3OWPA 2WMTA 2YACA 5M07A 3BYVA 3SLSA 5M56A 4APCA 1WBPA 5JMSA 4KWPA 4RX9A 1Q8TA 3PA4A 4ANNA 4JBOA 2R3LA 4CFWA 4EOLA 5BMSA 5M09A 5I9XA 4EHGA 5FUTA 3ORMA 4RWJA 2W4KA 2C47A 3ORPA 3VO3A 5J9LA 4WG3A 2YITA 2P55A 4GVJA 3FY2A 2UZTA 1U5QA 4ZMEA 2BCJA 3P08A 4GK3A 1R3CA 3PP1A 4GJ2A 4FGBA 1V0BA 2EUFB 5BVOA 2VWVA 3GENA 4DFLA 4EK3A 4RSSA 5H8BA 5DWRA 2CSNA 1AQ1A 3UNKA 2IWIA 4XP0A 4FC0A 4G6LA 4PDOA 5EOBA 5LMAA 4DE4A 2JBOA 4AOJA 3AOXA 3R8LA 4QQCA 4YZDA 3KMWA 4GG5A 3MGYA 4BFMA 2ITOA 3FMJA 2R2PA 2Y6MA 4FV0A 4DLJA 4NTSA 1PXOA 2IVSA 2JEDA 3CTJA 3OC1A 3BHHA 3BGQA 3NLBA 3OXZA 4XRJA 3W2PA 5E4HA 2IW9A 4O0SA 4M84A 2BAJA 2W1HA 4UWBA 2J0IA 4UN0C 3LXLA 2X6EA 3MFRA 4OTWA 5DR9A 2E2BA 3GXLA 4G1WA 2J51A 3DKOA 4DH5A 4RIOA 4PP7A 1M7QA 4ITJA 2YM8A 1REJA 4R6VA 4ID7A 1ATPE 3E3PA 4G3EA 3FL5A 2F7XE 5LVNA 3BYUA 4QQ5A 4JDKA 4PMTA 3AC5A 3UOHA 5J7BA 2HWOA 2VD5A 2WTKC 4F08A 4HNIA 3TUBA 2CNVA 1WVYA 5FWKK 3FQSA 2X7GA 3NX8A 4BWKA 3UZRA 1PXLA 4K9YA 3PWYA 2HAKA 3NW6A 2VGOA 3LM0A 3A8XA 5T68A 4MQ1A 2PVRA 3F3VA 4OTDA 1H0VA 4AE9A 4II5A 4BDHA 4CTCA 4W4XA 4X2GA 4M12A 3PTGA 3GQIA 3LFBA 5CVFA 4A9UA 3HGKA 4JG8A 4DEDA 5IQAA 3P86A 5EDRA 3F2AA 5M55A 3QL8A 3I7BA 4DYMA 2XEYA 4EH7A 5CEPA 4QMMA 4CRSA 1YXUA 1GZOA 1YXTA 2BAQA 3DCVA 4AZVA 2WXVA 2YJSA 3TT0A 3ORTA 2G1TA 4RIXA 1VYZA 3MVMA 4IBMA 1OM1A 2JFLA 4C4IA 4HVGA 5HLWA 3QU0A 5AAFA 4AOIA 4MKCA 2VU3A 4IM2A 3G90X 1H1RA 1Q8UA 1QPCA 2QVSE 3UQGA 3AD4A 2RG5A 4IE9A 1W84A 4MHAA 4BRXA 3KXXA 2OICA 5G1XA 3MH2A 4RVLA 4IAIA 4KS7A 2GQSA 5JRSA 2ZMCA 2XJ0A 2BRBA 5CSWA 4B7TA 4EBWA 4Q2AA 5CAQA 2VX3A 1VR2A 5A46A 4BDGA 4L46A 4GVAA 3GOPA 5CU4A 4JS8A 2NRUA 3SV0A 5I5ZA 4BDEA 4TL0A 1Q99A 4YR8A 3GC0A 4JBQA 4GJ3A 4YO6A 1AGWA 4FZAB 1VJYA 1OL7A 3ITZA 4P5ZA 4C3FA 5CF6A 2AC3A 3VNTA 5EHOA 2BIYA 3F69A 4XG3A 3R7YA 4YNEA 4HPUE 3BYOA 4D5HA 1KUTA 4YJVA 5C26A 3NEWA 2ZB0A 3G5DA 2UW3A 4E7WA 5HG9A 5I9WA 4G2FA 3MWUA 4JJRA 2WZJA 5CF5A 4AX8A 2J90A 2GS2A 3ORZA 4G9RA 4YSMA 3UOLA 3VS0A 3ZTXA 3MW1A 5TR6A 4BR3A 1UA2A 2W5BA 3MI9A 5EW9A 2GDOA 2WQEA 4QMPA 2YISA 1K9AA 4D2SA 2VX1A 3V51A 5IA0A 3PJ1A 2CJMA 2XNPA 4FK3A 3GGFA 4B9DA 5CEIA 5I3OA 4BTFA 3VS5A 5CVHA 5CX9A 3Q6WA 3LW0A 4B0GA 3UPZA 4J95A 1QL6A 4EONA 2R3QA 2XK6A 4N57A 4RIYB 5FTOA 4MWIA 3A2CA 3HYHA 4A9RA 3FHRA 5HBEA 4FV8A 4QP6A 3VUHA 3R7GA 2B7AA 2B9IA 1V1KA 1YHSA 3L9NA 1JKSA 2HZ0A 3QD3A 4FTCA 3UTOA 3MH1A 4HNFA 5I0BA 3R7IA 4EOKA 4QTBA 1M2RA 3TKHA 3F61A 4IZ7A 4QMUA 1Y57A 3VHKA 4N0SA 2Q0NA 2F2UA 3OBGA 2IVVA 4TT7A 4F0GA 4R7BA 1WZYA 4PMSA 5FXSA 3FI2A 4QNAA 3E8EA 3OY3A 4S33A 1WBOA 5AIKA 3E7VA 4ASZA 3LXPA 2W1IA 5FBNC 4EKLA 1W8CA 2BHEA 5C4LA 4EOQA 1OBGA 1FVVA 5IQDA 3U54A 4BDAA 1Z9XA 2FVDA 3EL8A 4QP4A 3CR0A 3HRCA 2WTJA 4Y85A 3V04A 5HO7A 3LCOA 5DRBA 2GNHA 4R3RA 2VO3A 3FI8A 3TL8A 2V7AA 4RIWB 2I7QA 3M42A 3E7OA 4NM7A 3EQBA 4AE6A 3CPBA 5DR2A 3NAYA 2DS1A 1ZZLA 4MF1A 5IA5A 2PVMA 3TV4A 3TZ7A 2WTCA 5CXHA 1OL6A 1RW8A 3COHA 3FZ1A 4O22A 5H8GA 4BICA 2BHHA 2C68A 2UZBA 3FZRA 3UZPA 2YCQA 3MJ1A 2EXMA 2QC6A 4U6RA 4Y73A 1JKTA 1IA8A 3VF9A 2CN5A 1XWSA 4WA9A 3HRFA 4O7YA 4U40A 2YN8A 3O51A 4U80A 3Q04A 4CGAA 1DAYA 4GRBA 5HZNA 1KE8A 2UZEA 2ITTA 3KL8A 4EK8A 5L6OA 1FMKA 2WTWA 4RFMA 5LJJA 4V0GA 1PW2A 3W2SA 3PIYA 1K3AA 3EQCA 2ITXA 4FKSA 4JI9A 4AGUA 3PXRA 2OO8X 4YJOA 3UIUA 5EYMA 5IH4A 4FV2A 4IJPA 4L44A 1PY5A 5ANGA 3A7GA 5AR4A 5CXZA 4QYFA 3QWJA 2VV9A 3Q96A 5JQ5A 5CENA 3PDTA 5FP6A 4F7SA 2F2CB 1IAHA 2V5QA 4AUAA 3S1HA 1R1WA 2QLUA 3H4JA 3E8CA 1H1WA 1ZXEA 4FTQA 3FAAA 2GQGA 3CXWA 4WOVA 1QPEA 3DKCA 2Y4PA 3NYXA 4IXPA 4UMTA 2QKWB 3CQWA 3E8NA 4FK6A 3ZRKA 4HGTA 3QRIA 4OAUC 4IB3A 4TZRA 1JKKA 4YHTA 4QYHA 5GZ9A 2UW8A 3EN9A 4GT4A 3THBA 4ASEA 4J96A 4D0WA 1HCKA 3GC7A 3UODA 3ZUTA 3NDMA 5FGKA 3CLYA 3PE2A 1O6KA 4IQ6A 5CNNA 5BX0A 3N9XA 4IMYA 4FEWA 2R3HA 3EL7A 3UO5A 4QP7A 4DFZE 4UV0A 4E6CA 1BLXA 3F5XA 5HHWA 2Z7LA 3QA0A 4A9YA 1XH4A 3RWQA 4CTBA 5CLPA 5M53A 4MWHA 4RJ4A 1PMEA 2XF0A 4A7CA 3VS6A 3G0EA 2A19B 2G15A 3DBEA 3VS2A 4ZY5A 5IDPA 4XS2A 2QNJA 2GSFA 4UZHA 1CKPA 4DCEA 4DH7A 3DBDA 3PVBA 5H3QA 4KUJA 4BCKA 4IM3A 4WNPA 3PRIA 3VUIA 3KN5A 1Y6BA 1H26A 3ANRA 4AW2A 1ZYLA 1FGKA 1GZNA 4GKIA 2YDJA 5A4EA 3DNDA 4C2WA 5BVDA 4LG4A 5HD4A 1Q8ZA 3VRZA 3C13A 3CY2A 5JGBA 3CJGA 5AA8A 1KSWA 4BCJA 4YJUA 4IFCA 5EH0A 3IOKA 3LHJA 2JKQA 5J79A 5AJQA 4HGEA 2O3PA 3AC3A 4FZFB 4JDHA 3EMGA 4D1XA 4AZWA 1GNGA 4D2TA 5BVNA 4FIJA 3NYOA 1GIHA 3PZEA 4UALA 4AN2A 4DC2A 1PMVA 3AC2A 4EORA 5BUEA 3SAYA 1UKIA 3KRRA 1UNGA 3MN3A 2YIXA 1A48A 3B8QA 2HZNA 3VWAA 1YI3A 2CHLA 3TDWA 4OTGA 4ALVA 5HLNA 3U6HA 4QP3A 3GCPA 3IECA 3KXMA 3HMIA 1SMHA 4BY9E 3NCGA 4C34A 5BPYA 3FMLA 4CZUA 2DUVA 4DTBA 4OTRA 4ZSGA 1ZYCA 2JKMA 4LV8A 1UU8A 4OUCA 4MD7E 4YHFA 2HENA 3NUUA 5EW3A 1KOAA 2ZV2A 3TZ8A 1JWHA 4BYJA 5DGZA 4ZTMA 4ACGA 1G3NA 3MH0A 4ANOA 1IEPA 2X0GA 4OLIA 2PK9A 2ZMDA 3FLNC 4WO5A 4KAOA 2WQNA 3DA6A 3OP5A 4IZAA 4Y8DA 4EJ7A 4XV1A 1OMWA 3HKOA 4Q9SA 2X7FA 5IQFA 2Y7JA 4R7IA 3TNIA 2HZIA 4XG8A 1OZ1A 3TTIA 4RJ6A 4AZFA 4ENXA 2ZM1A 2ONLC 1XBCA 5E8TA 3IW4A 4RQVA 3U55A 2R7BA 3EKKA 2WQBA 4MNFA 4MYGA 4QPSA 2HW7A 1FBNA 5F4NA 3KU2A 5LWNA 4F4PA 5A14A 5D11A 5EI6A 5M4CA 3BHYA 3WF8A 4DH8A 3UOJA 3FL4A 3PXYA 2GTMA 3H10A 4YPDA 4FV3A 5KKRB 5ITAA 1ND4A 4GMYA 5CVGA 4O82A 2B55A 1A06A 4R5YA 3PWDA 5ANDA 3CGFA 1SVEA 2O65A 3FE3A 5FD2A 3FYJX 3KVWA 4PL3A 1YQJA 3C4EA 3UMXA 4E4NA 1BL7A 3R8PA 5EDQA 4I92A 2YDKA 1ZMWA 3FLWA 3BHTA 4D0XA 3W33A 1R0PA 4J97A 4UWYA 3WZJA 4O84A 4NL0A 2FO0A 2G2IA 2WU6A 4TXCA 3QQHA 4JBPA 4JVGA 5AX3A 3QRKA 3LFEA 3QKLA 4IWPA 4LM5A 1JNKA 3ZSHA 4O38A 2WNTA 3NNXA 2WKMA 4Z7HA 4ZJVA 3FQHA 2BKKA 3QD4A 3QA8A 1J91A 3RZBA 3Q53A 3H9RA 4I22A 3F7WA 3DFAA 5CEQA 5GNKA 2VTIA 4MD9E 5KBQA 4DGOA 5HGIA 4D1SA 4JXFA 3P0MA 1U54B 4DINA 4I94A 3CP9A 3GUBA 4IW0A 4PL5A 4M0ZA 4RLLA 3GFWA 3QD0A 3V5PA 3KXNA 5C01A 4PDYA 2WPAA 5I3RA 4JNWA 4EEVA 4F6UA 2XMYA 4R3CA 5L2SA 4XEYA 2GU8A 3SRVA 5BMMA 1Y8GA 3CKWA 4RWLA 3ZEWA 5HIEA 3D2IA 2VTMA 3QUDA 4K8AA 4USEA 4ACMA 4N6YA 3SQQA 4DBXA 2W0JA 3W32A 4IVDA 2CLXA 4QTCA 1G5SA 3V5WA 3PG3A 5DE2A 2EXCX 1BX6A 1RDQE 2QHNA 2CLQA 3KULA 5FDXA 4AFJA 3CS9A 2IW8A 1YXVA 3TUDA 4EOMA 3LQ3A 2ONLA 3HMPA 1M7NA 1NVSA 4XOZA 5DFPA 5I4NA 4D4VA 4KKGA 3FMDA 2ZM3A 4A06A 4NJDA 5HQ0A 1U46A 5C27A 3MTLA 2PSQA 3UIMA 2OSCA 5L8KA 2Z02A 2XVDA 3KN6A 5EDPA 4LMUA 2ZV7A 4MXOA 4TYHB 1KE7A 4LI5A 3LAUA 4QTAA 1AD5A 4QPAA 4ASXA 1QPDA 2J2IB 3WOWA 3I81A 1ZY5A 2WOTA 2RFDA 2ZOQA 3A4PA 4BVUA 3EH9A 4JT3A 1GAGA 4QD6A 2CNQA 3ZBXA 4J1RA 5AR8A 1WVWA 3F88A 3FZPA 2PUUA 4RRVA 4F70A 4HCVA 3WF7A 3ZRMA 2G9XA 2JDSA 3HA8A 5HO8A 4O7RA 4HGLA 5CAPA 3RAWA 4WUAA 5CI6A 2X2KA 4AF3A 2GTNA 3TNWA 3IPHA 3WZDA 3GU4A 2X4ZA 3DNEA 3HUBA 3OOGA 3KK8A 3KVXA 3P1AA 4O86A 3NCZA 2REIA 1XHAA 2GFCA 4GU6A 4R1YA 4ZK5A 5JFSA 3PLAE 2Y9QA 3WIGA 3QYWA 2UZLA 4EYJA 4X3JA 1UU7A 4NIFB 5K0XA 3UNJA 5E7RA 3ZONA 4XG4A 2OXYA 5LCJA 3SW7A 5JN2A 4ZS4A 3QZFA 4FV9A 4O83A 2UZUE 4FVRA 4IX5A 4FG7A 3DJ7A 2OZOA 5FG8A 4IADA 3C4WA 4EK6A 1B6CB 3I6WA 4DGMA 3LQ5A 5HICA 2WQOA 3QXOA 2UW6A 3P78A 2R3FA 4YMJA 3UQCA 1H27A 4I6BA 3R01A 3U4UA 4KABA 4PTCA 3ET7A 3E64A 3LKMA 1BL6A 2VN9A 3D5XA 4I23A 4OR5A 3CE3A 4U42A 3LMIA 5EHLA 3NGAA 4FT5A 4H3QA 1JBPE 5ETCA 4PDPA 4PMPA 2YCRA 4I4EA 3P9JA 5CF8A 3HV5A 4FV5A 5CEMA 5CSVA 4I41A 3GC8A 3SVVA 2WMVA 4I6QA 3OXTA 4MBJA 3RK5A 1I44A 3M1SA 4IM0A 4RC3A 4TKSA 1MQ4A 3IOPA 4HZSA 2Z60A 3DDQA 1IRKA 2VGPA 2RFNA 2JKOA 5IA1A 4UX9A 3JS2A 3V5LA 1NW1A 1Q3WA 4BDIA 3DGKA 4B8MA 1U5RA 3IONA 4J71A 4EOJA 3VQHA 3BHUA 5E8VA 5C8NA 4ZSEA 3E93A 4C38A 5LVPA 1YVJA 1JSUA 4NFNA 2H34A 2VNWA 4IJ9A 5LCKA 4L67A 3IW7A 2OXXA 3I79A 4QMNA 2HWPA 3KREA 4YLLA 1QCFA 1T45A 2CGWA 3O17A 4RFZA 2QG5A 2ITYA 2YCSA 1JQHA 5H2UA 2BDWA 3P5KA 4ITHA 1PXIA 3PA5A 3LLTA 5HI2A 2C1AA 5HLPA 4H1JA 2PU8A 1ZZ2A 4LL0A 2OIQA 2EU9A 3HL7A 3UNZA 1YDSE 4F63A 5M57A 3BIZA 3O96A 3LOKA 5E8ZA 2FUMA 4APPA 4F6WA 3HAVA 4YLJA 5KMKA 2VRXA 2VWXA 3OFMA 5KMMA 4U8ZA 5DT3A 2H8HA 4F65A 3ORKA 3KF7A 4WIHA 3EQIA 3MS9A 2VAGA 4OTIA 3LFFA 3QYZA 3SG9A 3DAJA 4L7FA 3OWJA 3FHIA 3C4CA 4O6EA 3V8SA 1STCE 3F5UA 1ZY4A 3PA3A 3MY5A 3CKXA 3DV3A 5ETAA 3PSBA 4IX6A 1OIRA 2BTRA 2E9PA 2GPHA 4EZ3A 4OBOA 4IVBA 4U5JA 3C4ZA 4RGJA 2EB2A 2PWLA 4E3CA 3BLHA 3GQLA 3IDCA 4ORKA 1ZRZA 4MBIA 3R9NA 3QQFA 3QRUA 4QQJA 4FTUA 4FTLA 3HDNA 4EZ7A 4FV7A 3RBWA 3S00A 2XK4A 4TNDA 1J7UA 3VC4A 1NXKA 1OECA 4FG9A 4J99A 1F5QA 3PIXA 2W4OA 2Y6OA 1REKA 5C9CA 2GQRA 1OPKA 3G2FA 3A7HA 4BTMA 4B99A 2LGCA 2UZDA 2YM3A 4XYFA 5DBXA 2QD9A 3PJCA 3QX4A 3BQRA 2BRMA 5TOZA 4QO9A 5KMNA 3QC4A 3NMUF 1Q8WA 2E9UA 3QTQA 5DVRA 2EXEA 2J0KA 1K2PA 2WIPA 3VS7A 1JSTA 2NO3A 1H8FA 5AEPA
chains in the Genus database with same CATH superfamily
1J1BA 2GNFA 3EQGA 2WGJA 4FZ6A 4TNBA 4FTRA 2OK1A 2C30A 2QOBA 3KRLA 4ZS0A 2OWBA 1CMKE 3S2PA 4QMTA 4RLKA 5KHWA 5KO1A 4ZXTA 3C1XA 3BL7A 3EFWA 5DHJA 5L2WA 3BELA 2AUHA 3BV2A 3WE8A 2RIOA 2XCKA 3JVSA 3ZO1A 3NZ0A 4L00A 4MTAA 4LRMA 2NP8A 4YZNA 3UDZA 2E9NA 3CTQA 3RCDA 1Y8YA 2X81A 2H6DA 3QHWA 4PY1A 4LOOA 3MVJA 3AT3A 1OKZA 3QQUA 4K33A 5I9ZA 3BU5A 4F9CA 4KIKB 4FNWA 1H1SA 5CYIA 4MBLA 4BC6A 3NFFB 3ZOSA 4FKPA 4YZ9A 2IPXA 1OL5A 3OCBA 3BGZA 3C4FA 2YM4A 5H9BA 4E5WA 1XMMA 2QO7A 1JKLA 5F1ZA 2C5NA 3VUGA 5L6PA 5LOHA 2QO9A 2ITQA 5E8SA 4CLJA 5IISA 5M4FA 2PE0A 2C5VA 4FR4A 4G31A 1OVEA 4MXXA 5IA3A 4DLIA 4DG2E 5E92A 3BPRA 2WTDA 4C4FA 3U9CA 3ALNA 1ZYJA 4A07A 1H28A 4MXYA 2W1DA 3PFYA 1KWPA 1TVOA 5AR2A 3EFJA 5BYYA 4ANMA 1PMNA 4RJ3A 1M2PA 2XJ2A 4I5HA 3VRYA 5IDNA 2WTKB 3GT8A 5EHYA 1ZOGA 2XIXA 5I9UA 4FT7A 3T9TA 4ERWA 4W8EA 3SXRA 3CD3A 3Q32A 2X2MA 3SOAA 5HORA 3CTHA 2X4FA 3V8TA 4FKVA 5HOAA 3PUFC 4AZSA 2WHBA 1OITA 2WO6A 3BRBA 4O2ZA 1H08A 4CT2A 2XAOA 1W98A 2HCKA 3D5UA 1JVPP 5EM7A 3FUPA 4HOKA 3SGCA 1PYXA 5J87A 4AU8A 3DAKA 5IEVA 3FZSA 3EKNA 2C3JA 2XNGA 4PPBA 3D7ZA 5HNBA 4DEEA 5L4QA 2C6IA 4GFMA 3CGOA 4WBOA 2DQ7X 4CXAA 4YTCA 2XEZA 4MX9A 1SYKA 2PUIA 2W5HA 4ZJIA 3SX9A 5DMZA 3L9PA 4JQ7A 3ACKA 4BL1A 4CFMA 4ZTRA 3DBCA 3QQGA 1OPLA 4S32A 5TO8A 3OTUA 2QU6A 2C6TA 3R1YA 3W55A 3KFAA 3W0QA 3MJ2A 3ZSIA 3C9WA 3KXHA 2QR7A 2YA9A 3AD5A 3MYGA 4FT9A 1TQPA 2W1GA 3U4WA 1ZMVA 5CU2A 1OIYA 4KIOA 3GU7A 4C58A 3FJQE 4GW8A 4WT6A 3CC6A 5CTPA 4YBJA 2C6DA 3TWJA 5AP1A 4TPTA 3UPXA 1WBSA 3EN5A 3VIDA 3Q2MA 4ZSLA 3WARA 4ARKA 4FSWA 2QO2A 2ETRA 4DFYA 5A6NA 3R71A 2HW6A 3OWKA 2SRCA 4OTPA 2I6LA 4ZP5A 5AR7A 5IU2A 4FT0A 4CNHA 5ACBC 4W8DA 4EOIA 4E93A 4HVHA 5GZAA 2PVNA 5KE0A 2B9FA 3BU6A 4ERKA 2WOUA 4FYOA 4IDTA 4MCVA 3BEAA 3E87A 3IDPA 2Y0AA 2HIWA 4BDFA 4I0SA 4A9TA 3PIZA 4GIIA 3EFLA 3QLFA 4KD1A 4EK5A 3TCPA 2YIQA 4FUYA 3AT2A 3GU6A 4KIQA 5FM2A 4IHPA 2A98A 4JR7A 4NEUA 4UXLA 3KIOC 3HV3A 4C4HA 5HG7A 2VO6A 3VBYA 3TKIA 2OIBA 2YM5A 4U97A 4DDGA 4P2KA 1EH4A 2YFXA 4O0UA 4YZMA 3WBLA 2W06A 5BVWA 3B8RA 1B38A 3CY3A 4GKHA 4CFNA 2IZSA 3FSFA 3BU3A 2Y8OA 2P2IA 3Q5ZA 2ESMA 4GYGA 4L68A 5FXQA 4AP7A 4BI1A 3O2MA 2JC6A 2IVTA 2W4JA 3QTXA 5ETIA 1GOLA 5AUWA 3CPCA 1W7HA 2XK3A 4TYJA 5CT7A 4DBNA 2VTRA 3L9LA 2W1CA 4D28A 3O0GA 4I5CA 4USFA 5M4IA 3P79A 4ZMFA 3FC2A 3F5PA 4R7HA 2ITZA 3D83A 3F2RA 5AUUA 5B2LA 3HX4A 1Q5KA 5IUIA 2XNBA 1OGUA 3KKVA 3OD6X 1NA7A 1XH7A 2JAMA 4E5AX 5A6OA 4O7NA 3VW8A 3HP2A 4RA4A 5HU9A 3NWWA 3DB8A 3UE4A 1YKRA 3VJOA 4KKHA 4BDKA 3W0PA 4QP9A 3B2TA 4QMWA 3TXOA 3LMGA 5CEOA 2UUEA 4MUQA 3BQCA 2ZV9A 3MV5A 4Q5EA 1TFFA 1DM2A 1UVRA 3PFQA 3EOCA 1URWA 2XYUA 3HLLA 4O7WA 5AADA 4IX3A 5L2TA 4BWXA 4O81A 4TY1A 2ZM4A 3PVUA 4LGDA 2IF8A 1R0EA 2GS7A 3BCEA 4EH5A 1GIJA 1H1QA 5IZFA 2PVFA 3TM0A 2BDFA 5DA3A 3R21A 4W4VA 3QKKA 3BHVA 2LAVA 3RHKA 4C35A 4AGDA 2R3PA 1PYEA 3O7LD 3R7EA 4BDBA 3N4VA 4H3BA 3ZXZA 4AA5A 1YWNA 2UZVA 3OT3A 4LL5A 4Q5HA 4BIBA 4P4CA 2GNGA 2PL0A 3DFCB 4L9IA 4PL4A 4ZOGA 2C3IB 5J95A 4H05A 4W4WA 3R00A 3NUPA 4FKQA 2V0DA 4IC7A 4AOTA 4D55A 5CEKA 2PULA 3H0YA 3QALE 4UY9A 3RMFA 2C6EA 3W0RA 3FI4A 4IACA 1YXSA 4NKSA 2XB7A 1XKKA 2IW6A 3MH3A 3CQUA 4JAIA 3ODZX 1PXJA 1A9UA 3LFDA 3QD2B 3AKJA 5GINE 3COIA 3P7BA 4ITIA 3OCTA 3SKCA 4PTEA 1DI8A 4NU1A 2X8EA 3K5VA 4ZTLA 3V01A 2YJRA 1W2DA 5IA2A 1LUFA 5AP3A 3TKUA 1CTPE 5J1VA 5BQ0A 3TACA 1G8SA 4MXZA 4TWNA 2NRYA 4CKJA 4FL3A 1OI9A 3AXWA 3RK9A 3HAMA 3ENMA 3R8UA 1TQIA 1IA9A 4FJVA 1MP8A 3OHTA 4DTAA 4TTHB 2BDJA 3LJ1A 5KCVA 3ZM4A 3AKKA 3COMA 2R3JA 3DY7A 3C50A 3D7TB 4XBUA 4AWIA 3OEZA 4UMUA 2C5YA 5DNRA 3OUKA 5F95A 3CD8A 3FMKA 1V0OA 5CANA 2VWUA 5E9EA 3QQJA 2BUJA 2CDZA 4I3ZA 3UBDA 4OW8A 3LMHA 3R30A 3DDPA 4FV6A 4D4SA 3DB6A 3JR1A 3VBVA 4B4LA 3F6XA 3L8VA 1H25A 4UMRA 5JT2A 5GJGA 5IQCA 3O7LB 3IK3A 4R78A 2ZV8A 1FVTA 4RC4A 3R63A 4FTOA 2C6LA 2IZUA 1Q24A 4PX6A 3S95A 4BWPA 4CMTA 4L52A 3GOKA 3OW4A 1SVHA 1CDKA 3IW6A 3UVRA 1Q4LA 3D94A 5EYDA 4C3PA 2PE2A 2V22A 3JYAA 1OL1A 2PHKA 2VUWA 3Q9XA 3EJ1A 5EI2A 5TE0A 4AA4A 4EWQA 3FMMA 2P0CA 3DK3A 4CCBA 5K4IA 2KTYA 4CYIA 5CI7A 3FYKX 4A4LA 3DPKA 3FLZA 5IKWA 3ML1A 3MFTA 1MRYA 4CKIA 3LCTA 3AMBA 3PJ2A 3O71A 3MIYA 2XARA 2CMWA 1I09A 5G6VA 2WMRA 2C3KA 3TJCA 2J0JA 4WBBB 1Z57A 3PP0A 3DJ6A 3I7CA 3LCSA 3DTWA 5HIDA 3AC1A 3R7UA 4O7TA 2RGPA 2YIYA 4KRCA 4BBMA 2PVYA 1ST0A 4NZWB 4IC8A 4BGGA 1CM8A 4FSNA 3DTCA 5AP2A 3R02A 4PUZA 4I24A 4KBCA 3SHEA 4X2JA 5CASA 2PZYA 3BEGA 4RIYA 4N70A 5ACKA 4A9SA 1W2CA 5B0XA 4RPVA 4ANQA 2XUUA 2W5AA 3QAME 4YNOA 4AACA 5J9ZA 4PNIA 3MY0A 1CKJA 3QUEA 4I1ZA 4PP9A 3IGGA 1FVRA 4RWIA 3POOA 2XJ1A 2OW3A 3RHXA 4E20A 4K11A 2WEIA 3JUHA 3PXZA 3RAKA 1KE5A 1LEZA 4FTMA 2C0IA 5AUYA 2I0EA 3UJGA 3NNWA 4AN9A 4ZTHA 5KMLA 4GT3A 2NPQA 4ZEGA 3V3VA 1WFCA 4X3FB 1U59A 2FSMX 2I0VA 5DI1A 3ZUVA 2XM8A 3LZBA 2OF2A 4ZZOA 2X6DA 5EM5A 3R7OA 4BGQA 4CFFA 4LYNA 3F7ZA 5DIAA 4OT6A 5AM7A 1XBBA 4GEOA 4BCIA 3BE9A 4O0WA 4BTKA 3QTUA 4MF0A 3KGAA 4EBVA 3FKNA 3P4KA 4YURA 3E63A 3PJ3A 4RX5A 4BB4A 3MA3A 4YTIA 3VBWA 4BI2A 2HK5A 5EG3A 2BAKA 3V5JA 4EOPA 1JPAA 4RIWA 5JRQA 2PZPA 3HVCA 3C0GA 4WRGA 2VTLA 3E3BX 4UB7A 3ZO4A 1Q8YA 2XM9A 3EN4A 4ZTQA 4ZJJA 3HZTA 3UOKA 4G3GA 4FA2A 2Y4IB 3UYSA 4D2RA 2R3RA 4NT4A 3KA0A 2DYLA 3TJDA 3MVLA 2JAVA 3WZUA 2CPKE 4DGGA 2VO0A 3KC3A 3AC4A 5DN3A 4O4EA 3QLGA 3OEFX 3Q9YA 2YZAA 3TI1A 3A99A 3WZEA 4F0FA 4JIKA 4RVTA 2J9MA 3RALA 4MNEB 5AUXA 3H0ZA 2QURA 5FLFA 3BYMA 3VJNA 4X0MA 3EYGA 3K5UA 4TYIA 1NVQA 1FPUA 4QMSA 4AZTA 4EHZA 1WCCA 1ZOHA 3IS5A 2P33A 5CY3A 1YOJA 2WIHA 4F1MA 3ALOA 3ZRLA 4FTJA 3LJ0A 3WZKA 4DT8A 3EHAA 2IZTA 3ZO3A 2YERA 5A4QA 1PJKA 2UVZA 2ZJWA 2W1ZA 4LMNA 1NT2A 2BZKB 3HMOA 4HYHA 3L8XA 4I6FA 5JGAA 4IEBA 4DITA 2WMBA 3P7AA 1TZDA 4R8QA 4BI0A 1JLUE 4ZIMA 4FGRA 2Z7SA 3ZXTA 3CJFA 1OIQA 2AYPA 4M8TA 2ZB1A 4NUSA 4OBPA 1FMOE 4C7TA 2B1PA 3PLSA 3MPAA 4M68A 4P90A 3RPOA 2YM6A 3W2CA 2J6MA 4XLIA 4OTQA 3OBJA 5B2KA 4F1TA 5FEQA 2QLQA 2ACXA 3D9VA 3QCSA 3DQWA 2XIYA 3RZFA 4EOSA 4UBAA 2QOOA 2R7IA 3OY1A 3RKBA 1J7LA 2BMCA 3HEGA 2OH0E 3O8TA 4DTKA 1TKIA 2WMUA 3KMMA 2C69A 1KE9A 2EB3A 4U43A 4XP2A 4FKIA 5HEZA 5HVYA 4BGHA 5AAEA 3PY3A 4IB1A 4NW6A 4L45A 4LFIA 1XH6A 5A54A 5C8MA 3D5WA 4IWOA 3EZVA 4ZLZA 5L2QA 3ZS5A 4XV9A 5ANEA 2JIUA 3UZTA 4YJTA 2B54A 4CMUA 3PRFA 2JLDA 3UG1A 3FWQA 4YUQA 5TT7A 5DG5A 4YJQA 5HX6A 3MB7A 2O2UA 4BCOA 1V0PA 4CFVA 2C6OA 3DQXA 5HTCA 3TMOA 1H01A 2A1AB 5EM6A 4C36A 4C57A 5I9YA 1H0WA 1BKXA 5M44A 3QFVA 5KKRC 4MQ2A 1P14A 5A4LA 3DOGA 4UWCA 4WSQA 4DN5A 4G6OA 5JSMA 4WG4A 3QRJA 1BMKA 2DWBA 2XK9A 5DRDA 2UZNA 3GP0A 1M14A 2OBJA 4HYUA 3MPTA 3RJCA 4AT5A 4CQEA 4GV1A 3C0HA 3VBQA 1KE6A 3MTFA 3R8ZA 4FNXA 5CT0A 4EUUA 5D7AA 1IAJA 3OG7A 4YP8A 2RKUA 2V55A 1LR4A 3VHEA 2X9FA 2R3NA 2W96B 4FICA 1L8TA 3RWPA 2QOKA 1YDTE 2WMXA 3EQHA 4RBLA 5JZJA 4DF3A 2W1FA 4GFGA 5AP5A 4H1MA 2FSLX 1GZKA 4FIEA 3UO4A 3BYSA 3Q4TA 5AFVA 1PMUA 3ELJA 4FZDB 4FRFA 4JRVA 4S34A 4AW1A 2YIWA 5JFWA 1XO2B 3BLAA 2P3GX 2R3MA 4GK2A 4UMPA 1XQZA 5HTBA 2XAMA 3G15A 2XBAA 3FZTA 3VQUA 1ERKA 5LQFA 2C5OA 4M69B 5KMOA 3KQ7A 5IMEA 5ANJA 3BKBA 5EFQA 3QWKA 3BE2A 4PV0A 5JEBA 3COKA 4PMMA 4O0TA 3KK9A 4L6QA 3VVHA 3W2OA 4ZY4A 1QPJA 4E73A 5AA9A 4FSQA 1Y6AA 2QHMA 3P7CA 3V5TA 4G5PA 1Q62A 4FIIA 4KS8A 2HELA 3TUCA 3HMMA 2CKPA 1SNXA 3OTVA 3LFNA 1YRPA 1DAWA 4M97A 2OJJA 3HA6A 4ACHA 4C33A 3O8UA 3OF0A 5EW8A 4AGWA 4D9TA 3POZA 3QHRA 2ITVA 3MY1A 3PPJA 4QT1A 3U87A 3V8WA 3A61A 4BBEA 3GU5A 1BUHA 3TEIA 2RFEA 1E1VA 4F7JA 2VWBA 4G5JA 4S2ZA 3QX2A 3OCGA 4QDVA 3MFUA 5CALA 1H4LA 2XK8A 5AP6A 4BDJA 1NVRA 4TYGA 2CGXA 3FMNA 3L1SA 4Z16A 2J50A 1FQ1B 3WE4A 5AP4A 5BYZA 4FL2A 1E9HA 4JDJA 4NCTC 4WNOA 2CKQA 5HVKA 3NUAA 2IVUA 3Q3BA 3ZBFA 3DBFA 5EOLA 4BZNA 4E4LA 4QTEA 2HOGA 2GFSA 5E8UA 3RI1A 4AT4A 2JGZA 3Q4ZA 3F2NA 3KRWA 3R2YA 1KV1A 4V05A 5CAOA 2PVJA 5IEYA 2PMIA 3ZO2A 2OZAB 3OT8A 3NUSA 4M13A 4QMYA 5GJDA 1PKGA 3H3CA 3K3JA 2C6KA 2XIRA 5HVJA 3DT1A 3QCQA 2OIDA 3SDJA 4BCPA 2JDOA 5HIBA 3LM5A 4I5MA 4L7SA 5L8LA 4JG6A 3BLQA 1GIIA 5LWMA 4YLKA 4JDIA 1MRVA 3HUCA 5JZNA 3A7FA 5EYCA 3TZMA 2YZLA 2BFYA 4AS0A 2FGIA 2X9EA 3UP2A 1BI8A 1XBAA 4BIEA 2C6MA 1U54A 5J8IA 4Y83A 4X2NA 3TNQB 3AKLA 4GSBA 3ZUUA 3FPMA 4NWMA 4QMVA 4CEGA 5FDPA 4YGAA 4K2RA 1BI7A 4KNBA 4D4RA 4EQUA 3NVMB 4RT7A 3PZHA 4WNKA 2ZFYA 3FSKA 2F9GA 3TTJA 4FKGA 4HZRA 3QKMA 3FPQA 2O5KA 4J7BA 2RL5A 2XYNA 4MXAA 4S31A 5E8XA 4NM3A 2W99B 2VX0A 5C1QB 3PXFA 2BVAA 3LVPA 3EIDA 1PXNA 3IQ7A 3OWLA 4FL1A 1L3RE 4FTNA 4AQCA 4QP1A 4BCHA 4FBXA 4HCTA 3K2LA 4L8MA 5KUPA 2OJFE 3LLAA 2A27A 4RVMA 2OXDA 1FGIA 3D0EA 3VS3A 3W18A 3JVRA 5A9UA 4JAJA 3EYHA 3VF8A 4BIDA 4DEHA 3TN8A 5IEXA 1VZOA 2YHVA 4K18A 5F9EA 1J1CA 4NCTA 2C3LA 1ZLTA 3BX5A 4TYHA 1Q97A 2X1NA 3RPYA 3SOCA 5BV3A 5KBRA 4FIFA 4BTJA 5DR6A 2IEWA 5CZHA 2VTSA 3E92A 3ZM9A 3U6IA 3CBLA 2Z8CA 3EQPA 3QUPA 4ZLYA 5KHXA 1ZARA 4QP2A 2B9HA 2BZHB 2VO7A 4FSMA 4U0IA 4DEBA 4FKTA 4NW5A 2VTQA 2W1EA 4O4FA 5K5NA 2UZOA 4FOCA 4I5PA 5BUIA 4FSYA 1OUYA 4YZCA 4HYIA 2ETMA 4MAOA 3N4TA 4FZ7A 3QTSA 2OF4A 4IAKA 4AA0A 3DZOA 4IH8A 1PXPA 4F64A 2VTAA 2IZRA 3A8WA 2XNNA 5M4UA 4L3LA 2C0OA 2QOLA 5D7VA 3DXPA 1J3HA 3FY0A 3N4UA 2Z7RA 4BZDA 4EH8A 3R28A 4FMQA 4DCAA 4LRKA 3PPZA 5K5XA 1P4OA 4U9AA 1MUOA 4NIFA 4G6NA 4PPAA 4HVDA 2VWIA 5IMXA 5B2MA 4EHEA 2BZIB 4MK0A 4NH1A 2CCHA 2XIZA 4RG0A 3VUKA 3KCFA 4RJ5A 2XK7A 4GUEA 1H1PA 3UO6A 1RQQA 2BRHA 4ANBA 4F6SA 4XG9A 1LPUA 4ZSAA 3F3ZA 3P23A 4G34A 3G6GA 2YAAA 3PE1A 4IIRA 5AV0A 3FXXA 4CRLA 4DH1A 2BZJA 4DEIA 3ROCA 3MFSA 2BALA 4XV2A 3W2RA 1M2QA 3T3VA 2R4BA 4MEDA 3V6RA 2YWVA 5JKGA 3N51A 3MA6A 4BN1A 4M3QA 2GNLA 4RFYA 4E6QA 3ULZA 3R22A 2PTKA 2ZDUA 3QXPA 3L8SA 2GHMA 1W2FA 2R3OA 4ANLA 4PNKA 1Y91A 1X8BA 4YJRA 3GC9A 2PUPA 3GB2A 3OCSA 4IAAA 4L3JA 5AWMA 3TIZA 2YM7A 5J7HA 2UW0A 2ITWA 2H9VA 3DKGA 4AQKA 2I0HA 4IZ5A 2PZRA 4RJ7A 4YC3A 1Q41A 4RZVA 2ITNA 3LIJA 3KF4A 4RZWA 5CSXA 4BDDA 4AT3A 4FODA 4F9BA 3GCUA 3NUXA 2CGVA 4O4DA 3IGOA 3QF9A 5JFVA 3AG9A 5CQWA 5HX8A 4MH7A 3O23A 2QKRA 1RJBA 1MQBA 3ODYX 3RPRA 4X6QC 3FLQA 3CCNA 4FOBA 5ETFA 4V01A 4IAFA 5AIRA 4S30A 5M51A 2HY0A 5AUTA 1M17A 4NTTA 4QPMA 3FEGA 4H58A 3ATSA 5HE0A 4EC8A 3ZLSA 2FYSA 1ST4A 3LPBA 3GU8A 2VTHA 3D4QA 4IWQA 2CKEA 4OBQA 2YWPA 4NYEA 4XHKB 3R0TA 4O0YA 2F4JA 3HDMA 3F3WA 4HVSA 2R64A 3BZ3A 1YHVA 2YABA 4FKRA 4FTTA 3SD0A 4BDCA 4YSJA 4AW5A 4XNEA 4EH2A 3EN6A 2C0TA 1W83A 4DGNA 1GY3A 3LE6A 3HECA 5CWZA 5BVFA 4Y72A 4MXCA 2VZ6A 4CKRA 3ZZEA 5J1WA 5CQUA 4QMLA 2J7TA 3SA0A 1SM2A 3BWJA 4L43A 3SC1A 3V6SA 3KEXA 4AXAA 5IG1A 3NNUA 3MB6A 2PMLX 3I0QA 3A7IA 3M11A 4G16A 4JMQA 5E8YA 5C03A 3MPMA 5K3YA 4QYEA 4FKOA 1HCLA 3R8MA 2B9JA 2J5FA 3D2KA 4KRDA 2CCIA 4BHNA 5BVKA 4EH3A 1G8AA 4F78A 4ACDA 4KSQA 3F5GA 5DPVA 3KMUA 3R9RA 2UZWE 2WEVA 4WHZA 3OW3A 4UEUA 5K9IA 5KMJA 3UP7A 1SNUA 3NAXA 4D1ZA 4CZYB 4F7LA 4EOOA 4FKJA 4GH2A 2RSVA 4LQMA 5E1SA 3R1NA 4M14A 5A4TA 4FKWA 3Q6UA 3UDTA 2YIRA 3KXZA 4FKLA 2OJIA 1S9JA 3REPA 2R3GA 3U6JA 3EB0A 1VLRA 3TZ9A 4IVAA 4CQGA 1UWHA 3VN9A 4F99A 3W2QA 4EWHA 2B53A 4I6HA 4F7NA 2JFMA 1WBNA 3HV4A 4CYJA 3W16A 4NM0A 3O50A 3EQFA 3NR9A 4YC6A 3C5UA 4EC9A 3S3IA 3R9DA 3FMHA 4GS6A 4I93A 5F94A 5HCZA 4Z55A 4ZZNA 4M0YA 3FC1X 4V0GB 3ZU7A 3I0OA 4C62A 3QGYA 3QC9A 3ZDIA 2V62A 2J0LA 2QONA 5H8EA 4R77A 1WMKA 4PRJA 4AW0A 4CZTA 2UV2A 2VTTA 2R0UA 4KINA 4E1ZA 4C37A 2BILB 3OZ6A 5D41A 4EL9A 4KIKA 4C4JA 4EKKA 5CS6A 1ZMUA 2PY3A 3Q9WA 2XCHA 2WAJA 2FA2A 3I5NA 3QTIA 4I6LA 1PXMA 4YJNA 4O2PA 2CN8A 4ENYA 2OI4X 4FTKA 1UKHA 3PYYA 4U3ZA 4ASDA 4PF4A 3ZEPA 3IW5A 1PXKA 2YAKA 4CD0A 3R73A 4AXFA 4FF8A 2XH5A 2HXQA 2X39A 4FEVA 5JK3A 2FH9A 5M08A 4QNYA 3NS9A 5EYKA 5AV2A 3FXWA 4RC2A 4YPSA 4CV8A 5EQYA 3O8PA 3GBZA 3RAHA 3VW6A 4DFNA 5EM8A 3ZH8A 5IH5A 1LP4A 2CNUA 3BLRA 4JIAA 1ZYSA 4K6ZA 4BZOA 5LMKC 3NW5A 1XH5A 3MDYA 3QCYA 4FTIA 4W4YA 4ALWA 4F9YA 2GCDA 2BRGA 4ANSA 4GYIA 5HESA 1ZWSA 2VNYA 3TG1A 1FOTA 1URCA 2OFUA 2PVLA 4TRLA 4DAWA 5JGDA 3R7VA 4DHIB 4JLCA 4CT1A 2WTIA 4IDVA 5GZ8A 1YI6A 5GHVA 2ITPA 3ZFYA 2QI8A 3UC4A 4EQCA 4CG9A 2PMNX 2ERZE 2X0PA 4XV3A 2UVYA 4KSPA 3KRXA 1JAMA 3RP9A 5EI8A 1UNLA 3G9NA 3QTRA 4YC8A 4FSRA 4RA5A 2QCSA 2W9ZB 3EN7A 4FI1A 5DT0A 5FEEA 2W17A 4CSVA 3UQFA 1IASA 2CGUA 4NKAA 1OKYA 3OMVA 2OU7A 3AGLA 2XKEA 2WFYA 3LCDA 5JFXA 3W0OA 3DXQA 4OTHA 4CLIA 4AXDA 4Y5QA 3OVVA 3IDBA 5IQIA 3FI3A 2PUNA 5EQEA 4WD5A 4XX9A 3IO7A 2G01A 3EQDA 4O7VA 3ANQA 4QMZA 5D9HA 3NPCA 4I21A 3LFAA 2PMOX 4C02A 5CAUA 2WELA 4G3DA 2XALA 2Q0BA 1SZMA 3L9MA 3MVHA 5FBOA 3PXQA 5K0KA 3TIYA 4D2VA 4EI4A 2Z7QA 3WIKA 4DGLC 2XKFA 3R04A 3ZC5A 3RPVA 4QMOA 4YZBA 3MESA 1T46A 1WBWA 4L3PA 4YHJA 4M67A 5HE2A 1PRYA 3A7JA 5DEWA 4X6RA 2BTSA 2WB8A 1YDRE 4CFXA 3VS4A 1XH9A 3OS3A 4O0VA 2C5XA 2OKRA 2ZVAA 4DT9A 3VUDA 2BRNA 2GS6A 3JY0A 2JIIA 3C51A 3QBNA 3H30A 2QU5A 4J53A 4XH6A 4TWPA 5IUHA 3G51A 2PZ5A 3RK7A 4A4XA 1OL2A 1JSVA 3FV8A 1OB3A 4MD8E 3HRBA 5HCYA 3I1AA 1OIUA 3NIZA 5HCXA 3U51A 3MIAA 4FIGA 5LMKA 2R0IA 3G9LX 4E5BA 3ORNA 3T8OA 4BKZA 4EUTA 5L3AA 4C2VA 2B4SB 4LGGA 1VYWA 4O0XA 5HBJA 2WQMA 3AQVA 4J8NA 2QOHA 4FX3A 3QQLA 4NM5A 3T3UA 4YTHA 4HW7A 3S4QA 4O1OA 2JITA 4A4OA 2O63A 4U41A 1FINA 4U44A 5LVMA 2I40A 3ZFXA 3F66A 3IW8A 4KKEA 3SW4A 2XS0A 2XRWA 5DOSA 4ZTSA 2WU7A 5FTQA 3RPSA 1UWJA 2WTVA 4F9AA 4X2FA 2X0QA 4D2PA 2ZYBA 2R3KA 3LCKA 2XNEA 3BL9A 1OKVA 1XMLA 4X2KA 3VBTA 3ZLWA 1Z5MA 2IN6A 3FKOA 2IO6A 2WD1A 3GCSA 3GFEA 3UVPA 2ZAZA 3SXFA 3WF9A 5AX9A 4C0TA 3SG8A 3H9OA 4E26A 3VUMA 3JXWA 4HJOA 3GNIB 2C4GA 1YOMA 4IB0A 5ANKA 2WMAA 4O7ZA 4DFUA 1H24A 3FXZA 4RX7A 4RVKA 5HE1A 2FB8A 4YJPA 4GIHA 2VWWA 2W7XA 5CAVA 3U8WA 5ANIA 4DDIA 4XG7A 3AC8A 4MVFA 4RX8A 4LUEA 4E4MA 3DS6A 4C3RA 4F0IA 4B6LA 2BFXA 4FNYA 4GU9A 5TKDA 1GJOA 5IQBA 3DK6A 4M7IA 2O64A 4WRSA 4Y46A 2OLCA 4BYIA 3DK7A 4ZTNA 3ZFMA 4CMOA 3UGCA 3L8PA 2JDTA 4F1OA 4Z7GA 2BPMA 4OTFA 5IQEA 2VWZA 4V04A 2E9VA 5IUGA 4AG8A 4WUNA 2EVAA 2AC5A 3QZGA 5DT4A 2XRUA 3Q60A 4EHVA 4JQ8A 4BCNA 3WYYA 3K54A 2A4LA 2ITUA 4XOYA 4Z9LA 2OH4A 3ORLA 4C61A 1YI4A 3UC3A 5DH3A 5HBHA 4IB5A 3SRVB 4H3PA 5AP7A 3Q4CA 3BBWA 4NFMA 4YU2A 5AMNA 3U9NA 3KCKA