4BHZA

Scaffold focused virtual screening: prospective application to the discovery of ttk inhibitor
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
279
structure length
251
Chain Sequence
b'QSMSVKGRIYSILKQIGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQQVGTVNYMPPEAIKDISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Scaffold-Focused Virtual Screening: Prospective Application to the Discovery of Ttk Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 77
structure length 251
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bhzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bhzA01
3MVJA 4EJNA 3P7BA 1O6LA 1S9IA 2EVAA 5EYDA 2NP8A 2YLFA 1HCLA 3EN6A 3IECA 3OW3A 5L6WL 4EYJA 4FG8A 2W06A 3QUEA 4PY1A 4V04A 5D9HA 3NYOA 1GZNA 5CEIA 2PMIA 3UVRA 4XV3A 2WHBA 2OICA 4C35A 2CLQA 2QVSE 2Y4PA 5C27A 1PMNA 3JXWA 2XF0A 3F69A 2G1TA 5A6NA 1AGWA 4S30A 2QD9A 3N51A 2X2LA 4ZIMA 2PULA 4FEUA 4FIHA 3D5XA 5DRBA 4MNFA 4RJ7A 4UXLA 5KBRA 2BFXA 3MW1A 1YRPA 2QG5A 2R3GA 5IQDA 4AGUA 2Y6MA 2R3LA 4I6HA 4I5HA 4RVKA 4Q2AA 3SAYA 1DAYA 4YLKA 3QTWA 3PLSA 1Y57A 2WIHA 3BEAA 2X7OA 4RC2A 3RCJA 4Z16A 4RX8A 2ITWA 4DH1A 5EQEA 1NW1A 4IZYA 3EZVA 4QQJA 3FY2A 4AT4A 4FKGA 4ZLYA 1BMKA 4FEXA 4XUFA 2XS0A 4FZDB 3G5DA 3L8SA 4TZRA 2QR8A 4H36A 4TYEA 3WZJA 4MXOA 3NUPA 3UO5A 3QD3A 5DRDA 3A4OX 2F2CB 2PE2A 4QP3A 4H39A 4O22A 3FL5A 3KVWA 3QFVA 4FV0A 2BKZA 4NIFB 5HNGA 1UNLA 3FAAA 2QHNA 3WYXA 3M1SA 5L6PA 2P2IA 4TWCA 4UV0A 2IW6A 3EYGA 3A8WA 4L67A 4YZDA 3UQCA 3PSBA 2UV2A 5CS6A 1M2QA 4AF3A 2UZEA 3RM6A 4B99A 3OWKA 3R9OA 5BVWA 3W10A 3ELJA 1K2PA 3ZO1A 5M09A 4GUEA 4QTAA 4JX7A 3LQ3A 2UZVA 4KNBA 4FGBA 3KFAA 4LI5A 4N6ZA 2XVDA 2XNGA 2YIWA 4NTTA 4RVMA 3TT0A 4GK2A 4C7TA 4K11A 5JZJA 4M69B 3AMAA 2IZSA 2HW7A 3OTUA 4C3PA 2Z2WA 3CCNA 4ANSA 3FMNA 3AGLA 4EOPA 4FSUA 3TNPC 5DMZA 2CJMA 1ZMWA 5HCYA 5K4IA 4JQEA 4QMSA 3OS3A 3C0GA 2UW3A 5A4CA 3VUKA 3R1YA 4QMOA 1PXLA 4OTPA 3IDBA 3PFQA 2QOOA 3C4FA 1OPJA 3AG9A 3R7EA 3V5TA 2W1CA 5JK3A 3PWYA 1PW2A 3ATSA 2PE1A 3TWJA 3UOKA 2EWAA 4IAKA 4BHNA 2V22A 4HGEA 2GS2A 5JEBA 2X1NA 1OIRA 5J8IA 4GRBA 4LYNA 4FG7A 4RJ3A 3GU5A 4L8MA 4W8DA 2DS1A 4YJTA 5E1SA 3FLYA 4IZ5A 2JAVA 3HP5A 4QNAA 4B8MA 2VWWA 3HX4A 4DT8A 3D94A 1LUFA 5AP6A 4A7CA 3Q96A 4RZVA 3OY3A 4L44A 4JX3A 5AV1A 3V5JA 4ZEGA 2A4LA 2QNJA 3ZUTA 4X2GA 3ZLYA 3UOLA 4QP4A 3ZO4A 2XKDA 3KL8A 4DF3A 3C51A 4RPVA 1IRKA 2OZAA 5AUYA 4QQTA 3GB2A 3HA6A 3NVKI 4KIKA 4OTIA 2ZOQA 4C4GA 4OTWA 3R7UA 3ZFMA 3Q5IA 5EYKA 3LVPA 1YQJA 2PMLX 2X6DA 5HG7A 3LFAA 4E5AX 5I9VA 4BDEA 4IVCA 4EYMA 5E9EA 3H9FA 1G8SA 3QTSA 3EFKA 3ZRKA 4O0TA 2BR1A 4O7NA 3V5LA 3AC8A 4F1OA 2ITXA 5EHOA 3MESA 1J7UA 3SXRA 4FOCA 4S2ZA 5D12A 2AC5A 4JNWA 3OEZA 3Q52A 2P3GX 4RWLA 3G9NA 3UP2A 1OIQA 5E8SA 3QKKA 3Q04A 2R3RA 2GNJA 4TY1A 4ARKA 2F57A 3W8QA 4HYUA 2VTNA 4OBPA 3VUHA 1PXNA 2XBJA 2PUUA 3FV8A 4MTAA 3MY0A 2YM8A 1J91A 2X9EA 2A0CX 4J7BA 4NT4A 5E4HA 4N57A 4AFEA 4IB5A 3QZFA 3TJCA 2C5YA 3LM5A 4R6VA 5JN2A 2ZVAA 5IISA 2UZLA 4O0VA 4GVJA 3WOWA 5JGDA 3QRUA 4MD7E 1VZOA 5GHVA 4DA5A 4FSRA 3E7OA 4OTDA 2YDIA 4BDCA 4CV8A 2B0QA 4JBVA 3TUCA 1WBOA 3RCDA 3V5WA 5HTCA 1ZARA 5A3XA 3WIKA 4DTAA 2OIQA 4ZSGA 4RJ5A 4JRNA 4EZ7A 3QLFA 4I5MA 4TT7A 1UU8A 1GNGA 2J4ZA 3WF5A 4K2RA 4GYGA 5KMJA 2ZV9A 4FV3A 2WOUA 4EC9A 2WXVA 3IG7A 4KD1A 5HVJA 2BMCA 3ODYX 1RJBA 2UW5A 4KKHA 4IQ6A 4O7TA 3VBTA 3MA6A 2JFLA 2HELA 5J95A 3FXZA 5JRQA 4F6SA 5IA2A 2PMNX 4XBUA 5CLPA 2YWVA 4DH8A 5DR9A 3LMIA 3FMDA 5A4EA 1U54B 3RNIA 3A62A 1XBBA 3S95A 4DITA 2GNGA 2IVSA 1JSVA 2O63A 3R63A 4V0GB 1GJOA 3FSFA 3G2FA 1W7HA 2JAMA 2YM5A 3JVSA 3Q4CA 5ANGA 3LKMA 1OZ1A 2CCHA 5KMMA 2J51A 3OHTA 3NVMB 2JC6A 5FTGA 3LCOA 2WMUA 3R22A 5IUIA 4U42A 4WT6A 4F09A 3LJ2A 4A4OA 5BX0A 3MPMA 3VBVA 3N4TA 3Q4ZA 1OIUA 5IMXA 1FINA 3GU6A 4CFUA 2XA4A 4D2RA 4GV1A 1Y6BA 5DT0A 4KS7A 3E8CA 3EQPA 1RQQA 3R73A 4FMQA 2XNOA 3V8TA 2VTQA 3P1AA 1U5QA 3O71A 3O50A 1PXKA 4FSTA 4ENYA 3ZM4A 3OP5A 4CT2A 4YC6A 2R3PA 4CVAA 5HICA 2CLXA 3SV0A 4D1XA 4KRDA 1M2PA 3QZIA 4MK0A 4WNOA 3AMYA 4DTKA 5CF6A 2J9MA 5C1QB 1LEWA 2XJ2A 1MRUA 3GC9A 3I0OA 3OG7A 1KWPA 2JKMA 3DFAA 2BPMA 3MFSA 4RLKA 2IG7A 4L53A 2WU6A 4XG4A 1T45A 2GPHA 1YVJA 3P78A 3UP7A 1LEZA 5AUZA 2NNWB 4DBXA 4ZMEA 2PVMA 4WG5A 2OF2A 4HOKA 3CBLA 3RBWA 1Q8TA 4ALUA 4CFWA 2VTAA 2ITPA 2W1EA 3VAPA 5E8TA 5J5TA 5AX9A 4AE6A 3NW5A 1APME 1PXPA 3W2OA 4EWQA 5DI1A 3FDNA 4ITIA 3BE2A 4WNKA 5BVOA 3QTRA 4BTJA 5D1JA 5HG9A 2JIVA 5HU9A 1H4LA 1P5EA 2IW8A 3MH1A 5CWZA 3W32A 4L6QA 3FLSA 3F5XA 4MNEA 3GC0A 1P2AA 4M3QA 4YSMA 4MQ1A 4I6BA 4ANMA 3F7ZA 2C30A 1JKLA 5DNRA 2IPXA 3DB6A 2EXEA 4W8EA 4CFVA 2WQNA 4MHAA 5FXQA 4NW5A 5HU3A 5LMBA 4RVTA 5AX3A 4FZFB 1ND4A 3S0OA 4ZJJA 1UNGA 2XCHA 4HGSA 4XG2A 3R7VA 4ZZMA 3WF7A 5JQ5A 3PZHA 5ACBC 3TCPA 3PIYA 3DV3A 3TACA 2ETKA 3RI1A 1YWRA 4KIQA 2QU5A 4KIOA 5LVLA 4JG7A 3QRJA 2OXYA 3SXFA 3AT4A 3ZZEA 4ALVA 4HYHA 4PMSA 3H0ZA 4EH8A 2VO0A 5DN3A 3RAKA 4X2NA 4JL9A 3GENA 1H08A 3AC4A 3KK8A 3WZUA 4MXCA 1H1SA 4FODA 3SHEA 5JH6A 1OL6A 3MIAA 4PMTA 4GS6A 5DIAA 3R9NA 4GYIA 3LFBA 5HKMA 3GC8A 1XR1A 5KZ0A 3Q4TA 2JDVA 3GOKA 4BBFA 3R00A 4AZEA 1SVEA 4DEBA 1RE8A 5EI8A 2VV9A 1REKA 4NW6A 3UIMA 3T8OA 5EDPA 3C50A 1ZWSA 3PVWA 5CU6A 4C59A 4F7LA 2XK8A 4DEHA 2WU7A 2YCRA 4MQ2A 3I6UA 1JSTA 2B1PA 2QO7A 5HD7A 4CTCA 3NUSA 4HCUA 2R3QA 4KIPA 5AJQA 4RIYA 3WZEA 2XB7A 3FHRA 5AADA 3FZRA 4FSWA 4QTDA 5AWMA 4FZ6A 4AGDA 3GCVA 2IVUA 1G5SA 3IO7A 3RM7A 3Q2MA 3VW6A 3ZM9A 3EQFA 2YLEA 3BV2A 2GFSA 2UVZA 4ZY4A 3UNKA 3C0HA 3PY0A 2OJFE 5CU3A 4ZZNA 2GSFA 4R7HA 3R2YA 4O6LA 5ANDA 2AUHA 3RAWA 4LL5A 4WUAA 1LP4A 3DNDA 3EQGA 5M56A 3ZSGA 3C1XA 2OIBA 1WAKA 4L01A 1Q99A 1SZMA 2YERA 3FZPA 2Q83A 1OKVA 2UZBA 2I6LA 1LPUA 4BWXA 3A8XA 4AACA 4U41A 3FQHA 5IA4A 4X3FA 2BAKA 4YO6A 5C8KA 3R71A 5AV3A 5HTBA 3D83A 3IDCA 1YKRA 3AC3A 4U6RA 4O82A 4O83A 3VJNA 4L7SA 3TDVA 2F7XE 4JDHA 2V5QA 3A7FA 2PYWA 4OTGA 1ZYJA 3QQKA 5AFVA 5CVFA 4FTCA 4BCIA 3PXQA 5M4IA 5L6OA 3KREA 3EB0A 3GT8A 1FVRA 4TWOA 4TYHB 3ULIA 1PYEA 5GIPE 3MY1A 2XM9A 3GP0A 3KULA 3U9CA 5A4LA 4FT9A 4FKIA 3V04A 2GU8A 3R02A 2FUMA 4DH7A 4NM7A 5J9ZA 5JFSA 3O23A 3LJ1A 3BWJA 5LMAA 3CGFA 3I6WA 3EQCA 3CXWA 4FTOA 2E9OA 3UG1A 4BDFA 2YABA 2BILB 5AAEA 4CKIA 2GCDA 1PMEA 2X6EA 2CPKE 3BV3A 5ITAA 3OTVA 3IW7A 4YHFA 4CEGA 1YOJA 3CQEA 2CHLA 3ITZA 3UIBA 3HKOA 4GU6A 4EK6A 5HX8A 2IO6A 4YJOA 3ZXZA 4FVPA 4JDJA 4WNMA 1J1BA 2XRWA 3BIZA 3NIZA 3ZDUA 4DN5A 5KKRC 4KAOA 4NFMA 4WNPA 4ZXTA 2VU3A 2Z8CA 3A99A 4LRKA 4APCA 2J6MA 2WO6A 2RG5A 3FLZA 4HVDA 2F49A 2WMRA 5AUTA 5LWMA 5IEXA 1YWVA 4DEIA 2C6DA 3O96A 4PDOA 3K5UA 3PJ8A 3QUPA 4KABA 4FL2A 5AP4A 1WBVA 5AV0A 4BDKA 1ZOGA 4G5PA 2E9UA 1H26A 3R7OA 1KUTA 4NJ3A 3K3JA 5HBJA 4FYOA 4FTKA 4OBQA 5IEVA 3CTJA 5KKRB 4IXPA 4BVUA 4ZSLA 2VWYA 2GS6A 4IEBA 1Q8YA 3CY2A 5JFVA 4H3QA 4LMNA 3KXMA 3COIA 3V01A 4OTQA 4C38A 2QHMA 4CXAA 1SM2A 3PE2A 2XZSA 5FP6A 4ZLOA 2O8YA 4PDYA 5AUVA 2B7AA 3QGWA 5HCZA 2XYNA 5CNOA 3R9DA 4PMPA 3PA4A 4IX6A 3C13A 5DR6A 2FSLX 5EHLA 1ZZ2A 1Q8WA 3LFQA 3CPCA 4IM3A 5LXMA 2EXMA 5DLSA 1ATPE 3DBFA 1XBCA 3EFWA 1O6KA 2ETMA 2BZHB 1OBGA 2XNPA 2HZ0A 3VUGA 5HQ0A 3TV4A 2BVAA 3FC2A 5I4NA 2GQSA 4KBAA 1GIJA 3FMHA 3NAYA 1Y8GA 4GK3A 4GUBA 4KS8A 3F3UA 5CU4A 4GCJA 4RT7A 4DC2A 1S9JA 2R2PA 3ANQA 3C4ZA 3WE4A 1DS5A 2QQ7A 3BI6A 3VBWA 4G34A 3RZFA 4PL5A 4EBWA 4O38A 2VTJA 3CD3A 3DU8A 3PG3A 3TNQB 3U55A 4QMUA 5HHWA 2P33A 1SYKA 4WG4A 4YTCA 5CEOA 3F61A 2ZM3A 3BE9A 4CZYB 4DG0E 5FXSA 4HVHA 1QPCA 2PZ5A 5GJGA 4LOPA 2ZMCA 5GIOE 1YDRE 5M53A 2HY0A 3NZ0A 4J96A 3PPZA 3PVGA 3UQGA 4I0TA 1PXIA 3P08A 2OO8X 3F88A 2RFEA 2YIXA 4ASDA 1CSNA 3Q32A 3DCVA 4CRLA 1U4DA 1ZY4A 2PY3A 4O7WA 4F0IA 3QL8A 2XBAA 2G2IA 2PMOX 3FXXA 4JR7A 4P5QA 5IQFA 4DFLA 4G3CA 4APPA 5IF1A 4CG9A 3E88A 1SNUA 4XHKB 4D9TA 2X2MA 3DAEA 4RWIA 3BGZA 1I09A 1Z9XA 3K2LA 4IE9A 2NRYA 3D2IA 5H9BA 5EDQA 3BU3A 3NNXA 4XNEA 3EKNA 4EOLA 4F9AA 1OVEA 4WIHA 3LOKA 3HGKA 4FTNA 3ZUVA 4R1YA 2YAKA 3EL8A 3FWQA 4B0GA 4BCMA 4EBVA 4EOIA 5JSMA 3VS2A 2VO3A 4JRVA 4BZOA 2XNNA 4L00A 3FI2A 1WBSA 4I23A 2QC6A 5JMSA 3CPBA 2EXCX 3EFLA 4JBOA 4J1RA 3BLHA 4FKQA 2RF9A 3R8ZA 4G1WA 3TXOA 5BYYA 2EU9A 3OBGA 2WAJA 1ZYLA 3DTCA 3P0MA 4A4XA 4U43A 3UYSA 1WCCA 2OFVA 2QI8A 3G90X 5CEQA 4YO4A 4FV7A 4U44A 5K4JA 1IASA 5CX9A 3ZYAA 2R3HA 1ZRZA 3KXGA 4IB0A 3ZCLA 2W4JA 4EHEA 1YHVA 4AA4A 2IN6A 3UJGA 3HMPA 1YI3A 4I21A 4XP2A 4BBMA 2QCSA 3CSVA 4Y46A 4F1MA 3OF0A 1Y8YA 4FTTA 3GBZA 5H3QA 3CIKA 2YIQA 5DR2A 1FVVA 2Y8OA 3KRWA 5FM3A 2C6KA 4GT4A 4FNXA 2QOFA 2UVYA 5DWRA 5TO8A 3LLTA 3MGYA 5M51A 4XOYA 3LCSA 5KMOA 3QD4A 4HYIA 4WHZA 5CYIA 4BTKA 5L2TA 4EHVA 3D5VA 2JKKA 3ORPA 2G01A 5ETCA 4D4YA 3QKMA 2XP2A 3TNHA 2QLQA 1Q97A 3TKIA 1YW2A 3F3WA 1H00A 5HG8A 4ACDA 4E6DA 3GVUA 4MCVA 5HG5A 2FO0A 2QKRA 5CSXA 4NIFA 5A9UA 4F65A 3BLRA 4BY9E 3LIJA 3BYUA 4C2WA 1DI9A 2CKQA 4GFMA 4B8LA 1GY3A 4KWPA 4QMMA 4BCGA 3FI4A 4O7SA 2ERZE 5JQ8A 4FOBA 4XYFA 5F1ZA 5EKOA 2VNWA 3Q2JA 1OKWA 3OFMA 3JUHA 4KINA 1OUYA 4CSVA 4RIOA 3MVHA 4UALA 4FV5A 4M66A 4IC7A 4MBLA 2J5EA 3P23A 3VRYA 3MN3A 2HAKA 1ZYSA 1E1VA 4QYGA 5DGZA 4C57A 4MXYA 2YJSA 4XV1A 2YCQA 4ONAA 3Q5ZA 3V8SA 3ORTA 2BZJA 5T6KA 5FWKK 2CNVA 4QYHA 1UU9A 4ZSJA 3DNEA 5HNBA 1PXMA 3E8DA 2GFCA 5EW8A 3QRTA 4DGMA 4RIWB 2C6TA 4GT5A 2X81A 2WELA 5HVYA 3Q60A 4AOJA 2NRUA 1URCA 3CEKA 5AM6A 3ZSIA 4X21A 3ZLSA 3GC7A 4O0RA 5K5NA 3VIDA 3PY1A 3O17A 5CSWA 2ITYA 5EW3A 3W2QA 2P55A 2VWVA 3LFDA 4WUNA 4ZTMA 3OCTA 1STCE 4DEAA 4IWDA 2Z60A 3LMGA 5FGKA 5IQIA 4D2TA 4EOJA 5CAVA 3JY9A 2OI4X 3CE3A 3K3IA 4BKJA 2XNBA 3SXSA 3UBDA 2F7ZE 2EUFB 1JPAA 1TQMA 2YEXA 3NGAA 2FVDA 4AUAA 3ORXA 4QOXA 3N4VA 3BHYA 2FSTX 3II5A 2VRXA 2QU6A 4NK9A 4UMPA 4RIXB 1H07A 3A7JA 5HE2A 4ZTNA 5FTQA 5T3QA 3D5WA 3U51A 2I0YA 2JDSA 3G9LX 5BMSA 3H10A 3UYTA 4YPDA 5TF9A 3VBXA 2PVRA 4BWPA 1OUKA 4E4XA 3KN5A 1YDSE 2WD1A 3JR1A 2WMSA 3CTHA 4NM0A 2VTSA 3LXLA 3ZOSA 4DGOA 5M08A 4L9IA 3FL4A 4UMQA 3HAVA 1ZAOA 2GHLA 1VYWA 3HL7A 4FK3A 3PY3A 4FR4A 5DEYA 2WTJA 2VWXA 3RK5A 2UZDA 4AS0A 4HGTA 3HMOA 4W4WA 5FP5A 4D2WA 5IKWA 3LXNA 4ZS4A 3QQLA 1W83A 2J7TA 2QOQA 3R04A 3O0GA 4HVSA 5GZAA 4DYMA 5B2MA 4IFGA 2W1DA 2E9VA 3F2NA 3R28A 4FICA 4YC3A 3ZLWA 3G0EA 3QTIA 1TVOA 4M7IA 1H0VA 5AR7A 2O3PA 2WQBA 2W7XA 3L9LA 4AU8A 4ZLZA 4USFA 1OGUA 1H1PA 2BHHA 2JDTA 5A6OA 3F66A 2RG6A 2OJJA 2WTCA 3WYYA 2V62A 5HZNA 5D7VA 4U0IA 2WMTA 5CI6A 3IGGA 3LCDA 4IJ9A 5A4QA 4E4MA 3W33A 4ID7A 1KE7A 3QRIA 3SVVA 2C6MA 3VUDA 4F7SA 5IQBA 4RJ6A 2GNIA 3K54A 2QKWB 1F0QA 2R9SA 5CSVA 5HI2A 3F7WA 4EWHA 5DT3A 5KNJA 4WD5A 5DHJA 5FQDC 2I0HA 1JOWB 2BTRA 2IVVA 5EW9A 3OXZA 4X0MA 1P4OA 2QOLA 4FT0A 3W2SA 3ALNA 3R8VA 4BGGA 3LE6A 4YP8A 4GH2A 2XJ0A 4NKAA 2R4BA 3LFNA 1I44A 5HLPA 2XIYA 1YXXA 4J97A 3D9VA 4RJ8A 3IK3A 5FM2A 4F0GA 4DFBA 2BROA 4G3EA 3UZPA 1ZYDA 3DXNA 3Q9XA 4U80A 4H05A 3VUMA 4CMOA 3PJ2A 3LQ8A 4FGRA 4OT5A 4FTJA 4ERWA 4DE4A 2ZB1A 4XLVA 3HMMA 3KMMA 5DPVA 4DGGA 3HEGA 4P5ZA 3R21A 1U54A 2YFXA 3D0EA 4MBIA 2OF4A 1OECA 4LGHA 2WIPA 4GJ2A 3SG8A 2XMYA 4TRLA 5I9YA 4GU9A 3ZHPC 4V0GA 3UG2A 1BX6A 5CVHA 5IH6A 5KMIA 3EQRA 2VWUA 3N9XA 4HJOA 3BHHA 4XRLA 1ZOHA 2OU7A 5J9YA 2WMBA 4KKEA 4L43A 4HZSA 4B9DA 4EK8A 2BRGA 4ZP5A 4CYIA 5FLFA 4QP2A 2H34A 3RMFA 3ZEPA 5KBQA 3E63A 3QQUA 4HCTA 1A06A 5B7VA 4X3JA 2R3OA 3GFWA 4CG8A 4WBBB 5AP5A 4DEGA 1R39A 4EH3A 4L3JA 5GJFA 3MV5A 3MY5A 5AMNA 4BIBA 4K8AA 4PF4A 1IEPA 4PL3A 1Q8ZA 5IH4A 3O7LD 3KMUA 3GI3A 5CT0A 1KV2A 4QQCA 1U46A 4U5JA 5EHYA 3ZH8A 5EFQA 5KX8A 3HLLA 3O8PA 4MKCA 4L52A 3VO3A 4GFOA 1HCKA 3QZGA 1PKDA 4U8ZA 5C01A 4YGAA 1CTPE 2LGCA 4D4SA 5ETIA 1O9UA 4EZ3A 4TWPA 1XQZA 3DS6A 3GCSA 2BIYA 4I1ZA 1W8CA 1XWSA 2BZKB 3O8UA 2BDFA 2W5BA 4IWPA 2YN8A 3ALOA 5HTIA 2ITQA 2J0KA 5JGAA 4UMUA 4AOTA 4XMOA 5AR2A 5H8EA 4BCKA 3WF6A 4QPMA 5L2IA 4GJ3A 3A2CA 4YTHA 4PWNA 2CGWA 2OXDA 4ZK5A 1XO2B 1WBNA 3KC3A 4NSTA 5LVOA 3FUPA 1ZXEA 2PVKA 2YIYA 4FEQA 4ZZOA 3P4KA 4JBPA 4XG8A 1NVRA 4ZTSA 4UN0C 2ZV7A 4BB4A 4AZFA 2CCIA 3UVQA 5AR3A 4BDIA 3OC1A 5KHXA 4NL0A 2JITA 4D28A 4BWKA 5BQ0A 1PJKA 3W2PA 3GCPA 3V51A 2F7EE 3MVLA 2R3JA 3EN7A 3I7CA 4EZ5A 5H8GA 3GEQA 3DJ6A 5J5SA 4C3FA 4UYAA 4HVIA 4O27B 2Z02A 3VJOA 1M2RA 4WRSA 5CEKA 4HGLA 5I9WA 1MRYA 1Q41A 5CT7A 3V6SA 3NUXA 3ATTA 3GNIB 4RWJA 3HP2A 2OSCA 2GHGA 2WZJA 3D15A 3E3BX 4LV5A 4BCPA 3P7CA 4PNKA 4BBEA 2VWZA 2FSOX 5HLNA 1R1WA 2X0GA 2UW7A 2W5AA 4W4VA 3ZFYA 3COMA 2Z7RA 3EQIA 4RQKA 4DG2E 5M07A 4ZSEA 3KF4A 5IA0A 4BYJA 4TPTA 5CEPA 3KXZA 2C3JA 1FVTA 3E93A 1ZYCA 3RAIA 5IZFA 2JFMA 5CEMA 4CV9A 2WGJA 3Q9ZA 4HW7A 3TEIA 2UW8A 3E64A 4EORA 5M4FA 3E62A 3QBNA 4F9YA 3PJ3A 3ID6C 5IQCA 2BKKA 2XKFA 5ANOA 1JKSA 3QTUA 3H0YA 3KMWA 2UVXA 3VWAA 1K3AA 3FZTA 3ROYA 5KZIA 5HESA 3LPBA 2B9JA 2CN8A 1H25A 4IX5A 3BX5A 2ONLA 4FKPA 4LOQA 3SRVB 4QD6A 4EK3A 3DA6A 3DKOA 4GVAA 1BL6A 4IJPA 4BHZA 4EQMA 3FY0A 2FGIA 3F2RA 4NYEA 3KVXA 3FYJX 4LRJA 2Y7JA 3FQEA 5EDRA 4E26A 4LL0A 4DAWA 2B55A 4L3LA 4FX3A 4F0FA 4EL9A 4QT1A 3DGKA 2HXQA 1OIYA 2ITUA 3KXNA 3QTXA 4F7NA 3EQHA 4AG8A 4MD8E 1NY3A 3TZ9A 4IIRA 3QU0A 2J0IA 3PPKA 2C0TA 4OGRA 2V7OA 1J3HA 1BI7A 2HWPA 3AD5A 2FSMX 3D7TA 4NUSA 5EKNA 2RL5A 1SVHA 2XCKA 4FSNA 4WRGA 2O65A 2PZYA 4TYHA 5EM8A 3A7GA 2JD5A 5LCKA 4EOKA 3BQRA 4D0XA 1A9UA 5A54A 4IZAA 3ZC5A 2KULA 3E8EA 3I81A 1WZYA 4G9CA 2RFDA 4GL9A 4C33A 4KSPA 3SOCA 4XP0A 2HY81 4EQUA 4P2KA 4M97A 4FEVA 4EUTA 2A2AA 3U8WA 2RGPA 3OWLA 5CNNA 4A9SA 5AV4A 3LFSA 5A14A 3NNWA 2JDRA 4GSBA 5HIDA 5I9XA 5KMNA 1Q8UA 4ZAUA 2X39A 4GG5A 2H9VA 5HBHA 4S31A 2I1MA 3I5NA 4AXAA 3C4EA 4P90A 2W05A 1BLXA 3QCSA 1KE9A 4CFFA 4F99A 5EOBA 3UVPA 2W17A 3DXQA 2UZTA 4XG9A 5L3AA 4O91A 4I4FA 5D10A 4O2PA 4QTBA 3H4JA 4EH5A 4O7LA 3RK7A 3FC1X 2W4KA 1WMKA 1XH8A 4XRJA 4B7TA 2BHEA 5E8WA 3VHKA 1IAHA 3NIEA 3S4QA 4YC8A 4FTRA 4DINA 3PXKA 4R78A 2UW6A 2CSNA 4PTCA 1XH6A 4IB3A 3VN9A 3BLQA 4IACA 4BYIA 4GEOA 1CM8A 4L3PA 3DKCA 4M67A 1ZLTA 2X8EA 4U45A 2W99B 3SW4A 3VQHA 4ASEA 4FC0A 3TUDA 3R1SA 4J99A 1UNHA 3PDTA 3AMBA 5DE2A 3EQBA 4MF1A 4HZRA 4NWMA 4XOZA 3FYKX 3AT2A 3L9PA 4OAVB 2QOHA 5E8XA 3TTJA 4A9YA 3D5UA 4L68A 3KN6A 3MPTA 3REPA 3NR9A 4OTHA 4NEUA 4XS2A 5I9UA 3NPCA 1OI9A 2ZMDA 3L9NA 3KU2A 4W4YA 3BCEA 5CAOA 5AUXA 4BZNA 4YJRA 4ZTLA 2CGXA 5DOSA 2X4FA 2ONLC 3MDYA 4E5BA 5DYJA 3OWJA 3ENHA 2ZM1A 3DB8A 1XH4A 3HV5A 2BAJA 3KY2A 4FIEA 2JDOA 5DT4A 1CKIA 2C47A 4JVGA 4O7ZA 3L8XA 4LOOA 3ETAA 5AEPA 3L8VA 4G9RA 1PXJA 2BFYA 3G6GA 4WSQA 3TNWA 3VW8A 3EMGA 2YA9A 3O8TA 4QTEA 3FLQA 3SOAA 4Z55A 1OPKA 4AQCA 1FGKA 3L9MA 4UX9A 3RNYA 3ZSHA 4BCQA 1XH9A 2XUUA 3EKKA 3HUCA 2BDJA 3UGCA 3HRFA 4KRCA 4XV2A 5HIEA 1O6YA 3OXTA 5I9ZA 4IMYA 3OVVA 3NWWA 4IH8A 3E8NA 4OW8A 5AIKA 3DZOA 3FHIA 1IA8A 4MVFA 4QMNA 1TQIA 2QR7A 4F1TA 5AAFA 5ETAA 2J5FA 2VX3A 2QLUA 3CQWA 3P5KA 2WMVA 4FTIA 5BMMA 1GOLA 3CR0A 3FZOA 5C8NA 4BL1A 1NVSA 2FH9A 3CJFA 1XBAA 4WSYA 4YZMA 3SLSA 3TJDA 5J1WA 3TTIA 3DOGA 2CKPA 3KQ7A 3NW6A 4S33A 4GFGA 4KBCA 3RP9A 1J1CA 3POZA 4O0WA 4MAOA 3AQVA 2C6OA 3KXHA 3ORLA 4OLIA 3MBLA 3SKCA 4BF2A 5HORA 3E92A 1BUHA 4TYJA 4O0SA 4PTEA 4G6LA 1J7IA 3ACJA 3QC4A 4BTMA 2HYYA 4G16A 3OUKA 3FJQE 3BBTB 3U4UA 3PSCA 4D5HA 4JIAA 4O21A 4ASZA 4KSQA 4YR8A 4LMUA 3LCKA 2HIWA 5EM6A 5FG8A 3DK7A 2WNTA 3GU4A 4P4CA 4R3CA 3CJGA 2PVNA 3PVUA 4FG9A 2WTIA 1YDTE 5IA5A 1FQ1B 3SC1A 2CNQA 3NCGA 1JKTA 4JIKA 4M0ZA 1XH5A 5ANEA 3OWPA 2WMXA 4AZSA 3OT3A 3IGOA 2I7QA 3QQGA 5HEZA 3QHWA 2BRBA 5HCXA 1CKJA 2X4ZA 3UZTA 5JZNA 4MX9A 4YJNA 4O7YA 4Z3VA 5DVRA 4U81A 4TTHB 5F9EA 3DQXA 4RSSA 5LJJA 1OB3A 2JBOA 2WMAA 3AC5A 3UPZA 2CMWA 4RLLA 3VBYA 4EEVA 4F9WA 2OJ9A 1GIHA 4A07A 2J50A 3EN5A 4FTAA 5K3YA 3IONA 2DWBA 3O2MA 2UW0A 3NEWA 3ZC6A 4UMRA 2HK5A 2R0UA 2VGPA 4FIIA 4J52A 3W2CA 3D14A 4MWIA 2H8HA 2PWLA 3MVMA 4NU1A 2VTRA 3P9JA 3QD0A 5LMKC 3PWDA 5JRSA 3TI1A 4XG7A 1V1KA 3TZMA 3M11A 4PPAA 2ZV2A 4E93A 4QRCA 1URWA 1YI6A 4NTSA 3U6JA 3ORNA 2IWIA 4D4RA 4O0UA 3I79A 4IBMA 3RPSA 4BFMA 3AD6A 1ZY5A 4FV8A 2HCKA 3R6XA 3CC6A 3QX4A 3DXPA 4FYNA 1F5QA 2B52A 2HENA 1GZOA 4X7QA 2QURA 4GMYA 5C9CA 4O1PA 5D41A 1H24A 4JLCA 1OL2A 1WVXA 2YDKA 3KRRA 4B4LA 2ZV8A 4FSYA 5CXZA 4HPTE 2BIKB 2BCJA 2X7GA 3F5PA 3EIDA 2ESMA 3FZ1A 5AR8A 4IZ7A 3DDQA 3OROA 3UC3A 4M0YA 4YHJA 4PPCA 1B38A 2E2BA 4O84A 5C26A 2OJIA 3QD2B 5AR5A 4CKRA 5DEWA 4USDA 4H1JA 4K33A 4K6ZA 5CAPA 3LMHA 5IQHA 2GNLA 3HUBA 4C34A 3UQFA 5H2UA 1WVYA 4F9CA 5EK7A 2O64A 2LAVA 4C3RA 4RA5A 4NCTC 2C68A 4D0WA 4G6NA 2OZOA 3I4BA 4FNYA 4IB1A 4DGNA 2J90A 2XEYA 3NUUA 3GFEA 3F5GA 3BGQA 2GQGA 4MD9E 3VS4A 3PJCA 5FEQA 3UO4A 1H27A 5GZ8A 3E3PA 4RIWA 1Q3WA 1JKKA 2C69A 3R0TA 3HAMA 1PF8A 5L8JA 1OITA 4ACMA 1Q24A 2OWBA 4FSMA 3W2RA 5HE1A 5K0XA 2PUNA 3A60A 3JYAA 1M14A 5CI7A 5IEYA 3JY0A 3ZS5A 2ERKA 3H9OA 4CD0A 4UYNA 4AW1A 3IW4A 2OH4A 4Y95A 4ASXA 3GUBA 3KCKA 5CENA 3HRBA 2QODA 3QTQA 5C03A 3RJCA 4DEEA 4FF8A 2WMWA 3IW8A 3T3VA 4U3ZA 2RKUA 3U6IA 1ZMVA 2OFUA 3FQSA 2B4SB 4NKSA 4D1ZA 4E1ZA 4QYEA 4QMQA 2BTSA 2I40A 4G3GA 3F9NA 2WTWA 1H1WA 1Q5KA 4Y5HA 4YPSA 3R8MA 3ROCA 4WO5A 5CF4A 3G0FA 5E92A 3LAUA 4IM2A 3TIYA 2SRCA 3SDJA 1TQPA 4FEWA 5EOLA 4QO9A 3GXLA 2BAQA 2XYUA 4EH9A 3VHEA 3C4WA 3VS0A 3MWUA 4C4HA 3C7QA 3WI6A 3KF7A 3M42A 4CGAA 1VR2A 4F9BA 4AOIA 5GINE 4DH5A 2YZAA 3FKOA 1WFCA 2P0CA 4IADA 3QWKA 2ITOA 5DFPA 4YTFA 5DBXA 4EUUA 5J7HA 2WEVA 3OCSA 4BI1A 5HO7A 4U7ZA 4YZNA 2ITTA 4ZS0A 5J7BA 3HECA 1JSUA 4AN9A 5FTOA 5L2QA 3QXPA 4LRMA 3V3VA 3WARA 3QQHA 1X8BA 2RSVA 3KRJA 4GKIA 4MYGA 1OPLA 3ZRMA 3COHA 4GG7A 4O86A 4ERKA 4IAAA 4JXFA 4DFZE 3VS7A 1W84A 4AAAA 2ITNA 3G15A 2XK3A 2OXXA 4AZWA 4E7WA 3BYMA 1PMUA 4Q9SA 5BVEA 3S2PA 3WZDA 3KCFA 4QMZA 3N4UA 2WQMA 5BPYA 3EYHA 3Q6WA 5G1XA 2XRUA 2XM8A 1XHAA 2IW9A 3OCGA 3VC4A 4ZOGA 3E87A 4C58A 4ZTQA 2Q0NA 5BVNA 1SMHA 4XCUA 3ZO3A 1ZMUA 5IQGA 3MB6A 2YM4A 3F5UA 3FE3A 4G3DA 5KCVA 1R3CA 3MS9A 2XK9A 4I5CA 3QXOA 4RA4A 4BIDA 3C4CA 3KGAA 4CMUA 4XG3A 4A4LA 4EH2A 3QC9A 3ZLXA 4LV8A 3T9IA 1KOBA 5IUHA 3NUNA 3ZUUA 1M7QA 3OBJA 4BCJA 1UV5A 2PVHA 3R83A 2FYSA 3MFUA 4CLIA 5CF5A 3FKLA 2B9HA 4FKWA 2P4IA 4XJ0A 3G6HA 4QMTA 4M69A 4AN3A 2VN9A 4UXQA 3GU8A 2PL0A 3FMEA 2XH5A 3MPAA 4RFZA 3TKHA 1KE6A 1YXTA 4FK6A 4HPUE 5FDPA 2QG7A 2YZLA 4PPBA 5IMEA 4UWYA 4RMZA 4FBXA 3UOHA 3LFCA 3AGMA 2UZWE 5FEEA 4WOVA 4FTMA 4LFIA 4D4VA 1Z57A 4I5PA 2OK1A 4F6WA 2ETRA 2VNYA 5FD2A 1L3RE 2G9XA 4JT3A 2W9ZB 4LUEA 4MF0A 4N70A 3RWQA 2BRNA 2VAGA 2W96B 5E91A 3P86A 4P7EA 5HD4A 3UNZA 4TW9A 3NNVA 3DTWA 4A9UA 2QONA 4QMPA 4EJ7A 4H3PA 3IS5A 3QYWA 4CLJA 4DFUA 3QLGA 5AIRA 3HV6A 5CASA 1YHWA 1KE5A 1DI8A 4FKLA 5CQWA 3OZ6A 1BL7A 4E73A 3HDMA 4HVGA 1R78A 4Z7HA 4BCFA 3FBVA 3ANRA 3IW5A 4FKOA 1OL1A 3RTPA 4C0TA 3A61A 4ACCA 3EL7A 4FZAB 4AGWA 4XX9A 3NMUF 1PY5A 2XJ1A 2XIZA 3FPMA 4GT3A 5CZIA 3ZDIA 3ORZA 5JFXA 4U79A 4PDSA 3BWFA 4F64A 3QHRA 3MJ1A 5GZ9A 1J7LA 1PYXA 2EB3A 4JJRA 3PG1A 3UODA 3W55A 5E8ZA 4EKKA 4ALWA 2VD5A 3A4PA 3MIYA 2C5VA 4IANA 3MB7A 2E9PA 5E8VA 4JG8A 5CF8A 2F9GA 3BQCA 5BYZA 4RC3A 2GTNA 4M13A 2O2UA 3FSKA 5AAGA 3GQLA 3KB7A 3ACKA 4RRVA 3JVRA 4BDGA 3AXWA 3KKVA 4CQEA 2CDZA 3Q3BA 5TOZA 4C8BA 3ZXTA 3DAKA 4UWCA 4WG3A 3Q9WA 4J71A 5I3OA 4D2VA 4R7BA 4X6QC 3HMNA 4N6YA 5LVMA 4I24A 2JGZA 2B53A 5AV2A 3AT3A 4D55A 4QP9A 3DJ7A 5C4KA 4QYYA 5M06A 5LQFA 4FKUA 5G6VA 3NYXA 3C5IA 4J8NA 3CTQA 4KKGA 1XJDA 5D7AA 4E6CA 5C4LA 4LM5A 3HDNA 4BDHA 4CFMA 4R7IA 3BHTA 4DLJA 4YBJA 2VUWA 2YHVA 4X2FA 1WVWA 3TM0A 2R3FA 4S34A 3NUAA 4YSJA 3R1QA 3UTOA 4X6RA 4CRSA 3NS9A 4UZHA 3RKBA 2ZJWA 4RBLA 1NT2A 2OJGA 4Y5QA 2YAAA 3SA0A 3I7BA 2IZRA 3ZFXA 1P4FA 3TZ8A 4BCHA 4BZDA 4CCBA 3EJ1A 2C6LA 3HZTA 3V5QA 3VF8A 4YZBA 3NDMA 1DM2A 4TXCA 1FPUA 2WKMA 3MI9A 4OUCA 2C5OA 3R7YA 3ERKA 3HV7A 4O0YA 2OBJA 3GGFA 4RG0A 4WA9A 3QF9A 1WBWA 4JDIA 3ZBXA 2W5HA 1V0BA 3PP0A 4PDPA 3VULA 2X8DA 4G6OA 4O2ZA 3W1FA 4YUQA 3EZRA 3DT1A 3OMVA 2UZUE 3WF8A 5CALA 4IC8A 2V7AA 4OTFA 5BUJA 3UDBA 3VUIA 3O7LB 3HRCA 5CTPA 1EH4A 3GQIA 3TZ7A 4C4EA 2C0OA 4DG3E 3ORMA 3VF9A 2RFNA 2OH0E 4JR3A 3SD0A 3SRVA 5L8KA 3V5PA 1QCFA 5IQEA 1V0OA 4BN1A 2PUPA 4DGLC 4GW8A 1Y6AA 4NJDA 2J2IB 4PX6A 1ZZLA 1MQ4A 3F82A 4XP3A 2PVFA 4TYIA 3WBLA 4U40A 4YMJA 4QPAA 4BKYA 4QPSA 2DYLA 2HZ4A 3WE8A 3HMIA 5M57A 4PMMA 5LCJA 5A4TA 3ULZA 5KHWA 4IVAA 4RX5A 4EKLA 4AWIA 3W8LA 2Z7LA 3LFFA 4JI9A 4PL4A 3ORIA 3VUTA 3BU5A 3IPHA 4NM5A 2W1ZA 3D4QA 1VYZA 4II5A 1JNKA 3LJ0A 5HE3A 1K9AA 3DPKA 3U87A 4EONA 4IM0A 5L4QA 2C3LA 4IWQA 4JAIA 3T9TA 5K5XA 3DLSA 5IG1A 3Q6UA 4YHTA 5CY3A 1L8TA 2QOKA 5J9LA 1YXVA 5CZHA 5J87A 4B6LA 4YBKA 4QYFA 1LR4A 4JAJA 2XIXA 4G5JA 2PSQA 4I0SA 4E6QA 3R9RA 4KBKA 4USEA 5EM7A 4FIJA 2AC3A 3VS1A 3LXKA 3FLWA 2W1GA 3KEXA 1R0PA 4UB7A 1JAMA 2VTLA 2YM7A 3MYGA 4JBQA 1NA7A 4CCUA 4BCOA 2QO2A 4A9RA 3RINA 2F2UA 2P2HA 4IHPA 3OXIA 2OKRA 4CMTA 5BNJA 2GHMA 4IWOA 4F70A 2ZDTA 3B8RA 1A48A 5H8BA 5JFWA 5DA3A 4L7FA 3UOJA 3FLNC 5AA8A 2PK9A 5F4NA 5EQYA 4RFYA 5IH5A 4Y85A 2R7BA 3C9WA 1GZKA 1UVRA 3QCYA 1VEBA 4J8MA 4RX9A 3OD6X 4E5WA 1FOTA 4D2SA 1V0PA 3I5ZA 5GNKA 4TKSA 1GAGA 5FRIA 1KE8A 1OKYA 3Q4UA 4G31A 3PUPA 4ITJA 3S00A 4LG4A 3MTFA 4L45A 3MA3A 3R7GA 4Y8DA 3S3IA 4UEUA 2A27A 3DLZA 2REIA 1PXOA 1M52A 2OIDA 2C6EA 5J79A 3CKWA 4DT9A 1JLUE 2VTIA 1AD5A 1FMKA 1H8FA 3OW4A 2YM6A 3BELA 5CAQA 4ORKA 1QMZA 1MRVA 3DAJA 4RGJA 4YZCA 3SGCA 5EG3A 4G2FA 1UKHA 1ERKA 3C5UA 5LVNA 2W9FB 1HOWA 3HVCA 1MQBA 2XNMA 5EM5A 3GCUA 2V0DA 1F3MC 5CXHA 4EHZA 4N0SA 4M14A 4AW5A 3TL8A 5LVPA 1SNXA 4F7JA 4BDAA 4DH3A 4DCAA 3WIGA 5BVFA 2WOTA 4D1SA 3E5AA 3QA0A 3BKBA 3R2BA 4FVQA 3HNGA 5BUEA 4C61A 2VTPA 3A7HA 3R7IA 2VX0A 3P79A 2KTYA 4MBJA 2I0EA 4UZDA 2XEZA 2C0IA 2CKOA 4RC4A 3WZKA 4AFJA 1UKIA 5E1EA 5F94A 3ZBFA 2X8IA 4QNYA 1YOMA 2XIKA 4M12A 1H01A 3EWHA 3FMJA 4NFNA 4DFYA 4HNIA 4TNDA 4BKZA 3JS2A 3ZONA 4KUJA 4L42A 4QQ5A 4DFNA 1WBTA 3EN4A 3R01A 4IW0A 5F20A 4Q5EA 2HWOA 3MJ2A 3QKLA 4DHFA 4I6QA 5FEDA 1YXSA 4YTIA 3VVHA 4O81A 5EI6A 2A19B 4YURA 1PMVA 3RGFA 5IDPA 2Z7QA 2GDOA 2GS7A 3LW0A 1NXKA 5FBNC 4WBOA 3B2TA 4OBOA 4QTCA 3DY7A 3I1AA 4IAFA 3CY3A 1CMKE 3PIZA 2BRMA 3FMLA 3UPXA 3C0IA 2PVJA 1UU7A 4ITHA 2I0VA 3TIZA 3F3ZA 2O0UA 5B2LA 3VRZA 2ZAZA 3ZEWA 4CZUA 2X7FA 5D11A 2VWBA 3HA8A 4FT7A 4LQMA 4BIEA 3OY1A 2RFSA 4J98A 4BGQA 3VS3A 4MWHA 4E3CA 4BCNA 3QQFA 4K1BA 5L2WA 4BDBA 4EH4A 5KMLA 4DEDA 3RPYA 4EK4A 4NZWB 2PE0A 2VTTA 4BRXA 4QMWA 2JKOA 3O51A 2Y0AA 3THBA 2HZNA 4AN2A 4GKHA 4K9YA 3MTLA 3EHAA 3W18A 4FA2A 2BDWA 2OZAB 2WMQA 4H58A 2WQOA 5LOHA 5IU2A 2WEIA 4KIKB 2UW4A 2VGOA 3KK9A 5AP0A 4EQCA 1Q4LA 3TUBA 5HE0A 4U9AA 1E1XA 2BUJA 4K0YA 3FMKA 4DFXE 3ORKA 3TN8A 2C1BA 2GTMA 4M8TA 2R3IA 3BYSA 3E7VA 3F2AA 2ZM4A 3I60A 3FI8A 3CLYA 5K0KA 4C4FA 1Q3DA 3RAHA 4AA0A 2R3KA 3PRIA 5EI2A 4JQ8A 5JT2A 4GIIA 2VTHA 3Q9YA 2VO7A 4FL1A 4H1MA 5AUWA 4Q5HA 2XK6A 4XV9A 3IOKA 4CT1A 1JBPE 3FMMA 4G17A 3EH9A 2CKEA 2R3NA 3MH3A 3VQUA 3LZBA 4AW2A 2R3MA 3GCQA 2EB2A 4NH1A 4RFMA 1FMOE 3KXXA 3PJ1A 4I94A 5LMKA 5J1VA 3RZBA 2PUIA 3K5VA 1KSWA 4FV9A 4C36A 2G2HA 2DUVA 1JVPP 2UZOA 4FNWA 2NO3A 4C4IA 5E7RA 3TV6A 4AA5A 5K9IA 4KA3A 4CYJA 3VNTA 1BYGA 5IPJA 3R8LA 4MXXA 3RPRA 3IKAA 3QQJA 5AP7A 4I4EA 5CSHA 3V8WA 3SG9A 3PXRA 4BI0A 1P14A 3BU6A 3CKXA 2C3KA 2CGUA 4AW0A 3S1HA 4PRJA 4YNEA 3CQUA 4FI1A 3H3CA 5TE0A 1YOLA 3KRXA 5GJDA 3UMWA 2BRHA 3IOPA 3PA5A 2Y6OA 5AM7A 4YJSA 4ENXA 3PLAE 4DTBA 2J0LA 4ZY5A 4YJPA 3I0QA 2W1HA 2WTDA 1W98A 3PXYA 4FKRA 4N4SA 4W9WA 4NM3A 4AP7A 4W4XA 5KMKA 2G15A 4U97A 3TDWA 2PZRA 5L8LA 4YU2A 1MP8A 5L2SA 4R5YA 4NCTA 4ZTRA 2OGVA 3W16A 1B39A 3QA8A 2J0MB 2JLDA 4BICA 2UUEA 3UZRA 3DDPA 3QTZA 2R0IA 3PYYA 2R64A 1GZ8A 4QP6A 3NX8A 1JWHA 1UU3A 1UWHA 4ANBA 3VS5A 2R7IA 4PTGA 3ZZWA 4QP7A 5BVDA 2PVLA 2PZPA 3AC2A 2A1AB 2VX1A 5AP1A 2JKQA 3G33A 5HO6A 5T68A 5AR4A 4TNBA 4IX3A 5IUGA 4OT6A 5EYMA 3H9RA 2JBPA 3FI3A 2Y9QA 5BYLA 4HCVA 4Y73A 1IG1A 3BZ3A 4YLLA 2IZUA 4PP9A 2C5NA 5E8UA 3B2WA 3NLBA 4FTQA 2IVTA 3PXZA 1REJA 5HIBA 3NYVA 3CS9A 3L1SA 3A7IA 3MFRA 2YISA 2YM3A 5KE0A 4EOMA 3D7TB 4QMVA 4ZY6A 4J53A 3NNUA 3NUYA 2IJMA 3RALA 4YJUA 4R77A 3EN9A 3RPVA 4K18A 4JG6A 1E9HA 2J0JA 4RZWA 3BHVA 4IAYA 3ENMA 4PNIA 4IAZA 2HOGA 5FUTA 2FB8A 4V01A 3DK6A 4FTUA 2C6IA 1IR3A 2E9NA 5CVGA 4ANOA 1B6CB 3OCBA 4O96A 2VTMA 1H1QA 3LM0A 3OOMA 4AT5A 3QRKA 4I0RA 4I22A 4FIFA 5HLWA 4UMTA 1UWJA 3BBWA 4ANQA 2UZNA 2VTOA 3QGYA 2C1AA 4UWBA 1WBPA 4FKJA 5CU0A 3T3UA 3DBDA 5E90A 1BI8A 4MNEB 4C4JA 3PPJA 3D2KA 3LFEA 3PTGA 2XK7A 4Z9LA 2V55A 3FXWA 4YJVA 3RVGA 4CFXA 1QPEA 3LCTA 2ITZA 3GOPA 3GU7A 3F3VA 4XEYA 3SX9A 4MXAA 2XNEA 3PP1A 4WKQA 1DAWA 2GNHA 3DBQA 3IW6A 2XK4A 4OR5A 4KB8A 2FA2A 3MH2A 4M68A 4I3ZA 5M4UA 4I93A 4X2KA 2RIOA 3PZEA 3AC1A 5A46A 3BRBA 2PZIA 2YACA 2HZIA 3R30A 5KO1A 3PRFA 5IA1A 3ZRLA 4E20A 3R8PA 2ITVA 2QOBA 2Y4IC 3COKA 2YCFA 3U9NA 3SQQA 5CSPA 1U59A 4RX7A 3UO6A 4DLIA 4FKSA 4FUYA 3IDPA 4BC6A 4CZTA 2B9FA 2C5XA 5IDNA 3EOCA 3QX2A 4D58A 4EOSA 3BYVA 4RWKA 4S32A 3QZHA 4R3RA 4O7VA 3QAME 4HYSA 2YITA 3AOXA 1SVGA 4I92A 4TN6A 1OBDA 3EFJA 4TWNA 4E4LA 5AP2A 1PKGA 2QOIA 3UMXA 3FZSA 2X2KA 3V6RA 3P7AA 1ZOEA 1T46A 2Y4IB 4MXZA 2XKCA 3VS6A 3QALE 4EHGA 3CGOA 3AD4A 4M84A 1W82A 5TKDA 4AE9A 5TR6A 4RIYB 4GK4A 1OL7A 4H3BA 4TL0A 4OAUC 2W4OA 4ZSAA 2YDJA 2Q0BA 5TT7A 4E8AA 3EQDA 5ETFA 1OL5A 2VO6A 4FT5A 4X3FC 4IDVA 4ZMFA 3F6XA 4AZVA 1W0XC 3JPVA 3PSDA 2GQRA 3NYNA 2GMXA 5EQPA 2XKEA 3M2WA 4CQGA 2ZDUA 1YHSA 4FTLA 3OUNB 1CKPA 3BEGA 2DQ7X 2IZTA 3OT8A 1OM1A 4MH7A 4X2JA 3QYZA 3ODZX 1M17A 4RIXA 1FGIA 1U5RA 2X9FA 3RWPA 4YJQA 3PIXA 4XH6A 3LQ5A 3DKGA 1KOAA 3NRMA 1OKZA 1PHKA 3KRLA 3NSZA 4X3FB 4E6AA 1G8AA 3G51A 4I6FA 5AP3A 4C37A 5HNIX 3PXFA 2WTKC 4MEDA 4Y83A 4C02A 2WFYA 3LHJA 2ZYBA 4FIGA 4PUZA 2C3IB 2YIRA 2W1IA 3TV7A 2W0JA 4J95A 5CAUA 2CNUA 1G3NA 4FV2A 5BUIA 4AT3A 1XH7A 3CP9A 4A9TA 5ACKA 4F63A 1Y91A 4JDKA 5E8YA 3NCZA 5ANIA 1QPDA 2JEDA 4QMXA 3KULB 5ANJA 4CTBA 2WQEA 4OTRA 5LWNA 4Y72A 5CU2A 5F95A 1IAJA 3RK9A 2PHKA 4C2VA 1YI4A 4GIHA 4XG6A 2HW6A 5M55A 3TNIA 2WTKB 4IFCA 2CGVA 5CANA 1YWNA 5HGIA 3D7ZA 3B8QA 4O0XA 3NW7A 4BTFA 4CFNA 4V05A 5EYCA 3DQWA 4D9UA 2YCSA 5LARA 4EI4A 1NVQA 3MH0A 1FBNA 3ZMMA 1KV1A 4JQ7A 2BZIB 4CKJA 3BHUA 3BPRA 4RQVA 4AZTA 3SW7A 2PU8A 4JOAA 2YJRA 2NPQA 4ACHA 3U54A 3H30A 4D2PA 5M4CA 5I5ZA 2W1FA 2WB8A 4RJ4A 5FBOA 4AGCA 5HX6A 5CQUA 3BYOA 5C8MA 4F6UA 3DKFA 3PE1A 3UIXA 2PTKA 4M15A 2GNFA 4ZTHA 5B0XA 5JKGA 4FE2A 3FKNA 4YZ9A 3HV4A 5DG5A 4XLIA 1AQ1A 2PPQA 5AUUA 2F4JA 4FVRA 3PA3A 1QL6A 4R1VA 4DCEA 5HBEA 4ZJVA 2VWIA 3UE4A 1H1RA 5FXRA 4Z7GA 2H6DA 2WTVA 3WILA 4R8QA 5AA9A 4QP1A 2Z7SA 3R8UA 3OEFX 2CN5A 2OW3A 4EK5A 4AX8A 4R5SA 4FSQA 4BDDA 2B9IA 5ICPA 4EOOA 4TYGA 5IA3A 2JIIA 2QOCA 1RDQE 3RHXA 3MFTA 4F4PA 4EC8A 3UNJA 4I20A 1Q61A 1Z5MA 3IQ7A 4IAIA 4IVDA 3TKUA 3ZO2A 4YLJA 4ANLA 1Q62A 4FV4A 2AYPA 4RVLA 3NAXA 3U4WA 3HYHA 3QCQA 1BKXA 1GIIA 4FT3A 3C4XA 4LGGA 4FSZA 1UA2A 2C4GA 5M44A 5FDXA 4FL3A 4I41A 3WF9A 5KUPA 3CD8A 4A06A 3QCXA 4PV0A 1OMWA 5HO8A 2H96A 3R1NA 4K77A 3ZTXA 3UIUA 4BI2A 5I0BA 3RPOA 4UBAA 4QP8A 4IX4A 3LXPA 4FZ7A 4EOQA 3DBCA 3Q53A 5ANKA 1PRYA 5HVKA 4FKTA 1H28A 5I3RA 4ANNA 4LUDA 4QMYA 3PVBA 1M7NA 1H0WA 4L46A 3OOGA 4BDJA 4IVBA 2ZB0A 2VZ6A 4BR3A 1MUOA 3QUDA 3UC4A 2OG8A 3POOA 4IDTA 4ACGA 3ZU7A 2QO9A 4DBNA 4FV6A 1QPJA 1CDKA 4QMLA 4U3YA 4C62A 4Q9ZA 3VBQA 4CNHA 4FKVA 4G3FA 2JIUA 4LGDA 3R9HA 3F3TA 3MSSA 2B54A 4O6EA 5DH3A 3RHKA 4EH6A 4BGHA 3L8PA 3DJ5A 3DFCB 3DZQA 4O7RA 4PQNA 4O1OA 2XIRA 4PP7A 4UY9A 3KA0A 4ZJIA 5JGBA 1JQHA 3TG1A 4EH7A 3DK3A 4FNZA 1XKKA 2PVYA 2ACXA 3QWJA 4R3PA 3FEGA 3HV3A 5HOAA 1YXUA 1RW8A 3DBEA 5B2KA 2G2FA 5BVKA 2BALA 2YWPA 3ET7A 5EH0A 3LLAA 3BGPA 2WPAA 1R0EA 1IA9A 4E4NA 5IQAA 4JS8A 4F08A 4FV1A 4D5KA 2O5KA 4W9XA 2HXLA 1TKIA 2OLCA 3FPQA 4HNFA 4FUXA 4XBRA 2UW9A 2R5TA 4YNOA 1VJYA 3U6HA
chains in the Genus database with same CATH superfamily
3MVJA 4EJNA 3P7BA 1O6LA 1S9IA 2EVAA 5EYDA 2NP8A 2YLFA 1HCLA 3EN6A 3IECA 3OW3A 5L6WL 4EYJA 4FG8A 2W06A 3QUEA 4PY1A 4V04A 5D9HA 3NYOA 1GZNA 5CEIA 2PMIA 3UVRA 4XV3A 2WHBA 2OICA 4C35A 2CLQA 2QVSE 2Y4PA 5C27A 1PMNA 3JXWA 2XF0A 3F69A 2G1TA 5A6NA 1AGWA 4S30A 2QD9A 3N51A 2X2LA 4ZIMA 2PULA 4FEUA 4FIHA 3D5XA 5DRBA 4MNFA 4RJ7A 4UXLA 5KBRA 1VLRA 4AXDA 2BFXA 3MW1A 1YRPA 2QG5A 2R3GA 5IQDA 4AGUA 2Y6MA 2R3LA 4I6HA 4I5HA 4RVKA 4Q2AA 3SAYA 1DAYA 4YLKA 3QTWA 3BLAA 3PLSA 1Y57A 2WIHA 3BEAA 2X7OA 4RC2A 3RCJA 4Z16A 4RX8A 2ITWA 4DH1A 5EQEA 1NW1A 4IZYA 3EZVA 4QQJA 3FY2A 4AT4A 4FKGA 4ZLYA 1BMKA 4FEXA 4XUFA 2XS0A 4FZDB 3G5DA 3L8SA 4TZRA 2QR8A 4H36A 4TYEA 3WZJA 4MXOA 3NUPA 3UO5A 3QD3A 5DRDA 3A4OX 2F2CB 2PE2A 4QP3A 4H39A 4O22A 3FL5A 3KVWA 3QFVA 4FV0A 2BKZA 4NIFB 5HNGA 1UNLA 3FAAA 2QHNA 3WYXA 3M1SA 5L6PA 2P2IA 4TWCA 4UV0A 2IW6A 3EYGA 3A8WA 4L67A 4YZDA 3UQCA 3PSBA 2UV2A 5CS6A 1M2QA 4AF3A 2UZEA 3RM6A 4B99A 3OWKA 3R9OA 5BVWA 3W10A 3ELJA 1K2PA 3ZO1A 5M09A 4GUEA 4QTAA 4JX7A 3LQ3A 2UZVA 4KNBA 4FGBA 3KFAA 4LI5A 4N6ZA 2XVDA 2XNGA 2YIWA 4NTTA 4RVMA 3TT0A 4GK2A 4C7TA 4K11A 5JZJA 4M69B 3AMAA 2IZSA 2HW7A 3OTUA 4C3PA 2Z2WA 3CCNA 4ANSA 3FMNA 3AGLA 4EOPA 4FSUA 3TNPC 5DMZA 2CJMA 2XALA 1ZMWA 5HCYA 5K4IA 3W0NA 4JQEA 4QMSA 3OS3A 3C0GA 2UW3A 5A4CA 3VUKA 3R1YA 4QMOA 1PXLA 4OTPA 3IDBA 3PFQA 2QOOA 3C4FA 1OPJA 3AG9A 3R7EA 3V5TA 2W1CA 5JK3A 3PWYA 1PW2A 3ATSA 2PE1A 3TWJA 3UOKA 2EWAA 4IAKA 4BHNA 2V22A 4HGEA 2GS2A 5JEBA 2X1NA 1OIRA 5J8IA 4GRBA 4LYNA 4FG7A 4RJ3A 3GU5A 4L8MA 4W8DA 2DS1A 4YJTA 5E1SA 3FLYA 4IZ5A 2JAVA 3HP5A 4QNAA 4B8MA 2VWWA 3HX4A 4DT8A 3D94A 1LUFA 5AP6A 4A7CA 3Q96A 4RZVA 3OY3A 4L44A 4JX3A 5AV1A 3V5JA 4ZEGA 2A4LA 2QNJA 3ZUTA 4X2GA 3ZLYA 3UOLA 4QP4A 3ZO4A 2XKDA 3KL8A 4DF3A 3C51A 4RPVA 1IRKA 2OZAA 5AUYA 4QQTA 3GB2A 3HA6A 3NVKI 4KIKA 4OTIA 2ZOQA 4C4GA 4OTWA 3R7UA 3ZFMA 3Q5IA 5EYKA 4I6LA 3LVPA 1YQJA 2PMLX 2X6DA 5HG7A 3LFAA 4E5AX 5I9VA 4BDEA 4IVCA 4EYMA 4BJJA 5E9EA 3H9FA 1G8SA 3QTSA 3EFKA 3ZRKA 4O0TA 2BR1A 4O7NA 3V5LA 3AC8A 4F1OA 2ITXA 5EHOA 3MESA 1J7UA 3SXRA 4FOCA 4S2ZA 5D12A 2AC5A 4JNWA 3OEZA 3Q52A 2P3GX 4RWLA 3G9NA 3UP2A 1OIQA 5E8SA 3QKKA 3Q04A 2R3RA 2GNJA 4TY1A 4ARKA 2F57A 3W8QA 4HYUA 2VTNA 4OBPA 3VUHA 1PXNA 2XBJA 2PUUA 3FV8A 4MTAA 3MY0A 2YM8A 1J91A 2X9EA 2A0CX 4J7BA 4NT4A 5E4HA 4N57A 4AFEA 4IB5A 3QZFA 3TJCA 2C5YA 3LM5A 4R6VA 5JN2A 2ZVAA 5IISA 2UZLA 4O0VA 4GVJA 4FRFA 3WOWA 5JGDA 3QRUA 4MD7E 1VZOA 5GHVA 4DA5A 4FSRA 3E7OA 4OTDA 2YDIA 4BDCA 4CV8A 2B0QA 4JBVA 3TUCA 1WBOA 3RCDA 3V5WA 5HTCA 1ZARA 5A3XA 3WIKA 4DTAA 2OIQA 4ZSGA 4RJ5A 4JRNA 4EZ7A 3QLFA 4I5MA 4TT7A 1UU8A 1GNGA 2J4ZA 3WF5A 4K2RA 4GYGA 5KMJA 2ZV9A 4FV3A 2WOUA 4EC9A 2WXVA 3IG7A 4KD1A 5HVJA 2BMCA 3ODYX 1RJBA 2UW5A 4KKHA 4IQ6A 4O7TA 3VBTA 3MA6A 2JFLA 2HELA 5J95A 3FXZA 5JRQA 4F6SA 5IA2A 2PMNX 4XBUA 5CLPA 2YWVA 4DH8A 5DR9A 3LMIA 3FMDA 5A4EA 1U54B 3RNIA 3A62A 1XBBA 3S95A 4DITA 2GNGA 2IVSA 1JSVA 2O63A 3R63A 4V0GB 1GJOA 3FSFA 3G2FA 1W7HA 2JAMA 2YM5A 3JVSA 3Q4CA 5ANGA 3LKMA 1OZ1A 2CCHA 5KMMA 2J51A 3OHTA 3NVMB 2JC6A 5FTGA 3LCOA 2WMUA 3R22A 5IUIA 4U42A 4WT6A 4F09A 3LJ2A 4A4OA 5BX0A 3MPMA 3VBVA 2XAOA 3N4TA 3Q4ZA 1OIUA 5IMXA 1FINA 3GU6A 4CFUA 2XA4A 4D2RA 4GV1A 1Y6BA 5DT0A 4KS7A 3E8CA 3EQPA 1RQQA 3R73A 4FMQA 2XNOA 3V8TA 2VTQA 3P1AA 1U5QA 3O71A 3O50A 1PXKA 4FSTA 4ENYA 3ZM4A 3OP5A 4CT2A 4YC6A 2R3PA 4CVAA 5HICA 2CLXA 3SV0A 4D1XA 4KRDA 1M2PA 3QZIA 4MK0A 4WNOA 3AMYA 4DTKA 5CF6A 2J9MA 4O4FA 1LEWA 2XJ2A 1MRUA 3GC9A 3I0OA 3OG7A 1KWPA 2JKMA 3DFAA 2BPMA 3MFSA 4RLKA 2IG7A 4L53A 2WU6A 4XG4A 1T45A 2GPHA 1YVJA 3P78A 3UP7A 1LEZA 5AUZA 2NNWB 4DBXA 4ZMEA 2PVMA 4WG5A 2OF2A 4HOKA 3CBLA 3RBWA 1Q8TA 4ALUA 4CFWA 2VTAA 2ITPA 2W1EA 3VAPA 5E8TA 5J5TA 5AX9A 4AE6A 3NW5A 1APME 1PXPA 3W2OA 4EWQA 5DI1A 3FDNA 4ITIA 3BE2A 4WNKA 5BVOA 3QTRA 4BTJA 5D1JA 5HG9A 2JIVA 5HU9A 1H4LA 1P5EA 2IW8A 3MH1A 5CWZA 3W32A 4L6QA 3FLSA 3F5XA 4MNEA 3GC0A 1P2AA 4M3QA 4YSMA 4MQ1A 4I6BA 4ANMA 3F7ZA 2C30A 1JKLA 5DNRA 2IPXA 3DB6A 2EXEA 4W8EA 4CFVA 2WQNA 4MHAA 5FXQA 4NW5A 5HU3A 5LMBA 4RVTA 5AX3A 4FZFB 1ND4A 3S0OA 4ZJJA 1UNGA 2XCHA 4HGSA 4XG2A 3R7VA 4ZZMA 3WF7A 5JQ5A 3PZHA 5ACBC 3TCPA 3PIYA 3DV3A 3TACA 2ETKA 3RI1A 1YWRA 4KIQA 2QU5A 4KIOA 5LVLA 4JG7A 3QRJA 2OXYA 3SXFA 3AT4A 3ZZEA 4ALVA 4HYHA 4PMSA 3H0ZA 4EH8A 2VO0A 5DN3A 3RAKA 4X2NA 4JL9A 3GENA 1H08A 3AC4A 3KK8A 3WZUA 4MXCA 1H1SA 4FODA 3SHEA 5JH6A 1OL6A 3MIAA 4PMTA 4GS6A 5DIAA 3R9NA 4GYIA 3LFBA 5HKMA 3GC8A 1XR1A 5KZ0A 3Q4TA 2JDVA 3GOKA 4BBFA 3R00A 4AZEA 1SVEA 4DEBA 1RE8A 5EI8A 2VV9A 1REKA 4NW6A 3UIMA 3T8OA 5EDPA 3C50A 1ZWSA 3PVWA 5CU6A 4C59A 4F7LA 2XK8A 4DEHA 2WU7A 2YCRA 4MQ2A 3I6UA 1JSTA 2B1PA 2QO7A 5HD7A 4CTCA 3NUSA 4HCUA 2R3QA 4KIPA 5AJQA 4RIYA 3WZEA 2XB7A 3FHRA 5AADA 3FZRA 4FSWA 4QTDA 5AWMA 4FZ6A 4AGDA 3GCVA 2IVUA 1G5SA 3IO7A 3RM7A 3Q2MA 3VW6A 3ZM9A 3EQFA 2YLEA 3BV2A 2GFSA 2UVZA 4ZY4A 3UNKA 3C0HA 3PY0A 2OJFE 5CU3A 4ZZNA 2GSFA 4R7HA 3R2YA 4O6LA 5ANDA 2AUHA 3RAWA 4LL5A 4WUAA 1LP4A 3DNDA 3EQGA 5M56A 3ZSGA 3C1XA 2OIBA 1WAKA 4L01A 1Q99A 1SZMA 4LV7A 2YERA 3FZPA 2Q83A 1OKVA 2UZBA 2I6LA 1LPUA 4BWXA 3A8XA 4AACA 4U41A 3FQHA 5IA4A 4X3FA 2BAKA 4YO6A 5C8KA 3R71A 5AV3A 5HTBA 3D83A 3IDCA 1YKRA 3AC3A 4U6RA 4O82A 4O83A 3VJNA 4L7SA 3TDVA 2F7XE 4JDHA 2V5QA 3A7FA 2PYWA 4OTGA 1ZYJA 3QQKA 5AFVA 5CVFA 4FTCA 4BCIA 3PXQA 5M4IA 5L6OA 3KREA 3EB0A 3GT8A 1FVRA 4TWOA 4TYHB 3ULIA 1PYEA 5GIPE 3MY1A 2XM9A 3GP0A 3KULA 3U9CA 5A4LA 4FT9A 4FKIA 3V04A 2GU8A 3R02A 2FUMA 4DH7A 4NM7A 5J9ZA 5JFSA 3O23A 3LJ1A 3BWJA 5LMAA 3CGFA 3I6WA 3EQCA 3CXWA 4FTOA 2E9OA 3UG1A 4BDFA 2YABA 2BILB 5AAEA 4CKIA 2GCDA 1PMEA 2X6EA 2CPKE 3BV3A 5ITAA 3OTVA 3IW7A 4YHFA 4CEGA 1YOJA 3CQEA 2CHLA 3ITZA 3UIBA 3HKOA 4GU6A 4EK6A 5HX8A 2IO6A 4YJOA 3ZXZA 4FVPA 4JDJA 4WNMA 1J1BA 2XRWA 3BIZA 3NIZA 3ZDUA 4DN5A 5KKRC 4KAOA 4NFMA 4WNPA 4ZXTA 2VU3A 2Z8CA 3A99A 4LRKA 4APCA 2J6MA 2WO6A 2RG5A 3FLZA 4HVDA 2F49A 2WMRA 5AUTA 5LWMA 5IEXA 1YWVA 4DEIA 2C6DA 3O96A 4PDOA 3K5UA 3PJ8A 3QUPA 4KABA 4FL2A 5AP4A 1WBVA 5AV0A 4BDKA 1ZOGA 4G5PA 2E9UA 1H26A 3R7OA 1KUTA 4NJ3A 3K3JA 5HBJA 4FYOA 4FTKA 4OBQA 5IEVA 3CTJA 5KKRB 4IXPA 4BVUA 4ZSLA 2VWYA 2GS6A 4IEBA 1Q8YA 3CY2A 5JFVA 4H3QA 4LMNA 3KXMA 3COIA 3V01A 4OTQA 4C38A 3UDSA 2QHMA 4CXAA 1SM2A 3PE2A 2XZSA 5FP6A 4ZLOA 2O8YA 4PDYA 5AUVA 2B7AA 3QGWA 5HCZA 2XYNA 5CNOA 3R9DA 4PMPA 3PA4A 4IX6A 3C13A 5DR6A 2FSLX 5EHLA 1ZZ2A 1Q8WA 3LFQA 3CPCA 4IM3A 5LXMA 2EXMA 5DLSA 1ATPE 3DBFA 1XBCA 3EFWA 1O6KA 2ETMA 2BZHB 1OBGA 2XNPA 2HZ0A 3VUGA 5HQ0A 3TV4A 2BVAA 3FC2A 5I4NA 2GQSA 4KBAA 1GIJA 3FMHA 3NAYA 1Y8GA 4GK3A 4GUBA 4KS8A 3F3UA 5CU4A 4GCJA 4RT7A 4DC2A 1S9JA 2R2PA 3ANQA 3C4ZA 3WE4A 1DS5A 2QQ7A 3BI6A 3VBWA 4G34A 3RZFA 4PL5A 4EBWA 4O38A 2VTJA 3CD3A 3DU8A 3PG3A 3TNQB 3U55A 4QMUA 5HHWA 2P33A 1SYKA 4WG4A 4YTCA 5CEOA 3F61A 2ZM3A 3BE9A 4CZYB 4DG0E 5FXSA 4HVHA 1QPCA 2PZ5A 5GJGA 4LOPA 2ZMCA 5GIOE 1YDRE 5M53A 2HY0A 3NZ0A 4J96A 3PPZA 3PVGA 3UQGA 4I0TA 1PXIA 3P08A 2OO8X 3F88A 2RFEA 2YIXA 4ASDA 3KIOC 1CSNA 3Q32A 3DCVA 4CRLA 1U4DA 1ZY4A 2PY3A 4O7WA 1W2CA 4F0IA 3QL8A 2XBAA 2G2IA 2PMOX 3FXXA 4JR7A 4P5QA 5IQFA 4DFLA 4AXFA 4G3CA 4APPA 5IF1A 4CG9A 3E88A 1SNUA 4XHKB 4D9TA 2X2MA 3DAEA 4RWIA 3BGZA 1I09A 1Z9XA 3K2LA 4IE9A 2NRYA 3D2IA 5H9BA 5EDQA 3BU3A 3NNXA 4XNEA 3EKNA 4EOLA 4F9AA 1OVEA 4WIHA 3LOKA 3HGKA 4FTNA 3ZUVA 4R1YA 2YAKA 3EL8A 3FWQA 4B0GA 4BCMA 4EBVA 4EOIA 5JSMA 3VS2A 2VO3A 4JRVA 4BZOA 2XNNA 4L00A 3FI2A 1WBSA 4I23A 2QC6A 5JMSA 3CPBA 2EXCX 3EFLA 4JBOA 4J1RA 3BLHA 4FKQA 2RF9A 3R8ZA 4G1WA 3TXOA 5BYYA 2EU9A 3OBGA 2WAJA 1ZYLA 3DTCA 3P0MA 4A4XA 4U43A 3UYSA 1WCCA 2OFVA 2QI8A 3G90X 5CEQA 4YO4A 4FV7A 4U44A 5K4JA 1IASA 5CX9A 3ZYAA 2R3HA 1ZRZA 3KXGA 4IB0A 3ZCLA 2W4JA 4EHEA 1YHVA 4AA4A 2IN6A 3UJGA 3HMPA 1YI3A 4I21A 4XP2A 4BBMA 2QCSA 3CSVA 4Y46A 4F1MA 3OF0A 1Y8YA 4FTTA 3GBZA 5H3QA 3CIKA 2YIQA 5DR2A 1FVVA 2Y8OA 3KRWA 5FM3A 2C6KA 4GT4A 4FNXA 2QOFA 2UVYA 5DWRA 5TO8A 3LLTA 3MGYA 5M51A 4XOYA 3LCSA 5KMOA 3QD4A 4HYIA 4WHZA 5CYIA 4BTKA 5L2TA 4EHVA 3D5VA 2JKKA 3ORPA 2G01A 5ETCA 4D4YA 3QKMA 2XP2A 3TNHA 2QLQA 1Q97A 3TKIA 1YW2A 3F3WA 1H00A 5HG8A 4ACDA 4E6DA 3GVUA 4MCVA 5HG5A 2FO0A 2QKRA 5CSXA 4NIFA 5A9UA 4F65A 3BLRA 4BY9E 3LIJA 3BYUA 4C2WA 1DI9A 2CKQA 4GFMA 4B8LA 1GY3A 4KWPA 4QMMA 4BCGA 3FI4A 4O7SA 2ERZE 5JQ8A 4FOBA 4XYFA 5F1ZA 5EKOA 2VNWA 3Q2JA 1OKWA 3OFMA 3JUHA 4KINA 1OUYA 4CSVA 4RIOA 3MVHA 4UALA 4FV5A 4M66A 4IC7A 4MBLA 2J5EA 3P23A 3VRYA 3MN3A 2HAKA 1ZYSA 1E1VA 4QYGA 5DGZA 4C57A 4MXYA 2YJSA 4XV1A 2YCQA 4ONAA 3Q5ZA 3V8SA 3ORTA 2BZJA 5T6KA 5FWKK 2CNVA 4QYHA 1UU9A 4ZSJA 3DNEA 5HNBA 1PXMA 3E8DA 2GFCA 5EW8A 3QRTA 4DGMA 4RIWB 2C6TA 4GT5A 2X81A 2WELA 5HVYA 3Q60A 4AOJA 2NRUA 1URCA 3CEKA 5AM6A 3ZSIA 4X21A 3ZLSA 3GC7A 4O0RA 5K5NA 3VIDA 3PY1A 3O17A 5CSWA 2ITYA 5EW3A 3W2QA 2P55A 2VWVA 3LFDA 4WUNA 4ZTMA 3OCTA 1STCE 4DEAA 4IWDA 2Z60A 3LMGA 5FGKA 5IQIA 4D2TA 4EOJA 5CAVA 3JY9A 2OI4X 3CE3A 3K3IA 4BKJA 2XNBA 3SXSA 3UBDA 2F7ZE 3PFYA 2EUFB 1JPAA 1TQMA 2YEXA 3NGAA 2FVDA 4AUAA 3ORXA 4QOXA 1ST4A 3BHYA 2FSTX 3II5A 2VRXA 3N4VA 2QU6A 4NK9A 4UMPA 4RIXB 1H07A 3A7JA 5HE2A 4ZTNA 5FTQA 5T3QA 3D5WA 3U51A 2I0YA 2JDSA 3G9LX 5BMSA 3H10A 3NFFB 3UYTA 4YPDA 5TF9A 3VBXA 2PVRA 4BWPA 1OUKA 4E4XA 3KN5A 1YDSE 2WD1A 3JR1A 2WMSA 3CTHA 4NM0A 2VTSA 3LXLA 3ZOSA 4DGOA 5M08A 4L9IA 3FL4A 4UMQA 3HAVA 1ZAOA 2GHLA 1VYWA 3HL7A 4FK3A 3PY3A 4FR4A 5DEYA 2WTJA 2VWXA 3RK5A 2UZDA 4AS0A 4HGTA 3HMOA 4W4WA 5FP5A 4D2WA 5IKWA 3LXNA 4ZS4A 3QQLA 1W83A 2J7TA 2QOQA 3R04A 3O0GA 4HVSA 5GZAA 4DYMA 5B2MA 4IFGA 2W1DA 2E9VA 3F2NA 3R28A 4FICA 4YC3A 3ZLWA 3G0EA 3QTIA 1TVOA 4M7IA 1H0VA 5AR7A 2O3PA 2WQBA 2W7XA 3L9LA 4AU8A 4ZLZA 4USFA 1OGUA 1H1PA 2BHHA 2JDTA 5A6OA 3F66A 2RG6A 2OJJA 2WTCA 3WYYA 2V62A 5HZNA 5D7VA 4U0IA 2WMTA 5CI6A 3IGGA 3LCDA 4IJ9A 5A4QA 4E4MA 3W33A 4ID7A 1KE7A 3QRIA 3SVVA 3ML1A 2C6MA 3VUDA 4F7SA 5IQBA 4RJ6A 2GNIA 3K54A 2QKWB 1F0QA 2R9SA 5CSVA 5HI2A 3F7WA 4EWHA 5DT3A 5KNJA 4WD5A 5DHJA 5FQDC 2I0HA 1JOWB 2BTRA 2IVVA 5EW9A 3OXZA 4X0MA 1P4OA 2QOLA 4FT0A 3W2SA 1ST0A 3ALNA 3R8VA 4BGGA 2A98A 3LE6A 4YP8A 4GH2A 4DDIA 2XJ0A 4NKAA 2R4BA 3LFNA 1I44A 5HLPA 2XIYA 1YXXA 4J97A 3D9VA 4RJ8A 3IK3A 5FM2A 4F0GA 4DFBA 2BROA 1W2FA 4G3EA 3UZPA 1ZYDA 3DXNA 3Q9XA 4U80A 4H05A 3VUMA 4CMOA 3PJ2A 3LQ8A 4FGRA 4OT5A 4FTJA 4ERWA 4DE4A 2ZB1A 4XLVA 3HMMA 3KMMA 5DPVA 4DGGA 3HEGA 4P5ZA 3R21A 1U54A 2YFXA 3D0EA 4MBIA 2OF4A 1OECA 4LGHA 2WIPA 4GJ2A 3SG8A 2XMYA 4TRLA 5I9YA 4GU9A 3ZHPC 4V0GA 3UG2A 1BX6A 5CVHA 5IH6A 5KMIA 3EQRA 2VWUA 3N9XA 4HJOA 3BHHA 4XRLA 1ZOHA 2OU7A 5J9YA 2WMBA 4KKEA 4L43A 4HZSA 4B9DA 4EK8A 2BRGA 4ZP5A 4CYIA 5FLFA 4QP2A 2H34A 3RMFA 3ZEPA 5KBQA 3E63A 3QQUA 4HCTA 1A06A 5B7VA 4X3JA 2R3OA 3GFWA 4CG8A 4WBBB 5AP5A 4DEGA 1R39A 4EH3A 4L3JA 5GJFA 3MV5A 3MY5A 5AMNA 4BIBA 4K8AA 4PF4A 1IEPA 4PL3A 1Q8ZA 5IH4A 3O7LD 3KMUA 3GI3A 5CT0A 1KV2A 4QQCA 1U46A 4U5JA 5EHYA 3ZH8A 5EFQA 4AXCA 5KX8A 3HLLA 3O8PA 4MKCA 4L52A 3VO3A 4GFOA 1HCKA 3QZGA 1PKDA 4U8ZA 5C01A 4YGAA 1CTPE 2LGCA 4D4SA 5ETIA 1O9UA 4EZ3A 4TWPA 3UDZA 1XQZA 3DS6A 3GCSA 2BIYA 4I1ZA 1W8CA 1XWSA 2BZKB 3O8UA 2BDFA 2W5BA 4IWPA 2YN8A 3ALOA 5HTIA 2ITQA 2J0KA 5JGAA 4UMUA 4AOTA 4XMOA 5AR2A 5H8EA 4BCKA 3WF6A 4QPMA 5L2IA 4GJ3A 3A2CA 4YTHA 4PWNA 2CGWA 2OXDA 4ZK5A 1XO2B 1WBNA 3KC3A 4NSTA 5LVOA 3FUPA 1ZXEA 2PVKA 2YIYA 4FEQA 4ZZOA 3P4KA 4JBPA 4XG8A 1NVRA 4ZTSA 4UN0C 2ZV7A 4BB4A 4AZFA 4LDTA 2CCIA 3UVQA 5AR3A 4BDIA 3OC1A 5KHXA 4NL0A 2JITA 4D28A 4BWKA 5BQ0A 1PJKA 3W2PA 3GCPA 3V51A 2F7EE 3MVLA 2R3JA 3EN7A 3I7CA 4EZ5A 5H8GA 3GEQA 3DJ6A 5J5SA 4C3FA 4UYAA 4HVIA 4O27B 2Z02A 3VJOA 1M2RA 4WRSA 5CEKA 4HGLA 5I9WA 1MRYA 1Q41A 5CT7A 3V6SA 3NUXA 3ATTA 3GNIB 4RWJA 3HP2A 2OSCA 2GHGA 2WZJA 3D15A 3E3BX 4LV5A 4BCPA 3P7CA 4PNKA 4BBEA 2VWZA 2FSOX 5HLNA 1R1WA 2X0GA 2UW7A 2W5AA 4W4VA 3ZFYA 3COMA 2Z7RA 3EQIA 4RQKA 4DG2E 5M07A 4ZSEA 3KF4A 5IA0A 4BYJA 4TPTA 5CEPA 3KXZA 2C3JA 1FVTA 3E93A 1ZYCA 3RAIA 5IZFA 2JFMA 5CEMA 4CV9A 2WGJA 3Q9ZA 4HW7A 3TEIA 2UW8A 3E64A 4EORA 5M4FA 3E62A 3QBNA 4F9YA 3PJ3A 3ID6C 5IQCA 2BKKA 2XKFA 5ANOA 1JKSA 3QTUA 3H0YA 3KMWA 2UVXA 3VWAA 1K3AA 3FZTA 3ROYA 5KZIA 5HESA 3LPBA 2B9JA 2CN8A 1H25A 4IX5A 3BX5A 2ONLA 4FKPA 4LOQA 3SRVB 4QD6A 4EK3A 3DA6A 3DKOA 4GVAA 1BL6A 4IJPA 4BHZA 4EQMA 3FY0A 2FGIA 3F2RA 4NYEA 3KVXA 3FYJX 4LRJA 2Y7JA 3FQEA 5EDRA 4E26A 4LL0A 4DAWA 2B55A 4L3LA 4FX3A 4F0FA 4EL9A 4QT1A 3DGKA 2HXQA 1OIYA 2ITUA 3KXNA 3QTXA 4F7NA 3EQHA 4AG8A 4MD8E 1NY3A 3TZ9A 4IIRA 3QU0A 2J0IA 3PPKA 2C0TA 4OGRA 2V7OA 1J3HA 1BI7A 2HWPA 3AD5A 3AKKA 2FSMX 3D7TA 4NUSA 5EKNA 2RL5A 1SVHA 2XCKA 4FSNA 4WRGA 2O65A 2PZYA 4TYHA 5EM8A 3A7GA 2JD5A 5LCKA 4EOKA 3BQRA 4D0XA 1A9UA 5A54A 4IZAA 3ZC5A 2KULA 3E8EA 3I81A 1WZYA 4G9CA 2RFDA 4GL9A 4C33A 4KSPA 3SOCA 4XP0A 2HY81 4EQUA 4P2KA 4M97A 4FEVA 4EUTA 2A2AA 3U8WA 2RGPA 3OWLA 5CNNA 4A9SA 5AV4A 3LFSA 5A14A 3NNWA 2JDRA 4GSBA 5HIDA 5I9XA 5KMNA 1Q8UA 4ZAUA 2X39A 4GG5A 2H9VA 5HBHA 4S31A 2I1MA 3I5NA 4AXAA 3C4EA 4P90A 2W05A 1BLXA 3QCSA 1KE9A 4CFFA 4F99A 5EOBA 3UVPA 2W17A 3DXQA 2UZTA 4XG9A 5L3AA 2ZFYA 4O91A 4I4FA 5D10A 4O2PA 4QTBA 3H4JA 4EH5A 4O7LA 3RK7A 3FC1X 2W4KA 1WMKA 1XH8A 4XRJA 4B7TA 2BHEA 4O4BB 5E8WA 3VHKA 3NIEA 1IAHA 3S4QA 4YC8A 4FTRA 4DINA 4BJJB 3PXKA 4R78A 2UW6A 2CSNA 4PTCA 1XH6A 4IB3A 3VN9A 3BLQA 4IACA 4BYIA 4GEOA 1CM8A 4L3PA 3DKCA 4M67A 1ZLTA 2X8EA 4U45A 2W99B 3SW4A 3VQHA 4ASEA 4FC0A 3TUDA 3R1SA 4J99A 1UNHA 3PDTA 3AMBA 5DE2A 3EQBA 4MF1A 4HZRA 4NWMA 4XOZA 4AAYA 3FYKX 3AT2A 3L9PA 4OAVB 2QOHA 5E8XA 3TTJA 4A9YA 3D5UA 4L68A 3KN6A 3MPTA 3REPA 3NR9A 4OTHA 4NEUA 4XS2A 5I9UA 2X0PA 3NPCA 2ZMDA 1OI9A 3L9NA 3KU2A 2AQXA 3BCEA 4W4YA 5CAOA 4JMQA 5AUXA 4BZNA 4YJRA 4ZTLA 2CGXA 5DOSA 2X4FA 2ONLC 3MDYA 4E5BA 5DYJA 3OWJA 3ENHA 2ZM1A 3DB8A 1XH4A 3HV5A 2BAJA 5C1QB 3KY2A 4FIEA 2JDOA 5DT4A 1CKIA 2C47A 4JVGA 4O7ZA 3L8XA 4LOOA 3ETAA 5AEPA 3L8VA 4G9RA 1PXJA 2BFYA 3G6GA 4WSQA 3TNWA 3VW8A 3EMGA 2YA9A 3O8TA 4QTEA 3FLQA 3SOAA 4Z55A 1OPKA 4AQCA 1FGKA 3L9MA 4UX9A 3RNYA 3ZSHA 4BCQA 1XH9A 2XUUA