5BVOA

Fragment-based discovery of potent and selective ddr1/2 inhibitors
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
308
structure length
276
Chain Sequence
DFPRSRLRFKEKLGEFGEVHLCEVDSHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDKPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Epithelial discoidin domain-containing receptor 1
publication title Fragment-Based Discovery of Potent and Selective DDR1/2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 276
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bvoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bvoA01
2Z2WA 4FSNA 4FTLA 3RZFA 4IVBA 4R77A 2C0OA 4C7TA 1REKA 3NCGA 3SXSA 4AN9A 4W4YA 4LRKA 4ID7A 4MH7A 4DLIA 3PYYA 4USDA 2P4IA 3DNDA 4FIJA 5KZIA 2XCKA 4WIHA 2XZSA 4OT5A 3RAHA 4BDGA 3K2LA 4XG6A 4ZLOA 5AP7A 2OIDA 3NW5A 5LVMA 3G9NA 3R63A 4FV2A 4EONA 4L45A 3C0GA 3DBQA 3BQCA 4O1OA 2WB8A 3FWQA 4JS8A 3FHIA 3HAMA 3LCSA 4ZIMA 3QWKA 3MY5A 5D10A 4X2JA 3TWJA 4YLJA 4DCEA 3EYGA 3QFVA 4LRMA 1G8AA 3OY1A 3GVUA 4WRSA 3S95A 5M07A 1PHKA 2XK8A 1SM2A 1WZYA 2QONA 3SHEA 3DZQA 3H9OA 5E91A 4APPA 1JQHA 1M2RA 1QL6A 3OCTA 1T46A 4RX5A 2QU6A 4R7BA 2CGVA 3B2WA 4WO5A 3K3IA 5HG7A 3UTOA 3GC9A 4CTCA 4JG7A 4GUEA 3U54A 3KULB 3PLAE 1MQ4A 3HEGA 4M0YA 1GZKA 2I0VA 3CQUA 1OPKA 3LJ0A 2CKQA 3MPAA 4APCA 3F7ZA 2QCSA 3BU5A 2CKPA 4FVPA 3F66A 4OGRA 3LMHA 1PMUA 3DAKA 2YCSA 3PSBA 2JC6A 4GCJA 4NM3A 5HO6A 3G6HA 4WT6A 3EQFA 3NIEA 3JVRA 3PTGA 1WBNA 2WD1A 3TI1A 5J1VA 4NW5A 2FSLX 4R5YA 4EC8A 5L8LA 3RM7A 4O7SA 2WU6A 2X1NA 4ZS4A 5CEQA 4GIIA 4D58A 4UXLA 4FIGA 4FTMA 2JIUA 5EW9A 3KVXA 3VS6A 2RG6A 2VTRA 4KKHA 5IH5A 1KE5A 3V5TA 4M3QA 5HNBA 3TKHA 3QTQA 4C4GA 2OGVA 5J87A 3FMNA 3SDJA 3WE4A 4PUZA 2OU7A 3O7LB 3ORIA 5AV0A 4KRDA 3Q4CA 2UZOA 3IW5A 5EM6A 2GMXA 2P3GX 4E7WA 5L6OA 2VWVA 3KCFA 4R3PA 3T3VA 4ANMA 3TNIA 3C9WA 4L46A 2AYPA 1PXLA 2BHEA 1AQ1A 2PZPA 4BDBA 3D7ZA 3RVGA 5GJFA 5EI2A 3BBTB 5L2QA 4EOOA 2CKEA 2VGOA 4L52A 4MQ1A 2ITNA 5DMZA 5E92A 4D9UA 1NVRA 2CCHA 2XKCA 3Q2JA 4IFGA 4C3FA 4WUAA 4GT3A 4C33A 3TM0A 1KOBA 4O0XA 4CG9A 3CPCA 2YLEA 5KZ0A 2A4LA 2E9VA 3VQUA 2VTHA 3R00A 3SC1A 1ZLTA 2HK5A 1UWHA 4CMTA 4IVAA 3PXQA 3I1AA 5TO8A 2CCIA 3UG1A 4EI4A 1R39A 5E8UA 3PSDA 5IQIA 3QZIA 3AD4A 2VTQA 3ET7A 3NMUF 1QPCA 2ITWA 2XH5A 2XKDA 1YXSA 2X7GA 3ZLSA 2G15A 5FM3A 5EM8A 2NRUA 3GI3A 2W1HA 4EOJA 5IEXA 4RMZA 2OZAB 2UZBA 2VWBA 3G2FA 3QTZA 4TL0A 3Q9YA 2XBAA 4O96A 4ORKA 1RJBA 3I5ZA 3RALA 3WBLA 4S31A 3WYXA 3AC2A 3IDPA 5CI7A 4BI1A 4X2GA 2E9NA 2WMWA 4FG8A 4DITA 4FZDB 4XBUA 2IVTA 2OG8A 5CZHA 1YI6A 3ODZX 1K2PA 3LFQA 5AR4A 5FP6A 1VJYA 5JKGA 5IZFA 4FKLA 3P79A 1PW2A 4NM7A 4RWKA 4OTGA 3BX5A 1XQZA 4O2ZA 3F88A 3RMFA 3OC1A 3POOA 4NCTC 4KIQA 4QQ5A 3ZSGA 3E8DA 3QUPA 4I5PA 4PMMA 3C4WA 3TG1A 4X3FB 4UYAA 2G01A 3E63A 4FV0A 4H1MA 4OTWA 3EL8A 3MPTA 3QC4A 4I5HA 5HCYA 4B0GA 4YTFA 5T68A 4ENYA 2BIYA 4GL9A 5C03A 2QLUA 1MUOA 4BKZA 3LFAA 4QP1A 2X6EA 4PDOA 3EZVA 1ZOEA 5HBHA 4KKGA 3REPA 1VYZA 5KX8A 3U6HA 5A6OA 3D2IA 3KXNA 5GJDA 2W17A 4TN6A 5HLPA 3R83A 4A9TA 2PYWA 4GJ2A 5IQCA 4QP8A 5CSHA 1H01A 3W1FA 3F3TA 2WOUA 4FTAA 2OXYA 3I7BA 3RPVA 3HMNA 4AQCA 4OLIA 4I92A 3QKLA 4EZ5A 4NL0A 2Y0AA 1QPDA 2B9HA 4UBAA 3FYKX 3K3JA 4E8AA 3L9MA 2H8HA 4DINA 3MSSA 5JQ5A 2UVYA 1U54A 2BDWA 2CHLA 4O86A 4UMRA 3Q6UA 2R3PA 2BROA 4BIEA 1GAGA 2XJ1A 5E8XA 4GT4A 1JLUE 3P4KA 3EKNA 3F5PA 2BR1A 3LVPA 2VNYA 5H3QA 2PZ5A 4CEGA 2BUJA 1FVTA 3AQVA 3ORTA 1KOAA 2ZM1A 4FYNA 4FIIA 5AUUA 4HYSA 4KABA 3PY0A 4G3GA 4CG8A 1R3CA 5A4LA 2V22A 4FZ7A 4RIOA 3UQFA 4UMQA 5JFWA 5DIAA 1ND4A 3ID6C 3UZTA 1EH4A 3NGAA 4GYGA 4IAIA 2XIRA 4IHPA 5EHOA 4ERKA 4OAUC 3LXPA 3ORXA 4UB7A 3UMXA 5IA4A 2ZVAA 2B9JA 1YI4A 3OG7A 2F2UA 4ZXTA 4KS8A 4F09A 1Q4LA 4YJOA 2DS1A 4I1ZA 3QQLA 2C69A 3C0HA 4RVLA 3AC8A 5ANDA 4LOPA 4R1VA 1J91A 2I0HA 3ZBXA 3D7TA 4KA3A 3QGWA 1XBCA 3OMVA 2YEXA 5AAFA 4RJ3A 4BDEA 3G9LX 4XRJA 5IQHA 4F4PA 4QP6A 5BMMA 3HAVA 1H00A 3G33A 5H8GA 3GU7A 2XCHA 5FEEA 3OW3A 5EYMA 3T8OA 5HO8A 2C6TA 4JBQA 4MX9A 3VBTA 4DEDA 2C6OA 2R7BA 1KSWA 4BB4A 4MHAA 5E4HA 4FK6A 4UWBA 3GNIB 2W1EA 4RJ8A 4BIDA 4FSQA 2B0QA 1E1XA 4K9YA 3BCEA 3ORMA 5L2SA 3VS0A 2BDJA 3I6WA 5C8NA 5A4QA 5KMLA 2P2HA 4N6YA 4Q9ZA 3WF8A 4O7TA 4BR3A 3VAPA 2WEVA 3H0YA 2W4JA 2JGZA 4HVHA 4O0SA 2J0KA 1PMEA 1MP8A 4HPUE 4IEBA 4F9AA 3KCKA 5ANKA 3KC3A 3E92A 2CN8A 3AMYA 4O0RA 4I20A 2AC3A 4PRJA 4O84A 2GU8A 2X39A 3QA0A 4GU9A 4D4VA 3JUHA 4FZ6A 4KIOA 2VX3A 2BRGA 2CJMA 5C26A 3L8SA 3V01A 3G0EA 3EWHA 2Y6MA 2OXDA 3LCOA 5JFVA 5KE0A 2W1IA 4XH6A 3ZBFA 2HZNA 2DQ7X 3NUNA 4U42A 4BCKA 3DJ7A 3QZHA 3NW6A 4F1MA 2OO8X 3L9NA 4FSTA 5KMNA 5AX9A 4FGRA 3SLSA 3HUBA 1WVWA 4TW9A 4XV2A 2SRCA 2HZ4A 2Y4IC 3AC3A 5A4CA 1PYXA 5C8KA 5FLFA 1KV2A 1H1PA 3NIZA 3QZGA 1A9UA 2REIA 3HP5A 3R7UA 4BI2A 5AX3A 2QO2A 5JGAA 4J52A 2W9ZB 4QMQA 3A7JA 4QPAA 4O6LA 5CAOA 4EOPA 3MFRA 1YKRA 1CMKE 2EXEA 5HX8A 4U3YA 5KMIA 4TWPA 4UWYA 3FZ1A 4HYIA 3R7YA 3D9VA 4G3CA 3QTUA 3KFAA 5C9CA 4NZWB 3E88A 3HP2A 3EJ1A 4CCUA 4D4RA 3PXZA 3CP9A 1OL5A 2YHVA 1XBBA 2YIXA 3OP5A 4FGBA 4Y85A 3A62A 5KBRA 4KUJA 3KB7A 3H9RA 2GNFA 3O7LD 3IECA 3PZHA 2YN8A 5EM5A 2GQRA 3FBVA 2IPXA 4MQ2A 4UEUA 1PXPA 4YUQA 5ACKA 5HVJA 3RK5A 3TIYA 1ZYCA 2KTYA 3O2MA 4LV5A 4A9YA 4FF8A 3COIA 4F1OA 4CNHA 4JT3A 2PVKA 3HV4A 4IIRA 4LGGA 4WD5A 3SW7A 3KREA 4O7ZA 2UZWE 3UIXA 4WUNA 3FMMA 4CCBA 3NCZA 4FKRA 5IA5A 4BDIA 5FTQA 2CNQA 4RJ7A 4D1XA 3UVQA 2VWZA 1PY5A 3ZEPA 4CT1A 4AF3A 2XIKA 5BPYA 2UW7A 3FHRA 4O27B 4BIBA 2OJIA 3CTJA 3SKCA 5DR2A 4IVCA 4HVIA 5I3RA 2CNUA 2QVSE 2VWWA 5BMSA 4KKEA 1FMOE 2B55A 3DXPA 1YHSA 2YDKA 4RIXB 3LE6A 4KSPA 2VTPA 1JNKA 2VN9A 4QP9A 3R1NA 2YACA 5HQ0A 4RIYB 3LCKA 4KB8A 5ETCA 2DYLA 5JEBA 4Y5HA 1APME 3BGQA 3CGFA 5JGBA 2A27A 4JJRA 3R0TA 2QOLA 4JIAA 4DH5A 3M42A 4FIHA 1YOJA 2WTCA 3ZHPC 4QMPA 3WF6A 4QP2A 4NFNA 4PX6A 4BBEA 2IZUA 2IZSA 2R3QA 2ZV2A 3RAKA 3PVWA 2NP8A 4I5CA 5BX0A 3KK9A 2R7IA 3GOPA 4W8EA 1T45A 5H9BA 3IS5A 4YPSA 3W2OA 4BHNA 4PL4A 5M44A 4O0YA 5J5SA 4TWCA 3KL8A 3UE4A 1CDKA 4ASXA 5HU9A 5LMBA 3FKLA 3ERKA 4A4LA 4N0SA 3BGZA 3MFTA 3MH0A 4IB1A 4H3BA 3VVHA 4KIKB 2O65A 4A7CA 4ZMFA 1URCA 3O0GA 4BF2A 4C58A 4MBLA 2OH0E 2Y7JA 4O0VA 4GRBA 3WF7A 4CV8A 2UW6A 4EHVA 3EQHA 3UYSA 3L8VA 1XH4A 2IO6A 4UYNA 4YR8A 3ZXZA 4EHGA 5DRDA 4LI5A 1K3AA 2X8IA 3M11A 3MB6A 5CZIA 4IJ9A 4J71A 1XKKA 3ZFMA 3F7WA 3RK9A 4FT7A 3SRVB 3V3VA 3HV7A 3KRLA 5CYIA 2G2IA 4G6LA 3O71A 3KXXA 2BHHA 3EMGA 3QC9A 3LFFA 3TT0A 3F3VA 1H1QA 2HCKA 5EOLA 3WZUA 1GZOA 4MXYA 1MQBA 3CBLA 4RQKA 3C5UA 5A4EA 3LFEA 1OBGA 4IANA 5IQGA 4X3FA 4E6CA 3W2RA 2WTVA 4FTCA 5HE1A 3Q6WA 2XK7A 2OFUA 2XNMA 4AACA 2QG7A 4IBMA 4C34A 3IPHA 3TV4A 3WZDA 3WZJA 4BI0A 3WZEA 1TQIA 4YHTA 4M66A 5M4FA 4ZSJA 2W5AA 3I5NA 4JDKA 1JKSA 4CMOA 1FGIA 4ENXA 5F1ZA 1WCCA 3VS5A 1JKTA 1W82A 1OL7A 4DGGA 4QOXA 2OZOA 2UZVA 4IM0A 3W8LA 2YCQA 4DGLC 1LPUA 2R3OA 2ZOQA 2UW9A 3MESA 4TTHB 2PE0A 4O0UA 4AGDA 1J7IA 3ZZWA 2IVVA 1JBPE 3BHYA 4TYHA 3A61A 1Y91A 3KRXA 4P7EA 4Y83A 5GJGA 4CZTA 5HNGA 2JIVA 3A7IA 5DYJA 2YIQA 3IQ7A 4GIHA 4F9WA 4UMTA 3FI3A 4V0GB 4PMTA 3QRTA 3LMGA 4IC7A 4W9XA 4E26A 3LCDA 1XH9A 3U55A 4GFGA 2ZMDA 5HHWA 4M97A 5JRSA 2BFYA 4EYMA 2ESMA 4DN5A 5CS6A 5C27A 4RVKA 3LQ3A 3GFWA 5HBJA 4O82A 4ANQA 5CX9A 5IUHA 4GKIA 3H30A 4EUTA 5EYKA 4G17A 4L01A 4KNBA 3QXOA 2BZKB 1OIQA 3L1SA 4OTPA 3D4QA 3EQPA 3RPYA 3HV3A 4WNKA 4M13A 3Q04A 2C5NA 1NA7A 4XP0A 2W9FB 1IEPA 1MRYA 2JDSA 3WIGA 4ZLYA 4BCIA 3CCNA 2XIYA 2XRUA 3C4ZA 3W2QA 2YM7A 4EHZA 4MEDA 1UVRA 5HD7A 4Y73A 1OECA 5AWMA 4LG4A 3RBWA 2GNGA 5M4CA 3R30A 4KBKA 4YZNA 5A4TA 3VS3A 1JVPP 1H8FA 3ZS5A 3PJ2A 3NNXA 3OWLA 3CSVA 2Q0BA 2FGIA 2OXXA 5J5TA 5DBXA 4AGCA 3CGOA 3QA8A 1SYKA 4QMTA 3UIUA 2BVAA 4BRXA 4DGMA 5T6KA 2UW0A 4B6LA 3CTQA 3DV3A 2C6LA 3A2CA 3DLZA 3O51A 1ZYJA 2YFXA 4K1BA 4Z55A 5BVDA 5E9EA 4FICA 4FI1A 3WILA 5CVHA 3FY0A 5CXZA 3BHVA 3C51A 4YNOA 2OWBA 4G5PA 4GS6A 3KXGA 4QNAA 2ITTA 4AX8A 2ZJWA 4IB5A 4DBNA 4JI9A 4U0IA 3BIZA 4XNEA 4IZAA 5DH3A 5D1JA 3ODYX 3VWAA 2J9MA 3TUBA 1NVQA 3OTUA 3FLYA 4QYFA 5EHLA 3UMWA 4FNXA 2ETMA 1ZMVA 2G9XA 5F4NA 3LFNA 5BVKA 5DWRA 4DH8A 3KU2A 4ZZOA 5JH6A 2EU9A 4JDIA 1ZY5A 1SMHA 5L2IA 2XB7A 2JEDA 4XYFA 1P4FA 2E2BA 3PPKA 5E8TA 3DDQA 4GYIA 5HO7A 4JR7A 4NW6A 4CFVA 3TUDA 4O81A 2F49A 2CGXA 3A7HA 4TYIA 5HIBA 2F4JA 1KE9A 2O0UA 4BDDA 4EK4A 2X0GA 2ZYBA 4PPBA 1U5QA 2C1BA 3UGCA 3U6IA 3DCVA 4PPAA 4ZOGA 2G2FA 2OF4A 2ZM4A 3MWUA 5BUEA 4Q5HA 2ZV9A 4QYHA 2R9SA 1RW8A 4DEAA 3COKA 4FNWA 4ONAA 4I6BA 1PKGA 4EWHA 3MY0A 3THBA 4GG7A 4DH3A 1BX6A 2I1MA 2VWUA 2YZAA 4ERWA 4QMXA 1YXTA 3OFMA 4ZSAA 3D83A 3DBDA 4DC2A 2VTSA 4D1ZA 3PJ3A 1E9HA 5LVNA 4IX3A 3OEFX 3DFCB 3I81A 5IUIA 4F7LA 1LEWA 3ZYAA 4C02A 4W4WA 5FTOA 3HRFA 4EOLA 4PDYA 4TNBA 3UOJA 1W0XC 2R3LA 5EKOA 2W99B 5AUZA 5DR9A 4NKAA 3TV6A 3G0FA 3FZSA 3FZRA 3NNWA 3QQGA 4OTFA 4BZOA 2PK9A 4UZHA 4A4XA 4CFFA 3PJ8A 3R1YA 3ALOA 4UXQA 3ZDIA 3N51A 4MXAA 1YOLA 4PF4A 1H4LA 4MK0A 3KRRA 4X2FA 4FIFA 5HKMA 4FIEA 4DGOA 4UMPA 3VS7A 3LHJA 5EYCA 4C4EA 4XV9A 4CKRA 3ATSA 3OT3A 4RPVA 3QRIA 3VW6A 3C4EA 3FJQE 4RZWA 4KRCA 4O2PA 2X2KA 1AGWA 3FKOA 3QKKA 4YJPA 5B0XA 3RWQA 3U9CA 2B9IA 3BYSA 2XM8A 1O9UA 3A8XA 3PIZA 4G3EA 4IM3A 4D28A 3C0IA 3L8XA 4MD9E 5HIEA 4L43A 4DG2E 4KD1A 3FDNA 4A9UA 4BKYA 5BUIA 3DBFA 3V5JA 4C59A 4D2VA 3ATTA 4IZYA 1Y8YA 3QAME 4RIYA 3V04A 4EK5A 4EYJA 5IMEA 2OKRA 1YXVA 5JSMA 4KBCA 1F3MC 4PPCA 4BZDA 2XNGA 4IXPA 2GPHA 2UZTA 3N4TA 1JAMA 1WBVA 1G3NA 4RLLA 3SGCA 4CTBA 2RFEA 3EH9A 5D41A 4YTIA 4W4VA 3CD8A 3BV3A 3PJ1A 5KHXA 1R0EA 3O50A 3PPJA 3IDCA 3R22A 4JR3A 4RVTA 5IA3A 3TZ7A 1UV5A 3DGKA 5IQAA 3MH2A 3DOGA 2FYSA 4O21A 2HENA 2VTAA 3MH1A 4F64A 4ARKA 2YJSA 4E5BA 3EL7A 1Z5MA 3DNEA 3KMWA 3VHKA 1OI9A 2XNPA 4GU6A 4I23A 4M15A 1DAYA 1OL6A 4WNOA 1IG1A 3TXOA 3G51A 1P14A 2GQGA 5DA3A 1BUHA 1BLXA 1YOMA 2YITA 4FSYA 4WNPA 4ZSEA 2CSNA 3QRKA 4KIKA 2VO7A 1XH6A 3UOKA 4LMNA 4WKQA 3JY0A 3OZ6A 5I5ZA 3R01A 3NNVA 4P5QA 3UVRA 4GSBA 3EN9A 3C4CA 2XNOA 4QMYA 3CKWA 3R04A 1M7NA 3DS6A 3PY1A 5AUWA 4FZAB 4YZDA 3G15A 3GCSA 4FL2A 4GT5A 5KMOA 4FKJA 3U4UA 4EK3A 1WBPA 3E7VA 2Y6OA 4M8TA 3SRVA 4DGNA 5EQPA 5DI1A 1UU8A 4Z9LA 2OJGA 5FP5A 3TCPA 4FTQA 4EBVA 4PMPA 5AIKA 2GCDA 5HICA 2VWYA 3VJNA 3FSFA 2Y4IB 4ZY4A 2I7QA 1BL6A 2XYUA 3MJ2A 2O3PA 3RHXA 5FXQA 4L8MA 1PF8A 2R4BA 4PWNA 5DE2A 1FOTA 3ZC6A 1WBOA 4U81A 5DVRA 1YWNA 4NJ3A 4X7QA 3W16A 2PZYA 4QNYA 5BUJA 3GC0A 4L00A 5E8VA 1ATPE 2PVYA 4R8QA 4C2WA 5DGZA 3ULZA 3QUDA 3FPMA 4ZTHA 2JKMA 3V6SA 3UG2A 4OR5A 2V0DA 3QCSA 1JPAA 1HCKA 3TL8A 2Y4PA 3R1SA 2GTMA 4LL5A 3F3WA 2X4ZA 4O7WA 3AD6A 3PRFA 4ITHA 4BTFA 3UP2A 3HZTA 4EOKA 4CXAA 4S2ZA 1Q24A 3MTFA 3B2TA 5ACBC 2CKOA 4RJ5A 4C35A 5AUTA 1L8TA 2QI8A 4ZJVA 4TWOA 4KSQA 3CIKA 3QU0A 2HW6A 3CE3A 3DB8A 3BELA 4O22A 4G5JA 1FQ1B 2IJMA 3VW8A 3E8NA 5LCKA 5EW8A 5L3AA 2UVXA 4V0GA 4WBBB 2QQ7A 4DEIA 4QRCA 4TZRA 2QD9A 2YLFA 2GDOA 3FUPA 3QWJA 4NT4A 3BYVA 3BU6A 2C3JA 3TUCA 2WEIA 2OIQA 3L9LA 4WG4A 3PVGA 3I60A 4XMOA 2W1DA 1OKYA 4HCVA 2XEZA 4F7JA 5EDPA 4J7BA 3KN5A 2WTJA 3PRIA 4BFMA 3FMLA 2YM5A 4FSMA 5AR7A 3ZTXA 4C3PA 4GK4A 4RIWA 3ORZA 4HPTE 5M53A 3P0MA 2C47A 4E6QA 3ZONA 4Y72A 3I79A 3DKCA 1ZOGA 2R3GA 2PVMA 3QGYA 2XP2A 3W18A 4EORA 2PUNA 3MVLA 2X9EA 1FVRA 3RPRA 2AC5A 1GZNA 2YERA 4M69B 3Q32A 5HCXA 5HU3A 4EZ3A 2YISA 4IDTA 4O1PA 2WMTA 4PDPA 4QTBA 1FINA 3CJGA 2X9FA 2C6MA 2QHNA 4RC4A 3L8PA 4PL3A 5LCJA 2B1PA 3PWDA 1P2AA 4GW8A 2IZRA 3CLYA 5AA9A 4LM5A 1Q8WA 4XP2A 4YSMA 4MXOA 2GS7A 1IA9A 5E8SA 2EXCX 3UOLA 2C6KA 3GU6A 4JRNA 5LMKA 5JGDA 1W83A 4BWPA 3FE3A 3LCTA 2PVHA 5F94A 3WI6A 3FMJA 1I44A 1ZXEA 5AP3A 3C5IA 5E90A 4CFXA 5LMKC 3QCXA 2EB3A 2C6EA 4BGHA 1U46A 3ORPA 1OPLA 1PXIA 1YXUA 2Z7RA 3NUAA 4CKIA 5ITAA 2C30A 3MVMA 4DF3A 2VRXA 4OW8A 1XH8A 3T9IA 4AAAA 2GHMA 5FXSA 2YIYA 5J95A 2UW3A 3DPKA 3E8CA 4D2TA 4BDJA 4QP3A 3D14A 4IAYA 5JFXA 3MFUA 3PVBA 5GNKA 2HAKA 3RINA 1YXXA 4M84A 3MY1A 4NM5A 5IEYA 3HECA 3R8MA 3OROA 4ANOA 5CVGA 4FEVA 5AA8A 2ZV7A 3MPMA 3GGFA 4H36A 5AIRA 4K8AA 4NUSA 2YA9A 5KNJA 2C0IA 2NRYA 4FV7A 2XYNA 1DAWA 4F99A 4EH9A 4QTEA 5JQ8A 3KF7A 3VC4A 1QPJA 4XS2A 4A06A 5ETIA 2PZIA 3U6JA 3UZRA 5C4LA 2CNVA 5E8WA 1YDTE 2B52A 3IW4A 1Y6BA 4CFNA 4MD7E 5HLWA 5J79A 1WAKA 3SXRA 2PTKA 4PL5A 4YZMA 4ZTQA 4FSZA 2QHMA 1F5QA 4RA5A 5AUXA 3Q5IA 4AXAA 4QPSA 3R9NA 5IU2A 3UPXA 3NZ0A 4DFUA 4FBXA 4DG0E 1QMZA 2GNHA 4P4CA 5HIDA 2GFSA 4LL0A 4YBKA 5LARA 4D5KA 5CEMA 1S9IA 2QOOA 2JDTA 4FTNA 2OK1A 3MIYA 4DFZE 2C6IA 3E62A 3P9JA 3DQWA 2WTKC 4GH2A 4R5SA 4QP4A 4NYEA 2YM8A 4LOOA 1TKIA 4F08A 1J7UA 4C8BA 3TEIA 5A46A 1UA2A 3ZRLA 2R3MA 1OPJA 4Z7GA 4USEA 5HTIA 2XJ2A 3FAAA 4W8DA 2ITVA 3QD4A 4FTRA 4R3CA 3R28A 4K2RA 3SV0A 2X8EA 3PA3A 3VUKA 5HG8A 3FLNC 4BCMA 1Q8TA 3IO7A 3P1AA 3VF8A 4O7NA 3POZA 4ZTLA 5L6WL 1OGUA 1PXKA 4BBMA 3LLTA 4OT6A 5K0KA 3UC4A 4HYHA 4NH1A 4IZ5A 5FG8A 2WMXA 4EH6A 3BWJA 2JFLA 4GMYA 5D11A 3R9OA 4BBFA 4Z7HA 4CLJA 5IDNA 4QTCA 1YVJA 3NX8A 4HOKA 4D2WA 2QURA 2XIZA 4TXCA 2CDZA 2PE1A 5CTPA 5D9HA 4JLCA 4I3ZA 4O38A 4HNIA 2JIIA 3WYYA 2A0CX 2W7XA 3BLRA 2WKMA 5TR6A 2FVDA 2RF9A 5LWMA 3QTWA 4ZSGA 4GFOA 2A19B 4DEBA 5CU0A 3RNIA 2G2HA 2F7ZE 2O63A 3AMAA 3PA4A 4PNKA 1OL1A 2GSFA 2PL0A 4YURA 5BQ0A 5CAQA 2X7FA 4D2RA 4OAVB 4QTDA 5CAPA 4CQGA 5AV2A 3TZ9A 4RG0A 4IW0A 3LXKA 3LFBA 4U6RA 3HGKA 4F7SA 2LAVA 2BKKA 1WBWA 1Q97A 2X7OA 3E64A 4RX8A 5HLNA 2HIWA 2IW8A 5LWNA 4MTAA 2JDOA 3MN3A 5AP4A 2XBJA 1IA8A 2ZDUA 3GT8A 3PUPA 4XG3A 4YTCA 2HYYA 3FQHA 3QQHA 2VTIA 2GQSA 4NK9A 3D94A 4FSWA 2I0EA 2GHGA 3MA3A 4H3QA 5D7VA 5EH0A 4HVGA 4ACHA 4FEXA 4AU8A 1CM8A 3EQGA 4AOTA 4MXCA 2JBPA 2X2MA 4AE9A 4D55A 1ERKA 3A4PA 4G16A 4PP9A 5CSWA 4Z3VA 3GBZA 1W7HA 3Q60A 4ZTRA 4M68A 3QTSA 3PLSA 5B2MA 4TKSA 2V7OA 2PU8A 4L3PA 4IWPA 2GS6A 4IACA 4F1TA 4X6QC 2B53A 4LOQA 1KWPA 3WE8A 3C4XA 2WPAA 4HGLA 4YZBA 4HNFA 5ANIA 4CFMA 5DRBA 3VN9A 5AP5A 4FV9A 4B4LA 4GG5A 4L42A 3RPOA 4ACDA 4N57A 4RFZA 3PXKA 1M52A 3KULA 4M67A 4D5HA 3ORKA 4ALUA 1ZYDA 3DKOA 4UN0C 4AA4A 4YLLA 2XKEA 5CU4A 1OUKA 4J8NA 2W1FA 4QP7A 3ZUUA 3UPZA 4M14A 5AUVA 4HGTA 1H07A 3TNHA 1BI7A 4CV9A 4IB3A 5K5NA 3CY2A 1ZY4A 4U41A 3ENHA 2WQOA 3JS2A 4O6EA 2W1ZA 4FT3A 3R73A 1IAHA 3F2NA 4AW1A 1GZ8A 3D5UA 3QUEA 2EVAA 3VO3A 1J7LA 1ZARA 3ZUTA 5C8MA 1HOWA 5HORA 4HCUA 2RSVA 2VD5A 2W05A 4FEQA 3FPQA 4BGQA 4EKKA 4F6WA 2PVJA 3A99A 3WF9A 1NY3A 1TQPA 4HGEA 1PMNA 4V01A 4L7SA 5DN3A 3UNKA 4ASEA 3VUGA 3JVSA 1OKWA 3MVHA 2XA4A 3Q4UA 4FTJA 4BDHA 4FKSA 4YO4A 3MS9A 1ZWSA 1H24A 3BYOA 5K9IA 5C01A 1I09A 4KBAA 4UMUA 3LJ1A 3TZMA 5CQUA 2O8YA 2WFYA 4XBRA 4D2PA 2WQBA 2XK4A 3SVVA 4O7VA 5DNRA 5KUPA 2J5EA 5H2UA 2VO6A 4J8MA 1A06A 4FOCA 1WMKA 3D15A 4PNIA 3R7OA 3V8TA 4D9TA 3HA6A 4B8LA 3BGPA 1Q61A 1S9JA 2ERKA 4P2KA 1J1BA 4E5WA 1PXMA 3LFCA 1YRPA 3NEWA 4K18A 4JX7A 5DHJA 4I41A 3UYTA 4RT7A 2BCJA 4AT3A 2XNNA 3HKOA 1FMKA 3GCQA 2GTNA 1B6CB 3DTCA 4QMWA 1Y8GA 1GY3A 3MV5A 3BKBA 5K3YA 5E7RA 2FO0A 3KGAA 3DJ5A 5HG5A 3EQDA 3OT8A 4K0YA 3RAWA 5FBOA 3V51A 3FLZA 2PUUA 3IGGA 4YHJA 4AT5A 1GNGA 4CVAA 2OJFE 3A7FA 3W33A 3HNGA 2QG5A 3FXZA 3SOCA 4RJ6A 3MI9A 1OUYA 4GVJA 4WA9A 3NR9A 2UZDA 4HVDA 4GJ3A 5CASA 4F6SA 3IOKA 3TZ8A 2OZAA 2UVZA 4XLIA 3VIDA 1Q8UA 4BGGA 4EQCA 4FUXA 2BKZA 5K4JA 2W4OA 3ROCA 1J3HA 4ANSA 4EOSA 3DU8A 2PWLA 3GCPA 4IFCA 4DG3E 4D4YA 5AR8A 5EKNA 3ZRMA 1JWHA 1VYWA 3ZLYA 4B9DA 3AOXA 1R78A 3NYNA 3VBYA 5KKRC 2X81A 3EQBA 2AUHA 2BAQA 3OY3A 3LMIA 3PA5A 4E4NA 4WSQA 1ZOHA 3EN5A 1ZYLA 3FI4A 4NFMA 4TY1A 4XG8A 5AADA 1YHVA 5J8IA 3SG9A 4JQ8A 2JKOA 4BCOA 5AJQA 2R64A 4JDJA 4XHKB 3FSKA 3DK3A 4GVAA 4XG9A 4X3FC 5LVPA 4DTAA 3DAEA 1H08A 2J7TA 2WMUA 3AT4A 3FI8A 3AGMA 3UZPA 4G6NA 2JDRA 4TYJA 4U5JA 4FTUA 4KS7A 4S30A 5E1EA 5DEWA 3TKUA 4DFXE 3VBQA 3DT1A 3Q52A 3FY2A 3WOWA 1M7QA 3QCQA 1PXOA 3ZDUA 3KA0A 4FL3A 3WIKA 3N4UA 2JAVA 3I6UA 2O2UA 4IWDA 4YP8A 4ANNA 4D0XA 5CF4A 2EUFB 5TE0A 1DS5A 4U97A 1GIJA 2GS2A 2IVSA 4XJ0A 4BCPA 2Z8CA 3MA6A 5ANOA 5J9ZA 2F2CB 4OBOA 2H34A 3F5GA 2HOGA 5F9EA 3VULA 4EK8A 5AR2A 3B8RA 4AW0A 1OKVA 3R2YA 2PMLX 3F5XA 4IX5A 4JX3A 4H05A 4EJ7A 2Q0NA 3PZEA 2QOHA 3MGYA 4C4JA 3JPVA 3EN6A 5H8BA 1O6YA 4S33A 4FTIA 5M56A 4PTEA 1OB3A 3OTVA 1XWSA 3WARA 4HJOA 5M55A 1PRYA 2QO9A 1OVEA 5DPVA 3W55A 4F0FA 3Q9XA 3ZH8A 3NYVA 1MRUA 5CNOA 3UOHA 1XO2B 4RFMA 5CY3A 3VBXA 4FEUA 5M57A 1UU7A 2YIWA 5EI8A 3ZFXA 4EUUA 4D1SA 2HZ0A 3R02A 2WIPA 4F9BA 5CEPA 3E3PA 4RX9A 2VU3A 4OUCA 1YI3A 2PHKA 2WU7A 3TN8A 4EL9A 3RPSA 3W10A 5GIOE 1BI8A 4RFYA 1OIUA 4ZS0A 3V5QA 2OF2A 4IAZA 3H9FA 3OOGA 5HD4A 3DLSA 3QD0A 4U79A 2OSCA 5HX6A 5T3QA 4PP7A 3R9RA 3PP0A 2BALA 3E3BX 4JG6A 4C61A 2VTTA 3U87A 3ORNA 2IW6A 1OMWA 1L3RE 1R1WA 4ALWA 3EQRA 3M2WA 3VS1A 3CR0A 1ZMWA 2GNLA 2ITYA 4J98A 4K77A 2E9OA 1IAJA 5I3OA 1KE7A 4FC0A 3T3UA 2PULA 3M1SA 2QNJA 5EFQA 5GZ8A 4FKVA 2WAJA 4K6ZA 4EEVA 5A9UA 3F2AA 3NAYA 3W2CA 2ERZE 3AT2A 5IPJA 4H1JA 4YLKA 1XR1A 1UU3A 4E6AA 3BHUA 3LQ5A 1A48A 3HVCA 4FG9A 4GK3A 1OIRA 3E5AA 4F70A 4ASZA 1UNLA 1CTPE 2QOBA 3R8LA 3W8QA 4RSSA 1P5EA 4OBPA 5IQEA 5AFVA 3EFWA 5LXMA 3P7BA 2HXLA 4BICA 2E9PA 5E8ZA 3HA8A 3GOKA 3KXHA 4IWOA 1H1SA 4RA4A 3ZM9A 2BAJA 3QYWA 3NUYA 2JKQA 4W9WA 3ZO3A 3I0OA 4IMYA 2I6LA 2X6DA 3GQIA 4KAOA 2JD5A 4RC2A 2VZ6A 5L4QA 4DAWA 1H28A 3DB6A 1ZRZA 2VUWA 2YIRA 3PXFA 4WNMA 3AC4A 2CPKE 2ITPA 3ZRKA 4MBJA 3ACJA 4I93A 2Y9QA 4WG5A 5ETAA 3R8ZA 4E93A 1GJOA 5EG3A 3ANRA 2WMVA 3AGLA 2R3FA 3BI6A 4NU1A 1LR4A 2F9GA 4WBOA 5EOBA 4FSUA 5HI2A 4JBVA 3MYGA 4RZVA 3ZSIA 5FTGA 4QYGA 4DH7A 4BY9E 4AWIA 5FEDA 4L67A 3CC6A 3OCSA 3UVPA 5CF6A 5ICPA 3PIYA 4DBXA 2CGWA 5LVLA 2BILB 2BIKB 2YM6A 2WTWA 4FE2A 3BRBA 2QKWB 4ZTMA 5HZNA 3R71A 4H58A 3W32A 4C2VA 3PP1A 5M09A 2EXMA 5CAUA 2YAAA 4AT4A 3SXFA 3LIJA 3B8QA 4DFNA 3LLAA 2YDIA 2P0CA 4RLKA 4OTIA 4BDAA 3ZEWA 3GCUA 5FBNC 3NW7A 3KMUA 4E4MA 3IW7A 4FTTA 2ETRA 3F9NA 5I4NA 3QLFA 5CQWA 3S1HA 3HMOA 4JQEA 3F5UA 4FX3A 4I6QA 4R1YA 3ZM4A 4BTMA 4C62A 2HW7A 5FM2A 4AGUA 4BYJA 3ZO2A 3ELJA 2YZLA 2Q83A 5HVYA 2QOIA 3U51A 4UX9A 5EW3A 5J9LA 4GK2A 3DFAA 3ITZA 3ZO4A 3DA6A 4M12A 3Q9ZA 3UNJA 1LUFA 2ZM3A 3VS4A 3W2SA 3PXRA 4RIXA 4XRLA 5M06A 3LM5A 4AZEA 5I0BA 5KO1A 2FA2A 3D7TB 3I7CA 2BTRA 4JXFA 1V1KA 3MDYA 3PY3A 3NUSA 4XCUA 2QODA 4QD6A 3DJ6A 5CANA 4BDCA 4Y46A 4S34A 4RBLA 4AFEA 4I6FA 5FEQA 4F9CA 3GU8A 3QD3A 1X8BA 4DEHA 5CF5A 5EDRA 3P86A 2W06A 3MIAA 5I9UA 1E1VA 5FQDC 1IRKA 5JT2A 3ROYA 3V8SA 4Y8DA 1J1CA 2J0LA 4BHZA 5F95A 1WBTA 3KK8A 3O8PA 2ACXA 1V0OA 3K5VA 1UKIA 2IWIA 2ZAZA 3OS3A 3CY3A 3GC8A 4XG2A 5AEPA 4BWKA 2BFXA 3G6GA 4EH2A 5KMJA 1OIYA 5ETFA 3TNPC 2DUVA 3ZMMA 4A9RA 5EHYA 4EKLA 4X2NA 4L3JA 4E1ZA 4BCNA 1WBSA 1O6KA 4R6VA 3LAUA 5CSXA 2HY81 2UV2A 5HG9A 4FT5A 5JRQA 3VBWA 5CNNA 4FV6A 4L6QA 3FC1X 4D4SA 2XVDA 5M51A 3GFEA 4FV5A 4EOMA 5BNJA 5CSPA 4HZRA 1G5SA 4PTGA 3FMEA 4Q9SA 5FUTA 2UZUE 2CN5A 4B7TA 4F65A 3IW6A 3SG8A 2BRNA 3NWWA 2ZDTA 3PG1A 2C1AA 1STCE 5HCZA 1JSVA 2QR8A 3TJCA 3GUBA 5L2TA 2XEYA 3F2RA 3EQCA 2ETKA 2V55A 4ZTNA 5ANEA 2WTDA 3IGOA 3BZ3A 3R1QA 4XOZA 4YTHA 2XNBA 5AAGA 4OTDA 2J0MB 3GEQA 3HUCA 5CI6A 5KHWA 2VTMA 4P90A 1NT2A 5IQDA 4FOBA 4JVGA 4ZSLA 4MNEB 3BEAA 4BYIA 5HNIX 1Q5KA 5CEOA 2PVLA 4LFIA 5BVWA 3C50A 4RWJA 3VJOA 2QU5A 4I0TA 2ZV8A 3QALE 4UWCA 4U45A 5HE3A 4XOYA 5IMXA 3SQQA 3O8TA 4I6HA 3F69A 4X6RA 4BKJA 5CT7A 2CGUA 4RQVA 4UZDA 3UO5A 5DT0A 3T9TA 2NPQA 3FQSA 4YO6A 4NTSA 3BE2A 2XUUA 4Q5EA 4RWIA 5JZNA 3VUHA 4BVUA 3TACA 2WNTA 3OUNB 4ITIA 5I9YA 4L3LA 1XH5A 4G2FA 1JSTA 4G9CA 4DH1A 4LUEA 1AD5A 4ACCA 1JOWB 2C6DA 4WSYA 3S2PA 4ANBA 2P2IA 5L8KA 5ANGA 3R7EA 4J96A 5J7HA 3BE9A 3OHTA 3QTRA 3LOKA 3PIXA 5JZJA 3O23A 5D12A 1ZYSA 4JNWA 1BMKA 3EFJA 3NYXA 3DK7A 1V0BA 5CXHA 4FKIA 5FXRA 5I9XA 5I9ZA 3I0QA 3BLQA 3BQRA 3GQLA 4PY1A 1M2QA 3MW1A 2J2IB 3UO4A 3LW0A 3HDNA 3R7VA 2VGPA 2C68A 3CTHA 3GB2A 3ULIA 3V5WA 3QQJA 5DOSA 2WHBA 3PE1A 1BL7A 1PMVA 4E5AX 5KMMA 3O96A 4QT1A 2VNWA 2EWAA 2PMOX 1DI9A 3OCBA 4FV8A 4AN3A 4AZTA 2BZHB 5B2LA 1PKDA 1XH7A 3RI1A 2F7XE 3WZKA 2ITQA 3HV6A 3R6XA 3MTLA 4DT8A 1W98A 5J1WA 3KKVA 1DM2A 3SD0A 4MF0A 4CMUA 1OKZA 4ACMA 4FT9A 4F63A 3OOMA 4QPMA 4FV1A 1UU9A 2UZLA 3VRZA 2BDFA 4FKTA 5EQYA 2FSOX 4KWPA 4AZWA 3IONA 4MVFA 1MRVA 5LOHA 3FL5A 2CLXA 2R2PA 5IDPA 2WIHA 3D0EA 2R3RA 4IWQA 3JY9A 4QMOA 3HLLA 3R21A 4BTKA 4MYGA 2WOTA 4FG7A 3DXNA 4AOIA 2OLCA 3AC5A 3LXNA 4JL9A 3OXTA 1Q62A 2PSQA 3Q96A 4WHZA 1FVVA 4FKWA 1M17A 3EFLA 3G5DA 5HEZA 3R8UA 4YZ9A 4QQCA 3CS9A 5TT7A 1Q8ZA 4HZSA 4AFJA 4MCVA 3EFKA 4N6ZA 3QZFA 3DKGA 2J6MA 2JKKA 2ZMCA 3KN6A 2YJRA 4O0WA 4U9AA 5IG1A 5EM7A 5BVOA 3FLWA 3DBEA 3NVKI 3NPCA 1K9AA 5GHVA 2XS0A 3DAJA 4CRLA 1YWVA 2NNWB 3RAIA 4ZAUA 4JBOA 4AG8A 1W8CA 4RWLA 3TV7A 2ZB0A 4S32A 2Z02A 2ITZA 4JG8A 4RGJA 3E8EA 4FKOA 3LM0A 4MXZA 4HVSA 5KKRB 3QQKA 4NSTA 2VTLA 5IEVA 5AM7A 3CKXA 3OW4A 2V7AA 4BCQA 4NCTA 3ZFYA 1H1RA 4IX4A 3AMBA 1U4DA 5CU6A 2C5OA 3CXWA 3UC3A 3F61A 4I4FA 5LJJA 3OD6X 3E7OA 4JAJA 4J53A 4JIKA 4AUAA 4O7YA 5I9VA 4DFLA 4JQ7A 5IQFA 5IA2A 2P33A 3CEKA 4X3JA 4ITJA 4CYJA 2RIOA 4DHFA 2OJ9A 3TTIA 4ZZNA 2JFMA 5AAEA 1ZMUA 3GU4A 2BRBA 3H10A 2PY3A 4FR4A 4YJTA 4C36A 2OI4X 3NUUA 3NLBA 4C0TA 2I40A 3R8PA 3FZOA 5BYLA 3SAYA 3SOAA 2UUEA 3E87A 3ZLXA 1XJDA 5TKDA 4MD8E 2BRMA 2JLDA 2GNJA 4G3DA 3TTJA 3UNZA 3NDMA 4X2KA 1FBNA 4OTRA 4AZSA 2ITUA 1RQQA 3QX4A 2FH9A 1KE6A 4MAOA 2QOCA 3QF9A 5GINE 4PV0A 3GU5A 4C37A 5AMNA 4FODA 3NYOA 5HBEA 4TYHB 4U40A 4IADA 4FUYA 4DTKA 3Q4ZA 5CU2A 3G90X 3NAXA 4NTTA 4AZVA 2QOFA 3FI2A 3HRBA 4EC9A 4LRJA 5HVKA 2PZRA 4TYEA 3F3UA 4ALVA 3KEXA 3MB7A 2RGPA 4KIPA 5EYDA 1V0PA 1DI8A 4G34A 4R7IA 3L9PA 2Z7SA 4AZFA 2XK9A 4CRSA 5J7BA 3VQHA 4CGAA 4K33A 3BWFA 5CU3A 1Q3WA 4QYEA 4FKPA 2J51A 2UW5A 2X8DA 3DDPA 1UNHA 3OCGA 3FV8A 3AXWA 3HRCA 4IDVA 3FZPA 3P7CA 4JRVA 4FVRA 4WOVA 3NRMA 2UZNA 3BLHA 4C38A 3OVVA 2NO3A 3EN7A 2XF0A 2PE2A 3EQIA 3LJ2A 3V5LA 2QOKA 2OBJA 4PTCA 4QMZA 4D2SA 2XNEA 2B4SB 5C4KA 1WVXA 2YCFA 5AUYA 4BDKA 1W84A 2UZEA 3OEZA 4YHFA 4USFA 3H3CA 2YM4A 3AC1A 3QTIA 3LKMA 3OUKA 3KXZA 3Q53A 4IH8A 2WMRA 3P08A 4DFBA 1H0VA 1JKKA 2C4GA 4FVQA 4EOQA 5AR3A 5HTCA 4IB0A 2X4FA 3CD3A 3QTXA 4BN1A 2H9VA 3NS9A 5CVFA 3A60A 4C4IA 5L2WA 2J0IA 1GOLA 3A8WA 1BYGA 2O64A 1NVSA 3FXWA 4HYUA 3Q2MA 5CLPA 2HXQA 5GIPE 1Z57A 4IAKA 3Q3BA 4ZMEA 2XM9A 2B54A 4FT0A 2RFDA 3PG3A 2F7EE 2CLQA 3F82A 3ALNA 4GFMA 4AGWA 2WELA 4Q2AA 1VEBA 4AS0A 4CYIA 4RVMA 5FWKK 3VHEA 5BVFA 4C4HA 3F6XA 2PUPA 3Q4TA 4TRLA 1Y57A 3SX9A 4NJDA 4QMNA 5IH4A 3IKAA 3OXIA 3ZZEA 5CENA 5M4IA 2W5HA 3TNQB 3UIBA 4AA0A 3FMKA 5HOAA 3UQCA 5IA1A 3OBGA 5A3XA 1WVYA 4I22A 3NUPA 2Z60A 2HELA 4EWQA 5AR5A 2C3IB 2C3KA 1H1WA 3E93A 3VUMA 4FA2A 3Q9WA 1Q99A 2WXVA 3R7GA 3ZOSA 3PE2A 2R0UA 4I5MA 4LGDA 3QD2B 4XV1A 4XX9A 2W5BA 2JDVA 4RRVA 2HY0A 3QRUA 2J4ZA 2QC6A 2PVRA 2WQEA 2W1CA 4MNEA 4EH8A 4O7LA 2R3KA 4EOIA 2OW3A 3DK6A 3NVMB 4L7FA 2YDJA 2IN6A 4MBIA 2YABA 2VX1A 1OZ1A 3P23A 4MWIA 4I0RA 2DWBA 2PUIA 2ITOA 3NSZA 3FLQA 3HV5A 2Z7QA 4LMUA 2PVFA 3LPBA 3LXLA 3VUTA 2Y8OA 2HWPA 2W4KA 4YNEA 2BZJA 4ASDA 2C5XA 3LFSA 3ZUVA 2VV9A 4YJSA 2IVUA 1U59A 2VTOA 1SNXA 5AM6A 3U4WA 4IM2A 5HGIA 2C3LA 4IAFA 4IE9A 4XP3A 4BC6A 5IUGA 4BZNA 2X2LA 3MVJA 3SW4A 3BBWA 4JAIA 4QYYA 3UJGA 4DE4A 2QR7A 4E20A 3R2BA 3S00A 3OF0A 3V8WA 5BYZA 3GXLA 4H39A 5K5XA 2OICA 5CF8A 3IW8A 2QO7A 4ZK5A 3RP9A 3GP0A 1P4OA 3FZTA 3ZO1A 5G1XA 4PDSA 1ZAOA 5JK3A 4I94A 2OIBA 2FUMA 4N4SA 4Z16A 4E73A 3RM6A 2VWIA 2PVNA 4AOJA 5FGKA 3P78A 1Q3DA 3LFDA 4J1RA 4BCHA 4DYMA 4CZYB 3QRJA 3FQEA 5DT4A 3RWPA 2R3HA 4DT9A 3QX2A 3ENMA 4BWXA 2JITA 1SVGA 2OFVA 4O91A 5AP2A 5TF9A 4I4EA 4RX7A 5E1SA 3II5A 3RCDA 4BTJA 1BKXA 2R3IA 4C3RA 4CFWA 3IOPA 4F0IA 4J95A 3BHTA 1QPEA 5AV3A 5BVEA 4BCFA 3EHAA 4G3FA 4I21A 4YC8A 5LMAA 4ZY6A 1SVEA 2XK3A 3ZCLA 4A9SA 1ZZ2A 1VR2A 3TIZA 3FEGA 4UALA 3QYZA 5AP0A 4FTOA 4ZEGA 3FL4A 4BDFA 4NIFB 4IZ7A 4P5ZA 4XLVA 4M69A 1CKJA 1XHAA 3EZRA 4QMLA 3RHKA 1ZZLA 4CD0A 3FC2A 5H8EA 3QCYA 2IW9A 4C4FA 1UWJA 1YQJA 3C13A 1PXJA 3HX4A 4G9RA 4ANLA 3FMDA 4FEWA 3DBCA 4R3RA 4O0TA 3PPZA 1SVHA 2R5TA 3BYUA 2PMNX 3BHHA 1Y6AA 3VRYA 1KUTA 3TDVA 4NWMA 3OWJA 3TJDA 3MBLA 3IK3A 2A1AB 3KXMA 4LQMA 2R3JA 4LV8A 5AP1A 4YJQA 1JSUA 2WTIA 1YDSE 3A4OX 3WF5A 4MNFA 5KMKA 4YC3A 4O7RA 4EBWA 1PJKA 2B9FA 3V5PA 5L6PA 3HMPA 4QMSA 3RZBA 4DTBA 4WG3A 1M14A 4IAAA 4AN2A 2G1TA 3C4FA 3H0ZA 2YAKA 1REJA 3HDMA 3KRWA 4PMSA 4RC3A 4YBJA 4ZTSA 4AW5A 1OBDA 3GC7A 4I24A 3PJCA 3QQUA 4JBPA 5EI6A 5A14A 3W2PA 4EK6A 2BMCA 3K5UA 3QHRA 3H4JA 4ZY5A 4E4LA 5BYYA 5KCVA 3HYHA 2VAGA 3CQEA 4YPDA 2ZB1A 4X0MA 1Z9XA 5IISA 3MFSA 2KULA 3MJ1A 4V04A 4EH5A 4UV0A 4TWNA 3PXYA 2H6DA 3GENA 3UQGA 1H25A 4ZP5A 4L44A 4U7ZA 3OXZA 2FSMX 3AT3A 3PDTA 5TOZA 2XJ0A 2E9UA 4GKHA 4CKJA 5JN2A 3UO6A 1IASA 4U44A 2PPQA 2RG5A 3QXPA 3ORLA 3P5KA 1YDRE 3OWKA 4N70A 5CEKA 5M4UA 4U80A 5F20A 2C5YA 3P7AA 3EIDA 5CALA 4D0WA 3BYMA 3LQ8A 4K11A 3EYHA 2EB2A 4YJRA 4U43A 4FKGA 4UY9A 4EQUA 5DLSA 2J50A 4YJVA 4ZJJA 5CEIA 2GFCA 4LGHA 3UP7A 4FTKA 2WGJA 3BV2A 3EKKA 3BPRA 2O5KA 4EH3A 4KINA 2FSTX 4ZJIA 2WMQA 2W96B 3QQFA 1CSNA 4DCAA 3R9DA 4V05A 3ACKA 1H0WA 3RGFA 4EH7A 5M08A 2QKRA 2YCRA 4M7IA 4TPTA 5GZ9A 3ZXTA 4ZLZA 3DZOA 3JYAA 2W0JA 3ZSHA 4AW2A 2B7AA 2GNIA 4FV3A 4LYNA 5GZAA 2YWPA 5EDQA 1R0PA 4XG4A 1LEZA 5HE0A 4B8MA 1PYEA 3QHWA 1GIHA 1FGKA 3K54A 4FKQA 5IKWA 3JR1A 4E6DA 4FNYA 4FV4A 2BRHA 5FD2A 5AP6A 3TDWA 1UNGA 2C5VA 3RNYA 2QOQA 4DLJA 1H26A 2R3NA 3S0OA 3JXWA 4H3PA 2GHLA 4HW7A 1Q41A 3EN4A 3ZU7A 3V6RA 2F57A 4R7HA 4DFYA 4GV1A 2C0TA 1OITA 4CQEA 5K4IA 3FMHA 4JDHA 5EQEA 1XBAA 2VTNA 3CJFA 3VF9A 3ANQA 1CKIA 4RIWB 1URWA 1GIIA 4OBQA 2VTJA 5L8JA 5CAVA 4OTQA 3NUXA 3RK7A 3S3IA 4Y5QA 4DA5A 3HL7A 4G1WA 3HMMA 4BCJA 4CLIA 2RKUA 2WMBA 1SZMA 5LQFA 3HMIA 3KVWA 1RE8A 1NW1A 1NXKA 4HGSA 1WFCA 3QLGA 3QBNA 4TT7A 4YJUA 1QCFA 3NNUA 3EB0A 5HE2A 4F6UA 2WMSA 4IX6A 3O17A 2V5QA 3FLSA 4CZUA 4QMUA 1TQMA 4QO9A 4FNZA 4G31A 5LVOA 1Q8YA 2VX0A 2VWXA 4CT2A 3RCJA 2BAKA 4F7NA 5KBQA 2V62A 3RTPA 4I0SA 4L68A 2HZIA 2H96A 5AV4A 4W4XA 4QTAA 4O83A 3RJCA 4QQTA 3D5VA 5DG5A 1KE8A 1RDQE 1O6LA 4QQJA 1KV1A 5EK7A 4C57A 3KRJA 4IQ6A 4X21A 3PFQA 1B39A 2I0YA 4XEYA 4E3CA 3UDBA 3PSCA 4IVDA 5AV1A 2OJJA 4JOAA 3TKIA 3R9HA 4TYGA 3TNWA 5D7AA 5IH6A 4U3ZA 4IC8A 5CSVA 3D5XA 3OBJA 2IG7A 5FDXA 2BTSA 1OM1A 4MF1A 3ZC5A 1H27A 2OH4A 3FKNA 3UBDA 1YHWA 3BU3A 5DR6A 1U5RA 5CWZA 4OTHA 3PVUA 4PQNA 2A2AA 3UIMA 3R8VA 5BVNA 3QL8A 1OL2A 4YC6A 5JMSA 4NEUA 4AA5A 4EH4A 2W1GA 3D2KA 3OWPA 3CPBA 3EOCA 3F3ZA 2RL5A 4J97A 4YU2A 3SA0A 3N4VA 5IQBA 3C1XA 3BEGA 4MXXA 3GCVA 2HWOA 3QKMA 4BCGA 2YM3A 4EHEA 3COMA 2XRWA 1IR3A 4GEOA 3KQ7A 4EZ7A 3A7GA 4IJPA 2J5FA 2QLQA 5E8YA 2J0JA 4FMQA 4XG7A 4A4OA 4ACGA 4FYOA 3RKBA 2ONLA 3AD5A 3N9XA 3VS2A 1U54B 5I9WA 3C7QA 3DY7A 5A6NA 4G6OA 5IA0A 4LUDA 2YWVA 5FDPA 2VO3A 3KF4A 3AG9A 5G6VA 1FPUA 2XK6A 4RJ4A 2ONLC 3DTWA 2R0IA 1TVOA 3DQXA 3Q5ZA 5K0XA 4E4XA 4II5A 4FL1A 5DEYA 1PXNA 5DT3A 4NM0A 4EJNA 4Y95A 2ITXA 4BL1A 3CQWA 3DXQA 2LGCA 2J90A 4XV3A 1F0QA 2IZTA 2WO6A 2WTKB 2WQNA 4AP7A 4F0GA 2PMIA 4M0ZA 4YGAA 3VBVA 1G8SA 3FXXA 4AE6A 1HCLA 2WQMA 2FB8A 4FK3A 4MKCA 5ANJA 3UODA 3IDBA 2BZIB 4FSRA 5HTBA 5B2KA 3ETAA 3ZLWA 3R7IA 3LZBA 2JAMA 1M2PA 4FZFB 4HCTA 1YWRA 4L9IA 2WMAA 1B38A 1UKHA 1LP4A 4FKUA 3D5WA 3VNTA 4YJNA 1YW2A 4WRGA 3S4QA 4NKSA 2UW4A 5A54A 5B7VA 4J99A 1CKPA 3I4BA 5FRIA 2P55A 4F9YA 4R78A 3MH3A 4XUFA 4GUBA 2JBOA 4DEEA 3KMMA 1VZOA 3U8WA 5CT0A 3FYJX 3VUIA 4L53A 2BPMA 2CMWA 4TNDA 2XKFA 4YZCA 5JFSA 2WZJA 2XMYA 1JKLA 3COHA 3PWYA 2RFNA 2UW8A 1SNUA 5HESA 4NIFA 5J9YA 3DKFA 3U9NA 5DFPA 4CFUA 4YSJA 4A07A 4QMMA 4ZZMA 4EQMA 2XIXA 4YMJA 4U8ZA 4MWHA 3VUDA 4B99A 2Z7LA 2RFSA 5C1QB 4DEGA 3O8UA 4CSVA 4QMVA 2VO0A 3KY2A 5IF1A 3IG7A
chains in the Genus database with same CATH superfamily
2Z2WA 4FSNA 4FTLA 3RZFA 4IVBA 4R77A 2C0OA 4C7TA 1REKA 3NCGA 3SXSA 4AN9A 4W4YA 4LRKA 4ID7A 4MH7A 4DLIA 3PYYA 4USDA 1XMMA 2P4IA 3DNDA 4FIJA 5KZIA 2XCKA 4WIHA 2XZSA 4OT5A 3RAHA 4BDGA 3K2LA 4XG6A 4ZLOA 5AP7A 2OIDA 3NW5A 5LVMA 3G9NA 3R63A 4FV2A 4EONA 4L45A 3C0GA 3DBQA 3BQCA 4O4DA 2WB8A 3FWQA 4JS8A 3FHIA 4O1OA 3LCSA 4ZIMA 3QWKA 3MY5A 5D10A 4X2JA 3TWJA 4YLJA 4DCEA 3EYGA 3QFVA 4LRMA 1G8AA 3OY1A 3GVUA 4WRSA 3S95A 5M07A 1PHKA 2XK8A 1SM2A 1WZYA 2QONA 3SHEA 3DZQA 3H9OA 5E91A 4APPA 3BL9A 1JQHA 1M2RA 1QL6A 3OCTA 1T46A 4RX5A 2QU6A 4R7BA 2CGVA 3B2WA 4WO5A 3K3IA 5HG7A 3UTOA 3GC9A 4CTCA 4JG7A 4GUEA 3U54A 3KULB 3PLAE 1MQ4A 3HEGA 4M0YA 1GZKA 2I0VA 3CQUA 1OPKA 3LJ0A 2CKQA 3MPAA 4APCA 3F7ZA 2QCSA 3BU5A 2CKPA 4FVPA 3F66A 4OGRA 3LMHA 1PMUA 3DAKA 2YCSA 3PSBA 2JC6A 4GCJA 4NM3A 5HO6A 3G6HA 4WT6A 3EQFA 3NIEA 3JVRA 3PTGA 1WBNA 2WD1A 3TI1A 5J1VA 4NW5A 2FSLX 4R5YA 4EC8A 5L8LA 3RM7A 4O7SA 3W0MA 2WU6A 2X1NA 4ZS4A 5CEQA 4GIIA 4D58A 4UXLA 4FIGA 4FTMA 2JIUA 5EW9A 3KVXA 3VS6A 2RG6A 2VTRA 4KKHA 5IH5A 1KE5A 3V5TA 4M3QA 5HNBA 3TKHA 3QTQA 4C4GA 2OGVA 5J87A 3FMNA 3SDJA 3WE4A 4PUZA 2OU7A 3O7LB 3ORIA 5AV0A 4KRDA 3Q4CA 2UZOA 3IW5A 5EM6A 2GMXA 2P3GX 4E7WA 5L6OA 2VWVA 3KCFA 4R3PA 3T3VA 4ANMA 3TNIA 3C9WA 4L46A 2AYPA 1PXLA 2BHEA 1AQ1A 2PZPA 4BDBA 3D7ZA 3RVGA 5GJFA 5EI2A 3BBTB 5L2QA 4EOOA 2CKEA 2VGOA 4L52A 4MQ1A 2ITNA 1W2CA 5DMZA 5E92A 4D9UA 1NVRA 2CCHA 2XKCA 3Q2JA 4IFGA 4C3FA 4WUAA 4GT3A 4C33A 3TM0A 1KOBA 4O0XA 4CG9A 3CPCA 2YLEA 5KZ0A 2A4LA 2E9VA 3VQUA 2VTHA 3R00A 3SC1A 1ZLTA 2HK5A 1UWHA 4CMTA 4IVAA 3PXQA 3I1AA 5TO8A 2CCIA 3UG1A 4EI4A 1R39A 5E8UA 3AKLA 3PSDA 5IQIA 3QZIA 3NFGB 3AD4A 2VTQA 3ET7A 3NMUF 1QPCA 2ITWA 2XH5A 2XKDA 1YXSA 2X7GA 3ZLSA 2G15A 5FM3A 5EM8A 2NRUA 3GI3A 2W1HA 4EOJA 5IEXA 4RMZA 2OZAB 2UZBA 2VWBA 3G2FA 3QTZA 4TL0A 3Q9YA 2XBAA 4O96A 4ORKA 1RJBA 3I5ZA 3RALA 3WBLA 4S31A 3WYXA 3AC2A 3IDPA 5CI7A 4BI1A 4X2GA 2E9NA 2WMWA 4FG8A 4DITA 4FZDB 4XBUA 2IVTA 2OG8A 5CZHA 1YI6A 3ODZX 1K2PA 3LFQA 5AR4A 5FP6A 1VJYA 5JKGA 5IZFA 4FKLA 3P79A 1PW2A 4NM7A 4RWKA 4OTGA 3BX5A 1XQZA 4O2ZA 3F88A 3RMFA 3OC1A 3POOA 4NCTC 4KIQA 4QQ5A 3ZSGA 3E8DA 3QUPA 4I5PA 4PMMA 3C4WA 3TG1A 4X3FB 4UYAA 2G01A 3E63A 4FV0A 4H1MA 4OTWA 3EL8A 3MPTA 3QC4A 4I5HA 5HCYA 4B0GA 4YTFA 5T68A 4ENYA 2BIYA 4GL9A 5C03A 2QLUA 1MUOA 4BKZA 3LFAA 4QP1A 2X6EA 4PDOA 3EZVA 1ZOEA 5HBHA 4KKGA 3REPA 1VYZA 5KX8A 3U6HA 3VONA 5A6OA 3D2IA 3KXNA 5GJDA 2W17A 4TN6A 5HLPA 3R83A 4A9TA 2PYWA 4GJ2A 5IQCA 4QP8A 5CSHA 1H01A 3W1FA 3F3TA 2WOUA 4FTAA 2OXYA 3I7BA 3RPVA 3HMNA 4AQCA 4OLIA 4I92A 3QKLA 4EZ5A 4NL0A 2Y0AA 1QPDA 2B9HA 4UBAA 3FYKX 3K3JA 4E8AA 3L9MA 2H8HA 4DINA 3MSSA 5JQ5A 2UVYA 1U54A 2BDWA 2CHLA 4O86A 4UMRA 3Q6UA 2R3PA 2BROA 4BIEA 1GAGA 2XJ1A 5E8XA 4GT4A 1JLUE 3P4KA 3EKNA 3F5PA 2BR1A 3LVPA 2VNYA 5H3QA 2PZ5A 4CEGA 2BUJA 1FVTA 3AQVA 3ORTA 1KOAA 2ZM1A 4FYNA 4FIIA 5AUUA 4HYSA 4KABA 3PY0A 4G3GA 4CG8A 1R3CA 5A4LA 2V22A 4FZ7A 4RIOA 3UQFA 4UMQA 5JFWA 5DIAA 1ND4A 3ID6C 3UZTA 1EH4A 3NGAA 4GYGA 4IAIA 2XIRA 4IHPA 5EHOA 4ERKA 4OAUC 2X0OA 3LXPA 3ORXA 4UB7A 3UMXA 2ZVAA 5IA4A 2B9JA 1YI4A 3OG7A 2F2UA 4ZXTA 4KS8A 4F09A 1Q4LA 4YJOA 2DS1A 4I1ZA 3QQLA 2C69A 3C0HA 4RVLA 3AC8A 5ANDA 4LOPA 4R1VA 1J91A 2I0HA 3ZBXA 3D7TA 4KA3A 3QGWA 1XBCA 3OMVA 2YEXA 5AAFA 4RJ3A 4BDEA 3G9LX 4XRJA 5IQHA 4F4PA 4QP6A 5BMMA 3HAVA 1H00A 3G33A 5H8GA 3GU7A 2XCHA 5FEEA 3OW3A 5EYMA 3T8OA 5HO8A 2C6TA 4JBQA 4MX9A 3VBTA 4DEDA 2C6OA 2R7BA 1KSWA 4BB4A 4MHAA 2IF8A 5E4HA 4FK6A 4UWBA 3GNIB 2W1EA 4RJ8A 4BIDA 4FSQA 2B0QA 1E1XA 4K9YA 3BCEA 3ORMA 5L2SA 3VS0A 2BDJA 3I6WA 5C8NA 5A4QA 5KMLA 2P2HA 4N6YA 4Q9ZA 3WF8A 4O7TA 4BR3A 3VAPA 2WEVA 3H0YA 2W4JA 2JGZA 4HVHA 4O0SA 2J0KA 1PMEA 1MP8A 4HPUE 4IEBA 4F9AA 3KCKA 5ANKA 3KC3A 3E92A 2CN8A 3AMYA 4O0RA 4I20A 2AC3A 4PRJA 4O84A 2GU8A 2X39A 3QA0A 4GU9A 4D4VA 3JUHA 4FZ6A 4KIOA 2VX3A 2BRGA 2CJMA 5C26A 3L8SA 3V01A 3G0EA 3EWHA 2Y6MA 2OXDA 3LCOA 5JFVA 5KE0A 2W1IA 4XH6A 3ZBFA 2HZNA 2DQ7X 3NUNA 4U42A 4BCKA 3DJ7A 3QZHA 3NW6A 4F1MA 2OO8X 3L9NA 4FSTA 5KMNA 5AX9A 4FGRA 3SLSA 3HUBA 1WVWA 4TW9A 3P5JC 4XV2A 2SRCA 2HZ4A 2Y4IC 3AC3A 5A4CA 1PYXA 5C8KA 5FLFA 1KV2A 1H1PA 3NIZA 3QZGA 1A9UA 2REIA 3HP5A 3R7UA 4BI2A 5AX3A 2QO2A 5JGAA 4J52A 2W9ZB 1VLRA 4QMQA 3A7JA 4QPAA 4O6LA 5CAOA 4EOPA 3MFRA 1YKRA 1CMKE 2EXEA 5HX8A 4U3YA 5KMIA 4TWPA 4UWYA 3FZ1A 4HYIA 3R7YA 3D9VA 4G3CA 3QTUA 3KFAA 5C9CA 4NZWB 3E88A 3HP2A 3EJ1A 4CCUA 4D4RA 3W0QA 3PXZA 3CP9A 1OL5A 2YHVA 1XBBA 2YIXA 3OP5A 4FGBA 4Y85A 3A62A 5KBRA 4KUJA 3KB7A 3H9RA 2GNFA 3O7LD 3IECA 3PZHA 2YN8A 5EM5A 2GQRA 3FBVA 2IPXA 4MQ2A 4UEUA 1PXPA 4YUQA 5ACKA 5HVJA 3RK5A 3TIYA 1ZYCA 2KTYA 3O2MA 4LV5A 4A9YA 4FF8A 3COIA 4F1OA 4CNHA 4JT3A 2PVKA 3HV4A 4IIRA 4LGGA 4WD5A 3SW7A 3KREA 4O7ZA 2UZWE 3UIXA 4WUNA 3FMMA 4CCBA 3NCZA 4FKRA 5IA5A 4BDIA 1G8KA 5BV3A 5FTQA 3W0PA 2CNQA 4RJ7A 4D1XA 3UVQA 2VWZA 1PY5A 3ZEPA 4CT1A 4AF3A 2XIKA 5BPYA 2UW7A 3FHRA 4O27B 4BIBA 2OJIA 3CTJA 3SKCA 5DR2A 4IVCA 4HVIA 5I3RA 2CNUA 2NYAA 2QVSE 2VWWA 5BMSA 4KKEA 1FMOE 2B55A 3DXPA 1YHSA 2YDKA 4RIXB 3LE6A 4KSPA 2VTPA 1JNKA 2VN9A 4QP9A 3R1NA 2YACA 5HQ0A 4RIYB 3LCKA 4KB8A 5ETCA 2DYLA 5JEBA 4Y5HA 1APME 3BGQA 3CGFA 5JGBA 2A27A 4JJRA 3R0TA 2QOLA 3PFYA 4JIAA 4DH5A 3M42A 4FIHA 1YOJA 2WTCA 3ZHPC 4QMPA 3WF6A 4QP2A 4NFNA 4PX6A 4BBEA 3BL7A 2IZUA 2IZSA 2R3QA 2ZV2A 3RAKA 3PVWA 2NP8A 4I5CA 5BX0A 3KK9A 2R7IA 3GOPA 4W8EA 1T45A 5H9BA 3IS5A 4YPSA 3W2OA 4BHNA 4PL4A 5M44A 4O0YA 5J5SA 4TWCA 3KL8A 3UE4A 1CDKA 4ASXA 5HU9A 5LMBA 3FKLA 3ERKA 4A4LA 4FJVA 4N0SA 3BGZA 3MFTA 3MH0A 4IB1A 4H3BA 3VVHA 4KIKB 2O65A 4A7CA 4ZMFA 1URCA 3O0GA 4BF2A 4C58A 4MBLA 2OH0E 2Y7JA 4O0VA 4GRBA 3WF7A 4CV8A 2UW6A 4EHVA 3EQHA 3UYSA 3L8VA 1XH4A 2IO6A 4UYNA 4YR8A 3ZXZA 4EHGA 5DRDA 4LI5A 1K3AA 2X8IA 3M11A 3MB6A 5CZIA 4IJ9A 4J71A 1XKKA 3ZFMA 3F7WA 3RK9A 4FT7A 3SRVB 3V3VA 3HV7A 3KRLA 5CYIA 2G2IA 4G6LA 3O71A 3KXXA 2BHHA 3EMGA 3QC9A 3LFFA 3TT0A 3F3VA 1H1QA 2HCKA 5EOLA 3WZUA 1GZOA 4MXYA 1MQBA 4O4FA 3CBLA 4RQKA 3C5UA 5A4EA 3LFEA 1OBGA 4IANA 5IQGA 4X3FA 4E6CA 3W2RA 2WTVA 4FTCA 5HE1A 3Q6WA 2XK7A 2OFUA 2XNMA 4AACA 2QG7A 4IBMA 4C34A 3IPHA 2ZFYA 3TV4A 3WZDA 3WZJA 4BI0A 3WZEA 1TQIA 4YHTA 4M66A 5M4FA 4ZSJA 2W5AA 3I5NA 4JDKA 1JKSA 4CMOA 1FGIA 3W0SA 4ENXA 5F1ZA 1WCCA 3VS5A 1JKTA 1W82A 1OL7A 4DGGA 4QOXA 2OZOA 2UZVA 4IM0A 3W8LA 2YCQA 4DGLC 1LPUA 2R3OA 2ZOQA 2UW9A 3MESA 4TTHB 2PE0A 4O0UA 4AGDA 1J7IA 3ZZWA 2IVVA 1JBPE 3BHYA 4TYHA 3A61A 1Y91A 3KRXA 4P7EA 4Y83A 5GJGA 4CZTA 5HNGA 2JIVA 3A7IA 5DYJA 2YIQA 3IQ7A 4GIHA 4F9WA 4UMTA 3FI3A 4V0GB 4PMTA 3QRTA 3LMGA 4IC7A 4W9XA 4E26A 3LCDA 1XH9A 3U55A 4GFGA 2ZMDA 5HHWA 4M97A 5JRSA 2BFYA 4EYMA 2ESMA 4DN5A 5CS6A 5C27A 4RVKA 3LQ3A 3GFWA 5HBJA 4O82A 4ANQA 5CX9A 5IUHA 4GKIA 3H30A 4EUTA 5EYKA 4G17A 4L01A 4KNBA 3QXOA 2BZKB 1OIQA 3L1SA 4OTPA 3D4QA 3EQPA 3RPYA 3HV3A 4WNKA 4M13A 3Q04A 2C5NA 1NA7A 4XP0A 2W9FB 1IEPA 1MRYA 2JDSA 3WIGA 4ZLYA 4BCIA 3CCNA 2XIYA 2XRUA 3C4ZA 3W2QA 2YM7A 4EHZA 4MEDA 1UVRA 5HD7A 4Y73A 1OECA 5AWMA 4LG4A 3RBWA 2GNGA 5M4CA 3R30A 4KBKA 4YZNA 5A4TA 3VS3A 1JVPP 1H8FA 3ZS5A 3PJ2A 3NNXA 3OWLA 3CSVA 2Q0BA 2FGIA 2OXXA 5J5TA 5DBXA 4AGCA 3CGOA 3QA8A 1SYKA 4QMTA 3UIUA 2BVAA 4BRXA 4DGMA 5T6KA 2UW0A 4B6LA 3CTQA 3DV3A 2C6LA 3A2CA 3DLZA 3O51A 1ZYJA 2YFXA 4K1BA 4Z55A 5BVDA 5E9EA 4FICA 4FI1A 3WILA 5CVHA 3FY0A 5CXZA 3BHVA 3C51A 4YNOA 2OWBA 4G5PA 4GS6A 3KXGA 4QNAA 2ITTA 4AX8A 4AAYA 2ZJWA 4IB5A 4DBNA 4JI9A 4U0IA 3BIZA 4XNEA 4I6LA 4IZAA 5DH3A 5D1JA 3ODYX 3VWAA 2J9MA 3TUBA 1NVQA 3OTUA 3FLYA 4QYFA 5EHLA 3UMWA 4FNXA 2ETMA 1ZMVA 2G9XA 5F4NA 3LFNA 5BVKA 5DWRA 4DH8A 3KU2A 4ZZOA 5JH6A 2EU9A 4JDIA 1ZY5A 1SMHA 5L2IA 2XB7A 2JEDA 4XYFA 1P4FA 2E2BA 3PPKA 5E8TA 3DDQA 4GYIA 5HO7A 4JR7A 4NW6A 4CFVA 3TUDA 4O81A 2F49A 2CGXA 3A7HA 4TYIA 5HIBA 2F4JA 1KE9A 2O0UA 4BDDA 4EK4A 2X0GA 2ZYBA 4PPBA 1U5QA 2C1BA 3UGCA 3U6IA 3DCVA 4PPAA 4ZOGA 2G2FA 2OF4A 2ZM4A 3MWUA 5BUEA 3W0OA 4Q5HA 2ZV9A 4QYHA 2R9SA 1RW8A 4DEAA 3COKA 4FNWA 4ONAA 4I6BA 1PKGA 4EWHA 3MY0A 3THBA 4GG7A 4DH3A 1BX6A 2I1MA 2VWUA 2YZAA 4ERWA 4QMXA 1YXTA 3OFMA 4ZSAA 3D83A 3DBDA 4DC2A 2VTSA 4D1ZA 3PJ3A 1E9HA 5LVNA 4IX3A 3OEFX 3DFCB 3I81A 5IUIA 4F7LA 1LEWA 3ZYAA 4C02A 4W4WA 5FTOA 3HRFA 4EOLA 4PDYA 4TNBA 3UOJA 1W0XC 2R3LA 5EKOA 2W99B 5AUZA 5DR9A 4NKAA 3TV6A 3G0FA 3FZSA 3FZRA 3NNWA 3QQGA 4OTFA 4BZOA 2PK9A 4UZHA 4A4XA 4CFFA 3PJ8A 3R1YA 3ALOA 4UXQA 3ZDIA 3N51A 4MXAA 2XANA 1YOLA 3UDSA 4PF4A 1H4LA 4MK0A 3KRRA 4X2FA 4FIFA 5HKMA 4FIEA 4DGOA 4UMPA 3VS7A 3LHJA 5EYCA 4C4EA 4XV9A 4CKRA 3ATSA 3OT3A 4RPVA 3QRIA 3VW6A 3C4EA 3FJQE 4RZWA 4KRCA 4O2PA 2X2KA 1AGWA 3FKOA 3QKKA 4YJPA 5B0XA 3RWQA 3U9CA 2B9IA 3BYSA 2XM8A 1O9UA 3A8XA 3PIZA 4G3EA 4IM3A 4D28A 3C0IA 3L8XA 4MD9E 5HIEA 4L43A 4DG2E 4KD1A 3FDNA 4A9UA 4BKYA 5BUIA 3DBFA 3V5JA 4C59A 4D2VA 3ATTA 3PUFC 4IZYA 1Y8YA 3QAME 4RIYA 3V04A 4EK5A 4EYJA 5IMEA 2OKRA 1YXVA 5JSMA 4KBCA 1F3MC 4PPCA 4BZDA 2XNGA 4IXPA 2GPHA 2UZTA 3N4TA 1JAMA 1WBVA 1G3NA 4RLLA 3SGCA 4CTBA 2RFEA 3EH9A 5D41A 4YTIA 4W4VA 3CD8A 3BV3A 3PJ1A 5KHXA 1R0EA 3O50A 3PPJA 3IDCA 3R22A 4JR3A 4RVTA 5IA3A 3TZ7A 1UV5A 3DGKA 5IQAA 3MH2A 3DOGA 2FYSA 4O21A 2HENA 2VTAA 3MH1A 4F64A 4ARKA 2YJSA 4E5BA 3EL7A 1Z5MA 3DNEA 3KMWA 3VHKA 1OI9A 2XNPA 4GU6A 4I23A 4M15A 1DAYA 1OL6A 4WNOA 1IG1A 3TXOA 3G51A 1P14A 2GQGA 5DA3A 1BUHA 1BLXA 1YOMA 2YITA 4FSYA 4WNPA 4ZSEA 2CSNA 3QRKA 4KIKA 2VO7A 1XH6A 3UOKA 4LMNA 4WKQA 3JY0A 3OZ6A 5I5ZA 3R01A 3NNVA 4P5QA 3UVRA 4GSBA 3EN9A 3C4CA 2XNOA 4QMYA 3CKWA 3R04A 1M7NA 3DS6A 3PY1A 5AUWA 4FZAB 4YZDA 3G15A 3GCSA 4FL2A 4GT5A 5KMOA 4FKJA 3U4UA 4EK3A 1WBPA 3E7VA 2Y6OA 4M8TA 3SRVA 3W0NA 4DGNA 5EQPA 5DI1A 1UU8A 4Z9LA 2OJGA 5FP5A 3TCPA 4FTQA 4EBVA 4PMPA 5AIKA 2GCDA 5HICA 2VWYA 3VJNA 3FSFA 2Y4IB 4ZY4A 2I7QA 1BL6A 2XYUA 3MJ2A 2O3PA 3RHXA 5FXQA 4L8MA 1PF8A 2R4BA 4PWNA 5DE2A 1FOTA 3ZC6A 1WBOA 4U81A 5DVRA 1YWNA 4NJ3A 4X7QA 3W16A 2PZYA 4QNYA 5BUJA 3GC0A 4L00A 5E8VA 1ATPE 2PVYA 4R8QA 4C2WA 5DGZA 3ULZA 3QUDA 3FPMA 4ZTHA 2JKMA 3V6SA 3UG2A 4OR5A 2V0DA 3QCSA 3HAMA 1JPAA 1HCKA 3TL8A 2Y4PA 3R1SA 2GTMA 4LL5A 3F3WA 2X4ZA 4O7WA 3AD6A 3PRFA 4ITHA 4BTFA 3UP2A 3HZTA 4EOKA 4CXAA 4S2ZA 1Q24A 3MTFA 3B2TA 5ACBC 2CKOA 4RJ5A 4C35A 5AUTA 1L8TA 2QI8A 4ZJVA 4TWOA 4KSQA 3CIKA 3QU0A 2HW6A 3CE3A 3DB8A 3BELA 4O22A 4G5JA 1FQ1B 2IJMA 3VW8A 3E8NA 5LCKA 5EW8A 5L3AA 2UVXA 4V0GA 4WBBB 2QQ7A 4DEIA 4QRCA 4TZRA 2QD9A 2YLFA 2GDOA 3FUPA 3QWJA 4NT4A 3BYVA 3BU6A 2C3JA 3TUCA 2WEIA 2OIQA 3L9LA 4WG4A 3PVGA 3I60A 4XMOA 2W1DA 1OKYA 4HCVA 2XEZA 4F7JA 5EDPA 4J7BA 3KN5A 2WTJA 3PRIA 3UDTA 4BFMA 3FMLA 1W2FA 2YM5A 4FSMA 5AR7A 3ZTXA 4C3PA 4GK4A 4RIWA 3ORZA 4HPTE 5M53A 3P0MA 2C47A 4E6QA 3ZONA 4Y72A 3I79A 3DKCA 1ZOGA 2R3GA 2PVMA 3QGYA 2XP2A 3W18A 4EORA 2PUNA 3MVLA 2X9EA 1FVRA 3RPRA 2AC5A 1GZNA 2YERA 4M69B 4DHIB 3Q32A 5HCXA 5HU3A 4EZ3A 2YISA 4IDTA 4O1PA 2WMTA 4PDPA 4QTBA 1FINA 3CJGA 2X9FA 2C6MA 2QHNA 4RC4A 3L8PA 4PL3A 5LCJA 4QDEA 2B1PA 3PWDA 1P2AA 4GW8A 2IZRA 3CLYA 5AA9A 4LM5A 1Q8WA 4XP2A 4YSMA 4MXOA 4FRFA 2GS7A 1IA9A 5E8SA 2EXCX 3UOLA 2C6KA 3GU6A 4JRNA 5LMKA 5JGDA 1W83A 4BWPA 3FE3A 3LCTA 2PVHA 5F94A 3WI6A 3FMJA 1I44A 1ZXEA 5AP3A 3C5IA 5E90A 4CFXA 5LMKC 3QCXA 2EB3A 2C6EA 4BGHA 1U46A 3ORPA 1OPLA 1PXIA 1YXUA 2Z7RA 3NUAA 4CKIA 5ITAA 2C30A 3MVMA 4DF3A 2VRXA 4OW8A 1XH8A 4BJJA 3T9IA 4AAAA 2GHMA 5FXSA 2YIYA 5J95A 2UW3A 3DPKA 3E8CA 4D2TA 4BDJA 4QP3A 3D14A 4IAYA 5JFXA 2XARA 3MFUA 3PVBA 5GNKA 2HAKA 3RINA 1YXXA 4M84A 3MY1A 4NM5A 5IEYA 3HECA 3R8MA 3OROA 4ANOA 5CVGA 4FEVA 5AA8A 2ZV7A 4AXEA 3MPMA 3GGFA 4H36A 5AIRA 4K8AA 4NUSA 2YA9A 5KNJA 2C0IA 2NRYA 4FV7A 2XYNA 1DAWA 4F99A 4EH9A 4QTEA 5JQ8A 3KF7A 3VC4A 1QPJA 4XS2A 4A06A 5ETIA 2PZIA 3U6JA 3UZRA 5C4LA 2CNVA 5E8WA 1YDTE 2B52A 3IW4A 1Y6BA 4CFNA 4MD7E 5HLWA 5J79A 1WAKA 3SXRA 2PTKA 4PL5A 4YZMA 4ZTQA 4FSZA 2QHMA 1F5QA 4RA5A 5AUXA 3Q5IA 4AXAA 4QPSA 3R9NA 5IU2A 3UPXA 3NZ0A 4DFUA 4FBXA 4DG0E 1QMZA 2GNHA 4P4CA 5HIDA 2GFSA 4LL0A 4YBKA 5LARA 4D5KA 5CEMA 1S9IA 2QOOA 2JDTA 4FTNA 2OK1A 3MIYA 4DFZE 2C6IA 3E62A 3P9JA 3DQWA 2WTKC 4GH2A 4R5SA 4QP4A 4NYEA 2YM8A 4LOOA 1TKIA 4F08A 1J7UA 4C8BA 3TEIA 5A46A 1UA2A 3ZRLA 2R3MA 1OPJA 4Z7GA 4USEA 5HTIA 2XJ2A 3FAAA 4W8DA 2ITVA 3QD4A 4FTRA 4R3CA 3R28A 4K2RA 3SV0A 2X8EA 3PA3A 3VUKA 5HG8A 3FLNC 4BCMA 1Q8TA 3IO7A 3P1AA 3VF8A 4O7NA 3POZA 4ZTLA 5L6WL 1OGUA 1PXKA 4BBMA 3LLTA 4OT6A 5K0KA 3UC4A 4HYHA 4NH1A 4IZ5A 5FG8A 2WMXA 4EH6A 3BWJA 2JFLA 4GMYA 5D11A 3R9OA 4BBFA 4Z7HA 4CLJA 5IDNA 4QTCA 1YVJA 3NX8A 4HOKA 4D2WA 2QURA 2XIZA 4TXCA 2CDZA 2PE1A 5CTPA 5D9HA 4JLCA 4I3ZA 4O38A 4HNIA 2JIIA 3WYYA 2A0CX 2W7XA 3BLRA 2WKMA 5TR6A 2FVDA 2RF9A 5LWMA 3QTWA 4ZSGA 4GFOA 2A19B 4DEBA 5CU0A 3RNIA 2G2HA 2F7ZE 2O63A 2X0PA 3AMAA 3PA4A 4PNKA 1OL1A 2GSFA 2PL0A 4YURA 5BQ0A 5CAQA 2X7FA 4D2RA 4OAVB 4QTDA 5CAPA 4CQGA 5AV2A 3TZ9A 4RG0A 4IW0A 3LXKA 3LFBA 4U6RA 3HGKA 4F7SA 2LAVA 2BKKA 1WBWA 1Q97A 2X7OA 3E64A 4RX8A 5HLNA 2HIWA 2IW8A 5LWNA 4MTAA 2JDOA 3MN3A 5AP4A 2XBJA 1IA8A 2ZDUA 3GT8A 3PUPA 4XG3A 4YTCA 2HYYA 3FQHA 3QQHA 2VTIA 2GQSA 4NK9A 3D94A 4FSWA 2I0EA 2GHGA 3MA3A 4H3QA 5D7VA 5EH0A 4HVGA 4ACHA 4FEXA 4AU8A 1CM8A 3EQGA 4AOTA 4MXCA 2JBPA 2X2MA 4AE9A 4D55A 1ERKA 3A4PA 4G16A 4PP9A 5CSWA 4Z3VA 3GBZA 1W7HA 3Q60A 4ZTRA 4M68A 3QTSA 3PLSA 5B2MA 4TKSA 3ML1A 2V7OA 2PU8A 4L3PA 4IWPA 2GS6A 4IACA 4F1TA 4X6QC 2B53A 4LOQA 1KWPA 3WE8A 3C4XA 2WPAA 4HGLA 4YZBA 4HNFA 5ANIA 4CFMA 5DRBA 3VN9A 5AP5A 4FV9A 4B4LA 4GG5A 4L42A 3RPOA 4ACDA 4N57A 4RFZA 3PXKA 1M52A 3KULA 4M67A 4D5HA 3ORKA 4ALUA 1ZYDA 3DKOA 4UN0C 4AA4A 4YLLA 2XKEA 5CU4A 1OUKA 4J8NA 2W1FA 4QP7A 3ZUUA 3UPZA 4M14A 5AUVA 4HGTA 1H07A 3TNHA 1BI7A 4CV9A 4IB3A 5K5NA 3CY2A 1ZY4A 4U41A 3ENHA 2WQOA 3JS2A 4O6EA 2W1ZA 4FT3A 3R73A 1IAHA 3F2NA 4AW1A 1GZ8A 3D5UA 3QUEA 2EVAA 3VO3A 1J7LA 1ZARA 3ZUTA 5C8MA 1HOWA 5HORA 4HCUA 2RSVA 2VD5A 2W05A 4FEQA 3FPQA 4BGQA 4EKKA 4F6WA 4O4BB 2PVJA 3A99A 3WF9A 1NY3A 1TQPA 4HGEA 1PMNA 4V01A 4L7SA 5DN3A 3UNKA 4ASEA 3VUGA 3JVSA 1OKWA 3MVHA 2XA4A 3Q4UA 4FTJA 4BDHA 4FKSA 4YO4A 3MS9A