5BVOA

Fragment-based discovery of potent and selective ddr1/2 inhibitors
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
308
structure length
276
Chain Sequence
DFPRSRLRFKEKLGEFGEVHLCEVDSHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDKPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epithelial discoidin domain-containing receptor 1
publication title Fragment-Based Discovery of Potent and Selective DDR1/2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 276
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bvoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bvoA01
3QALE 2HELA 2PVYA 3D2KA 4M69A 4W8DA 2B54A 3DQWA 3LXLA 3RNIA 4BF2A 4FTCA 2BCJA 4LL0A 3LLAA 1OPJA 5CU6A 4DFYA 3CC6A 4WUNA 2Z2WA 2C5OA 4KUJA 3G9LX 2W5BA 3F2AA 1PXKA 3DKFA 4RVMA 2XMYA 3ZYAA 4RFYA 4EOSA 4KBCA 2QONA 4PTCA 4U41A 4C4GA 4RA5A 2GHLA 2XCHA 3NUNA 5CSVA 3RGFA 5T3QA 4AZVA 1OUKA 3MFSA 2HIWA 3KQ7A 1KUTA 3KXHA 2G15A 4AG8A 4E1ZA 4PY1A 3QHWA 4MNFA 4U79A 4EH5A 5KKRB 4E73A 3NUUA 5ANDA 2PY3A 4GK4A 1UWHA 3I79A 1MRVA 2UZTA 1ATPE 2WMWA 1J1BA 4MD7E 5FWKK 5GHVA 4C37A 3PJ2A 4IB0A 4CEGA 5DEYA 5AAEA 2YWPA 4FL1A 2FB8A 3C0IA 3DFCB 4UALA 1ZOGA 1YHWA 3O8UA 4C3RA 5BNJA 2X6EA 4IC8A 3FI4A 1H01A 5HNBA 4XRJA 3LFBA 4CG8A 2FYSA 1PXLA 4BR3A 3FY0A 3OS3A 4NEUA 4TYHB 3E8EA 4CT1A 5IQCA 2OFVA 5HTIA 4B6LA 5ANEA 4ALVA 3N4VA 2XB7A 3CXWA 2XK7A 3UIMA 2CMWA 1YVJA 2W17A 1QMZA 3OTVA 3VUGA 3AD6A 4C4EA 1BL6A 1K9AA 2EU9A 3BGQA 4K1BA 1ZY4A 3BYMA 4Y73A 5CU0A 2Y4IC 2IZTA 3PG3A 2WTVA 3KCKA 4E5BA 1YHVA 2GDOA 2R64A 3A7GA 3V6RA 2VWBA 5IEVA 2QURA 1Y8YA 1UNHA 3QXPA 2J0JA 5AUZA 4ZTSA 3EQDA 3W2RA 3A8XA 1ERKA 3A7FA 3PRFA 1OKVA 4Z7GA 3AD4A 5FG8A 2OJGA 2HYYA 3GVUA 1BL7A 5IF1A 3PP0A 3PP1A 2GU8A 2P3GX 2RF9A 4AQCA 3IQ7A 3KXZA 4DA5A 2BIYA 3KK8A 3ULIA 3D5VA 4I1ZA 4LGDA 5CQUA 1BYGA 4GIHA 2VTIA 3F5PA 3ZU7A 4FK3A 4YGAA 2XS0A 4IWOA 3W55A 3IPHA 5KUPA 1P14A 3MS9A 4NKAA 1ZZ2A 4MD8E 2CHLA 4XG6A 2HXQA 2GQSA 4O83A 3BEAA 2KTYA 2W1EA 1FINA 4DBNA 3BIZA 1FVRA 1CSNA 4JJRA 2GFSA 3MPTA 5AUXA 5HESA 3VUHA 1PXNA 3HP5A 3KFAA 4D1XA 4FGRA 1VZOA 4DH5A 1XH6A 3QTSA 2XRUA 2V62A 3OXZA 5CEKA 4JDHA 5HQ0A 4MAOA 4XX9A 2EXMA 4E93A 2J0IA 3OWPA 1HOWA 3ATTA 3UQFA 2ZV2A 3DT1A 4CG9A 2E2BA 5ANGA 5IU2A 3D5XA 2PVRA 4FT7A 3RWQA 3SXRA 3KB7A 3Q4UA 3QKMA 4AN3A 2UZUE 3FMLA 5K0XA 3ETAA 4HZRA 1H1PA 4AZEA 4OBOA 4C3FA 1W8CA 4EWQA 4GH2A 1IEPA 3SG9A 2Y4IB 2F7EE 1SNXA 1OL6A 4NM5A 4O1PA 2Y9QA 4JDIA 3CP9A 3GCVA 3ACKA 2PE0A 1JQHA 2VX3A 3QWKA 3VIDA 4G5PA 3RM6A 3JPVA 4GJ2A 2GS7A 2B9FA 4RC4A 1UNGA 3PE2A 2YISA 1OMWA 3P86A 5HTBA 5H9BA 3GP0A 5J7BA 1JNKA 2QVSE 1ZYLA 2X39A 5E8YA 3TNWA 2C1AA 5IH4A 3EQIA 4FV0A 1OM1A 2V55A 3EKNA 5I0BA 5BQ0A 4CYIA 1WBVA 1RQQA 5GZ8A 5AUTA 4O0VA 5FBNC 5M4UA 4AXAA 2XNMA 1KOAA 3AXWA 1GAGA 4GK3A 4IZ5A 4MQ2A 2Y6MA 3EHAA 3G5DA 4W4VA 4YC3A 2JIIA 4P7EA 2A27A 4O0RA 5D41A 4F0FA 1FMKA 4M69B 3KRLA 4O7YA 3FMKA 3HUCA 1WZYA 3P4KA 5J9YA 4W8EA 1L3RE 1WBNA 1OZ1A 3AT3A 2YM8A 4FNWA 4GU6A 4LRMA 3FMHA 4NK9A 4R6VA 3UIXA 3D5UA 4ZJJA 5E8XA 1GZKA 3QQGA 3RPVA 4B7TA 2Y4PA 4J52A 4BKYA 4CRSA 3QTZA 3DK7A 4N57A 4R77A 3LM0A 3WBLA 2XEYA 3NNVA 1R0PA 4GT3A 5BVKA 1MP8A 3DBDA 5J95A 5AUWA 1SYKA 4O27B 4EK4A 2BZJA 4PNKA 4I23A 2AC3A 4M84A 3ORLA 3EFJA 3PXQA 4C4IA 4XH6A 3A62A 4GMYA 4DHFA 1PXOA 2OKRA 4YZ9A 4AA5A 4ANLA 3NUSA 3B2TA 3B2WA 4FEQA 3WZKA 1GIJA 3NW5A 3NWWA 4TT7A 4S33A 2X81A 2R3GA 3CE3A 4IFGA 5DI1A 3ZDUA 3GQLA 4A9TA 4D0XA 1CKJA 3LQ5A 4KD1A 4NL0A 4MF1A 4BKZA 5AEPA 4USEA 4QMXA 5EQPA 4KS7A 3ZTXA 1ZMVA 2BDWA 4UWBA 5L4QA 3ZBXA 1F5QA 4JX3A 3ELJA 4I3ZA 2QO7A 2XCKA 3DZOA 4L52A 1OKWA 3CIKA 3BGZA 4QQCA 2DQ7X 3V5PA 3RZBA 5CLPA 3ZO1A 5CVFA 5DHJA 4RX7A 2W1CA 2ITYA 4DEGA 3NNUA 3A4PA 3MESA 3LPBA 2JEDA 4DCEA 1VEBA 2XZSA 2RKUA 2YCFA 5HX6A 1YXUA 3QKKA 3K3JA 1H8FA 3MH1A 3T3VA 3Q2JA 2XK6A 4S2ZA 1G8AA 2CKPA 1U54A 3MPMA 3QQUA 3FXZA 4F64A 4YJUA 3ZZEA 1PJKA 1JAMA 5HE0A 5LVLA 2YCRA 2C5VA 4FEVA 3VUIA 4FG9A 3UC3A 3ZM9A 3R7UA 2OK1A 2OZOA 2PUNA 4X6QC 3VBYA 2OSCA 2NP8A 4BN1A 4BZNA 5AFVA 2VZ6A 1DI9A 5AA8A 1JBPE 3HGKA 3QRTA 4FSYA 3D94A 3LFSA 5CI6A 1RW8A 2E9PA 5HKMA 4RLLA 5JGAA 3FYKX 3O8TA 4LOOA 2OIBA 2GNHA 1STCE 3LXKA 5EHYA 3VHEA 3D2IA 5KHWA 5AP0A 4G3DA 4MHAA 3NGAA 4J8MA 4KBAA 1ZOHA 5H8BA 4C33A 5IDPA 4O7ZA 2EWAA 4DC2A 3AGMA 3P1AA 5FRIA 3NPCA 2IW9A 2V7AA 1SM2A 5M55A 3MWUA 4BL1A 4Z55A 1OVEA 4FIEA 2F49A 4D2SA 4F7NA 5FD2A 4RA4A 4AX8A 3QTRA 4UV0A 5HGIA 2X1NA 3HV7A 5IUIA 4Y5QA 5LMAA 3EFKA 5FDPA 2Z02A 3I4BA 3KXXA 5BYYA 3FI2A 4UBAA 2OICA 4AZFA 4RX5A 5CF4A 3BLHA 3KRJA 3R7GA 5GINE 3R9HA 3O7LB 3NIEA 2RGPA 2O5KA 2W1IA 3ANQA 4FTJA 3W33A 5HG9A 1ZLTA 4OUCA 2PVFA 4YZMA 4I94A 3THBA 1ZARA 4A4OA 3HAMA 1YI3A 4ASXA 4HVGA 5KMLA 3FZPA 3QLGA 4FSZA 3DAEA 4AA0A 3VUDA 2UV2A 4D2RA 1RE8A 3KN6A 3VULA 4X3JA 2WOTA 3Q32A 4J1RA 5A6OA 2ZB1A 4HGEA 5C27A 1YDRE 3QX4A 3GB2A 4FTUA 2QHMA 2UVZA 4WG4A 5CSXA 2X2MA 5EDQA 3Q2MA 4XV2A 2GHMA 3VUKA 3V5LA 1B39A 4L46A 4OTDA 4FZ7A 3WARA 1IA9A 3G9NA 1KE6A 2C6OA 1U5RA 3DU8A 5CSHA 5E1SA 5JT2A 1YKRA 3OWLA 3RVGA 4JX7A 1P4OA 5C01A 3OF0A 4DTAA 4ZTQA 3ZLWA 5K4JA 4PUZA 4UXLA 3OCTA 2WTIA 4BIBA 5AP3A 4BDKA 4EZ5A 4F4PA 3O17A 5HD4A 2JC6A 3KRRA 3UOJA 4CTBA 4Y95A 3V5WA 4CFFA 3IDPA 4LMUA 4WD5A 3QU0A 2QU5A 5EW8A 3F9NA 3ZUVA 5I9YA 4FKRA 3DLZA 5CEOA 2QKWB 5EM6A 4ANOA 3MY0A 4RRVA 4ZSLA 4EHEA 4IZYA 1OIQA 4U7ZA 5CNNA 2QR7A 5DLSA 3WYYA 5BUJA 1REKA 4O84A 2XRWA 1Y8GA 4OTQA 4O81A 3KRXA 5FUTA 1FVTA 4HPTE 3BHTA 4N6ZA 4OTRA 1JKSA 3UMWA 5AADA 3HMNA 3BU6A 3NR9A 4Z7HA 4FGBA 4QOXA 3PJ3A 3JXWA 2VTQA 3DCVA 4JBOA 3WF8A 4FC0A 2W1ZA 3TACA 4F9WA 3AOXA 5BVWA 2JDSA 3O23A 4GCJA 5CXHA 2CKQA 2W06A 2RG5A 4O7NA 4LRKA 4O86A 3QD0A 4G9CA 3CQUA 4TN6A 2J0LA 3NS9A 3TKIA 4IAYA 5DR9A 2XIKA 3IG7A 4FIGA 3VF9A 4EC8A 4F7JA 3HA6A 4I92A 2Y6OA 2OH0E 3DFAA 4O7RA 3K2LA 4OTWA 3IOKA 4KRCA 4IVCA 1KE5A 2OFUA 3FZ1A 4FNZA 2BR1A 5J9LA 4F6WA 4FA2A 4ZXTA 3UNZA 4O0TA 3VBQA 2GCDA 4X2JA 4CFWA 3SOCA 5A4CA 3FKNA 2BIKB 2CNQA 3S00A 1XR1A 2GS2A 4PP9A 4E3CA 2QQ7A 2GSFA 3OTUA 4JLCA 3RAKA 4GV1A 4CMUA 3N9XA 4RWIA 4EZ3A 2VO0A 3K5UA 2YABA 4U97A 2VO7A 1FQ1B 2W1FA 3UP2A 1OGUA 5KZ0A 4D2VA 3MA3A 3Q60A 4AAAA 4KSPA 1U54B 3POZA 2ETKA 5IH5A 2BRHA 2GTMA 3CD3A 5J1WA 3W2SA 5A6NA 3R1SA 4TYEA 5BX0A 4CVAA 3ZSGA 1UKHA 5ANKA 3W2CA 3L9MA 2W1DA 1YOLA 4GT4A 1I44A 3OY3A 5DN3A 3S3IA 4EOKA 3FHRA 5M4FA 5EQEA 5HIEA 4U42A 3HRBA 3F61A 4I24A 3RPYA 4IJ9A 4L68A 1KE9A 4JI9A 4BRXA 2R3LA 5EI2A 4A9SA 2C5XA 1U5QA 4J53A 3QZFA 4I0RA 3ULZA 3CGOA 4D4VA 2B4SB 4ZLZA 4LGHA 4NU1A 3T3UA 3OWKA 3TJCA 4AOTA 3ET7A 4QNAA 5EHOA 3E7VA 3C51A 4QMOA 4XP0A 2F7ZE 3EIDA 5C4KA 2XK9A 2CDZA 3KREA 4IWPA 3W2OA 2W96B 1YI6A 2FVDA 1U4DA 3QD4A 4FF8A 4MXOA 4EUTA 1P4FA 3MB6A 5C8MA 5CSPA 4MBLA 3PWDA 2F57A 2CLQA 2G1TA 3FLYA 4QTEA 2C5YA 3E5AA 3BZ3A 4DFZE 2B53A 3JVRA 4W4XA 5CI7A 4ZTNA 4B9DA 2PPQA 2WMTA 4FTAA 1GZOA 3QBNA 5DVRA 3KF7A 4QMVA 4AZSA 3HECA 4PL5A 3TKUA 4EI4A 1W0XC 4BCNA 1M7NA 4KIOA 1CTPE 3LCTA 4FV9A 5IQEA 2R2PA 4MBIA 3PTGA 2AUHA 2P2HA 5AR3A 4E5AX 4M0ZA 3DKCA 5JQ5A 4AOJA 4Y72A 4FV2A 1OL5A 2WMXA 3QGYA 1ZOEA 4BGQA 2R0UA 2WEVA 4AF3A 3LMIA 2XM9A 2A1AB 4YZCA 5CYIA 4C61A 4BDAA 4CKIA 5CEQA 2JDVA 5E8WA 1VYZA 4EQUA 4E4XA 1IA8A 2HY81 4Z16A 4D9UA 5LVMA 5KMKA 4PMPA 2BDJA 4W9WA 5HCXA 4XLIA 3UG2A 4EYJA 2NNWB 3CBLA 4IM3A 4LV8A 4HCVA 4EH7A 5HZNA 5AM6A 5KMNA 3KKVA 5CAOA 5B2KA 2WMRA 4X6RA 2YEXA 4F70A 4IAIA 4UWCA 4TWOA 3PA5A 3HRCA 4TKSA 2VTMA 3C0GA 5ETIA 4YSJA 3UOHA 4PL4A 1XQZA 4EOOA 5HCZA 4M13A 5JFWA 3KU2A 3CY3A 4I20A 4LMNA 2R3MA 4V04A 3ZCLA 3TEIA 2ITWA 3BHHA 3KULB 3E7OA 3FV8A 1WVYA 3ODYX 4KSQA 4X3FA 4Y46A 1XBCA 3TIZA 4YUQA 2ZV8A 5HVJA 3LQ8A 2H8HA 3OEFX 4CFMA 3V01A 4HYUA 4D2WA 1XO2B 4HYSA 4O91A 3MI9A 4TYHA 4CFUA 3W8LA 1OPKA 3MA6A 2ESMA 4I93A 3PLSA 5JMSA 1SMHA 2QR8A 4RJ6A 4WA9A 3FSKA 3BGPA 1P2AA 4L9IA 3U4UA 3V04A 3I1AA 4YTIA 5AR2A 2PZ5A 4DCAA 3U8WA 2BILB 3QLFA 4CMTA 3FMNA 3RCJA 3ZFYA 5BVDA 2HWOA 2WZJA 3MBLA 3B8RA 1V1KA 3BV2A 2Z8CA 2YZLA 3BBWA 3IS5A 4O7SA 4BGGA 5C1QB 4PTEA 2OXXA 3HV3A 4RBLA 5HLPA 3IW6A 5G1XA 3VS0A 2ITOA 5CU2A 5TKDA 3C4WA 3FZTA 3OD6X 4KIKA 3BWJA 4XCUA 5GZAA 4PF4A 4YHFA 1FPUA 3NCZA 3QQHA 1BMKA 3OXIA 5HICA 4HW7A 4H39A 4RJ3A 3KC3A 3MTFA 3QTUA 4AN9A 3DK6A 2W5HA 1WBOA 5JK3A 3BHUA 4IZ7A 4FSWA 3R8UA 3LFAA 3AGLA 3TG1A 4BDFA 1RJBA 1PYEA 1WFCA 3C13A 4V01A 4C57A 2WTKC 2OLCA 2I0HA 3OZ6A 4BTKA 4QQJA 3LCDA 3MGYA 3IKAA 5IQIA 5EK7A 4HNFA 4DF3A 4MNEA 4JIAA 3FL5A 2F9GA 5JRSA 3RNYA 3EFWA 2FSOX 5BVFA 2IVSA 4JQEA 4CFNA 3DV3A 4G1WA 3FQHA 3ZEWA 2R3FA 2YM7A 3Q3BA 3F7ZA 3MYGA 3CQWA 3DZQA 4PDSA 2X7OA 5KKRC 3ZRKA 2VWXA 4KIPA 1V0BA 3WIKA 2ZJWA 2JBOA 3EQPA 4RJ8A 4X2GA 5IDNA 3DDPA 5K5NA 1ZMWA 2VWYA 4FT3A 4UMTA 4H36A 4YJQA 2Y8OA 4D1SA 4IAFA 3D7ZA 5DYJA 1W82A 4X3FC 1NT2A 4WUAA 4PRJA 3NNXA 4G2FA 2BFYA 3FXWA 4YURA 4D4YA 2VAGA 1YXTA 5J5SA 2WPAA 2DUVA 3EQGA 4PPCA 4WNPA 5M51A 5CZIA 3R71A 2WFYA 4IAAA 2JFLA 5AAFA 3P0MA 1XJDA 3C4CA 4TYGA 1T45A 2P2IA 4O6EA 4DINA 4M3QA 4J97A 1A9UA 3GCUA 1G3NA 4BFMA 4BI0A 2XIYA 5ACKA 4FZAB 4BGHA 2QOHA 4GIIA 2A4LA 3SX9A 4B8MA 4E7WA 4MQ1A 4U80A 4PTGA 3W16A 1ZY5A 2C6LA 1T46A 3ZONA 3M42A 5BVOA 2WMVA 4FR4A 3VJOA 3QZGA 5TR6A 4CFXA 4RT7A 4EONA 3UPZA 2XIXA 3DOGA 1Y6AA 2WTJA 4EHZA 4ALUA 4RIXB 4NYEA 1E1XA 4YJVA 4A06A 3MVLA 2CLXA 4JDKA 1Z57A 4O0XA 4CLJA 2YDJA 3E3PA 4H3BA 5FTGA 3DB8A 5FQDC 4DT8A 2VRXA 5FXSA 5M44A 1YOMA 2XKCA 2X2KA 4DLIA 2WTDA 5K4IA 3Q6UA 2YWVA 4EH3A 4I0TA 2WTKB 3E62A 3EQRA 5EW3A 3MVJA 3FAAA 2VWVA 3DS6A 4WNKA 2WMAA 1H27A 2CKEA 4LV5A 3PVBA 3GU7A 1M17A 3QCYA 4FEUA 2ETRA 3HNGA 4BDIA 4CQGA 4WRGA 2X8DA 3CLYA 3SOAA 3R9RA 3COMA 5IEXA 4FKVA 1O6YA 4IDTA 2V7OA 4G3FA 3FJQE 4UWYA 4WO5A 4AACA 4R7IA 5GNKA 4GRBA 3BU3A 5ANOA 4CZUA 5BUIA 5J7HA 5IA2A 4PMTA 1HCKA 1WBWA 2I6LA 2PUUA 3GCSA 4J98A 5HG7A 5T68A 4DITA 3LFDA 3ZXZA 3ZRLA 4EBVA 4ZLOA 1QCFA 3CSVA 4X3FB 4JBPA 3DPKA 5M08A 3RMFA 1I09A 3FC1X 2FGIA 2R0IA 2XKEA 3PY0A 2GPHA 3KXGA 4F9YA 4FYNA 3R8MA 2JDOA 4BTFA 4I6HA 4B8LA 2YIXA 5GJDA 4CD0A 1IG1A 3NDMA 1F3MC 5DG5A 3QFVA 4UB7A 1Y6BA 3ZLSA 4HJOA 5GJFA 2BZIB 3QUPA 4UXQA 3UO5A 3ZOSA 3UJGA 3CJFA 4L44A 4RJ5A 5DMZA 3F5XA 5GZ9A 3TI1A 2BALA 4F99A 5LMKA 2BKZA 1LEZA 1PXPA 4MF0A 4AOIA 4DEAA 2A0CX 2R7IA 4G5JA 4IX5A 3FLWA 3IW8A 4FSRA 4NKSA 3SW4A 4CNHA 3MY5A 5HO7A 5ITAA 1CM8A 4DTKA 4PP7A 2XEZA 4XBRA 3C9WA 2YERA 2HK5A 5K0KA 4ZP5A 4L6QA 4EQMA 3EN4A 3QRJA 4JIKA 4RLKA 4DH7A 2Y0AA 3I0OA 4KIKB 4L3LA 4ASDA 1NW1A 4O6LA 4BCPA 2YJRA 4FSTA 1JSVA 2XYUA 2JBPA 3ALNA 4FEXA 4C3PA 3OUKA 1TVOA 4IHPA 4IX3A 5IQBA 3NAYA 4N4SA 4YC8A 5LCJA 4HZSA 1BX6A 1NA7A 5I9UA 5HD7A 3R8LA 3S2PA 3VS6A 3RK5A 5KBRA 5AV0A 4KKEA 5K9IA 2PU8A 4X0MA 2QOBA 3FZOA 3UP7A 4ACGA 3B8QA 4QMWA 5DFPA 2YCQA 3EMGA 1Q3DA 4CCUA 2WIHA 3F7WA 3TV7A 1XWSA 3TUBA 4M67A 3Q5ZA 4MNEB 5J87A 3QQFA 1OIRA 4C2WA 3VS1A 4QTDA 1JLUE 5B7VA 3COKA 3LKMA 1AGWA 5A4LA 3FZRA 3JS2A 3NX8A 3V5TA 2E9UA 4TL0A 3BYUA 3NYNA 4TWNA 3IW7A 2UW9A 4C38A 3VRYA 4FVRA 2BAQA 3V51A 2ZM1A 4KRDA 2WU7A 4I6BA 4EJNA 1J7LA 3EQCA 4BDJA 2XJ2A 3P79A 4IX6A 4WNMA 3S95A 4E6QA 4EHVA 4QQ5A 3F69A 4IFCA 2QO9A 2P4IA 4IBMA 1OBDA 4GL9A 3OG7A 5A46A 4DFBA 4NZWB 2B1PA 4NH1A 2X6DA 4U40A 5JFVA 5IA3A 4YO6A 3EN9A 3GENA 4G3EA 4IB3A 5EKOA 3UC4A 3V6SA 5CF5A 2XKDA 3D9VA 4I6FA 4U81A 3DQXA 3NYOA 2Z7RA 4L53A 4JG8A 1E1VA 2VTJA 3VNTA 3HMPA 2R9SA 4FTOA 3OC1A 3IGOA 3VBTA 5IZFA 3RTPA 3FQEA 4BCHA 4CLIA 2PULA 3MW1A 4BCFA 5L8JA 3HKOA 5I9ZA 5LVOA 3DK3A 2GS6A 4RVLA 4JRVA 2R3OA 2E9NA 2ZM3A 4QYHA 4QMSA 2NPQA 4YJSA 2VTNA 5LMKC 4FE2A 4E4LA 2ZDUA 3PUPA 3BX5A 4MVFA 3OCBA 1RDQE 1PKGA 3AC4A 2O0UA 5DIAA 3IDBA 3EB0A 4HYIA 5IUHA 2BAKA 3OW4A 3G51A 5F20A 3ZLYA 3A7HA 4F1TA 5DE2A 3I5NA 5HHWA 2IO6A 3EYHA 4MX9A 5H3QA 1PHKA 3WE4A 4QYFA 3ORXA 5DWRA 3LFQA 2OBJA 2WMQA 4E26A 2QG5A 2J9MA 3DKOA 3C4EA 5HEZA 2C6MA 3PRIA 5HX8A 3E88A 3CPBA 2IVTA 2ITTA 3HP2A 4XOYA 4L7FA 4EOJA 1LEWA 4JDJA 4QMLA 1YOJA 4OTFA 1MQBA 2R3KA 4ERKA 3ORNA 3QZIA 2J7TA 3A4OX 3GC7A 1Q41A 4NSTA 4WT6A 3TXOA 2WQNA 5CT7A 4PV0A 2C69A 5BPYA 3NAXA 2CJMA 3W18A 4RIOA 4G3GA 1V0OA 2WELA 2WQOA 4GT5A 3O7LD 4WRSA 3VS3A 1JKTA 2RSVA 3EH9A 3PXYA 4OT6A 1J7IA 3U9NA 3BRBA 4F1MA 4G6LA 4ZSAA 5HI2A 4ZSGA 4BB4A 5A54A 5C8NA 5IMEA 4C58A 3SA0A 3AC1A 1Q99A 3MFUA 2VTAA 4PL3A 3QA8A 2BMCA 4ZK5A 3OHTA 4EK8A 2CCHA 4EBWA 5CXZA 4NFMA 4AP7A 2R3IA 3QGWA 4FV1A 2CGUA 3QCQA 2VWWA 3R01A 2GNJA 4TRLA 1JOWB 4QYYA 2OIDA 2XNEA 3R1NA 5KZIA 3UMXA 3ACJA 3SLSA 3TJDA 3DNDA 1GJOA 4M12A 5FXQA 3V5QA 5FDXA 3R7EA 4A9UA 5CEMA 2W1HA 5LARA 3WF7A 1UVRA 4P2KA 5IPJA 4BC6A 3DAJA 2YLFA 4WNOA 4FTRA 3SXSA 3ZO4A 2XP2A 4P90A 3R0TA 2PUPA 5EYKA 3EOCA 2ITXA 1H1RA 2C6EA 1G5SA 2UUEA 2YM3A 3GFEA 3HV5A 3Q6WA 3R7VA 3ZUTA 5IG1A 2YM5A 3N4TA 5IQFA 3UBDA 1R3CA 2C0TA 1XH5A 2R5TA 4EKKA 5EH0A 5CVGA 4XUFA 2NRYA 3PXRA 3FI3A 2ZV9A 3QYZA 4M97A 3UZPA 2B55A 1JKKA 3R22A 3GEQA 2DYLA 1PMUA 3IW4A 5TO8A 5I9XA 1KWPA 5EW9A 4G6OA 3DBFA 4YO4A 2X2LA 2XNNA 3OY1A 2C3LA 2HXLA 3RALA 5BUEA 1XH8A 3FHIA 5ICPA 1M7QA 3LCSA 4ZMFA 2VTRA 3UODA 2HOGA 3LM5A 4QP8A 2BTSA 3MPAA 5E91A 2YM6A 4L3JA 4OTIA 2PE2A 4UY9A 2R3PA 4XMOA 4J71A 4O7LA 4F9AA 5CAQA 5L2QA 1VR2A 4JS8A 1JVPP 3FQSA 2CGXA 3MIAA 5BYZA 1PY5A 5L8LA 1J1CA 1YQJA 2JLDA 3D5WA 4W4YA 2BPMA 5L6WL 3FPMA 4TNDA 4ZIMA 4C0TA 5CWZA 5M4IA 4DEBA 3A60A 4AS0A 4XLVA 3U54A 4HCTA 5IQHA 1ZAOA 4H3QA 4AW1A 2CNVA 2OH4A 3QX2A 4EH9A 5EYDA 3E92A 3JVSA 2PMOX 4BIDA 4J8NA 4APCA 2PVKA 2O2UA 1J7UA 4FKSA 1M2RA 4HYHA 4JG6A 2YJSA 4I4FA 3NEWA 2J2IB 4BCJA 4FICA 2VNWA 4Y85A 5JRQA 4ZOGA 3SV0A 4P4CA 4OTHA 4LQMA 3ZXTA 4HGLA 2B9JA 4NW6A 1MUOA 1OKYA 5DGZA 4L01A 3AC8A 4NTTA 2H34A 2QOCA 5J1VA 5F4NA 1YXVA 4FV8A 4N0SA 4AE6A 2WO6A 3C5IA 5FBOA 4C7TA 4H1JA 4IX4A 4TYJA 2BAJA 3D83A 3PG1A 4MXAA 3VVHA 1S9JA 1Q5KA 4PDYA 3BU5A 5D9HA 2PL0A 3H3CA 4K77A 5CT0A 2VU3A 3K54A 4EH4A 2GTNA 3G6GA 2I40A 4FKOA 3BKBA 3CKXA 3O51A 3VC4A 2J4ZA 2XKFA 3OT3A 4U3YA 4O96A 3FLNC 4QMMA 3RBWA 2YITA 5EM8A 4K0YA 4G16A 3OP5A 4FMQA 2XK8A 2QD9A 3GU5A 4OAVB 2BRBA 2C68A 3R9NA 4FEWA 4FKWA 2PVMA 2BRMA 4EOMA 1FGKA 2IVVA 4YNEA 4ZTMA 1OBGA 3KMWA 3FLQA 4QD6A 1UU8A 5CASA 2PYWA 1WBSA 3CJGA 3KULA 2IVUA 3FMMA 1H1SA 4RG0A 1YW2A 4YJNA 5BMSA 4IAKA 4D4SA 4JR3A 2EXEA 4FI1A 3VS7A 3DDQA 3AMAA 3SAYA 5CAPA 2XNPA 3FMEA 3A99A 5M06A 2ZV7A 3F2NA 4RJ4A 4G34A 4YHJA 2J90A 4FVPA 5E92A 4BDDA 3TV4A 3FXXA 3DBCA 5EDRA 5M57A 2UW6A 3LW0A 4I21A 3OWJA 4FTKA 4XG7A 5DA3A 4BZDA 4C35A 4U5JA 2JGZA 4ZTHA 3U87A 3CQEA 2PZRA 4B99A 1W7HA 3EN5A 3TT0A 1XH7A 1OITA 3ZO3A 3F3WA 3NUYA 4DFUA 4MXYA 2CGWA 3GT8A 4FOBA 1CMKE 4JQ7A 5FTQA 3WF9A 2C6DA 2FO0A 3HL7A 3JUHA 3EL8A 1WVWA 4Q5EA 5ETAA 4M7IA 4F6SA 4AW0A 4HVSA 2QHNA 3GI3A 3PVUA 4QMUA 2UW0A 4R1YA 4XYFA 1WBPA 3QYWA 3RI1A 4AE9A 1URCA 5KHXA 2RIOA 3CS9A 3PZHA 5A3XA 3D14A 3UIBA 3AMYA 4GEOA 5L6OA 3PA3A 2UVYA 3FUPA 3FI8A 3Q96A 4BDCA 4I5CA 1K3AA 3P7BA 3TV6A 2BHHA 3GNIB 2ITUA 3AC5A 4U0IA 4WG5A 4K33A 3MSSA 3UDBA 1UV5A 4C4FA 4DTBA 4EC9A 4UZDA 4F6UA 5HLNA 3QCSA 4KB8A 3SKCA 2YHVA 3O8PA 4ASZA 1IASA 3P78A 3U6JA 4QMNA 5E8TA 2C3IB 3MFTA 4ANMA 4S34A 5ACBC 3VBVA 2EXCX 2DWBA 3BHVA 3DTWA 3H10A 3M1SA 1E9HA 3C0HA 3P7AA 5AJQA 5E8VA 5AR8A 5AV3A 4F65A 3ALOA 1MRUA 3QL8A 4UYNA 4YZDA 2GHGA 1NVQA 2P33A 3RZFA 3CKWA 2XIZA 1PXJA 2FH9A 2Z7LA 4Q5HA 5BMMA 2GFCA 5M53A 3QKLA 4RZWA 4BWPA 2WB8A 5M09A 2XNBA 4LUEA 4QTBA 3L8VA 2PTKA 4FTLA 1APME 2G9XA 1DS5A 2YIWA 3COHA 3IO7A 4QTCA 5JZNA 3W2QA 4EKLA 5L2SA 2OG8A 1Q8UA 3COIA 3KXMA 2YAKA 3OFMA 3TUCA 2PUIA 4EOLA 2W4OA 5TT7A 4O82A 3ZEPA 1ZYSA 3ORMA 4LI5A 4I22A 4FIHA 2A2AA 5JFXA 3DKGA 3UG1A 2RFDA 3T8OA 4HCUA 1KE8A 4MWIA 5HVYA 3L8XA 1H25A 4FKUA 4Y8DA 4CSVA 4FTIA 3NNWA 3ORZA 5CVHA 4CMOA 4U3ZA 4X2KA 3TDWA 2BHEA 4M0YA 4AGUA 3NZ0A 3EZVA 1YWRA 2UZLA 3GC9A 2QI8A 4MD9E 5AUYA 2XYNA 2XH5A 3PSBA 5GIPE 3W32A 3VRZA 2EB2A 4OW8A 4ACHA 1H00A 4NTSA 2J50A 5FP6A 4RIXA 5A4EA 4A9YA 4D55A 3O2MA 2OIQA 2F2UA 3IW5A 1SVGA 3FWQA 4ZJIA 3I0QA 4QP3A 4IANA 3DGKA 4QP1A 3RJCA 1QPDA 4TPTA 4FZFB 1OIYA 5CEIA 1PMNA 1PXMA 3H9OA 5CF8A 4HGTA 5LJJA 5EDPA 2RFEA 3QA0A 4EK3A 3IONA 4MH7A 3RPSA 4AFJA 5C03A 3U6IA 2C0OA 2G01A 4IIRA 4KWPA 3V8WA 5FXRA 4CRLA 1GZ8A 1P5EA 3OMVA 2F2CB 3GU4A 3MH3A 1YXXA 2OXDA 2YIYA 3Q52A 4OAUC 1TQIA 1J3HA 2W05A 2C5NA 4PWNA 5LWNA 1JKLA 4D4RA 2Y7JA 5AP1A 3EYGA 3L8PA 3AMBA 1QPCA 3C4XA 4V0GA 1H28A 4N6YA 4WG3A 3PFQA 2V22A 1J91A 1NVSA 4AT3A 3FKLA 4IJPA 5CTPA 5TF9A 2WTCA 4QPAA 3R2YA 3SC1A 4AZWA 5JN2A 3OXTA 3UZRA 2CN8A 3GXLA 4TTHB 4BCIA 5LWMA 2PZYA 5KMMA 1FGIA 1XBBA 2OW3A 4HNIA 3F2RA 3QTIA 4NW5A 3PXFA 4IACA 3W1FA 5A4QA 4O2PA 4RQKA 3MTLA 3FBVA 5JGDA 5HE3A 1Q24A 1UU3A 1GIIA 4ANSA 5F95A 2CKOA 3LOKA 3QUEA 1BKXA 3ZC5A 1FMOE 2ETMA 4GS6A 5L8KA 3LCOA 2OGVA 1Q62A 2VTSA 3EFLA 4GVJA 4S31A 4A4LA 3LFCA 3ATSA 3KMUA 4IC7A 4BCKA 1OB3A 2O8YA 4IVDA 2R3HA 2VWIA 2O3PA 3E63A 4DGNA 4XS2A 4EUUA 3FLSA 4YZBA 3V3VA 3R8VA 4BCMA 5HORA 5IH6A 2YLEA 4IW0A 4YTFA 3A7JA 4UMUA 2QCSA 3JYAA 5I3RA 3TM0A 4GFMA 5EHLA 5AV2A 3DAKA 3Q4CA 4AUAA 1ZYDA 4D58A 2WHBA 3PWYA 2PSQA 3PSDA 3E8DA 3UOKA 2VN9A 4GKHA 4FZDB 5KBQA 2JD5A 4D5HA 2W4JA 4WSQA 2RG6A 4APPA 2XVDA 4RQVA 3H9FA 1PW2A 3E8CA 4I0SA 3UPXA 2F7XE 3SG8A 4C8BA 2YAAA 5DR6A 5HNGA 4XP3A 4FVQA 1OL2A 3H4JA 5AM7A 3TCPA 1KSWA 2W9FB 5KO1A 3DJ6A 3OROA 5E8ZA 3G15A 3Q9XA 4DFXE 4TNBA 3Q9WA 3WE8A 4GUBA 2XK3A 3RP9A 3WOWA 4U43A 4QYEA 2NO3A 4YSMA 3LVPA 2BTRA 3O0GA 4ID7A 4XEYA 4RX8A 1AQ1A 5DT4A 1H1QA 4RZVA 4XP2A 5E9EA 4K6ZA 3KA0A 2REIA 5CENA 2E9VA 3KK9A 3ZSIA 5E1EA 5HE2A 4FIJA 3QTXA 3P7CA 3E93A 4DGOA 4TWCA 4YBKA 4Z9LA 4BVUA 5IA0A 3I60A 5DRDA 4MBJA 2ACXA 4K2RA 4DLJA 4AWIA 3BE9A 4KAOA 5M56A 3HUBA 5CAUA 4DEEA 4GYIA 1ZXEA 4BBFA 5LOHA 4FIFA 5FP5A 1OPLA 3PZEA 5A14A 2WAJA 2PE1A 2QOFA 3FSFA 4ZEGA 3ROYA 4YU2A 3K5VA 4XHKB 2O63A 1REJA 4G17A 2XM8A 3V8SA 3MV5A 4FKQA 4J99A 5JGBA 3PLAE 1QL6A 3GU8A 3U4WA 3KXNA 4CCBA 1WAKA 4TXCA 5IA5A 2R3QA 2VUWA 3OBJA 3IDCA 4LFIA 4L43A 3NYXA 3OOGA 4ZY5A 2XF0A 2YN8A 3C4FA 3R02A 4FKJA 4D1ZA 4NM7A 4NM0A 4UN0C 4E8AA 4OGRA 3V8TA 2H6DA 4L8MA 3ROCA 1WMKA 2VTTA 3MB7A 3PVGA 4M66A 4N70A 2LAVA 1ZYCA 3D15A 1H07A 3DTCA 3RAWA 4ARKA 4CZYB 5F9EA 3LLTA 3NUAA 4G9RA 5CNOA 4AW5A 2RL5A 4RJ7A 3MDYA 4F1OA 1BLXA 1LP4A 4NIFB 3R7OA 3ZO2A 4DYMA 1YRPA 1Q97A 4YLLA 4EOPA 4XG3A 3U6HA 1CDKA 1UU7A 3CTQA 4F9CA 3DXNA 3HA8A 4ALWA 4F7LA 4UMQA 1XKKA 4FSNA 3BYOA 2PZPA 4MXZA 1FBNA 3SHEA 4FL2A 4YNOA 4YPDA 4A9RA 1PMVA 5DT3A 3L1SA 1OIUA 2RFSA 2UZNA 1WBTA 3Q5IA 5EYCA 3UGCA 2H9VA 3FE3A 2YFXA 4O2ZA 3KMMA 3N51A 3PJ1A 4V0GB 2VX1A 4RWLA 2W9ZB 4RGJA 4XV3A 4NM3A 1L8TA 1YWVA 3VW8A 4RFZA 4II5A 3HZTA 2BZKB 3IOPA 3JY0A 3R04A 4LGGA 3MVMA 5CU3A 3TZ9A 5J5TA 1B6CB 3GUBA 2F4JA 4S32A 2VGPA 1W83A 2HW7A 3ZFXA 4IADA 4ENYA 1PYXA 4U6RA 3UO6A 3W10A 3VHKA 4OT5A 5JQ8A 4RIWB 3G6HA 1LPUA 3RAIA 3VN9A 1GZNA 2VD5A 3CTHA 4KBKA 4YJOA 3Q4TA 2QKRA 4GFOA 2XJ1A 4EYMA 3TDVA 3ZZWA 3Q9YA 4PMSA 4FKPA 4HPUE 3SQQA 2DS1A 5J79A 5IQAA 4O1OA 3BYVA 5FEDA 2IZUA 2P55A 3BYSA 5TE0A 3HAVA 4F09A 1TKIA 4FG7A 3F6XA 2X8IA 3S1HA 1YXSA 2WIPA 3SD0A 1U59A 1H4LA 2ONLA 3F88A 4FSQA 4PQNA 1ZYJA 4RSSA 2YIRA 4E4NA 3PJCA 4R1VA 2OF2A 5I9VA 4F7SA 2PVJA 3T9IA 2G2IA 4Q9ZA 3MJ1A 1R1WA 3QF9A 3U9CA 3MVHA 4D2PA 4ZAUA 3VAPA 1IR3A 3LE6A 3BE2A 3TIYA 4NWMA 4F0IA 5I3OA 3LJ0A 2ERZE 5JEBA 5GJGA 3U55A 2IWIA 4EHGA 3R9OA 4QPMA 3QQLA 4WBBB 3FPQA 4YJTA 3HRFA 3PE1A 4G31A 2GNGA 2OJJA 3EZRA 4FKLA 5E8SA 5F94A 4YP8A 3FL4A 5E90A 3ZDIA 1Q8WA 1KV1A 1VJYA 3AD5A 2IG7A 1A06A 3LJ2A 4L00A 3S4QA 3AT4A 1UA2A 4H58A 4O0WA 4OBQA 3LFNA 3REPA 4GYGA 4BYIA 2QOKA 4MTAA 4XJ0A 2YDKA 5AIRA 4PPAA 4FT5A 5C8KA 2ZVAA 1WCCA 4XV9A 3LQ3A 5DRBA 3H0ZA 3ID6C 2WKMA 2ZMCA 4E20A 4WSYA 1FOTA 2OO8X 3ENMA 2OXYA 2J0KA 5HG5A 2WD1A 3SRVA 4PNIA 1Q8YA 4C02A 4AGWA 3EKKA 2BKKA 2YDIA 1AD5A 4M68A 3VJNA 3BCEA 3ZRMA 3KVWA 3QTWA 4QP9A 3QZHA 1KE7A 2GNFA 4X2FA 3PPJA 3DXQA 2YIQA 4KIQA 2CCIA 4GG5A 4TZRA 4FUXA 5D1JA 3F82A 3A7IA 3MH2A 4QPSA 3I6WA 2QOQA 4XNEA 5B2MA 3I7CA 3CY2A 3E8NA 1W98A 3RAHA 3VS5A 4GK2A 2V0DA 4L67A 2B0QA 3HV4A 4PX6A 2YM4A 3EL7A 3SVVA 1O6KA 1OL7A 4JVGA 1DAWA 4YC6A 3UE4A 2IN6A 2CNUA 4WHZA 5A4TA 4LM5A 1H1WA 4QMTA 3LAUA 5JH6A 4ORKA 4O0UA 4FSMA 5H2UA 3ZUUA 4HVIA 3PIYA 4IWQA 4BWKA 2CN5A 3TKHA 4L3PA 1SZMA 3UO4A 1H26A 1Y57A 3QTQA 4UYAA 2BROA 1YI4A 3Q9ZA 2ONLC 3DJ7A 3IGGA 4ZZOA 3SW7A 5C4LA 3RKBA 2QOIA 5EM7A 2W4KA 4BI2A 3OBGA 5CU4A 3R9DA 4L7SA 4FNYA 4DT9A 3VO3A 4TW9A 3F3TA 4MYGA 3POOA 2J5EA 3WZUA 1SVHA 2UZWE 4AFEA 3R1QA 4E5WA 4EH8A 1OUYA 2WQMA 4QP7A 3KRWA 4BIEA 3NMUF 1OKZA 3O96A 5IQGA 3DA6A 4DFLA 3GQIA 3PJ8A 4RIYA 2QLUA 4HVHA 5J9ZA 3WF5A 4XG2A 5I5ZA 4IDVA 4KINA 3TWJA 1VYWA 4E6CA 5BVNA 2IZSA 4JXFA 3QD2B 5CALA 3DB6A 3KN5A 2X8EA 4U45A 5CS6A 3SDJA 4A7CA 3N4UA 5JKGA 3UQCA 3KL8A 4ZSEA 1H08A 4FG8A 1R78A 2C1BA 4RPVA 4DGLC 5AUVA 3BEGA 4AGDA 4LG4A 3R63A 4EJ7A 3HVCA 4FX3A 4FT9A 2JDTA 5IISA 3LZBA 3ORPA 2IW8A 1Z5MA 4JRNA 5EOLA 4ASEA 5HVKA 5L2TA 4R3RA 4QYGA 4R7BA 1BI8A 3CD8A 2ITQA 3E3BX 3MH0A 3QD3A 5AMNA 3CGFA 2OF4A 2WMBA 3G90X 3NCGA 4P5QA 2XK4A 2QG7A 3E87A 2J0MB 4IE9A 2YACA 4GFGA 3II5A 2B9HA 2P0CA 2ITNA 1H24A 3GGFA 4ZMEA 4YR8A 3HX4A 4NT4A 3PY3A 4MXCA 3DLSA 3GCPA 4IB5A 4BDGA 2ZYBA 3MN3A 3GCQA 3ERKA 5GIOE 4DH8A 2XBJA 1X8BA 4QP6A 2BRGA 2WMSA 1ZZLA 4TWPA 5HOAA 4DH1A 5JFSA 5L2WA 1UNLA 2OJ9A 2V5QA 2PVNA 3VWAA 3ZH8A 4C34A 4DAWA 2QOLA 3I7BA 2WNTA 2A19B 3C50A 4H3PA 1YHSA 2ZDTA 3FYJX 3GOPA 4R7HA 4FNXA 5KCVA 4LOQA 4D5KA 2JAVA 5HU9A 4KABA 4C59A 3LMHA 4ITHA 4OTGA 3T9TA 4D0WA 4ZSJA 4HOKA 3WZJA 3FDNA 4I41A 3DY7A 4JAJA 3L9LA 5KMJA 2Q83A 5M07A 2VWZA 3PDTA 1MRYA 1NVRA 4QO9A 5IA4A 1A48A 3P08A 3LXNA 4GG7A 4DN5A 2UW4A 3VQUA 2C6KA 1UU9A 2JKQA 4QMPA 2IJMA 3PSCA 3NSZA 4IWDA 2C6IA 4YJRA 1XBAA 2YCSA 4EOQA 4USFA 3QUDA 4Q9SA 5DT0A 3WF6A 3TTIA 3RHKA 4NUSA 1PRYA 4OTPA 3NRMA 4S30A 4YBJA 5LMBA 3BHYA 4V05A 4C4JA 5FEEA 4BBMA 3C1XA 3HMOA 3MJ2A 5EI6A 5IEYA 1XH9A 4FZ6A 4WKQA 2PMLX 2X7GA 5H8GA 4DG2E 3GC8A 3FKOA 2VV9A 4YMJA 2X0GA 3NIZA 4XV1A 4I4EA 5DNRA 2JIUA 2C3KA 3QC9A 3BLRA 4I5HA 3ENHA 2X4ZA 3UNKA 5EQYA 4IEBA 1CKPA 2HWPA 2IW6A 4K9YA 3VS4A 2B52A 3F3UA 3R73A 4DGGA 4NFNA 4IQ6A 3PA4A 4Y5HA 4ANQA 5FEQA 1TQPA 2ITZA 1S9IA 3RCDA 3RWPA 1O9UA 4LOPA 5L2IA 3SRVB 3GC0A 2KULA 5AR5A 4F9BA 4CGAA 2Z60A 5L6PA 5CZHA 4G3CA 3KCFA 2OI4X 3FZSA 4CZTA 5HG8A 5LVNA 3GU6A 2XJ0A 5G6VA 4DE4A 3D0EA 4FK6A 1PMEA 4I6QA 4IVBA 2J6MA 3R8PA 4YTCA 3VF8A 2BZHB 5BVEA 2QC6A 4JL9A 4NJ3A 1KV2A 4JR7A 4MWHA 3R7IA 5C26A 2PMNX 3BPRA 1M52A 1M2PA 2GMXA 4KKHA 3NW7A 3D7TA 4F08A 1GY3A 2FSMX 4X2NA 4W9XA 1Q8TA 5L3AA 3L9PA 4DEIA 1Q4LA 3R00A 4R78A 4ZZNA 1G8SA 2LGCA 1ZRZA 4ZY6A 3PPKA 5T6KA 4RVTA 4AGCA 4YPSA 4QQTA 4XG4A 4YZNA 4MKCA 4AN2A 5HU3A 3OVVA 2C30A 3LJ1A 3Q4ZA 4IM0A 2BDFA 4U8ZA 4ACCA 5CEPA 1UWJA 4M15A 1ND4A 2HENA 5J8IA 1GOLA 2ITVA 2VTOA 4M8TA 2XUUA 4WBOA 2E9OA 3RM7A 3UOLA 3WZDA 4ZLYA 2PMIA 4PPBA 4YJPA 4KA3A 1NXKA 3C5UA 3M11A 1B38A 2XNOA 1TQMA 2HY0A 2VNYA 3ORKA 5B2LA 5CAVA 4E6AA 3CEKA 3DNEA 3OCGA 4I5MA 3U51A 4RMZA 4C36A 2G2HA 4LUDA 4ZY4A 1QPJA 3HLLA 3M2WA 2WQBA 4RIYB 3ZFMA 4AA4A 1Q61A 3FC2A 3ODZX 2BUJA 3HDMA 3QCXA 2R3RA 2QU6A 4MCVA 4JOAA 4JAIA 5DR2A 3G0EA 4H05A 5LQFA 3C4ZA 3QXOA 3EN7A 1SVEA 2VTHA 4Y83A 3C7QA 4ZTRA 5FM2A 4FSUA 4TYIA 2R3JA 2WOUA 3H9RA 3MY1A 4RC3A 4C4HA 3HMIA 4ONAA 3F5UA 4R5SA 2HW6A 4FKIA 3TTJA 1UKIA 5TOZA 4OLIA 5K5XA 4BTJA 3KEXA 4BZOA 1JSTA 5AX3A 2QLQA 4GKIA 3TNQB 3QHRA 3WILA 3UQGA 2PHKA 3VBXA 4EEVA 4EQCA 3BQRA 3OW3A 4I5PA 2WXVA 3I5ZA 4J7BA 1YWNA 4AW2A 3FLZA 5DH3A 3AC2A 3R7YA 4C2VA 4H1MA 1EH4A 2NRUA 2QNJA 2OJFE 1URWA 4HGSA 3DXPA 5AUUA 2RFNA 1Y91A 4B0GA 2PK9A 2EB3A 5D10A 4O7VA 5HBJA 2GNLA 4W4WA 4K11A 5AP5A 2I0YA 4JQ8A 3QC4A 5AA9A 5AP2A 3HDNA 5IA1A 3EQHA 5HE1A 1NY3A 3K3IA 5HIDA 4ZS4A 4U44A 3F3ZA 4YHTA 4RX9A 3PIXA 4XG9A 2BRNA 3PYYA 3KVXA 4MEDA 2UW7A 3QQJA 2R7BA 2JKKA 3TNPC 1XH4A 3NUPA 1R39A 1DM2A 4HVDA 5AP6A 3CCNA 4KS8A 5HBEA 4QTAA 3WZEA 3ZM4A 3BELA 3NLBA 5FTOA 2CGVA 4X7QA 4EOIA 4PMMA 4ZS0A 5DEWA 3L9NA 3NYVA 4GW8A 1Q3WA 2BVAA 2ZM4A 1JPAA 3OOMA 3G33A 2OU7A 4CT2A 5CX9A 3ORIA 2PZIA 3EQFA 1MQ4A 4FKTA 4LYNA 3KGAA 4DG3E 4E4MA 3ZMMA 5E8UA 4O0YA 2WEIA 3F3VA 4IZAA 4LL5A 4YTHA 5AP7A 3JR1A 3OUNB 4FKGA 1ZWSA 3H30A 4DFNA 4IH8A 4EORA 2J5FA 4ACMA 4NCTA 3FMDA 3TZMA 3BI6A 4KNBA 2VO3A 5EOBA 2Q0BA 5AAGA 1SNUA 1F0QA 2XNGA 3QRIA 4QT1A 4BBEA 3MIYA 4FOCA 5LXMA 5E4HA 2QO2A 5DPVA 3I81A 3R30A 3QQKA 3LFFA 4FODA 3BQCA 4QMZA 4ANBA 4MK0A 4BCQA 3NUXA 2C0IA 3F5GA 2W1GA 3CTJA 4EH6A 3AT2A 4GVAA 3CR0A 4A4XA 4J96A 3R8ZA 4CQEA 3UVPA 4LRJA 4XG8A 4UEUA 2JKOA 3RHXA 5CY3A 1O6LA 2FA2A 4ZTLA 2Z7SA 5HNIX 3EJ1A 1IAHA 1JSUA 2UZEA 3R1YA 3DJ5A 4JBQA 1M14A 2PVLA 2YA9A 5KNJA 1BI7A 2ZB0A 2W0JA 3OEZA 3ZS5A 4CKRA 4QNYA 3LFEA 3D7TB 5H8EA 4QRCA 4BY9E 4AU8A 4Q2AA 3MFRA 4FV4A 2XA4A 4QMQA 2FSLX 5AR4A 2ZMDA 4GSBA 5I4NA 4CV9A 3RK9A 4D9TA 2UZVA 2R3NA 3E64A 1BUHA 5D12A 1DI8A 2OZAA 1IAJA 1H0WA 1PF8A 2AYPA 5D7VA 4NIFA 4UZHA 2C6TA 5EYMA 3A2CA 5EKNA 4FL3A 3Q53A 2JKMA 3PY1A 1IRKA 5EM5A 2J51A 3ANRA 5ETFA 3AG9A 4Z3VA 2VGOA 2EVAA 4FYOA 3VS2A 2GQRA 1YDTE 1R0EA 4DGMA 1YDSE 2FSTX 3LXPA 4FV7A 5B0XA 4DG0E 2CSNA 2XIRA 2PWLA 5I9WA 3V5JA 4BYJA 2UZBA 4FV5A 3R28A 5AIKA 3QWJA 5F1ZA 3OCSA 2IZRA 4CFVA 4ZJVA 3A8WA 3QRUA 3VUTA 3PPZA 5EFQA 3NW6A 3RINA 4FV3A 3GOKA 3BLQA 4IVAA 3Q04A 3R21A 5HBHA 2WU6A 3R2BA 2XBAA 3OT8A 4DH3A 2IPXA 4EK5A 5FLFA 4FUYA 4FT0A 1HCLA 1ZMUA 3IK3A 4ZZMA 4RIWA 2AC5A 4L42A 4NCTC 3JY9A 2WGJA 3ZSHA 4F63A 5E7RA 2FUMA 3PIZA 3O71A 3H0YA 4BDHA 4EH2A 5EI8A 2HZ0A 4L45A 2UVXA 4O22A 5AV1A 4IMYA 2ZAZA 4DBXA 3P5KA 4J95A 4O7TA 1GIHA 4IXPA 5AX9A 4XOZA 5EG3A 1OECA 1PKDA 4UMPA 5HIBA 3F66A 4GU9A 2VTLA 2HZ4A 3WYXA 3EWHA 3ITZA 2BFXA 5BYLA 4BHZA 4OR5A 5AP4A 5ANIA 5FGKA 1U46A 3P23A 4QMYA 4CV8A 5JZJA 4UX9A 3KY2A 3A61A 2QODA 3BBTB 2WMUA 4FTMA 1LUFA 3TNHA 5HLWA 3ZC6A 3KF4A 5IKWA 3UTOA 3VBWA 4C62A 2X9EA 3AC3A 4FTQA 3HYHA 4UMRA 3UZTA 2W99B 3CPCA 3O50A 4IAZA 2OWBA 4IM2A 5LCKA 5CANA 3LHJA 4ACDA 2I0EA 3NVMB 3ORTA 2X4FA 4FTTA 5JSMA 1M2QA 3WIGA 2JAMA 5FM3A 5AWMA 5C9CA 2JIVA 5ETCA 5CF6A 2H96A 3FY2A 2I1MA 4K8AA 5HO8A 4CXAA 2X9FA 2YZAA 4K18A 3BWFA 3P9JA 4G6NA 4D28A 2EUFB 2R4BA 3EQBA 3TL8A 4XRLA 4YLJA 4AZTA 2UW3A 2CPKE 4AT4A 2W5AA 4ANNA 1JWHA 4WIHA 2HCKA 4QP2A 4X21A 4KKGA 5AR7A 3EN6A 2JDRA 3RPOA 4EZ7A 2VX0A 5HTCA 3UVQA 2OJIA 3UYSA 4BKJA 4BWXA 2W7XA 4BCOA 3NVKI 5AV4A 2UW5A 4ENXA 1KOBA 3PVWA 3R83A 2I0VA 4CKJA 3TUDA 5IQDA 4GJ3A 3PXZA 4JG7A 4YLKA 4EWHA 5CSWA 1W84A 3PXKA 3HV6A 3L8SA 2C3JA 1V0PA 4XBUA 2G2FA 3VQHA 3ZLXA 2C4GA 4MXXA 2VO6A 2ZOQA 1CKIA 1PXIA 2UZOA 5HCYA 4A07A 1H0VA 2O64A 4BHNA 4DEHA 4IB1A 2VTPA 1Q8ZA 4R3CA 1WVXA 1QPEA 4FBXA 3SGCA 5KE0A 2Z7QA 4QP4A 3WI6A 4BICA 4ERWA 4U9AA 3UNJA 3TZ8A 3UIUA 4B4LA 4O0SA 3I6UA 3S0OA 5D7AA 3RK7A 4BCGA 2UW8A 5IUGA 5HO6A 4BI1A 4CYJA 2HZNA 5D11A 3ZBFA 4JT3A 4WOVA 1GNGA 2QOOA 4FTNA 3VUMA 1K2PA 4E6DA 2UZDA 1OL1A 3LIJA 4OBPA 5CQWA 3LCKA 2WQEA 4NJDA 4O21A 1OI9A 4RWJA 3HEGA 3QRKA 4P5ZA 5M4CA 4BDEA 3R6XA 2B7AA 4RVKA 5A9UA 3GBZA 3SXFA 2O65A 4USDA 3G2FA 4R3PA 5IMXA 4D2TA 3DBQA 5DOSA 4FIIA 2GNIA 2HZIA 3TZ7A 4DEDA 2WTWA 5KMOA 3D4QA 4R8QA 4EK6A 3FEGA 3GFWA 4O38A 4M14A 4PDPA 4TY1A 4RWKA 4PDOA 4EL9A 1FVVA 3VW6A 3TN8A 2X7FA 1DAYA 3RPRA 1LR4A 2OZAB 2Q0NA 3W8QA 3IECA 5DBXA 5ANJA 4F0GA 4AT5A 3W2PA 4JNWA 2JFMA 1Z9XA 4BDBA 5LVPA 2HAKA 4GUEA 3ZHPC 2C47A 3TNIA 2PVHA 4ITIA 4RC2A 2SRCA 3HMMA 4BTMA 4JBVA 1XHAA 2VWUA 5KX8A 4RFMA 3LMGA 3G0FA 2GQGA 3FMJA 2B9IA 3BV3A 4FV6A 3AQVA 4O7WA 3UYTA 4ITJA 2ITPA 5K3YA 3DBEA 4CTCA 5KMIA 2JITA 4R5YA 2ERKA 3QAME 3UVRA 2I7QA
chains in the Genus database with same CATH superfamily
3QALE 2HELA 2PVYA 3D2KA 4M69A 4W8DA 2B54A 3DQWA 3LXLA 3RNIA 4BF2A 4FTCA 2BCJA 4LL0A 3LLAA 1OPJA 5CU6A 4DFYA 3CC6A 4WUNA 2Z2WA 2C5OA 4KUJA 3G9LX 2W5BA 3F2AA 1PXKA 2IEWA 3DKFA 2XMYA 4RVMA 3ZYAA 4RFYA 4EOSA 4KBCA 2QONA 4PTCA 4U41A 4C4GA 4RA5A 2GHLA 2XCHA 3NUNA 5CSVA 3RGFA 5T3QA 4AZVA 1OUKA 3MFSA 2HIWA 3KQ7A 1KUTA 3KXHA 2G15A 4AG8A 4E1ZA 4PY1A 3QHWA 4MNFA 4U79A 4EH5A 5KKRB 4E73A 3NUUA 4FRFA 5ANDA 2PY3A 4GK4A 1UWHA 3I79A 1MRVA 2UZTA 1ATPE 2WMWA 1J1BA 4MD7E 5FWKK 5GHVA 4C37A 3PJ2A 4IB0A 4CEGA 5DEYA 5AAEA 2YWPA 4FL1A 2FB8A 3C0IA 3DFCB 4UALA 1ZOGA 1YHWA 3O8UA 3NFFB 4C3RA 5BNJA 2X6EA 4IC8A 3FI4A 1H01A 5HNBA 4XRJA 3LFBA 4CG8A 2FYSA 1PXLA 4BR3A 3FY0A 3OS3A 4NEUA 4TYHB 3E8EA 4CT1A 5IQCA 2OFVA 5HTIA 4B6LA 5ANEA 4ALVA 3N4VA 2XB7A 3CXWA 2XK7A 3UIMA 2CMWA 3AKJA 1YVJA 2W17A 1QMZA 3OTVA 3VUGA 3AD6A 4C4EA 1BL6A 1K9AA 2EU9A 3BGQA 4K1BA 1ZY4A 3BYMA 4Y73A 5CU0A 2Y4IC 2IZTA 3PG3A 2WTVA 3KCKA 4E5BA 1YHVA 2GDOA 2R64A 3A7GA 3V6RA 2VWBA 5IEVA 2QURA 1Y8YA 1UNHA 3QXPA 2J0JA 5AUZA 4ZTSA 3EQDA 3W2RA 3A8XA 1ERKA 3A7FA 3PRFA 1OKVA 4Z7GA 3AD4A 5FG8A 2OJGA 2HYYA 3GVUA 1BL7A 5IF1A 3PP0A 3PP1A 3PFYA 2GU8A 2P3GX 2RF9A 4AQCA 3IQ7A 3KXZA 4DA5A 2BIYA 3KK8A 3ULIA 3D5VA 4I1ZA 4LGDA 5CQUA 1BYGA 4GIHA 2VTIA 3F5PA 3ZU7A 4BJJB 4FK3A 4YGAA 2XS0A 4IWOA 3W55A 3IPHA 5KUPA 1P14A 3MS9A 4NKAA 1OGYA 1ZZ2A 4MD8E 2CHLA 4JMQA 4XG6A 2HXQA 2GQSA 4O83A 3BEAA 2KTYA 2W1EA 1FINA 4DBNA 3BIZA 1FVRA 1CSNA 4JJRA 2GFSA 3MPTA 5AUXA 5HESA 3VUHA 1PXNA 3HP5A 3KFAA 4D1XA 4FGRA 4FJVA 1VZOA 4DH5A 1XH6A 3QTSA 2XRUA 2V62A 3OXZA 5CEKA 4JDHA 5HQ0A 4MAOA 4XX9A 2EXMA 4E93A 2J0IA 3OWPA 1HOWA 3ATTA 3UQFA 2ZV2A 3DT1A 4CG9A 2E2BA 5ANGA 5IU2A 3D5XA 2PVRA 4FT7A 3RWQA 3SXRA 3KB7A 3Q4UA 3QKMA 4AN3A 2UZUE 3FMLA 5K0XA 3ETAA 4HZRA 1H1PA 4AZEA 4OBOA 4C3FA 1W8CA 4EWQA 4GH2A 1IEPA 3SG9A 2Y4IB 2F7EE 1SNXA 1OL6A 4O4FA 4NM5A 4O1PA 2Y9QA 4JDIA 3CP9A 3GCVA 3ACKA 2PE0A 1JQHA 2VX3A 3QWKA 3VIDA 4G5PA 3RM6A 3JPVA 4GJ2A 2GS7A 2B9FA 4RC4A 1UNGA 3PE2A 2YISA 1OMWA 3P86A 5HTBA 5H9BA 3GP0A 5J7BA 1JNKA 2QVSE 1ZYLA 2X39A 5E8YA 3TNWA 2C1AA 5IH4A 3EQIA 4FV0A 1OM1A 2V55A 3EKNA 5I0BA 5BQ0A 4CYIA 1WBVA 1RQQA 5GZ8A 5AUTA 4AXEA 4O0VA 5FBNC 5M4UA 4AXAA 2XNMA 1KOAA 3AXWA 1GAGA 4GK3A 4IZ5A 4MQ2A 2Y6MA 3EHAA 3G5DA 4W4VA 4YC3A 2JIIA 4P7EA 2A27A 4O0RA 5D41A 4F0FA 1FMKA 4M69B 3KRLA 4O7YA 3FMKA 3HUCA 3BL9A 1WZYA 3P4KA 5J9YA 4W8EA 1L3RE 1WBNA 1OZ1A 3AT3A 2YM8A 4FNWA 4GU6A 4LRMA 3FMHA 4NK9A 4R6VA 3UIXA 3D5UA 4ZJJA 5E8XA 1GZKA 3QQGA 3RPVA 4B7TA 2Y4PA 4J52A 4BKYA 4CRSA 3QTZA 3DK7A 4N57A 4R77A 3LM0A 3WBLA 2XEYA 3NNVA 1R0PA 4GT3A 5BVKA 1MP8A 3DBDA 5J95A 5AUWA 1SYKA 4O27B 4EK4A 2BZJA 4PNKA 4I23A 3TMOA 2AC3A 4M84A 3ORLA 3EFJA 3PXQA 4C4IA 4XH6A 3A62A 4GMYA 4DHFA 1PXOA 2OKRA 4YZ9A 4AA5A 4ANLA 3NUSA 3B2TA 3B2WA 4FEQA 3WZKA 1GIJA 3NW5A 3NWWA 4TT7A 4S33A 2X81A 2R3GA 3CE3A 4IFGA 5DI1A 3ZDUA 3GQLA 4A9TA 4D0XA 1CKJA 3LQ5A 4KD1A 4NL0A 4MF1A 4BKZA 5AEPA 4USEA 4QMXA 5EQPA 4KS7A 3ZTXA 1ZMVA 2BDWA 4UWBA 5L4QA 3ZBXA 1F5QA 4JX3A 3ELJA 4I3ZA 5BV3A 2QO7A 2XCKA 3DZOA 4L52A 1OKWA 3CIKA 3BGZA 4QQCA 2DQ7X 3V5PA 3RZBA 5CLPA 3ZO1A 5CVFA 5DHJA 4RX7A 2W1CA 2ITYA 4DEGA 3NNUA 3A4PA 3MESA 3LPBA 2JEDA 4DCEA 1VEBA 2XZSA 2RKUA 2YCFA 5HX6A 2ZFYA 1YXUA 3QKKA 3K3JA 1H8FA 3MH1A 3T3VA 3Q2JA 2XK6A 4S2ZA 1G8AA 2CKPA 1U54A 3MPMA 3QQUA 3FXZA 4F64A 4YJUA 3ZZEA 1PJKA 1JAMA 5HE0A 5LVLA 2YCRA 2C5VA 4FEVA 4DHZA 3VUIA 4FG9A 1W2CA 3UC3A 3ZM9A 3R7UA 2OK1A 2OZOA 2PUNA 4X6QC 3VBYA 2OSCA 2NP8A 4BN1A 4BZNA 5AFVA 2VZ6A 1DI9A 5AA8A 1JBPE 3HGKA 3QRTA 4FSYA 3D94A 3LFSA 5CI6A 1RW8A 2E9PA 5HKMA 4RLLA 5JGAA 3FYKX 3O8TA 4LOOA 2OIBA 2GNHA 1STCE 3LXKA 5EHYA 3VHEA 3D2IA 5KHWA 5AP0A 4G3DA 4MHAA 3NGAA 4MUQA 4J8MA 4KBAA 1ZOHA 5H8BA 4C33A 5IDPA 4O7ZA 2EWAA 4DC2A 3AGMA 3P1AA 5FRIA 3NPCA 2IW9A 2V7AA 1SM2A 5M55A 3MWUA 4BL1A 4Z55A 1OVEA 4FIEA 2F49A 4D2SA 4F7NA 5FD2A 4RA4A 4AX8A 3QTRA 4UV0A 5HGIA 2X1NA 3HV7A 5IUIA 4Y5QA 5LMAA 3EFKA 5FDPA 2Z02A 3I4BA 3KXXA 3W0MA 5BYYA 3FI2A 4UBAA 2OICA 4AZFA 4RX5A 5CF4A 3BLHA 3KRJA 3R7GA 5GINE 3R9HA 3O7LB 3NIEA 2RGPA 2O5KA 2W1IA 3ANQA 4FTJA 3W33A 5HG9A 1ZLTA 4OUCA 2PVFA 4YZMA 4I94A 3THBA 1ZARA 4A4OA 3HAMA 1YI3A 4ASXA 4HVGA 5KMLA 3FZPA 4LV7A 3QLGA 4FSZA 3DAEA 4AA0A 3VUDA 2UV2A 3W0SA 4D2RA 1RE8A 3KN6A 3VULA 4X3JA 2WOTA 3Q32A 4J1RA 5A6OA 2ZB1A 4HGEA 5C27A 1YDRE 3QX4A 3GB2A 4FTUA 2QHMA 2UVZA 4WG4A 5CSXA 2X2MA 5EDQA 3Q2MA 4XV2A 2GHMA 3VUKA 3V5LA 1B39A 4L46A 4OTDA 4FZ7A 3WARA 1IA9A 3G9NA 1KE6A 2C6OA 1U5RA 3DU8A 5CSHA 5E1SA 5JT2A 1YKRA 3OWLA 3RVGA 4JX7A 1P4OA 5C01A 3OF0A 4DTAA 4ZTQA 3ZLWA 5K4JA 4PUZA 4UXLA 3OCTA 2WTIA 4BIBA 5AP3A 4BDKA 4EZ5A 4F4PA 3O17A 5HD4A 2JC6A 3KRRA 3UOJA 4CTBA 4Y95A 3V5WA 4CFFA 3IDPA 4LMUA 4WD5A 3QU0A 2QU5A 5EW8A 3F9NA 3ZUVA 5I9YA 4FKRA 3DLZA 5CEOA 2QKWB 5EM6A 4ANOA 3MY0A 4RRVA 4ZSLA 4EHEA 4IZYA 1OIQA 4U7ZA 5CNNA 2QR7A 5DLSA 3WYYA 5BUJA 1REKA 4O84A 2XRWA 1Y8GA 4OTQA 4O81A 3KRXA 5FUTA 1FVTA 4HPTE 3BHTA 4N6ZA 4OTRA 1JKSA 3UMWA 5AADA 3HMNA 3BU6A 3NR9A 4AXFA 4Z7HA 4FGBA 4QOXA 3PJ3A 3JXWA 2VTQA 3DCVA 4JBOA 3WF8A 4FC0A 2W1ZA 3TACA 4F9WA 3AOXA 5BVWA 2JDSA 3O23A 4GCJA 5CXHA 2CKQA 2W06A 2RG5A 4O7NA 4LRKA 4O86A 3QD0A 4G9CA 3CQUA 4TN6A 2J0LA 1G8KA 3NS9A 3TKIA 4IAYA 5DR9A 2XIKA 3IG7A 4FIGA 3VF9A 4EC8A 4F7JA 3HA6A 4I92A 2Y6OA 2OH0E 3DFAA 4O7RA 3K2LA 4OTWA 3IOKA 4KRCA 3P5JC 4IVCA 1KE5A 2OFUA 3FZ1A 4FNZA 2BR1A 5J9LA 4I6LA 4F6WA 4FA2A 4ZXTA 3UNZA 4O0TA 3VBQA 2GCDA 4X2JA 4CFWA 3SOCA 5A4CA 3FKNA 2BIKB 2CNQA 3S00A 1XR1A 2GS2A 4PP9A 4E3CA 2QQ7A 2GSFA 3OTUA 4JLCA 3RAKA 4GV1A 4CMUA 3N9XA 4RWIA 3W0RA 4EZ3A 2VO0A 3K5UA 2YABA 4U97A 2VO7A 1FQ1B 2W1FA 3UP2A 1OGUA 5KZ0A 4D2VA 3MA3A 3Q60A 4AAAA 4KSPA 1U54B 3POZA 2ETKA 5IH5A 2BRHA 2GTMA 3CD3A 5J1WA 3W2SA 5A6NA 3R1SA 4TYEA 5BX0A 4CVAA 3ZSGA 1UKHA 5ANKA 3W2CA 3L9MA 2W1DA 1YOLA 4GT4A 1I44A 3OY3A 5DN3A 3S3IA 4EOKA 3FHRA 5M4FA 5EQEA 5HIEA 4U42A 3HRBA 3F61A 4I24A 3RPYA 4IJ9A 4L68A 1KE9A 4JI9A 4BRXA 2R3LA 5EI2A 4A9SA 2C5XA 1U5QA 4J53A 3QZFA 4I0RA 3ULZA 3CGOA 4D4VA 2B4SB 4ZLZA 4LGHA 4NU1A 3T3UA 3OWKA 3TJCA 4AOTA 3ET7A 4QNAA 5EHOA 3E7VA 3C51A 4QMOA 4XP0A 2F7ZE 3EIDA 5C4KA 2XK9A 2CDZA 3KREA 4IWPA 3W2OA 2W96B 1YI6A 2FVDA 1U4DA 3QD4A 1XMMA 4FF8A 4MXOA 4EUTA 1P4FA 3MB6A 5C8MA 5CSPA 4MBLA 3PWDA 1XMLA 2F57A 2CLQA 2G1TA 3FLYA 4QTEA 2C5YA 3E5AA 3BZ3A 4DFZE 2B53A 3JVRA 4W4XA 5CI7A 4ZTNA 4B9DA 2PPQA 2WMTA 4FTAA 1GZOA 3QBNA 5DVRA 3KF7A 4QMVA 4AZSA 3HECA 4PL5A 3TKUA 4EI4A 1W0XC 4BCNA 1M7NA 4KIOA 1CTPE 3LCTA 4FV9A 5IQEA 2R2PA 4MBIA 3PTGA 2AUHA 2P2HA 5AR3A 4E5AX 4M0ZA 3DKCA 5JQ5A 4AOJA 4Y72A 4FV2A 1OL5A 2WMXA 3QGYA 1ZOEA 4BGQA 2R0UA 2WEVA 4AF3A 3LMIA 2XM9A 2A1AB 4YZCA 5CYIA 4C61A 4BDAA 4CKIA 5CEQA 2JDVA 5E8WA 1VYZA 4EQUA 4E4XA 3W0NA 1IA8A 2HY81 4Z16A 4D9UA 5LVMA 5KMKA 4PMPA 2BDJA 4W9WA 5HCXA 4XLIA 3UG2A 4EYJA 2NNWB 3CBLA 4IM3A 1ST4A 4LV8A 4HCVA 4EH7A 5HZNA 5AM6A 5KMNA 3KKVA 5CAOA 5B2KA 2WMRA 4X6RA 2YEXA 3AKLA 4F70A 4IAIA 4UWCA 4TWOA 3PA5A 3HRCA 4TKSA 2VTMA 3C0GA 5ETIA 4YSJA 3UOHA 4PL4A 1XQZA 4EOOA 5HCZA 4M13A 5JFWA 3KU2A 3CY3A 4I20A 4LMNA 2R3MA 4V04A 3ZCLA 3TEIA 2ITWA 3BHHA 3KULB 3E7OA 3FV8A 1WVYA 3ODYX 4KSQA 4X3FA 4Y46A 1XBCA 3TIZA 4YUQA 2ZV8A 5HVJA 3LQ8A 2H8HA 3OEFX 4CFMA 3UDSA 2A98A 3V01A 4HYUA 4D2WA 1XO2B 4HYSA 4O91A 3MI9A 4TYHA 4CFUA 3W8LA 1OPKA 3MA6A 2ESMA 4I93A 3PLSA 5JMSA 1SMHA 2QR8A 4RJ6A 4WA9A 3FSKA 3BGPA 1P2AA 4L9IA 3U4UA 3V04A 3I1AA 4YTIA 5AR2A 2PZ5A 4DCAA 3U8WA 2BILB 3QLFA 4CMTA 3FMNA 3RCJA 3ZFYA 5BVDA 2HWOA 2WZJA 3MBLA 3B8RA 1V1KA 3BV2A 2Z8CA 2YZLA 3BBWA 3IS5A 4O7SA 4BGGA 5C1QB 4PTEA 2OXXA 3HV3A 4RBLA 5HLPA 3IW6A 5G1XA 3VS0A 2ITOA 5CU2A 5TKDA 3C4WA 3FZTA 3OD6X 4KIKA 3BWJA 4XCUA 5GZAA 4PF4A 4YHFA 1FPUA 3NCZA 3QQHA 1BMKA 3OXIA 5HICA 4HW7A 4BJJA 4H39A 4RJ3A 3KC3A 3MTFA 3QTUA 4AN9A 3DK6A 2W5HA 1WBOA 5JK3A 3BHUA 4IZ7A 4FSWA 3R8UA 3LFAA 3AGLA 3TG1A 4BDFA 1RJBA 1PYEA 1WFCA 3C13A 4V01A 4C57A 2WTKC 2OLCA 2I0HA 3OZ6A 4BTKA 4QQJA 3LCDA 3MGYA 3KIOC 3IKAA 5IQIA 5EK7A 4HNFA 4DF3A 4MNEA 4JIAA 3FL5A 2F9GA 5JRSA 3RNYA 3EFWA 2FSOX 5BVFA 2IVSA 4JQEA 4CFNA 3DV3A 4G1WA 3FQHA 3ZEWA 2R3FA 2YM7A 3Q3BA 3F7ZA 3MYGA 3CQWA 3DZQA 4PDSA 2X7OA 5KKRC 3ZRKA 2VWXA 4KIPA 1V0BA 3WIKA 2ZJWA 2AQXA 2JBOA 3EQPA 4RJ8A 4X2GA 5IDNA 3DDPA 5K5NA 1ZMWA 2VWYA 4FT3A 4UMTA 4H36A 4YJQA 2Y8OA 4D1SA 4IAFA 3D7ZA 5DYJA 1W82A 4X3FC 1NT2A 4WUAA 4PRJA 3NNXA 4G2FA 2BFYA 3FXWA 4YURA 4D4YA 2VAGA 1YXTA 5J5SA 2WPAA 2DUVA 3EQGA 4PPCA 4QEBA 4WNPA 5M51A 5CZIA 3R71A 2WFYA 4IAAA 2JFLA 5AAFA 3P0MA 1XJDA 3C4CA 4TYGA 1T45A 2P2IA 4O6EA 4DINA 4M3QA 4J97A 1A9UA 3GCUA 1G3NA 4BFMA 4BI0A 2XIYA 5ACKA 4FZAB 4BGHA 2QOHA 4GIIA 2A4LA 3SX9A 4B8MA 4E7WA 4MQ1A 4U80A 4PTGA 3W16A 1ZY5A 2C6LA 1T46A 3ZONA 3M42A 5BVOA 2WMVA 4FR4A 3VJOA 3QZGA 5TR6A 4CFXA 4RT7A 4EONA 3UPZA 2XIXA 3DOGA 1Y6AA 2WTJA 4EHZA 4ALUA 4RIXB 4NYEA 1E1XA 4YJVA 4A06A 3MVLA 2CLXA 4JDKA 1Z57A 4O0XA 4CLJA 2YDJA 3E3PA 4H3BA 5FTGA 3DB8A 5FQDC 4DT8A 2VRXA 5FXSA 5M44A 1YOMA 2XKCA 2X2KA 4DLIA 2WTDA 5K4IA 3Q6UA 2YWVA 4EH3A 4I0TA 2WTKB 3E62A 3EQRA 5EW3A 3MVJA 3FAAA 2VWVA 3DS6A 4WNKA 2WMAA 1H27A 2CKEA 4LV5A 3PVBA 3GU7A 1M17A 3QCYA 4FEUA 2ETRA 3HNGA 4BDIA 4CQGA 4WRGA 2X8DA 3CLYA 3SOAA 3R9RA 3COMA 5IEXA 4FKVA 1O6YA 4IDTA 2V7OA 4G3FA 3FJQE 4UWYA 4WO5A 4AACA 4R7IA 5GNKA 4GRBA 3BU3A 5ANOA 4CZUA 5BUIA 5J7HA 5IA2A 4PMTA 1HCKA 1WBWA 2I6LA 2PUUA 3GCSA 4J98A 5HG7A 5T68A 4DITA 3LFDA 3ZXZA 3ZRLA 4EBVA 4ZLOA 1QCFA 3CSVA 4X3FB 4JBPA 3DPKA 5M08A 3RMFA 1I09A 3FC1X 2FGIA 2R0IA 2XKEA 3PY0A 2GPHA 3KXGA 4F9YA 4FYNA 3R8MA 2JDOA 4BTFA 4I6HA 4B8LA 2YIXA 5GJDA 4CD0A 1IG1A 3NDMA 1F3MC 5DG5A 3QFVA 4UB7A 1Y6BA 3ZLSA 4HJOA 5GJFA 2BZIB 3QUPA 4UXQA 3UO5A 3ZOSA 3UJGA 3CJFA 4L44A 4RJ5A 5DMZA 3F5XA 5GZ9A 3TI1A 2BALA 4F99A 5LMKA 2BKZA 1LEZA 1PXPA 4MF0A 4AOIA 4DEAA 2A0CX 2R7IA 4G5JA 4IX5A 3FLWA 3IW8A 4FSRA 4NKSA 3SW4A 4CNHA 3MY5A 5HO7A 5ITAA 1CM8A 4DTKA 4PP7A 2XEZA 4XBRA 3C9WA 2YERA 2HK5A 5K0KA 4ZP5A 4L6QA 4EQMA 3EN4A 3QRJA 4JIKA 4RLKA 4DH7A 2Y0AA 3I0OA 4KIKB 4L3LA 4ASDA 1NW1A 4O6LA 4BCPA 2YJRA 4FSTA 1JSVA 2XYUA 2JBPA 3ALNA 4FEXA 4C3PA 3OUKA 1TVOA 4IHPA 4IX3A 5IQBA 3NAYA 4N4SA 4YC8A 5LCJA 4HZSA 1BX6A 1NA7A 5I9UA 5HD7A 3R8LA 3S2PA 3VS6A 3RK5A 5KBRA 5AV0A 4KKEA 5K9IA 2PU8A 4X0MA 2QOBA 3FZOA 3UP7A 4ACGA 3B8QA 4QMWA 5DFPA 2YCQA 3EMGA 1Q3DA 4CCUA 2WIHA 3F7WA 3TV7A 1XWSA 3TUBA 4M67A 3Q5ZA 4MNEB 5J87A 3QQFA 1OIRA 4C2WA 3VS1A 4QTDA 1JLUE 5B7VA 3COKA 3LKMA 1AGWA 5A4LA 3FZRA 3JS2A 3NX8A 3V5TA 2E9UA 4TL0A 3BYUA 3NYNA 4TWNA 3IW7A 2UW9A 4C38A 3VRYA 4FVRA 2BAQA 3V51A 2ZM1A 4KRDA 2WU7A 4I6BA 4EJNA 1J7LA 4DHJA 3EQCA 4BDJA 2XJ2A 3P79A 4IX6A 4WNMA 3S95A 4E6QA 4EHVA 4QQ5A 3F69A 4IFCA 2QO9A 2P4IA 4IBMA 1OBDA 4GL9A 3OG7A 5A46A 4DFBA 4NZWB 2B1PA 4NH1A 2X6DA 4U40A 5JFVA 5IA3A 4YO6A 3ML1A 3EN9A 3GENA 4G3EA 4IB3A 5EKOA 3UC4A 3V6SA 5CF5A 2XKDA 3D9VA 4I6FA 4U81A 3DQXA 3NYOA 2Z7RA 4L53A 4JG8A 1E1VA 2VTJA 3VNTA 3HMPA 2R9SA 4FTOA 3OC1A 3IGOA 3VBTA 5IZFA 3RTPA 3FQEA 4BCHA 4CLIA 2PULA 3MW1A 4BCFA 5L8JA 3HKOA 5I9ZA 5LVOA 3DK3A 2GS6A 4RVLA 4JRVA 2R3OA 2E9NA 2ZM3A 4QYHA 4QMSA 2NPQA 4YJSA 2VTNA 5LMKC 4FE2A 4E4LA 2ZDUA 3PUPA 3BX5A 3AKKA 4MVFA 3OCBA 1RDQE 1PKGA 3AC4A 2O0UA 5DIAA 3IDBA 3EB0A 4HYIA 4O4CA 5IUHA 2BAKA 3OW4A 3G51A 5F20A 3ZLYA 3A7HA 4F1TA 5DE2A 3I5NA 5HHWA 2IO6A 3EYHA 4MX9A 5H3QA 1PHKA 3UDZA 3WE4A 4QYFA 3ORXA 5DWRA 3LFQA 2OBJA 2WMQA 4E26A 2QG5A 2J9MA 3DKOA 3C4EA 5HEZA 2C6MA 3PRIA 5HX8A 3E88A 3CPBA 2IVTA 2ITTA 3HP2A 4XOYA 4L7FA 4EOJA 1LEWA 4JDJA 4QMLA 1YOJA 4OTFA 1MQBA 2R3KA 4ERKA 3ORNA 3QZIA 2J7TA 3A4OX 3GC7A 1Q41A 4NSTA 4WT6A 3TXOA 2WQNA 5CT7A 4PV0A 2C69A 4AQKA 5BPYA 3NAXA 2CJMA 3W18A 2XAOA 4RIOA 4G3GA 1V0OA 2WELA 2WQOA 4GT5A 3O7LD 4WRSA 3VS3A 1JKTA 2RSVA 3EH9A 3PXYA 4OT6A 1J7IA 3U9NA 3BRBA 4F1MA 4G6LA 4ZSAA 5HI2A 4ZSGA 4BB4A 5A54A 5C8NA 5IMEA 4C58A 3SA0A 3AC1A 1Q99A 3MFUA 2VTAA 4PL3A 3QA8A 2BMCA 4ZK5A 3OHTA 4EK8A 2CCHA 4EBWA 5CXZA 4NFMA 4AP7A 2R3IA 3QGWA 4FV1A 2CGUA 3QCQA 2VWWA 3R01A 2GNJA 4TRLA 1JOWB 4QYYA 2OIDA 2XNEA 3R1NA 5KZIA 3UMXA 3ACJA 3SLSA 3TJDA 3DNDA 1GJOA 2X0OA 4M12A 5FXQA 3V5QA 5FDXA 3R7EA 4A9UA 5CEMA 2W1HA 5LARA 3WF7A 1UVRA 4P2KA 5IPJA 4BC6A 3DAJA 2YLFA 4WNOA 4FTRA 3SXSA 3ZO4A 2XP2A 4P90A 3R0TA 2PUPA 5EYKA 3EOCA 2ITXA 1H1RA 2C6EA 1G5SA 2UUEA 2YM3A 3GFEA 3HV5A 3Q6WA 3R7VA 3ZUTA 5IG1A 2YM5A 3N4TA 5IQFA 3UBDA 1R3CA 2C0TA 1XH5A 2R5TA 4EKKA 5EH0A 5CVGA 4XUFA 2NRYA 3PXRA 3FI3A 2ZV9A 3QYZA 1ST0A 4M97A 3UZPA 2B55A 1JKKA 3R22A 3GEQA 2DYLA 1PMUA 3IW4A 5TO8A 5I9XA 1KWPA 5EW9A 4G6OA 3DBFA 4YO4A 2X2LA 2XNNA 3OY1A 2C3LA 2HXLA 3RALA 5BUEA 1XH8A 3FHIA 5ICPA 1M7QA 3LCSA 4ZMFA 2VTRA 3UODA 2HOGA 3LM5A 4QP8A 2BTSA 3MPAA 5E91A 2YM6A 4L3JA 4OTIA 2PE2A 4UY9A 2R3PA 4XMOA 4J71A 4O7LA 4F9AA 5CAQA 5L2QA 1VR2A 4JS8A 1JVPP 3FQSA 2CGXA 3MIAA 2X0PA 5BYZA 1PY5A 5L8LA 1J1CA 1YQJA 2JLDA 3D5WA 4W4YA 2BPMA 5L6WL 3FPMA 4TNDA 4ZIMA 4C0TA 5CWZA 5M4IA 4DEBA 4AAYA 3A60A 4AS0A 4XLVA 3U54A 4HCTA 5IQHA 1ZAOA 4H3QA 4AW1A 2CNVA 2OH4A 3QX2A 4EH9A 5EYDA 3E92A 3JVSA 2PMOX 4BIDA 4J8NA 4APCA 2PVKA 2O2UA 1J7UA 4FKSA 1M2RA 4HYHA 4JG6A 2YJSA 4I4FA 3NEWA 2J2IB 4BCJA 4FICA 2VNWA 4Y85A 5JRQA 4ZOGA 3SV0A 4P4CA 4OTHA 4LQMA 3ZXTA 4HGLA 2B9JA 3BLAA 4NW6A 1MUOA 1OKYA 5DGZA 4L01A 3AC8A 4NTTA 2H34A 2QOCA 5J1VA 5F4NA 1YXVA 4FV8A 4N0SA 4AE6A 2WO6A 3C5IA 5FBOA 4C7TA 4H1JA 4IX4A 4TYJA 2BAJA 3D83A 3PG1A 4MXAA 3W0PA 3VVHA 1S9JA 1Q5KA 4PDYA 3BU5A 5D9HA 2PL0A 3H3CA 4K77A 5CT0A 2VU3A 3K54A 4EH4A 2GTNA 3G6GA 2I40A 4FKOA 3BKBA 2X0QA 3CKXA 3O51A 3VC4A 2J4ZA 2XKFA 3OT3A 4U3YA 4O96A 3FLNC 4QMMA 3RBWA 3UDTA 2YITA 5EM8A 4K0YA 4G16A 3OP5A 4FMQA 2XK8A 2QD9A 3GU5A 4OAVB 2BRBA 2C68A 2IF8A 3R9NA 4FKWA 2PVMA 2BRMA 1W2FA 4FEWA 4EOMA 1FGKA 2IVVA 4YNEA 4ZTMA 1OBGA 3KMWA 3FLQA 4QD6A 1UU8A 5CASA 2PYWA 1WBSA 3CJGA 3KULA 2IVUA 3FMMA 1H1SA 4RG0A 1YW2A 4YJNA 5BMSA 4IAKA 4D4SA 4JR3A 2EXEA 4FI1A 3VS7A 3DDQA 3AMAA 3SAYA 5CAPA 2XNPA 3FMEA 2XARA 3A99A 5M06A 2ZV7A 3F2NA 4RJ4A 4G34A 4YHJA 2J90A 4FVPA 5E92A