5BVOA

Fragment-based discovery of potent and selective ddr1/2 inhibitors
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
308
structure length
276
Chain Sequence
DFPRSRLRFKEKLGEFGEVHLCEVDSHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDKPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Fragment-Based Discovery of Potent and Selective DDR1/2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Epithelial discoidin domain-containing receptor 1
total genus 92
structure length 276
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bvoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bvoA01
4RBLA 2PE0A 4I1ZA 3BPRA 3PJ2A 4E73A 4W4XA 4IVAA 5E8XA 3L9LA 3VHEA 2GU8A 4RX7A 5KBQA 4ANMA 3BGQA 2BRBA 2ZDUA 4X2JA 4C4EA 5EKOA 3FXZA 4IC7A 1WBVA 4IAKA 3VNTA 5GJDA 3RJCA 3TG1A 1VJYA 4IWQA 5LJJA 4N6YA 4KRCA 4EORA 3TUBA 4YO4A 4ZY6A 1WCCA 3ELJA 4CFUA 3R22A 3JS2A 3NNWA 2QI8A 5FGKA 3TIYA 1CM8A 4WRSA 5IDNA 3R30A 1SVEA 5DH3A 3DXPA 3ETAA 4FV0A 2IZUA 3AOXA 5KO1A 3E3BX 3FZSA 5HX6A 5CZHA 3K54A 4Y83A 5ETFA 4EHEA 4AS0A 4BCPA 4O81A 2JKMA 4PMPA 2W1IA 2ERZE 4WNPA 2BZIB 4IDVA 5LARA 1UKIA 2HZNA 3TL8A 4R78A 2WTWA 2X39A 4O0TA 3N4TA 2IJMA 3SRVB 2WTJA 1IRKA 4X21A 1ZYJA 3SV0A 3HAVA 1F3MC 1OPJA 2C0TA 3PIZA 4FV8A 5L8KA 3AGLA 3SA0A 1GY3A 3WARA 5I3OA 4FODA 4W4WA 3ORZA 4O7VA 4ORKA 4XBUA 4RMZA 1Y57A 3Q2JA 4FNWA 3WBLA 4FKRA 5EFQA 4DLIA 2XIRA 4EKLA 4OTRA 1YQJA 1YI6A 3TTIA 2O8YA 1O6LA 3L9PA 4ZTSA 2XRUA 4ZJJA 4BCHA 5CU0A 4U42A 2QHMA 3DKCA 5JKGA 2R3FA 4AN3A 2XJ1A 3QLGA 4D1XA 5A4CA 3HDMA 3VW8A 3ZHPC 2ZMDA 3A7IA 3DBEA 4J52A 1JSUA 3Q4UA 4L7FA 2V55A 4HVIA 2PZPA 2OH0E 5JN2A 5M51A 5FP6A 3ZDIA 4ACDA 4U0IA 4JDIA 3EQFA 4K77A 2O2UA 1APME 5BMMA 1FGKA 2JBOA 3PA4A 4RQKA 5AR5A 4C38A 4QP9A 4W9WA 2BKZA 5CVHA 2WTCA 5B0XA 5IA5A 3S0OA 2CN5A 1GZKA 5D7VA 3BE2A 4BCJA 2OJJA 4GS6A 4WO5A 4XYFA 1REJA 3P86A 3DOGA 2GS2A 4I6BA 3KXGA 4YSMA 1PMUA 3WZEA 5L2WA 4I4FA 3R7VA 3FKLA 3OUKA 3QQKA 5EW8A 3TJDA 3U6HA 4GVAA 3KVWA 2ZV9A 4F0IA 4C2VA 2GPHA 3OFMA 2YZAA 2OK1A 4P5ZA 3VS4A 4JRNA 5DPVA 3SDJA 4ANQA 1ZLTA 3PLSA 2FSTX 4Z9LA 2H9VA 4K6ZA 5I9UA 4GIHA 2ZM3A 1Y6BA 4OTDA 3C4CA 1BMKA 4ZTLA 2E9VA 4YPSA 5EOBA 4EBWA 4ALUA 4RG0A 4EK3A 5EH0A 5IF1A 4H39A 3SXFA 4J71A 2EU9A 3CCNA 4CFNA 3MESA 4MVFA 2ETKA 5FTGA 4H3QA 3PWYA 2RKUA 4BDBA 4EHVA 3LIJA 2OJ9A 4DGLC 4EH5A 2GDOA 4QYYA 2PUIA 1OL5A 3FL5A 2CKQA 3MB7A 5JGAA 3MVMA 5CI6A 2XS0A 5A14A 2XBJA 4AA4A 1QPDA 4AXAA 1P14A 1URWA 3WZJA 4JIAA 4ZMFA 3CSVA 1H1RA 2X0GA 3Q4TA 3NMUF 2H6DA 2VO0A 4MXAA 3HV3A 2J0KA 3C4ZA 3OT3A 5AMNA 4MXXA 3PY1A 4C33A 3OW3A 4EOKA 5B2KA 1ZYLA 1RJBA 3EFKA 4ALWA 4BY9E 2OXDA 2UW3A 4RC4A 1R0PA 2ITZA 3KC3A 4QP8A 3DJ5A 4AZEA 4CYJA 3E64A 2J6MA 5FBOA 4KUJA 4KKGA 3NR9A 5FDPA 2XZSA 3BYOA 4QNAA 4J8NA 3CD8A 3P9JA 4UWYA 3E7OA 4D5KA 3ORLA 4DGOA 2Z8CA 4HGEA 5EHLA 5D12A 3OWPA 2W7XA 3R6XA 2OFUA 3NWWA 5D1JA 1GNGA 2QLUA 5HICA 3V01A 4MBIA 2PL0A 4NW6A 4YTHA 3ZU7A 4I93A 3RPVA 3ORKA 2QOCA 3COKA 4O0UA 3W2RA 4OGRA 1REKA 3Q96A 4OBPA 5KZIA 2Q0BA 3L9NA 4PL3A 4CQEA 4ENXA 1BI8A 3PVGA 3CKXA 1R78A 3ZXZA 3LLAA 4QYGA 3BBTB 3C51A 2PUPA 1P5EA 2YEXA 4EOSA 2C6EA 5HTBA 2Z7RA 3ACJA 4J1RA 2WEVA 5HKMA 4K8AA 3C4XA 4ERWA 2Z2WA 2WOTA 3WZKA 2RFSA 3QRKA 3SC1A 3QX4A 1EH4A 5CALA 5AM7A 1QPCA 2ZMCA 4OTIA 2WNTA 3FMDA 2ETRA 3DTWA 3G90X 4U5JA 3DCVA 3SLSA 5KKRC 3EQIA 4NEUA 3E92A 3GC9A 5DIAA 2PVMA 3BCEA 4UWBA 5CQWA 3WF8A 4AW1A 5EYKA 5A9UA 4BHNA 4AGCA 3BHTA 2VGOA 3WZUA 4FIHA 3M2WA 4QYFA 2YJRA 2F49A 4RZVA 4L67A 3UGCA 2HOGA 3AD5A 5E91A 1L8TA 2YCFA 3WIKA 2YCRA 3DBQA 3GC0A 5FM2A 5LWNA 3I7BA 3KK9A 3GNIB 2R64A 4ID7A 2ZVAA 3CQUA 4FV9A 4JG8A 5HD7A 2BUJA 4G9RA 4ZEGA 4O83A 2HZ4A 2YM8A 1MRYA 2W06A 3GOPA 4TWPA 4CFVA 4F1OA 1YWNA 2W4JA 4D28A 4UMPA 1STCE 4D4VA 4FA2A 3UZTA 1W8CA 4DLJA 4QPAA 1YXXA 4V05A 1H08A 5AP3A 2ITOA 4XBRA 3P23A 4BTFA 4G16A 1J7UA 1YHWA 5DR9A 1M52A 2A2AA 2VTRA 4ITJA 3P08A 4WG4A 4DTAA 5FXSA 3FXWA 4HZRA 5BVDA 2P2IA 3QTSA 2UZUE 4LV8A 2OU7A 4IC8A 3UYTA 4AU8A 2CMWA 3FWQA 3TWJA 4YHTA 3QKMA 3MJ1A 3QCYA 4C02A 2A0CX 3RI1A 5LVNA 3O0GA 4KRDA 4LOPA 3UYSA 3F3ZA 2X1NA 3LW0A 4EWQA 5M4CA 2XMYA 4EOQA 4XG8A 2ETMA 5F1ZA 3VS2A 4MK0A 4MXOA 4GK4A 4MNEA 2NNWB 3IW4A 3HP5A 3DB6A 4AWIA 5I9VA 1JOWB 2YJSA 3QRJA 5CSVA 3F5UA 3UE4A 2JGZA 2W1CA 4UMTA 5GHVA 3S3IA 3C9WA 3PPKA 2PMNX 3KN6A 4JRVA 4R5SA 2YWPA 4CT2A 5IISA 2BILB 4PTGA 4DE4A 1J7IA 4FV7A 2C6KA 4UMUA 4CQGA 4L68A 2WXVA 3MB6A 2R3JA 4J97A 4RIXB 4TWOA 2GTNA 3QQFA 3CIKA 2V5QA 4RJ7A 3UJGA 3EZVA 3IPHA 3NW5A 4C57A 4WOVA 1NXKA 2OXXA 1VEBA 3FMHA 4U43A 2KULA 4D0WA 4EC9A 4HCVA 3R8PA 4B8LA 4YLKA 3B2TA 5DNRA 1JQHA 3VHKA 2FSMX 5AV2A 1QPJA 1XHAA 2OZAB 5EM5A 5FM3A 4IX4A 3QX2A 2XNNA 5J7BA 3CPCA 4MBLA 5LMKA 2IPXA 5J87A 3V8SA 3WZDA 3FV8A 2R3OA 5TO8A 4BTJA 3NAYA 4RIYA 4R7BA 2FSOX 2ZYBA 4FTMA 4I3ZA 4U81A 2XNGA 3ZRKA 4WKQA 2YERA 3AD4A 3RPSA 4I0TA 4ZTNA 3C5IA 3CP9A 4U41A 5HI2A 2XIKA 4FI1A 4FKIA 1PKDA 4I0RA 3SKCA 4NM5A 4FTCA 3CKWA 4BDAA 2OIBA 2QKRA 2XNPA 4PDSA 5IDPA 5KX8A 4FOCA 4FZFB 3QYWA 3R9NA 2C6LA 4YJQA 5JGDA 1NVRA 2I40A 3PPZA 4BHZA 3HMPA 5K5XA 1UU3A 1Y8YA 4JG6A 3ZBFA 4RJ6A 3HEGA 4U7ZA 4WA9A 3ZBXA 5AV4A 4O91A 3HV5A 1H0VA 4PP7A 2P55A 3GB2A 4QP2A 5F9EA 3NW7A 5LMBA 1NY3A 3EJ1A 4PUZA 2VV9A 4BZNA 3PY0A 2QO2A 3DK3A 4Y46A 3AXWA 3Q6WA 3U6IA 3IW7A 5KHWA 3EKKA 3CC6A 2UZOA 2BAJA 2YCSA 3I6UA 5CANA 2AYPA 2IG7A 3F82A 2G01A 5TF9A 3OOGA 5BMSA 2PUUA 4W8EA 3I6WA 2Y0AA 3UMXA 3CEKA 4F9YA 2OFVA 2R3QA 2X8IA 1OECA 4WT6A 2HIWA 2P33A 4F9WA 4JT3A 3ZO2A 2B9FA 4P90A 5FEDA 2WO6A 3ORMA 3ZRMA 4U44A 5K5NA 4IACA 2ZM4A 4HGLA 5EI6A 5K4IA 3UVPA 4KINA 3EZRA 5L4QA 3FXXA 2B1PA 3GEQA 2Z02A 2R7IA 3LCSA 2OH4A 3C7QA 3RAWA 1YI4A 3Q53A 4A9TA 3LPBA 4CMOA 4D2WA 3NS9A 5J9ZA 4YJOA 1XJDA 4RIOA 3EN9A 2WQOA 3LOKA 4TNDA 2UZWE 3QD0A 3IECA 2ITWA 4BCKA 2VU3A 3FHRA 4L8MA 3H9RA 4LG4A 5EM8A 3B8QA 3QA0A 2CDZA 4AZWA 3UO6A 2RG5A 3IDCA 4OTHA 3PIYA 1H27A 1OGUA 1PKGA 4RC3A 2W5BA 4MNFA 1F0QA 2X6DA 4A7CA 3IONA 4F99A 4QMOA 2H34A 3LVPA 3QZGA 3SAYA 4GT3A 4HGSA 5BVFA 1MRUA 2C1AA 2F57A 2IZRA 2UW5A 2XKFA 4O0WA 4GFOA 4QMXA 3VBWA 3EL7A 5AP4A 4DFUA 4BWXA 5H8GA 2E9NA 3EYGA 3Q9ZA 4AAAA 4DAWA 1E1XA 4O1PA 2X8EA 4M0ZA 4QNYA 3ZRLA 1YWVA 2B4SB 4O6EA 3RZFA 5CEOA 3QTUA 2QC6A 5A54A 3TV7A 3QGYA 3L8PA 4G3EA 4XLVA 3GP0A 4OLIA 3DK7A 3GU6A 2W1GA 2J9MA 4GT4A 3MIAA 1OL7A 3O2MA 3D15A 3E8CA 3QXOA 5E7RA 4HW7A 3BU6A 4ZIMA 1LR4A 4DFBA 1BKXA 3GQLA 3EN4A 3F66A 4F08A 1ZMWA 1J1BA 1OB3A 3KY2A 4HVSA 3E63A 2VWIA 2VN9A 4PNIA 4D58A 4RGJA 5F20A 2XK6A 3IW5A 5IU2A 4LMUA 4NJ3A 4RJ8A 1DI9A 2OBJA 5J7HA 3A4PA 1ERKA 3NUYA 4IDTA 4BL1A 1FVTA 4BCOA 3ZEPA 2B52A 3MFRA 2F7ZE 3HUBA 2BZJA 3QTZA 3R1SA 4BIDA 1FBNA 4R7IA 3W55A 3U9CA 1WZYA 2CPKE 3FLNC 3DTCA 4L00A 2BZHB 5HE2A 4M12A 5T68A 3NYOA 4W4YA 3VBYA 2QR7A 4X2NA 3DBCA 5AAEA 2AC3A 3FAAA 4N70A 3QD4A 5AUUA 5EI8A 3UQFA 1BI7A 3LMHA 4MXYA 4YZMA 4ITIA 4CV8A 2VZ6A 3H9OA 2LAVA 1M7NA 3MW1A 4NH1A 4BBMA 4AOIA 4X3FB 3UNKA 4NFNA 4AW5A 5DFPA 1DM2A 1OM1A 4UEUA 2HELA 4K2RA 1OUYA 3ANQA 4EOIA 3QWKA 1YOMA 5KMLA 3MWUA 4QQJA 2Y9QA 3WF7A 4EWHA 2BROA 4E1ZA 3THBA 3FBVA 2I0VA 5DEWA 4YTFA 4FC0A 5BVEA 4MXCA 3ATTA 1SZMA 3P1AA 3G6HA 5GIOE 3FI8A 2OIQA 3NW6A 3QTXA 4TXCA 5EM6A 5KNJA 5CSXA 4C3PA 5HIBA 5AP6A 5IEYA 1KWPA 3UODA 3R0TA 4J98A 2O64A 2XNEA 3PJ8A 4E3CA 3BKBA 1XBCA 4FF8A 4OT5A 1Q61A 3NUNA 5HIDA 1IA9A 3HMNA 2OF4A 4XG6A 4DFLA 5CT0A 4RJ4A 5HTIA 3E7VA 3R7UA 2W1HA 4I5CA 5JRQA 4K9YA 3TNWA 5HO7A 3WYYA 4M15A 2QOFA 3TJCA 4CVAA 1P4OA 3KVXA 4XG2A 3N4UA 2JFMA 4QTBA 4LUEA 4BDKA 4QMVA 1IASA 1Q3WA 2IZSA 2DS1A 4AE6A 4ZTQA 4X7QA 1OBGA 1IG1A 4Q5HA 3PA3A 3LXKA 3ORXA 4BGQA 4AN2A 4MD8E 5D7AA 2BCJA 2ITUA 2J4ZA 2W4OA 1FGIA 2WMRA 2YISA 3BGPA 3D0EA 4NIFB 4P5QA 3DJ7A 4Q5EA 5DG5A 4DG0E 3CY2A 3CXWA 4IFGA 4PMSA 2W05A 1ZWSA 3A7HA 1FMOE 4C58A 3OG7A 1VYWA 2F4JA 3VUTA 3FJQE 1NVQA 1KOAA 2XCHA 1XBBA 1ND4A 4X2KA 4EYJA 5HU9A 4M69B 2FYSA 1GOLA 5CY3A 4CLIA 5HLNA 4EL9A 3ZC6A 4GVJA 4YZ9A 4HYUA 5KZ0A 3F5XA 4LFIA 4UMRA 4WG5A 1V0PA 3EN6A 4H3PA 3UC4A 3NCGA 3PTGA 3MA3A 3R2BA 3ZZWA 3DAEA 4BKJA 5BVOA 3OY3A 3L1SA 4YBJA 3PSBA 4E5WA 2WZJA 3HA6A 3BLRA 3R63A 3V5WA 5FDXA 4ANBA 1YW2A 2XRWA 1OIRA 4YTIA 2PTKA 3OOMA 5LVMA 3UOJA 2VTTA 3R7YA 3QLFA 5FTOA 5AAFA 1WBTA 4FGBA 1Q41A 4X3JA 2XBAA 3W2PA 4R1YA 4OBOA 4GK2A 3FI3A 1MP8A 2E9OA 3SXRA 2G2IA 3H30A 3ODYX 4DG3E 5GJGA 3H9FA 5ACKA 3KQ7A 2WOUA 3E5AA 3DDPA 2C5OA 4N0SA 4UYNA 3TT0A 4F65A 4CSVA 1ZXEA 4AT4A 4RX8A 1XO2B 2J5FA 4AE9A 4DTKA 3QBNA 2RFDA 4RVKA 2X4ZA 2JKKA 2C3LA 4QTDA 4O0RA 4B0GA 1XH5A 2FSLX 2Z7SA 3EQPA 3HX4A 3MH3A 3LLTA 4K33A 3ZO4A 5LQFA 1H24A 2ONLA 4RVTA 3D9VA 3AC1A 2W17A 5DA3A 5E8TA 4QMNA 5TE0A 4MF0A 3ZO3A 5LVOA 3QCQA 3FSKA 2QLQA 3P7BA 5DR6A 3D5XA 4F0GA 3QUDA 5IA4A 1FOTA 2CNVA 4RZWA 5KKRB 4LGDA 5EHOA 3KXXA 4IANA 4D2SA 2C5VA 4KNBA 5GIPE 2WEIA 2QD9A 2YDIA 5KHXA 5AUTA 3MY1A 3E93A 3KMWA 5IH5A 2WQMA 4IM3A 5CVGA 4U79A 4BC6A 5E1EA 4DEHA 4FG7A 3V5LA 3I60A 2PVRA 2XK4A 4DEEA 2QG5A 3D5UA 2VO7A 4QYEA 4YGAA 1IAHA 2GNLA 2XIXA 2NP8A 3MFUA 4LM5A 4XV9A 5E4HA 2JFLA 3KKVA 3VULA 4D4YA 2XK9A 3GI3A 3NNVA 3SVVA 5EM7A 3VUHA 3W2QA 2UZVA 2YITA 3F9NA 4O0VA 3MN3A 5EQEA 1GZNA 2WU7A 3ZLWA 3LKMA 1BX6A 4C37A 3NUAA 4FEXA 4XV2A 3JVSA 3EQCA 3HZTA 4E26A 5EDPA 4HZSA 4WNKA 2PVKA 2X7GA 4RJ3A 1KSWA 4ZY5A 4XH6A 5EYMA 2VWWA 4FT5A 3U54A 4G5PA 4EJ7A 3ENHA 2O0UA 3W2SA 3KFAA 5BPYA 2PMOX 2X2MA 3WI6A 3MJ2A 4AUAA 2WHBA 1LP4A 2YM7A 4LQMA 4FVQA 3R1YA 3P5KA 4LGHA 4DF3A 4U6RA 1PYEA 5E8UA 3PG1A 3FDNA 2PVYA 2UW6A 3P4KA 4QP3A 3ZOSA 4C7TA 3KEXA 1S9JA 2C6TA 4N6ZA 4X0MA 4J95A 4YO6A 2ZDTA 3S1HA 4M7IA 3L8VA 4O22A 4D2TA 4TYHB 2PK9A 3B8RA 5E8YA 5L8LA 2QG7A 3QTRA 2ERKA 2WFYA 2PZRA 4C61A 3Q4ZA 1W84A 3R9DA 4YUQA 2EB2A 2JKOA 4FYOA 2JDTA 1SMHA 2YZLA 3FLSA 3EN7A 4J8MA 3MS9A 5DMZA 2C69A 4HOKA 2HWOA 3C0IA 3LQ3A 5E8WA 2EVAA 2WMVA 5HBEA 3CQWA 4HCUA 5B2MA 5BYLA 3RINA 2LGCA 4CNHA 2YDJA 3HECA 3IGOA 3LE6A 5LMAA 2X4FA 3UC3A 3FYJX 4HYHA 3SD0A 4BZOA 4EK6A 3BQRA 4IM2A 4Y8DA 2XEZA 4O38A 5JK3A 2PULA 4DH1A 3GC7A 5B7VA 4X3FA 3VS3A 4EJNA 4BDDA 4TN6A 1Z5MA 3I0OA 3N9XA 1WVYA 4GRBA 4JBQA 3JR1A 3GFEA 3I0QA 2JAVA 3BX5A 1WAKA 4UY9A 4PP9A 4D2VA 4PPBA 1O9UA 1Q4LA 1ZYCA 4UWCA 3PZHA 1A9UA 5H8EA 1Q5KA 2CJMA 2PE2A 5JSMA 4CKJA 2UVXA 4QMQA 4M0YA 1CDKA 2GNIA 4KSPA 5IQEA 3UPZA 2YWVA 1ZMUA 3R02A 4WBBB 4DH7A 3UTOA 3BV2A 4F7LA 2UZTA 2J51A 2J2IB 3HRFA 4BN1A 3LFAA 4DFNA 4DGNA 2C0IA 4U3ZA 2GSFA 5IEVA 5JQ5A 5M53A 3BEAA 3TKHA 2OW3A 2YIRA 2ZB0A 3R7OA 4FKQA 2PU8A 5IH6A 4RWIA 4BDGA 3MDYA 5HTCA 3F69A 3R73A 3FL4A 1DAWA 3D5VA 3GOKA 4IHPA 3U51A 3FYKX 5C8MA 4JJRA 4YC3A 4MNEB 5FEEA 3JY9A 3GBZA 1ATPE 2V7OA 2EWAA 4LRJA 4XV3A 3R21A 5M09A 4I22A 2H8HA 4QT1A 1M14A 3ZFYA 1PXOA 3MIYA 3KN5A 1O6YA 2VTSA 4JDKA 4QQTA 4DGMA 2E2BA 4FVRA 3DZQA 4XG9A 5DT0A 5GJFA 5BYZA 2BHEA 5DOSA 5A4EA 4F9CA 2FO0A 2XJ2A 2XK3A 4AT5A 5C4LA 1DAYA 3AC8A 4WIHA 4FTQA 2IW9A 4EH6A 4PDPA 4UYAA 3UQGA 3ZH8A 3TDVA 3VUMA 3RKBA 1ZY5A 3BU3A 5LCKA 4EHZA 3MGYA 2BIYA 4O7SA 5M55A 3VQUA 2IVSA 2A19B 3POOA 5C03A 3UIMA 4EOPA 4FTLA 5DRDA 4K18A 3T8OA 5ITAA 2JDVA 3ZM4A 4ZZMA 3SX9A 2UW8A 2VAGA 3VS0A 4IFCA 4RIYB 4WNOA 3SQQA 2YACA 4II5A 2QOLA 1HCKA 4B9DA 5L6OA 3V5JA 1T45A 1YDSE 3TKUA 2W1ZA 2WMQA 1KE5A 3A60A 4C59A 2C5XA 4MWHA 4IH8A 3ATSA 2ITPA 2WQNA 3KMMA 2QKWB 2HY81 4WSQA 4FGRA 4BDJA 3LXNA 1LUFA 4U40A 1H0WA 2R9SA 3BYUA 4GMYA 4GV1A 4J96A 1G8AA 2DYLA 2JEDA 1H1PA 4YZBA 3ZMMA 1PW2A 2WMSA 4JDHA 5FP5A 5ETIA 3VBQA 3JY0A 4CEGA 2XEYA 2YABA 3IW8A 3VUDA 3W32A 4B6LA 3K2LA 3TNIA 2E9PA 5IA0A 4NCTC 4I5PA 4HPTE 4ZMEA 3VIDA 5C27A 3UIXA 4BWPA 2R3MA 5DHJA 3Q4CA 5T3QA 3D94A 4PNKA 1TKIA 2CGXA 3IS5A 4LMNA 4JDJA 1JBPE 4XMOA 2OI4X 1WVXA 2X9FA 5CF4A 4FSQA 3CTJA 5CAPA 4ZP5A 5KCVA 3LMIA 1OI9A 2JD5A 3TKIA 4JOAA 3Q32A 5E90A 3K5VA 4XUFA 4F9AA 4YMJA 3DAJA 3FI4A 3MSSA 3PFQA 3F5GA 4KIKB 4MEDA 3FC2A 2BAQA 4NK9A 4C4FA 5C8NA 5M44A 3ZCLA 5B2LA 4FE2A 3R9RA 3O8PA 4O7TA 3I5ZA 4USFA 4FVPA 2UZLA 1UNHA 1OL2A 5HE0A 2F7EE 3EN5A 3VRZA 2XA4A 4IAYA 4O1OA 4LYNA 3DKGA 4OTGA 1YXSA 2B9HA 2JDSA 3PE1A 1G8SA 3QTIA 3BLQA 2GQRA 3D2KA 4CXAA 1XWSA 4YSJA 4NFMA 4KKEA 1CKPA 4GG7A 2XF0A 1BLXA 1YXVA 4QQ5A 1ZARA 4YR8A 3QZFA 1YHVA 4LV5A 4BI2A 2W0JA 5M57A 3A2CA 4I92A 3IW6A 4TRLA 3VBXA 4AA0A 4M3QA 4BICA 1AGWA 4ZS4A 4UB7A 5JH6A 5CENA 2CNUA 3LJ0A 5K4JA 3D83A 2BRMA 3OY1A 4FKTA 4WRGA 4WUNA 3G15A 3HYHA 3LQ8A 3HMIA 5HBHA 2UW0A 4C3RA 5AV1A 3S95A 2B9JA 5DN3A 4AX8A 1SNUA 3B2WA 3CJGA 3FMMA 4IJPA 3LCTA 3F7WA 2DQ7X 5DGZA 5FEQA 3V8WA 4FV6A 4QMUA 3SG9A 1YVJA 4QYHA 5DVRA 3NCZA 5CEQA 4IMYA 4KB8A 4KA3A 3EFJA 4BZDA 3CQEA 4EH7A 3VS7A 4F7NA 1ZYSA 1GIIA 2Z60A 4NW5A 3Q5ZA 4IX6A 2PPQA 3IDPA 1SVHA 4CKRA 3MPTA 2C3JA 4FICA 2I0YA 4FKGA 4MX9A 4PTCA 5E8ZA 5IA3A 4ONAA 4FG8A 3KREA 3H0ZA 5AP2A 5BYYA 2HWPA 4CFMA 4JI9A 3P78A 1KE9A 3RWQA 2GNHA 1H8FA 4FIJA 5AA8A 4KS8A 4AQCA 2J0LA 4I23A 3EQGA 5JFXA 2BVAA 3FMKA 5ANOA 5BUEA 3CR0A 4H36A 3TNPC 5C1QB 1BUHA 3VUIA 2BRHA 2B9IA 4EYMA 5CNOA 4GK3A 2X7OA 4IXPA 2ZM1A 3R8LA 5AADA 4D4RA 3FY2A 1IA8A 3COMA 3KRLA 2W5HA 4F63A 4DT8A 1RQQA 4GU6A 3EMGA 4PMMA 4IZAA 3FZ1A 2UZNA 4CCBA 3GCQA 3LCOA 5HO6A 4F4PA 5C9CA 3ZXTA 4Y5HA 3SW7A 2IW6A 2ZB1A 3FUPA 3W18A 4H1MA 4GH2A 2QOKA 2PSQA 4C4GA 1BYGA 3GCPA 3WF5A 4IAAA 5CAVA 3UG1A 2VNYA 2R3HA 4FK6A 5DWRA 3A8WA 3EQRA 4F0FA 3DNEA 3R28A 4L42A 1YDRE 2GQGA 3PUPA 1M2RA 3V6SA 3V5QA 2PWLA 5AP5A 4PRJA 5CEPA 4TWNA 3T9IA 3UIUA 4DT9A 2I0HA 2XH5A 3HL7A 2UZEA 4D5HA 3KRJA 4B7TA 4DBXA 3AC3A 3TZ8A 3FMLA 5DRBA 2QNJA 4KBAA 2CHLA 4PY1A 1Y6AA 3FPQA 4AG8A 3HVCA 3FLWA 4ENYA 4EZ7A 3NVKI 5DLSA 3VS1A 4D55A 4PWNA 5EQYA 4HPUE 1JAMA 3UMWA 1ZZ2A 2OICA 3BIZA 4KWPA 1OIYA 1GAGA 2P0CA 1PXMA 3D4QA 3OEZA 3RAIA 1PHKA 5T6KA 4G34A 4C4JA 3DPKA 4RIXA 2HW6A 1FVVA 1B39A 2BRNA 5TT7A 4EUUA 4RLLA 5AUVA 4D2PA 4BCGA 2I6LA 4BTMA 2RSVA 3KRXA 4EEVA 4EUTA 5AFVA 2H96A 3E8DA 3VJNA 1JVPP 3NIZA 3UVRA 4UXLA 4JX3A 4D9TA 3RPOA 2JDRA 4V0GB 3RAHA 3C5UA 1TQPA 2OG8A 3FZPA 4ZSJA 5IKWA 4JR3A 4CKIA 4EBVA 3FKNA 5HLWA 3MH2A 2O5KA 1JKKA 2XP2A 1OKVA 3GUBA 4E6DA 3D7TA 4KBCA 3UIBA 5E92A 5I4NA 4L3JA 4TZRA 1NW1A 2WTKC 3KU2A 3M1SA 2C3IB 3RK9A 3OROA 1H01A 4EOJA 5ANJA 3OVVA 4IB0A 3ZDUA 5HIEA 4TNBA 3ZYAA 3TZMA 4MQ2A 4GSBA 5FBNC 5K0KA 3PRFA 3REPA 2OSCA 1U4DA 3TI1A 2F2CB 4M67A 4R1VA 4FIEA 2GTMA 4CFFA 5HG7A 3U6JA 1X8BA 3NVMB 1H1QA 3FC1X 3CPBA 4YC6A 4YLJA 2RG6A 3PVWA 1I09A 4O96A 4EK8A 3ID6C 1AD5A 2JITA 2VTQA 3DFAA 2XK7A 2YIWA 4M13A 1J7LA 2W96B 4NM3A 2PE1A 2VTMA 3NGAA 3BHHA 4EQUA 1UKHA 3ORTA 1KUTA 2X6EA 4QOXA 4YJSA 3BHYA 3DLZA 3DKOA 4MAOA 1E9HA 3DLSA 4ZOGA 3O23A 3V5TA 3DFCB 3HAMA 1OVEA 2ITYA 2XYUA 2F9GA 2WKMA 1WBPA 3R8MA 4ZLYA 3U8WA 3G9NA 4LRKA 4U3YA 4KD1A 3UNZA 4AGWA 2R3NA 3OWJA 3R1QA 4WD5A 3AMBA 5JZJA 2IVTA 5HO8A 5A46A 2OGVA 2VX0A 3CTQA 4HGTA 5ANIA 3ZFXA 4FEWA 3BU5A 4B4LA 2YIQA 2HW7A 1J91A 4IM0A 2WGJA 1W7HA 5FG8A 1R3CA 4AOTA 4BGHA 1QPEA 4IX5A 1XR1A 3RPRA 2RIOA 1Z9XA 2R0UA 3OMVA 4W9XA 1H26A 1OMWA 2GMXA 2VTJA 2UW7A 3PJCA 3OEFX 3PVUA 3DY7A 3GGFA 4GJ3A 4Y73A 2VX1A 3R8ZA 4AGUA 4ASXA 2QVSE 3CY3A 3QZIA 4MH7A 1VYZA 5ETAA 1FVRA 1CMKE 3I5NA 2EXMA 4AZTA 5IG1A 1UA2A 3W1FA 4KABA 4EQMA 3POZA 4M68A 3BRBA 4Y72A 2G2HA 2O3PA 4WUAA 3RTPA 3U4UA 1OPLA 3K5UA 3OXZA 5C4KA 1E1VA 1UNLA 4Y95A 5HLPA 2WMXA 3NZ0A 2C5YA 3QQJA 3DQWA 4U45A 2QU5A 4HVDA 5J5SA 5DR2A 3FLQA 3GU8A 4L45A 4QTAA 3FQSA 5IUIA 3LXLA 3RM6A 1TQIA 4A4OA 3PP1A 2DWBA 3DQXA 3E8EA 4PPCA 5C01A 3Q9YA 4QD6A 3GC8A 4XP3A 1FMKA 2UV2A 2B55A 2I1MA 2WTKB 5E8VA 5HCYA 3HDNA 5J8IA 3RBWA 2XIYA 4IX3A 4NSTA 4R3PA 5HESA 4DC2A 4E7WA 3OS3A 2WMTA 2WMBA 1J3HA 2WU6A 4B99A 3TM0A 4W4VA 4FSWA 5DEYA 4UALA 2B54A 3F3UA 3G5DA 3TV4A 2BIKB 4QMLA 3ODZX 4IVCA 3VUGA 5IPJA 5BUIA 1RE8A 1Q8YA 4O2PA 3C0HA 3IOKA 3R71A 3JXWA 3O17A 2KTYA 1LEZA 5AR2A 2C6IA 4F70A 3QL8A 5M4IA 2FB8A 4GYIA 4AF3A 3BYMA 2JIIA 4JBPA 2RGPA 4TYGA 1XBAA 4DH3A 4FSZA 3VAPA 1NVSA 5JEBA 2VTAA 4Z55A 2P4IA 4AW2A 3TNHA 4YP8A 5DT4A 3I81A 2VWXA 4IAIA 3TACA 2QONA 5HNIX 4XG4A 1ZMVA 3EQBA 3BBWA 3G0FA 2YLFA 3QRTA 3A4OX 3OXTA 4DBNA 4C8BA 3C0GA 4I21A 4NKAA 2OJFE 3AC2A 4IADA 4IB1A 4BCFA 5FUTA 4NM7A 3LQ5A 4O0XA 4XV1A 5IQHA 4Z7GA 3OCTA 1P2AA 3FI2A 3F3VA 4W8DA 1W0XC 3KXZA 3EH9A 3V8TA 3C4FA 1Y91A 3BHVA 2QODA 3VRYA 5LVPA 3ALNA 3F5PA 2Y8OA 4O0YA 2XKCA 4DFXE 3N51A 4E6QA 3ERKA 3E62A 2YIYA 4FMQA 2CN8A 1JWHA 2OO8X 1OPKA 4DEIA 3H10A 4YPDA 5ANKA 4FIGA 1OKWA 3EYHA 2QOHA 1PXPA 2XKEA 1PMEA 3QC4A 1Q99A 4MD9E 4FNYA 1Q97A 3LHJA 4K0YA 1V0BA 3AMYA 3NUXA 5KMKA 1TVOA 4APCA 4XOZA 3TZ7A 2BALA 2X7FA 2PY3A 2ZV7A 5FD2A 3QCSA 2F7XE 4GU9A 3I79A 5KMOA 3BHUA 4O7LA 4O2ZA 1JKLA 2QURA 2IVVA 5HCXA 3VJOA 2X8DA 5AUXA 3NUPA 1ZZLA 2XM9A 4FTKA 3I7CA 2JLDA 1OIUA 5HGIA 4IW0A 3BWJA 4ZJVA 2YCQA 4GIIA 3QALE 5H3QA 2UW9A 5A3XA 3KA0A 4BBFA 2W9ZB 2CKPA 1XH8A 2BAKA 5AX9A 5D41A 4G3FA 1H25A 3P7CA 1U5QA 1AQ1A 5H8BA 3Q6UA 5FLFA 3RK7A 3UZRA 4CG8A 1A48A 3MV5A 4FKPA 4EH8A 2OKRA 2BTSA 4U9AA 2BDFA 5A6NA 4BFMA 2YHVA 4L46A 5FRIA 5GZ9A 3NX8A 5IQAA 4RFMA 4TYHA 2XNOA 1WVWA 3SRVA 5IQGA 2HENA 2OF2A 4DFZE 3PE2A 4CFWA 1H28A 2VTNA 4D1ZA 1K2PA 5AUYA 5ETCA 2PVLA 4GFGA 4IVDA 2BKKA 2A1AB 5A6OA 4AZVA 3R8VA 4YC8A 1KV1A 1QL6A 2XB7A 3QA8A 2Y4IC 2I0EA 3Q52A 3U55A 1FQ1B 2QHNA 1XH6A 3R7GA 5IMEA 2HZ0A 4YJRA 3ORPA 4AW0A 1UV5A 2ONLC 2BZKB 3NUUA 4HVHA 2HY0A 1CTPE 3NDMA 5JRSA 4BDCA 3MI9A 4KAOA 4JNWA 4RIWB 5IUGA 4I0SA 3DNDA 2BPMA 5HD4A 2QR8A 1H07A 1PF8A 3G6GA 4Z3VA 3JYAA 3RWPA 3IK3A 2EXCX 4FKOA 4FEUA 3Q5IA 2B0QA 5HE3A 5J79A 4RLKA 3S2PA 4CG9A 1WBOA 2BFXA 4TYJA 4E93A 4O6LA 3OTUA 3O7LD 4IWPA 5CSPA 4MKCA 2VNWA 4YTCA 5F94A 4G3CA 4KBKA 4C4HA 5AR4A 2NPQA 4FT7A 4RVLA 4CLJA 4Y85A 2GCDA 4FNZA 3Q9XA 3BLHA 4JR7A 4YJTA 4EOLA 3F6XA 3UVQA 4IJ9A 3PXKA 1PXLA 3VS6A 1WBSA 4L01A 5JFSA 2RFEA 3VVHA 3QRIA 5KMNA 5H9BA 1H00A 4NYEA 3KULB 1F5QA 3V5PA 2EXEA 3ZEWA 4H58A 4L3PA 3L8XA 4NL0A 3PYYA 5EHYA 2GNFA 3OCGA 3R1NA 3DS6A 3QQGA 4I94A 3HV6A 2G9XA 3PY3A 3QF9A 4G17A 2R3GA 4UZDA 4XG7A 4DCEA 2OLCA 4CTCA 3FLZA 4D9UA 4F6SA 2JIVA 4FIFA 4FYNA 3TTJA 4CRLA 4TL0A 4PDYA 5J9YA 2CGWA 3KMUA 4YJPA 4QRCA 3PZEA 4NJDA 1U5RA 3CGOA 5AX3A 4E4MA 3D7TB 5FWKK 3LXPA 5L2TA 2HAKA 4FL2A 4N57A 4DN5A 3RP9A 4NUSA 3HRCA 2P2HA 3GCSA 3KGAA 4RVMA 3CTHA 4TPTA 2RFNA 4AN9A 4CYIA 5AA9A 5L2SA 2OZOA 4ALVA 4IBMA 5IQBA 2RL5A 2J7TA 3O8UA 4S30A 5EOLA 1P4FA 4FV4A 5I9ZA 4WSYA 1S9IA 4F1MA 1WBNA 3MVJA 4CCUA 3CBLA 2V62A 3QZHA 3RHXA 2VTPA 4FT9A 3KRRA 1R0EA 4OAUC 3TUDA 2RF9A 1IEPA 4G3GA 5CF5A 5LOHA 5ANGA 4ZLOA 3PXQA 3EFWA 5HX8A 4FTUA 1U46A 2BFYA 3DJ6A 4R5YA 3BE9A 3II5A 3MTFA 3NIEA 4B8MA 1URCA 2J0JA 3PG3A 3W33A 3F2RA 2HYYA 4LI5A 4N4SA 4DYMA 2Q83A 1PXIA 3E3PA 4HNIA 4BDFA 3RNYA 2IO6A 4CT1A 3KXNA 3QGWA 5G1XA 4GL9A 4IWDA 4IAFA 4YBKA 3R7EA 4GYGA 2IW8A 1WFCA 4I41A 2HXQA 2J90A 3UO4A 1GZOA 1Q8ZA 4U97A 5HE1A 4ANSA 4JBOA 4MQ1A 3UP2A 2CCIA 4ZLZA 4GG5A 4TYIA 4M69A 4S34A 4L53A 4YHFA 4O84A 3PP0A 3ZSHA 4BWKA 1XH4A 2FA2A 3A99A 4C36A 4JQ8A 3LFSA 4OBQA 3VUKA 1UNGA 5M56A 5I9XA 4O7ZA 5CEMA 3GVUA 2ZOQA 3LFDA 5E8SA 4UMQA 2PMLX 2WD1A 3DGKA 5AV0A 3NAXA 5DYJA 4MWIA 5CWZA 2HK5A 2XKDA 3QYZA 3QRUA 4EI4A 4L3LA 4YNEA 4JXFA 4EH3A 5CF6A 4BYIA 5DBXA 4DEAA 5LCJA 1H1SA 1GIJA 2J5EA 3AC4A 5GINE 1ZRZA 3WIGA 4OAVB 4KIPA 3TEIA 4ZSAA 4D0XA 5A4TA 4C3FA 4X6QC 3SOAA 4AFJA 2I7QA 4XLIA 5AJQA 3A61A 3ROYA 2NRUA 1MUOA 4FSRA 3C1XA 4LRMA 4XHKB 5EKNA 1UU7A 4UX9A 2PZ5A 5J1WA 3PXZA 4JBVA 4PL4A 5EYDA 3FQHA 3OBGA 4KIQA 4TKSA 4ZXTA 4BIBA 4UBAA 1QMZA 1SNXA 3A8XA 3ITZA 3A7GA 2GNJA 3T9TA 4R3RA 4EK4A 3SGCA 4X2FA 3QD2B 3FZOA 4C2WA 2ITXA 4FOBA 3EHAA 4TW9A 5IH4A 4M8TA 1SM2A 4QMPA 3ACKA 3O7LB 3FQEA 3KRWA 3ZM9A 4FZAB 3Q3BA 3ZUUA 5ICPA 4O7RA 4GEOA 4R3CA 4FUXA 3DT1A 4BCQA 3KF7A 4ZTHA 3D5WA 3FHIA 5KUPA 4DH8A 4XCUA 3VF9A 3R8UA 4Z7HA 1B38A 1Q8WA 5CZIA 4FSYA 2C1BA 4FTJA 5CTPA 2QQ7A 2ITNA 5FTQA 2WQEA 2ITTA 2V0DA 3EIDA 5CEIA 2WMWA 3VQHA 3VO3A 4CZYB 2VTHA 2YA9A 2JDOA 3FZRA 3A62A 2G15A 3SG8A 2W1EA 4IB3A 4QMZA 4E4LA 4A9RA 3GU5A 4LL0A 3OF0A 2C6DA 4BKZA 4FKUA 5AAGA 4EH2A 3EKNA 2CLQA 3AQVA 4FT0A 4BTKA 1PMVA 3CS9A 4GKIA 2G2FA 4JIKA 1VR2A 2CGVA 2GHGA 4MD7E 4LUDA 4JVGA 1YXUA 3DAKA 4FV5A 1W82A 1QCFA 3EB0A 5EW9A 3V04A 5I9WA 5LXMA 5M4UA 2FUMA 5DE2A 4BDEA 4FSTA 2J50A 3S4QA 3PSCA 3EWHA 4QMTA 1XH9A 3LM5A 5K3YA 5HVKA 4IAZA 4OR5A 4M84A 3WYXA 1Q62A 2BHHA 3MH0A 3O71A 4L9IA 2QOQA 4YHJA 5HBJA 3FPMA 4CRSA 1OZ1A 1PYXA 4XRJA 2Z7LA 4IEBA 4QMYA 1JSVA 3MVLA 3QKKA 4XS2A 4ZSEA 3OWLA 4H3BA 2XUUA 2R4BA 3ET7A 3IG7A 1T46A 4RWJA 4RPVA 3COHA 4EONA 2XNMA 2WMUA 3QTWA 4O82A 5E9EA 4WBOA 3TNQB 3UBDA 4RC2A 4PL5A 5KE0A 3MYGA 3KCFA 3PXYA 2NRYA 2OZAA 3K3IA 3MPMA 3AG9A 5AIRA 3SXSA 4O7WA 3JUHA 4JQ7A 4M14A 3M11A 3G33A 4FTAA 4FT3A 3FZTA 4FIIA 4GUBA 5BVWA 4BGGA 2WTVA 4UN0C 5JZNA 4DCAA 3L8SA 2WIPA 2XNBA 2NO3A 4TT7A 3LMGA 5HG5A 3LFFA 3CD3A 4NZWB 3QXPA 2Q0NA 3R83A 3W8QA 4CV9A 5EQPA 1NT2A 4ZTRA 4L52A 4Q2AA 1G5SA 5FQDC 5HQ0A 4FG9A 4FNXA 4IB5A 5K0XA 4EH9A 5BVNA 4G3DA 4V04A 4C35A 4RX9A 3PLAE 3ALOA 2CLXA 3RPYA 5ANEA 2WB8A 2WIHA 4ACCA 2YLEA 3LFNA 1K3AA 1ZOGA 3VBVA 4YU2A 5HNGA 4R77A 3QUEA 4ZK5A 4A4XA 5HORA 4ANLA 1YDTE 3GCVA 2CCHA 1CKIA 4RSSA 3HGKA 2OXYA 4AT3A 3DB8A 3E8NA 3U87A 3NRMA 3UG2A 3F2AA 4F9BA 4ZS0A 4I6FA 4QP4A 3WE4A 5BVKA 3QHRA 4P4CA 3UPXA 3BZ3A 3RMFA 4DG2E 1GIHA 2EB3A 4HCTA 5EI2A 5J1VA 5A4QA 5IQDA 3PPJA 2B7AA 3PIXA 4FKLA 1ZAOA 3OTVA 2P3GX 5M4FA 3GENA 3G51A 3WF9A 5LWMA 3O50A 5CI7A 4OTFA 2CNQA 1KE6A 4QTCA 1H1WA 2XYNA 4FKJA 3TIZA 4E6AA 3ZSGA 4C4IA 4ANNA 2YM3A 1K9AA 4FV1A 5K9IA 5BX0A 2AC5A 4APPA 2WAJA 2R5TA 3R04A 3PXFA 4DEGA 2V22A 3Q04A 4BVUA 4O7YA 5KMIA 5HVYA 4FL3A 4JAJA 3UOKA 2VO3A 3HLLA 4DITA 2PVFA 3ZTXA 5I5ZA 2C6MA 4X2GA 2A4LA 2QCSA 4A9UA 3EFLA 3R7IA 5HZNA 2R3IA 4AACA 2R0IA 3VC4A 2REIA 4FK3A 4DEDA 4EK5A 1PXJA 2PUNA 3ROCA 3TCPA 4ITHA 5J5TA 4BF2A 3HRBA 3U9NA 5IA1A 1KV2A 3W16A 4U8ZA 4E20A 3DXQA 2WTDA 2C47A 3L9MA 3LZBA 3MY0A 4FUYA 4MHAA 5CU3A 3O8TA 5L6WL 3UO5A 3I1AA 3QTQA 2ZAZA 4PV0A 3AT2A 4H1JA 4JG7A 4I6HA 4FKVA 4I5HA 2Y6OA 5GZAA 3R01A 5CU4A 4MBJA 1RDQE 3V3VA 2VTLA 4F1TA 2E9UA 5J9LA 4DTBA 2X2KA 3TZ9A 3DZOA 4LOOA 4X3FC 1PRYA 4R6VA 3BYSA 4CZTA 4O86A 1W98A 2JBPA 4FEQA 4DINA 2QO9A 1KOBA 1YHSA 5IA2A 4L7SA 1ZOEA 4YNOA 3FLYA 2EUFB 2CKOA 4R7HA 2OJGA 4NM0A 3MPAA 2BMCA 2WMAA 5FXQA 3F3TA 3LCKA 3UNJA 3RM7A 3DBDA 4O0SA 3DBFA 3O96A 3ORNA 4RIWA 4ZJIA 4IIRA 3HUCA 2ITVA 3F2NA 3G2FA 2XK8A 4E4NA 4OT6A 1PY5A 3RCJA 4CGAA 3MFSA 5KMMA 4QMWA 1MRVA 5I0BA 2ZV8A 1UU8A 4MF1A 4JAIA 5GNKA 4BDHA 3C4EA 2J0MB 5EK7A 3KF4A 5AR3A 3T3UA 4ZY4A 3DA6A 5FXRA 1XH7A 2GNGA 3FSFA 3PJ1A 3RCDA 4LOQA 3DKFA 5IQCA 4OTWA 4XG3A 5IUHA 1U59A 4O7NA 3SHEA 4CMUA 3KB7A 4EKKA 4E4XA 3NUSA 2YM6A 4G6OA 4V0GA 4ZSLA 5IQIA 5C8KA 1OUKA 3LJ2A 3W8LA 3RALA 3UDBA 2XJ0A 2W5AA 2YM4A 5AIKA 2CSNA 1YRPA 3BEGA 1IR3A 3G0EA 3IOPA 4BI0A 4X6RA 3PXRA 3R9OA 3GXLA 4C62A 1YXTA 2OJIA 5EDRA 3QWJA 4H05A 3R9HA 4E8AA 4K11A 3P7AA 3OBJA 3WF6A 5CF8A 3GFWA 4EZ5A 2GFCA 4QPMA 4D4SA 3G9LX 4HNFA 4IZ5A 5BNJA 2VTOA 4WHZA 3RK5A 3M42A 4XJ0A 2PVNA 3HNGA 4F6UA 5CU6A 4AZSA 2C0OA 3BQCA 4YJNA 1JKTA 1GJOA 1R39A 3OT8A 3WOWA 4AGDA 5AWMA 3WILA 5AR7A 1YOLA 4P7EA 3TV6A 2VWYA 4PQNA 5CX9A 4UXQA 4CMTA 3RZBA 2QO7A 3GQIA 5L8JA 3IGGA 4ASEA 1I44A 4QP6A 4ACGA 1VZOA 4YLLA 3ZO1A 2GS7A 3ZLYA 4MXZA 5HU3A 4EZ3A 2BTRA 3BYVA 4NIFA 4I6QA 2QOBA 3BGZA 5CLPA 5JFVA 4GJ2A 3VN9A 3OCSA 3W2CA 3F61A 4NTSA 5AP0A 2UVYA 4BBEA 2BR1A 2B53A 1MQBA 3F3WA 3NLBA 2WELA 3QQUA 1JNKA 3MY5A 2ZV2A 4K1BA 4JL9A 4M97A 2VUWA 1M2QA 3LFCA 3TXOA 4GCJA 1UWJA 1R1WA 3OC1A 3EQHA 5D9HA 4F6WA 2UUEA 2PMIA 3TDWA 4FSNA 5AUWA 2Z7QA 1XKKA 4I24A 3C13A 4FTNA 3A7JA 3HV7A 2GS6A 3SW4A 2R3KA 3ZS5A 2W1FA 4CZUA 3PA5A 4BR3A 2VO6A 1U54B 2YM5A 4BKYA 1PXNA 3LJ1A 3NYXA 4FKSA 5HG9A 1NA7A 3BV3A 2JKQA 4Y5QA 3Q60A 4YZNA 3C4WA 4J7BA 3HA8A 4XP2A 5CAQA 3Q2MA 4F7JA 4BDIA 4IE9A 4A07A 2BDJA 4FV2A 4JX7A 1IAJA 5CSHA 4J99A 1WMKA 3QKLA 4BRXA 2G1TA 1G3NA 3SOCA 2PZIA 3W10A 4A4LA 5L2IA 5CS6A 3VS5A 4FZ7A 4D2RA 2WQBA 5BQ0A 3ULZA 2IWIA 2HCKA 4EOMA 1YWRA 3IQ7A 3MBLA 5F4NA 4ANOA 3V51A 4GUEA 2YN8A 2W9FB 2GHLA 3QCXA 4QPSA 2VX3A 4ZZNA 4FSMA 3LFQA 4FV3A 5HHWA 3LFBA 3KL8A 3FMNA 4FKWA 4XOYA 3OUNB 5CQUA 4EH4A 2W1DA 2FVDA 3BWFA 4DHFA 4RFZA 1GZ8A 4GW8A 4M66A 3QHWA 2PVJA 2R3RA 4TYEA 4BCIA 4CTBA 3T3VA 3DXNA 1UVRA 2R2PA 3OHTA 4S31A 5IMXA 1OBDA 4RFYA 3RNIA 4U80A 2C5NA 2XVDA 3ZSIA 3KCKA 4L43A 4EHGA 4MTAA 2XIZA 3ZC5A 3V6RA 3AC5A 4L6QA 2HZIA 3QU0A 4NKSA 3KULA 4G6NA 4BI1A 3NYNA 3PWDA 4E5AX 2PZYA 4YJVA 4L44A 3CGFA 5AP7A 4ZSGA 5C26A 1DS5A 4I4EA 4G1WA 5HOAA 3IDBA 1HCLA 5CASA 5IEXA 2VTIA 2F2UA 2Y4IB 1UU9A 4CD0A 3QC9A 4PMTA 4LL5A 4RWKA 4FEVA 4A9YA 3GCUA 5EW3A 4S32A 5LMKC 2Y6MA 2BRGA 4EQCA 4KIKA 5CXHA 4PDOA 3R00A 4XP0A 5JQ8A 3I4BA 3KXHA 2VWZA 4Q9ZA 4KIOA 4DFYA 3P0MA 3VF8A 5HCZA 4S2ZA 1YI3A 2UZBA 4NWMA 5M06A 3ZUTA 2FGIA 3P79A 3R2YA 5CNNA 5L2QA 4FR4A 2SRCA 3H0YA 4QMSA 4ZAUA 2VGPA 3CJFA 1OITA 4MYGA 4AOJA 1Q3DA 2QU6A 4PPAA 1ZYDA 1OL1A 3EQDA 3LFEA 5G6VA 4E5BA 2VD5A 2FH9A 2J0IA 4XX9A 5BUJA 2VWVA 3O51A 5AUZA 4BIEA 2R7BA 2IZTA 5EDQA 3RHKA 4BCMA 2GFSA 2X2LA 1MQ4A 1OIQA 4FSUA 1JKSA 4WNMA 3QAME 4V01A 4EC8A 4QP7A 5GZ8A 4IZYA 1M7QA 4G2FA 4OTPA 4UV0A 5CU2A 4RWLA 4ACMA 3OCBA 1O6KA 4RRVA 3EL8A 3CLYA 5J95A 3A7FA 5CEKA 1U54A 3D2IA 4AP7A 1YKRA 4IVBA 3IO7A 4P2KA 3UQCA 3RGFA 2YIXA 3C50A 5EG3A 4JS8A 2PVHA 1RW8A 2VWBA 3ZLSA 4FBXA 4GT5A 3CE3A 3HV4A 3TN8A 4ZZOA 3ENMA 1Q24A 3AGMA 4DEBA 1Y8GA 1PXKA 1Q8UA 3AD6A 1H4LA 4A9SA 3OZ6A 4J53A 4O27B 3UP7A 4OTQA 2VWUA 2XCKA 1SYKA 2YAKA 2IN6A 2XM8A 3AT4A 4JLCA 1V0OA 2CKEA 5LVLA 3FMJA 1LPUA 4RJ5A 4TWCA 3PSDA 4I20A 3GU4A 2VRXA 2CGUA 3DV3A 1CKJA 3NNUA 3HKOA 4G9CA 2UW4A 4YJUA 3K3JA 4YZCA 3UOHA 4MCVA 2DUVA 3QFVA 4NTTA 3EOCA 4RX5A 4EOOA 3IKAA 4FL1A 4RQVA 5AV3A 4QO9A 3D14A 3ANRA 3NYVA 1ZOHA 5DT3A 3H4JA 3JVRA 3FMEA 3NNXA 4HJOA 3OW4A 4GFMA 2WTIA 1W83A 3MA6A 3ORIA 4O21A 1DI8A 1TQMA 4KS7A 4G31A 3ZLXA 4C0TA 5KMJA 3AMAA 4D1SA 2PYWA 2C6OA 2C68A 4F64A 4BB4A 2PHKA 1FINA 2QOIA 3Q9WA 5I3RA 4ACHA 3MFTA 4F7SA 4NT4A 2QOOA 3OP5A 1PJKA 1OKZA 3RVGA 1A06A 3MVHA 4I5MA 3QQLA 3HMMA 3OWKA 4USEA 4PF4A 3FEGA 3BELA 4A06A 1CSNA 5D11A 3PVBA 3QUPA 4RA4A 2R3PA 4F09A 3JPVA 2ACXA 1PMNA 2UVZA 2YAAA 3VWAA 4DA5A 5H2UA 2ITQA 5CVFA 3QQHA 4R8QA 4JQEA 4ASDA 1YOJA 3W2OA 5HNBA 4QTEA 1J1CA 1UWHA 5M07A 2BDWA 4XNEA 1M2PA 1LEWA 1OL6A 2X81A 4YZDA 3ZZEA 4S33A 4BCNA 3DDQA 5AM6A 2W4KA 3MH1A 4AFEA 5A4LA 3ZONA 4Q9SA 3ULIA 4TY1A 3VBTA 4AA5A 4ERKA 4ARKA 1V1KA 4FZ6A 4IQ6A 2JC6A 4LGGA 2C30A 2R3LA 4E6CA 4XRLA 4BYJA 3VW6A 2GQSA 1M17A 4HYIA 1BL7A 4DGGA 5JFWA 5KBRA 3U4WA 2OWBA 1OKYA 4WG3A 3N4VA 1BL6A 3FE3A 5CT7A 3WE8A 4G6LA 1JPAA 5AEPA 5CYIA 5JMSA 2Y7JA 2IVUA 3QD3A 4RA5A 4FTOA 3ZFMA 3HMOA 1SVGA 4PTEA 4OUCA 4PX6A 2C4GA 3HP2A 3DU8A 3ZUVA 2JIUA 3GT8A 1L3RE 2O65A 3MTLA 4QP1A 5CXZA 4XEYA 4C34A 3NEWA 5F95A 5TR6A 3DK6A 3OXIA 5JGBA 1XQZA 2GHMA 3KK8A 5TKDA 3E87A 2C3KA 1B6CB 4IWOA 3PRIA 4NU1A 2W99B 5DI1A 4GKHA 3H3CA 4USDA 4QQCA 5AP1A 3UZPA 5IZFA 5JT2A 4OW8A 5M08A 1FPUA 4ZTMA 3UOLA 3AT3A 4YURA 5CSWA 5E1SA 4KKHA 5L3AA 2YDKA 3F7ZA 3PJ3A 1ZY4A 2HXLA 3NPCA 4CFXA 2O63A 4QMMA 2YFXA 2WPAA 5HEZA 1WBWA 1JSTA 3E88A 5D10A 5CAUA 2A27A 5HG8A 5TOZA 4Z16A 4G5JA 3TUCA 5ACBC 1KE8A 3OD6X 3KXMA 3RAKA 3FKOA 3NSZA 3FY0A 4FZDB 5AR8A 4KSQA 4HYSA 2OIDA 2UZDA 2Y4PA 4HVGA 4NCTA 4DH5A 1Z57A 5CAOA 4FTRA 4TTHB 5IQFA 4FX3A 5ANDA 4FTTA 4IZ7A 2ZJWA 5HVJA 3COIA 4AZFA 3F88A 3LAUA 1HOWA 5L6PA 1JLUE 3PDTA 3S00A 3D7ZA 3GU7A 4UZHA 1Q8TA 2AUHA 4RT7A 3LCDA 1KE7A 5I9YA 2JAMA 2V7AA 2X9EA 3BI6A 4FTIA 4ASZA 3LM0A 2ESMA 5EYCA
chains in the Genus database with same CATH superfamily
4RBLA 2PE0A 4I1ZA 3BPRA 3PJ2A 4E73A 4W4XA 4IVAA 5E8XA 3L9LA 3VHEA 2GU8A 4RX7A 5KBQA 4ANMA 3BGQA 2BRBA 2ZDUA 4X2JA 4C4EA 5EKOA 3FXZA 4IC7A 1WBVA 4IAKA 3VNTA 5GJDA 3RJCA 3TG1A 1VJYA 4IWQA 5LJJA 4N6YA 4KRCA 4EORA 3TUBA 4YO4A 4ZY6A 1WCCA 3ELJA 4CFUA 3R22A 3JS2A 3NNWA 2QI8A 5FGKA 3TIYA 1CM8A 4WRSA 5IDNA 3R30A 1SVEA 5DH3A 3DXPA 3ETAA 4FV0A 2IZUA 3AOXA 5KO1A 3E3BX 3FZSA 5HX6A 5CZHA 3K54A 4Y83A 5ETFA 4EHEA 4AS0A 4BCPA 4O81A 2JKMA 4PMPA 2W1IA 2ERZE 4WNPA 2BZIB 3BL9A 4IDVA 5LARA 1UKIA 2HZNA 3TL8A 4R78A 2WTWA 2X39A 4O0TA 3N4TA 2IJMA 3SRVB 2WTJA 1IRKA 4X21A 1ZYJA 3SV0A 3HAVA 1F3MC 1OPJA 2C0TA 3PIZA 4FV8A 5L8KA 3AGLA 3SA0A 1GY3A 3WARA 5I3OA 4FODA 4W4WA 3ORZA 4O7VA 4ORKA 4XBUA 4RMZA 1Y57A 3Q2JA 4FNWA 3WBLA 4FKRA 5EFQA 4DLIA 2XIRA 4EKLA 3TMOA 4OTRA 1YQJA 1YI6A 3TTIA 2O8YA 1O6LA 3L9PA 4ZTSA 2XRUA 4ZJJA 4BCHA 5CU0A 4U42A 2QHMA 3DKCA 5JKGA 2R3FA 4AN3A 2XJ1A 3QLGA 4D1XA 5A4CA 3HDMA 3VW8A 3ZHPC 2ZMDA 3A7IA 3DBEA 4J52A 1JSUA 3Q4UA 4L7FA 2V55A 4HVIA 2PZPA 2OH0E 5JN2A 5BV3A 5M51A 5FP6A 3ZDIA 4ACDA 4U0IA 4JDIA 3EQFA 4K77A 2O2UA 1APME 5BMMA 1FGKA 2JBOA 3PA4A 4RQKA 5AR5A 4C38A 3AKKA 4QP9A 4W9WA 2BKZA 5CVHA 2WTCA 5B0XA 5IA5A 3S0OA 2CN5A 1GZKA 5D7VA 3BE2A 4BCJA 2OJJA 4GS6A 4WO5A 4XYFA 1REJA 3P86A 3DOGA 2GS2A 4I6BA 3KXGA 3P5JC 4YSMA 1PMUA 3WZEA 5L2WA 4I4FA 3R7VA 3FKLA 3OUKA 3QQKA 5EW8A 3TJDA 3U6HA 4GVAA 3KVWA 2ZV9A 4F0IA 4C2VA 2GPHA 3OFMA 2YZAA 3W0QA 2OK1A 4P5ZA 3VS4A 4JRNA 5DPVA 3SDJA 4ANQA 1ZLTA 3PLSA 2FSTX 4Z9LA 2H9VA 4K6ZA 5I9UA 4GIHA 2ZM3A 1Y6BA 4OTDA 3C4CA 1BMKA 4ZTLA 2E9VA 4YPSA 5EOBA 4EBWA 4ALUA 4RG0A 4EK3A 5EH0A 5IF1A 4H39A 3SXFA 4J71A 2EU9A 3NFGB 3CCNA 4CFNA 3MESA 4MVFA 2ETKA 5FTGA 4H3QA 3PWYA 2RKUA 4BDBA 4EHVA 3LIJA 2OJ9A 4DGLC 4EH5A 2GDOA 4QYYA 2PUIA 1VLRA 1OL5A 3FL5A 2CKQA 3MB7A 5JGAA 3MVMA 5CI6A 2XS0A 5A14A 2XBJA 4AA4A 1QPDA 4AXAA 1P14A 1URWA 3WZJA 4JIAA 4ZMFA 3CSVA 1H1RA 2X0GA 3Q4TA 3NMUF 2H6DA 2VO0A 4MXAA 3HV3A 2J0KA 3C4ZA 3OT3A 5AMNA 4MXXA 3PY1A 4C33A 3OW3A 4EOKA 5B2KA 1ZYLA 1RJBA 3EFKA 4ALWA 4I6LA 4BY9E 2OXDA 2UW3A 4RC4A 1R0PA 2ITZA 3KC3A 4QP8A 3DJ5A 4AZEA 4CYJA 3E64A 2J6MA 5FBOA 4KUJA 4KKGA 3NR9A 5FDPA 2XZSA 3BYOA 4QNAA 4J8NA 3CD8A 3P9JA 4UWYA 3E7OA 4D5KA 3ORLA 4DGOA 2Z8CA 4HGEA 5EHLA 5D12A 3OWPA 2W7XA 3R6XA 2OFUA 3NWWA 5D1JA 1GNGA 2QLUA 5HICA 3V01A 4MBIA 2PL0A 4NW6A 4YTHA 3ZU7A 2X0QA 4I93A 3RPVA 3ORKA 2QOCA 3COKA 4O0UA 3W2RA 4OGRA 1REKA 3Q96A 4OBPA 5KZIA 2Q0BA 3L9NA 4PL3A 4CQEA 4ENXA 1BI8A 3PVGA 3CKXA 1R78A 3ZXZA 3LLAA 4QYGA 3BBTB 3C51A 2PUPA 1P5EA 2YEXA 4EOSA 2C6EA 5HTBA 2Z7RA 3ACJA 4J1RA 2WEVA 5HKMA 4K8AA 3C4XA 4ERWA 2Z2WA 2WOTA 3WZKA 2RFSA 3QRKA 3SC1A 3QX4A 1EH4A 5CALA 5AM7A 1QPCA 2ZMCA 4OTIA 2WNTA 3FMDA 2ETRA 3DTWA 3G90X 4U5JA 3DCVA 3SLSA 5KKRC 3EQIA 4NEUA 3E92A 3GC9A 5DIAA 2PVMA 3BCEA 4UWBA 5CQWA 3WF8A 4AW1A 5EYKA 5A9UA 4BHNA 4AGCA 3BHTA 2VGOA 3WZUA 4FIHA 3M2WA 4QYFA 2YJRA 2F49A 4RZVA 4L67A 3UGCA 2HOGA 3AD5A 5E91A 1L8TA 2YCFA 3WIKA 2YCRA 3DBQA 3GC0A 5FM2A 5LWNA 3I7BA 3KK9A 3GNIB 2R64A 4ID7A 2ZVAA 3CQUA 4FV9A 4JG8A 3UDSA 5HD7A 2BUJA 4G9RA 4ZEGA 4O83A 2HZ4A 2YM8A 1MRYA 2W06A 3GOPA 4TWPA 4CFVA 4F1OA 1YWNA 2W4JA 4D28A 4UMPA 1STCE 4D4VA 4FA2A 3UZTA 1W8CA 4DLJA 4QPAA 1YXXA 4V05A 1H08A 5AP3A 2ITOA 4XBRA 3P23A 4BTFA 4G16A 1J7UA 1YHWA 5DR9A 1M52A 2A2AA 2VTRA 4ITJA 3P08A 4WG4A 4DTAA 5FXSA 3FXWA 4HZRA 5BVDA 2P2IA 3QTSA 2UZUE 4LV8A 2OU7A 4IC8A 3UYTA 4AU8A 2CMWA 3FWQA 3TWJA 4YHTA 3QKMA 3MJ1A 3QCYA 4C02A 2A0CX 3RI1A 5LVNA 3O0GA 4KRDA 4LOPA 3UYSA 3F3ZA 2X1NA 3LW0A 4EWQA 5M4CA 2XMYA 4EOQA 4XG8A 2ETMA 5F1ZA 3VS2A 4MK0A 4MXOA 4GK4A 4MNEA 2NNWB 3IW4A 3HP5A 3DB6A 4AWIA 5I9VA 1JOWB 2YJSA 3QRJA 5CSVA 3F5UA 3UE4A 2JGZA 2W1CA 4UMTA 5GHVA 3S3IA 3C9WA 3PPKA 2PMNX 3KN6A 4JRVA 4R5SA 2YWPA 4CT2A 5IISA 2XARA 2BILB 4PTGA 4DE4A 1J7IA 4FV7A 2C6KA 4UMUA 4CQGA 4L68A 2WXVA 3MB6A 2R3JA 4J97A 4RIXB 4TWOA 2GTNA 3QQFA 3CIKA 2V5QA 4RJ7A 3UJGA 3EZVA 3IPHA 3NW5A 4C57A 4WOVA 1NXKA 3TYKA 2OXXA 1VEBA 3FMHA 4U43A 2KULA 4D0WA 4EC9A 4HCVA 3R8PA 4B8LA 4YLKA 3B2TA 5DNRA 1JQHA 3VHKA 2FSMX 5AV2A 1QPJA 1XHAA 2OZAB 5EM5A 5FM3A 4IX4A 3QX2A 2XNNA 5J7BA 3CPCA 4MBLA 5LMKA 2IPXA 5J87A 3V8SA 3WZDA 3FV8A 2R3OA 5TO8A 4BTJA 3NAYA 4RIYA 4R7BA 2FSOX 2ZYBA 4FTMA 4I3ZA 4U81A 2XNGA 3ZRKA 4WKQA 2YERA 3AD4A 3RPSA 4I0TA 4ZTNA 3C5IA 3CP9A 4U41A 5HI2A 2XIKA 4FI1A 4FKIA 1PKDA 4I0RA 3SKCA 4NM5A 4FTCA 3CKWA 4BDAA 2OIBA 2QKRA 2XNPA 4PDSA 5IDPA 5KX8A 4FOCA 4FZFB 3QYWA 3R9NA 2C6LA 4BJJB 4YJQA 5JGDA 1NVRA 2I40A 3PPZA 4BHZA 3HMPA 5K5XA 1UU3A 1Y8YA 4JG6A 3ZBFA 4RJ6A 3HEGA 4U7ZA 4WA9A 3ZBXA 5AV4A 4O91A 3HV5A 1H0VA 4PP7A 2P55A 3GB2A 4QP2A 5F9EA 3NW7A 5LMBA 1NY3A 3EJ1A 4PUZA 2VV9A 4BZNA 3PY0A 2QO2A 3DK3A 4Y46A 3AXWA 3Q6WA 3U6IA 3IW7A 5KHWA 3EKKA 3CC6A 2UZOA 2BAJA 2YCSA 3I6UA 5CANA 2AYPA 2IG7A 3F82A 2G01A 5TF9A 3OOGA 5BMSA 2PUUA 4W8EA 3I6WA 2Y0AA 3UMXA 3CEKA 4F9YA 2OFVA 2R3QA 2X8IA 1OECA 4WT6A 2HIWA 2P33A 4F9WA 4JT3A 3ZO2A 2B9FA 4P90A 5FEDA 2WO6A 3ORMA 3ZRMA 4U44A 5K5NA 4FRFA 4IACA 2ZM4A 4HGLA 5EI6A 5K4IA 3UVPA 4KINA 3EZRA 5L4QA 3FXXA 2B1PA 3GEQA 2Z02A 2R7IA 3LCSA 2OH4A 3C7QA 3RAWA 1YI4A 3Q53A 4A9TA 3LPBA 4CMOA 4D2WA 3NS9A 5J9ZA 4YJOA 1XJDA 4RIOA 3EN9A 2WQOA 3LOKA 4TNDA 2UZWE 3QD0A 3IECA 2ITWA 4BCKA 2VU3A 3FHRA 4L8MA 3H9RA 4LG4A 5EM8A 3B8QA 3QA0A 2CDZA 4AZWA 3UO6A 2RG5A 3IDCA 4OTHA 3PIYA 1H27A 1OGUA 1PKGA 4RC3A 2W5BA 4MNFA 1F0QA 2X6DA 4A7CA 3IONA 4F99A 4QMOA 2H34A 3LVPA 3QZGA 3SAYA 4GT3A 4HGSA 5BVFA 1MRUA 2C1AA 2F57A 2IZRA 2UW5A 2XKFA 4O0WA 4GFOA 4QMXA 3VBWA 2XAOA 3EL7A 5AP4A 4DFUA 4BWXA 5H8GA 2E9NA 3EYGA 3Q9ZA 4AAAA 4DAWA 1E1XA 4O1PA 2X8EA 4M0ZA 4QNYA 3ZRLA 1YWVA 2B4SB 4O6EA 3RZFA 5CEOA 3QTUA 2QC6A 5A54A 3TV7A 3QGYA 3L8PA 4G3EA 4XLVA 3GP0A 4OLIA 3DK7A 3GU6A 2W1GA 2J9MA 4GT4A 3MIAA 1OL7A 3O2MA 3D15A 3E8CA 3QXOA 5E7RA 4HW7A 3BU6A 4ZIMA 1LR4A 4DFBA 1BKXA 3GQLA 3EN4A 3F66A 4F08A 1ZMWA 1J1BA 1OB3A 3KY2A 4HVSA 3E63A 2VWIA 2VN9A 4PNIA 4D58A 4RGJA 5F20A 2XK6A 3IW5A 5IU2A 4LMUA 4NJ3A 4RJ8A 1DI9A 2OBJA 5J7HA 3A4PA 1ERKA 3NUYA 4IDTA 4BL1A 1FVTA 4BCOA 3ZEPA 2B52A 3MFRA 2F7ZE 3HUBA 2BZJA 3QTZA 3R1SA 4BIDA 1FBNA 4R7IA 3W55A 3U9CA 1WZYA 2CPKE 3FLNC 3DTCA 4L00A 2BZHB 5HE2A 4M12A 5T68A 3NYOA 4W4YA 3VBYA 2QR7A 4X2NA 3DBCA 5AAEA 2AC3A 3FAAA 4N70A 3QD4A 5AUUA 5EI8A 3UQFA 3W0RA 1BI7A 3LMHA 4MXYA 4YZMA 4ITIA 4CV8A 2VZ6A 3H9OA 2LAVA 2NYAA 1M7NA 3MW1A 4NH1A 4BBMA 4AOIA 4X3FB 3UNKA 4NFNA 4AW5A 5DFPA 1DM2A 1OM1A 4UEUA 2HELA 4K2RA 1OUYA 3ANQA 4EOIA 3QWKA 1YOMA 5KMLA 3MWUA 4QQJA 2Y9QA 3WF7A 4EWHA 2BROA 4E1ZA 3THBA 3FBVA 2I0VA 5DEWA 4YTFA 4FC0A 5BVEA 4MXCA 3ATTA 1SZMA 3P1AA 3G6HA 5GIOE 3FI8A 2OIQA 3NW6A 3QTXA 4TXCA 5EM6A 5KNJA 5CSXA 4C3PA 5HIBA 5AP6A 5IEYA 1KWPA 3UODA 3R0TA 4J98A 2O64A 2XNEA 3PJ8A 4E3CA 3BKBA 1XBCA 4FF8A 4OT5A 1Q61A 3NUNA 5HIDA 1IA9A 3HMNA 2OF4A 4XG6A 4DFLA 5CT0A 4RJ4A 5HTIA 3E7VA 3R7UA 2W1HA 4I5CA 5JRQA 4K9YA 3TNWA 5HO7A 3WYYA 4M15A 2QOFA 3TJCA 4CVAA 1P4OA 3KVXA 4XG2A 3N4UA 2JFMA 4QTBA 4LUEA 4BDKA 4QMVA 1IASA 1Q3WA 2IZSA 2DS1A 4AE6A 4ZTQA 4X7QA 1OBGA 1IG1A 4Q5HA 3PA3A 3LXKA 3ORXA 4BGQA 4AN2A 4MD8E 5D7AA 2BCJA 2ITUA 2J4ZA 2W4OA 1FGIA 2WMRA 2YISA 3BGPA 3D0EA 4NIFB 4P5QA 3DJ7A 4Q5EA 5DG5A 4DG0E 3PFYA 3CY2A 3CXWA 4IFGA 4PMSA 2W05A 1ZWSA 3A7HA 1FMOE 4C58A 3OG7A 1VYWA 2F4JA 3VUTA 3FJQE 1NVQA 1KOAA 2XCHA 1XBBA 1ND4A 4X2KA 4EYJA 5HU9A 4M69B 2FYSA 1GOLA 5CY3A 4CLIA 5HLNA 4EL9A 3ZC6A 4GVJA 4YZ9A 4HYUA 5KZ0A 3F5XA 4LFIA 4UMRA 4WG5A 1V0PA 3EN6A 4H3PA 3UC4A 3NCGA 3PTGA 3MA3A 3R2BA 3ZZWA 3DAEA 4BKJA 5BVOA 3OY3A 3L1SA 4YBJA 3PSBA 4E5WA 2WZJA 3UDTA 3HA6A 3BLRA 3R63A 3V5WA 5FDXA 4ANBA 1YW2A 2XRWA 1OIRA 4YTIA 2PTKA 3OOMA 5LVMA 3UOJA 2VTTA 3R7YA 3QLFA 5FTOA 5AAFA 1WBTA 4FGBA 1Q41A 4X3JA 2XBAA 3W2PA 4R1YA 4OBOA 4GK2A 3FI3A 1MP8A 2E9OA 3SXRA 2G2IA 3H30A 3ODYX 4DG3E 5GJGA 3H9FA 5ACKA 3KQ7A 2WOUA 3E5AA 3DDPA 2C5OA 4N0SA 4UYNA 3TT0A 4F65A 4CSVA 1ZXEA 4AT4A 4RX8A 1XO2B 2J5FA 4AE9A 4DTKA 3QBNA 2RFDA 4RVKA 2X4ZA 2JKKA 2C3LA 4QTDA 4O0RA 4B0GA 1XH5A 2FSLX 2Z7SA 3EQPA 3HX4A 3MH3A 3LLTA 4K33A 3ZO4A 5LQFA 1H24A 2ONLA 4RVTA 3D9VA 3AC1A 2W17A 5DA3A 5E8TA 4QMNA 5TE0A 4MF0A 3ZO3A 5LVOA 3QCQA 3FSKA 2QLQA 3P7BA 5DR6A 3D5XA 4F0GA 3QUDA 5IA4A 1FOTA 2CNVA 4RZWA 5KKRB 4LGDA 5EHOA 3KXXA 4IANA 4D2SA 2C5VA 4KNBA 5GIPE 2WEIA 2QD9A 2YDIA 5KHXA 5AUTA 3MY1A 3E93A 3KMWA 5IH5A 2WQMA 4IM3A 5CVGA 4U79A 4BC6A 5E1EA 4DEHA 4FG7A 3V5LA 3I60A 2PVRA 2XK4A 4DEEA 2QG5A 3D5UA 2VO7A 4QYEA 4YGAA 1IAHA 2GNLA 2XIXA 2NP8A 3MFUA 4LM5A 4XV9A 5E4HA 2JFLA 3KKVA 3VULA 4D4YA 2XK9A 3GI3A 3NNVA 3SVVA 5EM7A 3VUHA 3W2QA 2UZVA 2YITA 3F9NA 4O0VA 3MN3A 5EQEA 1GZNA 2WU7A 3ZLWA 3LKMA 1BX6A 4C37A 3NUAA 4FEXA 4XV2A 3JVSA 3EQCA 3HZTA 4E26A 5EDPA 4HZSA 4WNKA 2PVKA 2X7GA 4RJ3A 1KSWA 4ZY5A 4XH6A 5EYMA 2VWWA 4FT5A 3U54A 4G5PA 4EJ7A 3ENHA 2O0UA 3W2SA 3KFAA 5BPYA 2PMOX 2X2MA 3WI6A 3MJ2A 4AUAA 2WHBA 1LP4A 2YM7A 4LQMA 4FVQA 3R1YA 3P5KA 4LGHA 4DF3A 4U6RA 1PYEA 5E8UA 3PG1A 3FDNA 2PVYA 2UW6A 3P4KA 4QP3A 3ZOSA 4C7TA 3KEXA 1S9JA 2C6TA 4N6ZA 4X0MA 4J95A 4YO6A 2ZDTA 3S1HA 4M7IA 3L8VA 4O22A 4D2TA 3BLAA 4TYHB 2PK9A 3B8RA 5E8YA 5L8LA 2QG7A 3QTRA 2ERKA 2WFYA 2PZRA 4C61A 3Q4ZA 1W84A 3R9DA 4YUQA 2EB2A 2JKOA 4FYOA 2JDTA 1SMHA 2YZLA 3FLSA 3EN7A 4J8MA 3MS9A 5DMZA 2C69A 4HOKA 2HWOA 3C0IA 3LQ3A 5E8WA 2EVAA 2WMVA 5HBEA 3CQWA 4HCUA 5B2MA 5BYLA 3RINA 2LGCA 4CNHA 2YDJA 3HECA 3IGOA 3LE6A 5LMAA 2X4FA 1OGYA 3UC3A 3FYJX 4HYHA 3SD0A 4BZOA 4EK6A 3BQRA 4IM2A 4Y8DA 2XEZA 4O38A 5JK3A 2PULA 4DH1A 3GC7A 5B7VA 4X3FA 3VS3A 4EJNA 4BDDA 4TN6A 1Z5MA 3I0OA 3N9XA 1WVYA 4GRBA 4JBQA 3JR1A 3GFEA 3I0QA 2JAVA 3BX5A 1WAKA 4UY9A 4PP9A 4D2VA 4PPBA 1O9UA 1Q4LA 1ZYCA 4UWCA 3PZHA 1A9UA 5H8EA 1Q5KA 2CJMA 2PE2A 5JSMA 4CKJA 2UVXA 4QMQA 4M0YA 1CDKA 4BJJA 2GNIA 4KSPA 5IQEA 3UPZA 2YWVA 1ZMUA 3R02A 4WBBB 4DH7A 3UTOA 1ST0A 3BV2A 4F7LA 2UZTA 2J51A 2J2IB 3HRFA 4BN1A 3LFAA 4DFNA 4DGNA 2C0IA 4U3ZA 2GSFA 5IEVA 5JQ5A 5M53A 3BEAA 3TKHA 2OW3A 2YIRA 2ZB0A 3R7OA 4FKQA 2PU8A 5IH6A 4RWIA 4BDGA 3MDYA 5HTCA 3F69A 3R73A 3FL4A 1DAWA 3D5VA 3GOKA 4IHPA 3U51A 3FYKX 5C8MA 4JJRA 4YC3A 4MNEB 5FEEA 3JY9A 3GBZA 1ATPE 2V7OA 2EWAA 4LRJA 4XV3A 3R21A 5M09A 4I22A 2H8HA 4QT1A 1M14A 3ZFYA 1PXOA 1W2FA 3MIYA 3KN5A 1O6YA 2VTSA 4JDKA 4QQTA 4DGMA 2E2BA 4FVRA 3DZQA 4XG9A 5DT0A 5GJFA 5BYZA 2BHEA 5DOSA 5A4EA 4F9CA 2FO0A 2XJ2A 2XK3A 4AT5A 5C4LA 1DAYA 3AC8A 4WIHA 4FTQA 2IW9A 4EH6A 4PDPA 4UYAA 3UQGA 3ZH8A 3TDVA 3VUMA 2XALA 3RKBA 1ZY5A 3BU3A 5LCKA 4EHZA 3MGYA 2BIYA 4O7SA 5M55A 3VQUA 2IVSA 2A19B 3POOA 5C03A 3UIMA 4EOPA 4FTLA 5DRDA 4K18A 3T8OA 5ITAA 2JDVA 3ZM4A 4ZZMA 3SX9A 2UW8A 2VAGA 3VS0A 4IFCA 4RIYB 4WNOA 3SQQA 2YACA 4II5A 2QOLA 1HCKA 4B9DA 5L6OA 4DHJA 3V5JA 1T45A 1YDSE 3TKUA 2W1ZA 2WMQA 1KE5A 3A60A 4C59A 2C5XA 4MWHA 4IH8A 3ATSA 2ITPA 2WQNA 3KMMA 2QKWB 2HY81 4WSQA 4FGRA 4BDJA 3LXNA 1LUFA 4U40A 1H0WA 2R9SA 3BYUA 4GMYA 4GV1A 4J96A 1G8AA 2DYLA 2JEDA 1H1PA 4YZBA 3ZMMA 1PW2A 2WMSA 4JDHA 5FP5A 5ETIA 3VBQA 3JY0A 4CEGA 2XEYA 2YABA 3IW8A 3VUDA 3W32A 4B6LA 3K2LA 3TNIA 2E9PA 5IA0A 4NCTC 4I5PA 4HPTE 4ZMEA 3VIDA 5C27A 3UIXA 4BWPA 2R3MA 5DHJA 3Q4CA 5T3QA 4AXDA 3D94A 4PNKA 1TKIA 2CGXA 3IS5A 4LMNA 4JDJA 1JBPE 4XMOA 2OI4X 1WVXA 2X9FA 5CF4A 4FSQA 3CTJA 5CAPA 4ZP5A 5KCVA 3LMIA 1OI9A 2JD5A 3TKIA 4JOAA 3Q32A 5E90A 3K5VA 4XUFA 4F9AA 4YMJA 3DAJA 3FI4A 3MSSA 3PFQA 3F5GA 4KIKB 4MEDA 3FC2A 2BAQA 4NK9A 4C4FA 5C8NA 5M44A 3ZCLA 5B2LA 4FE2A 3R9RA 3O8PA 4O7TA 3I5ZA 4USFA 4FVPA 2UZLA 1UNHA 1OL2A 5HE0A 2F7EE 3EN5A 3VRZA 2XA4A 4IAYA 4O1OA 4LYNA 3DKGA 4OTGA 1YXSA 2B9HA 2JDSA 3PE1A 1G8SA 3QTIA 3BLQA 2GQRA 3D2KA 4CXAA 1XWSA 4YSJA 4NFMA 4KKEA 1CKPA 4GG7A 2XF0A 1BLXA 1YXVA 4QQ5A 1ZARA 4YR8A 3QZFA 1YHVA 4LV5A 4BI2A 2W0JA 5M57A 3A2CA 4I92A 3IW6A 4TRLA 3VBXA 4AA0A 4M3QA 4BICA 1AGWA 4ZS4A 4UB7A 5JH6A 5CENA 2CNUA 3LJ0A 5K4JA 3D83A 2BRMA 3OY1A 4FKTA 4WRGA 2XAMA 4WUNA 3G15A 3HYHA 3LQ8A 3HMIA 5HBHA 2UW0A 4C3RA 5AV1A 3S95A 2B9JA 5DN3A 4AX8A 1SNUA 3B2WA 3CJGA 3FMMA 4IJPA 3LCTA 3F7WA 2DQ7X 5DGZA 5FEQA 3V8WA 4FV6A 4QMUA 3SG9A 1YVJA 4QYHA 5DVRA 3NCZA 5CEQA 4IMYA 4KB8A 4KA3A 3EFJA 4BZDA 3CQEA 2AEGA 4EH7A 3VS7A 4F7NA 1ZYSA 1GIIA 2Z60A 4NW5A 3Q5ZA 4IX6A 2PPQA 3IDPA 1SVHA 4CKRA 3MPTA 2C3JA 4FICA 2I0YA 4FKGA 4MX9A 4PTCA 5E8ZA 5IA3A 4ONAA 4FG8A 3KREA 3H0ZA 5AP2A 5BYYA 2HWPA 4CFMA 4JI9A 3P78A 1KE9A 3RWQA 2GNHA 1H8FA 4FIJA 5AA8A 4KS8A 4AQCA 2J0LA 4I23A 3EQGA 5JFXA 2BVAA 3FMKA 5ANOA 5BUEA 4AAYA 3CR0A 4H36A 3TNPC 5C1QB 1BUHA 3VUIA 2BRHA 2B9IA 4EYMA 5CNOA 4GK3A 2X7OA 4IXPA 2ZM1A 3R8LA 5AADA 4D4RA 3FY2A 1IA8A 3COMA 3KRLA 2W5HA 4F63A 4DT8A 1RQQA 4ASXA 4GU6A 3EMGA 4PMMA 4IZAA 3FZ1A 2UZNA 4CCBA 3GCQA 3LCOA 5HO6A 4F4PA 5C9CA 3ZXTA 4Y5HA 3SW7A 2IW6A 2ZB1A 3FUPA 3W18A 4H1MA 4GH2A 2QOKA 2PSQA 4C4GA 1BYGA 3GCPA 3WF5A 4IAAA 5CAVA 3UG1A 2VNYA 2R3HA 4FK6A 5DWRA 3PUFC 3A8WA 3EQRA 4F0FA 3DNEA 3R28A 4L42A 1YDRE 2GQGA 3PUPA 1M2RA 3V6SA 3V5QA 2PWLA 5AP5A 4PRJA 5CEPA 4TWNA 3T9IA 3UIUA 4DT9A 2I0HA 2XH5A 3HL7A 2UZEA 4D5HA 3KRJA 4B7TA 4DBXA 3AC3A 3TZ8A 3FMLA 5DRBA 2QNJA 4KBAA 2CHLA 4PY1A 1Y6AA 3FPQA 4AG8A 3HVCA 3FLWA 4ENYA 4EZ7A 3NVKI 5DLSA 3VS1A 4D55A 4PWNA 5EQYA 4HPUE 1JAMA 3UMWA 1ZZ2A 2OICA 3BIZA 4KWPA 1OIYA 1GAGA 2P0CA 1PXMA 3D4QA 3OEZA 3RAIA 1PHKA 5T6KA 4G34A 4C4JA 3DPKA 4RIXA 2HW6A 1FVVA 1B39A 2BRNA 5TT7A 4EUUA 4RLLA 5AUVA 4D2PA 4BCGA 2I6LA 4BTMA 2RSVA 3KRXA 4EEVA 4EUTA 5AFVA 2H96A 3E8DA 3VJNA 1JVPP 3NIZA 3UVRA 4UXLA 4JX3A 4D9TA 3RPOA 1TFFA 2JDRA 4V0GB 3RAHA 3C5UA 1TQPA 2OG8A 3FZPA 4ZSJA 5IKWA 4JR3A 4CKIA 4EBVA 3FKNA 5HLWA 3MH2A 2O5KA 1JKKA 2XP2A 1OKVA 3GUBA 4E6DA 3D7TA 4KBCA 3UIBA 5E92A 5I4NA 4L3JA 4TZRA 1NW1A 3W0MA 2WTKC 3KU2A 3M1SA 2C3IB 3RK9A 3OROA 1H01A 4EOJA 5ANJA 3OVVA 4IB0A 3ZDUA 5HIEA 4TNBA 3ZYAA 3TZMA 4MQ2A 4GSBA 5FBNC 5K0KA 3PRFA 3REPA 2OSCA 1U4DA 3TI1A 2F2CB 4M67A 4R1VA 4FIEA 2GTMA 4CFFA 5HG7A 3U6JA 1X8BA 3NVMB 1H1QA 3FC1X 4DHZA 3CPBA 4YC6A 4YLJA 2RG6A 3PVWA 1I09A 4O96A 4EK8A 3ID6C 1AD5A 2JITA 2VTQA 3DFAA 2ZFYA 2XK7A 2YIWA 4M13A 1J7LA 2W96B