5BVOA

Fragment-based discovery of potent and selective ddr1/2 inhibitors
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
308
structure length
276
Chain Sequence
b'DFPRSRLRFKEKLGEFGEVHLCEVDSHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDKPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epithelial discoidin domain-containing receptor 1
publication title Fragment-Based Discovery of Potent and Selective DDR1/2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 276
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bvoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bvoA01
4Z7HA 3V8TA 4D0WA 4JDJA 4CCBA 3E93A 2ZM4A 1W83A 4H3QA 4XLIA 4XP0A 3MFSA 3SGCA 3NS9A 4AZVA 4CZUA 5IISA 3PG1A 4FEQA 3DS6A 4IX5A 4V05A 1ZLTA 5BMSA 5JGAA 2XBJA 3GCVA 4XV3A 3NLBA 5AV0A 2ERZE 2WKMA 2R3PA 3E8NA 3PZHA 4U0IA 3QA8A 4E7WA 2C3IB 4DCEA 5CXZA 5M4UA 2PSQA 3D14A 3HX4A 3VUHA 3LPBA 2H96A 4FZDB 5CZHA 3ZONA 3GCUA 3GQLA 4PL3A 5BUEA 1Q4LA 1LEZA 4XCUA 4D5HA 4QYYA 2X1NA 4GSBA 3HMIA 3ORXA 4FSWA 4QMMA 4FKSA 5BVEA 5KBRA 3ULIA 2ITQA 3VBVA 4H36A 5HICA 2Y9QA 4EK8A 1IA9A 2BDWA 2OW3A 3EYHA 2O0UA 3QRKA 5EHOA 4UMTA 5L2TA 4YMJA 2GNIA 3OROA 4FG8A 1REJA 1TQPA 2EUFB 3EWHA 1QMZA 3NUSA 1V0PA 3BE9A 3WZEA 2GU8A 3MVLA 5LJJA 3M2WA 3F3WA 5D1JA 5EW8A 4BHNA 5ANIA 4QP7A 3E7OA 3QRUA 3ZO4A 4LM5A 3BLHA 3Q4CA 4GV1A 5DYJA 4FX3A 3U55A 2GHLA 3HRFA 5CX9A 5CSVA 2Z7RA 3RTPA 1Q41A 3U9NA 2R3HA 3FI8A 4KBCA 4GK3A 3BHTA 1G8SA 3BKBA 1A9UA 4QO9A 5HNBA 1I09A 4HGTA 4YJNA 3VS4A 4JBQA 3FXWA 4D9TA 2P33A 3UQCA 3I6WA 5JZJA 2H9VA 1AD5A 3GQIA 3N51A 4XG2A 5F95A 1YHVA 3DBFA 4ASXA 2XM8A 4R3CA 1XKKA 2C6OA 4C58A 3KB7A 3DAJA 4OTQA 3BLQA 4FTAA 3OOGA 3F82A 4L53A 2PULA 2J5FA 3A7FA 1OIYA 1PYEA 4XBUA 3IDCA 4IMYA 3T9IA 5J87A 3DFCB 3FKNA 3E7VA 4I4FA 3OHTA 3FMLA 4QMZA 4DN5A 4LL0A 3V5LA 4RG0A 4F9WA 2BIYA 2ZJWA 4MVFA 3SOAA 3LFSA 5HO6A 2OGVA 4PNIA 5HIDA 3CTQA 4BTJA 3MFTA 5M57A 3ORZA 2IG7A 3EZRA 2W05A 4XBRA 3F5UA 4X21A 4HCTA 4FEUA 3JS2A 2WTIA 5CF6A 2X2MA 1ZOEA 4HOKA 3GOKA 3BZ3A 3Q2MA 3QX2A 3CKWA 2B0QA 4FEXA 2B7AA 4AXAA 4TXCA 1WFCA 1J7LA 1O9UA 2YERA 5B0XA 3RK9A 3VNTA 4MK0A 4ALWA 2PTKA 4QPSA 2PVKA 4ASDA 3Q4TA 2BDJA 4UALA 2V22A 5JQ5A 4EOLA 5IEXA 4CT1A 3OZ6A 4XG4A 3D5UA 2VWWA 2PL0A 3R2BA 4IDVA 4TYEA 4OT6A 4FTLA 4HGLA 1OKWA 3RKBA 4RIWB 5FEEA 2XIKA 2J9MA 3HA6A 3HDMA 2VO3A 4FIGA 1RW8A 1CMKE 4QYFA 4D9UA 3OXTA 5L6OA 2RFSA 4AQCA 2CNUA 1E1VA 1PF8A 2J5EA 2PMNX 5AJQA 4IXPA 1WVWA 3TNWA 4O7YA 5AR2A 3II5A 3A62A 4FTNA 3SKCA 3PG3A 3AD4A 2ACXA 1GAGA 3VC4A 3H9OA 4L42A 2Y6OA 2C30A 2J50A 3C4XA 4GK2A 2EXMA 4OW8A 5G6VA 3T3VA 3MJ1A 4EHVA 5KCVA 4MCVA 1G3NA 1YOJA 2WPAA 4TKSA 2XJ0A 3SXRA 2A27A 3PIYA 2WU6A 4GEOA 4H1MA 4ITJA 2RGPA 4IW0A 1M2QA 5A4QA 4BZNA 4FICA 4EUUA 1U46A 1E1XA 4AT5A 4BTMA 2JKOA 1RJBA 2XNOA 4GUBA 4OGRA 3PJ2A 5LVLA 2QC6A 4KSPA 1NY3A 4YNEA 4ANSA 5AFVA 3UPXA 3NYXA 4CFWA 5J5TA 2IPXA 3QCYA 3N4TA 4ZS4A 3WF6A 4QP4A 3QFVA 2IZRA 4H3BA 4FV7A 4ACMA 2LAVA 1OUKA 2B55A 3P7BA 5KZIA 4G31A 1H27A 3ZUVA 3RAIA 5EDRA 3ZBFA 3OT8A 5DNRA 4J53A 3FQEA 3MH1A 3BHUA 3M1SA 4IAZA 2RFEA 2XK3A 4I0TA 3ZCLA 4QP6A 5EW3A 3GU4A 3PJ3A 4KS8A 4TWNA 4U40A 4BKZA 4PDOA 4BCJA 5J8IA 5A46A 5AAEA 5AV2A 3F7ZA 4A7CA 4C2WA 3D9VA 3U6HA 4YSJA 5M56A 3RNYA 2UV2A 2VO6A 3QZHA 4RGJA 4MF0A 3LM5A 2J6MA 3KA0A 4TYGA 3SD0A 3P9JA 4QT1A 2OFVA 1P4OA 2WGJA 4J7BA 5HGIA 3UO5A 2C6LA 2VTQA 3AT2A 2OBJA 4FF8A 3D2KA 4FV6A 1PHKA 2FVDA 2QOKA 4J97A 5DGZA 1Q62A 4O96A 2BMCA 2QOOA 4BIBA 4Y72A 4C2VA 5ITAA 4YBJA 3G5DA 3HP2A 5ACKA 4RJ3A 5H2UA 1R3CA 2OWBA 2WMSA 4D4YA 4JDHA 4MF1A 1HOWA 2WO6A 5JRSA 4D1XA 1WBOA 5J95A 1JSTA 3W2OA 4IDTA 1ATPE 1WBVA 3E3BX 3PXFA 3Q04A 4RC2A 3QYZA 5ANJA 3VF9A 3D83A 4FSTA 1JKTA 4LV5A 5HG9A 4HW7A 4AT3A 4FIEA 3ZDUA 2XIRA 3D5WA 3IW6A 4I41A 4XRJA 4A9TA 1GY3A 4L45A 4NFMA 4NIFB 3RAWA 5JSMA 3FZOA 3UBDA 4U5JA 5J5SA 4XNEA 4FV9A 3R21A 3RBWA 4RIYA 2E2BA 1XH7A 4EQUA 4NJDA 5E8SA 2CSNA 3UYTA 4O7NA 4P4CA 3R8UA 2OIDA 4MXCA 2WEIA 3VHKA 5IA1A 3C5UA 4IM0A 3TV6A 2W1FA 2G2IA 2WMBA 3LKMA 2J0KA 3FWQA 3QTQA 4FKPA 4LGGA 4RWKA 1UNLA 1XHAA 4M97A 5CLPA 3ATTA 5TE0A 3L8XA 4CGAA 4PMPA 4NKSA 2QODA 1H8FA 3DDPA 3R7YA 4FEVA 3WBLA 4JS8A 5AP1A 2WD1A 1DI9A 5J9YA 5M51A 2UZEA 4TW9A 2WQMA 3FY2A 2I0HA 5H8EA 3NYOA 2YM6A 4NM0A 3KMWA 3Q52A 4CT2A 3ZXTA 3QAME 4G3DA 5BVNA 2IWIA 2J51A 3HMMA 2C0IA 4I0RA 4AFEA 4E6AA 2JFMA 2GSFA 4L7SA 3IDPA 2BALA 4YU2A 2JIVA 5K0KA 3BYUA 4G9RA 5LOHA 5HX6A 3ZLWA 3EL7A 4MYGA 5J9LA 2X7OA 4M67A 1ZYSA 5C9CA 4DEDA 4CV9A 2JITA 4E5BA 4UMRA 2ZB1A 4PRJA 2ESMA 1Z57A 4A4XA 3U4WA 4B8LA 1WVXA 4MWHA 2H8HA 3KK8A 4BCKA 3AT3A 3ERKA 3GVUA 4HCUA 4HZRA 5AUYA 3NGAA 3KRRA 4F6UA 2PUIA 1J1CA 3RI1A 4Y83A 4C4FA 4FTKA 5CALA 4GU6A 4YJOA 5EI8A 5FWKK 3VJOA 3OTUA 5LVMA 3C5IA 3C0GA 4EK6A 4PUZA 4BVUA 1FVTA 2PVMA 4HPUE 2YISA 4FT0A 4FTTA 5BVOA 1QL6A 4NFNA 2Q0NA 3FQHA 3W2CA 4X3FB 5DWRA 3E87A 4EUTA 4ZTMA 3VQUA 2XB7A 2B54A 3F9NA 4M84A 5CVGA 4NEUA 2X6DA 3R71A 4RQVA 2QKWB 3MH2A 5IKWA 2HW7A 3UIUA 3NX8A 1ND4A 5FRIA 3ZBXA 2KTYA 3DCVA 5HG5A 4BDKA 2YFXA 3AGLA 5D12A 4BDCA 2PZYA 5EOLA 1K2PA 2ITPA 3UIXA 3BRBA 4AGUA 5H8BA 2XRWA 1Q3WA 3MJ2A 5LARA 3QZGA 3QTWA 3AD6A 3TKUA 2C3KA 2J7TA 2R7IA 3GFWA 5K9IA 3F3UA 4YPDA 4M0ZA 4FTMA 1CDKA 1TQMA 3TZMA 3VAPA 3V01A 4FZAB 1YWNA 3CIKA 3KL8A 4PF4A 4DBNA 4OTWA 3EYGA 4E26A 5A4CA 5EYKA 2QOHA 2UZWE 2R3KA 2UZVA 1YHSA 1Q8ZA 5HO8A 1IG1A 4QMNA 3ID6C 2UZLA 4DFZE 4H39A 1BLXA 2UZUE 4G5PA 1F5QA 3AMAA 4GT5A 3KMMA 4FKOA 1Z5MA 1CM8A 2C3JA 1OPLA 2GCDA 2W7XA 2C5XA 4L7FA 4DEHA 3W55A 4F7SA 3LCOA 2J0MB 2WQEA 3KN5A 4PX6A 4XG3A 4EYMA 4M15A 5AV4A 2DWBA 2UW6A 4BCHA 3Q2JA 4ZXTA 5FGKA 2F2CB 2A2AA 3BEAA 3HEGA 4HVHA 5B2LA 2RG6A 3KVXA 2YWPA 3OT3A 1GIHA 4II5A 4TPTA 4FA2A 3R04A 3OTVA 5L2IA 3S1HA 2HW6A 2OZAB 4M7IA 5EW9A 3UIBA 2X2KA 5CSPA 2JC6A 3M11A 1FBNA 2BDFA 4JQ7A 3KQ7A 4D1SA 2I40A 1X8BA 3VBQA 4YJVA 4G34A 1V1KA 1XO2B 3MV5A 2VTAA 2BIKB 4FNYA 1B6CB 4IZ7A 3R7UA 2WQOA 4AW0A 3GEQA 4Z55A 4AACA 2GNHA 2O8YA 3GC7A 2UZTA 5CYIA 4DEBA 4FL2A 3MPMA 4FSMA 2VTIA 3DZOA 3E64A 1JQHA 3PY1A 5I9UA 1OBGA 3BIZA 4KBKA 4DFUA 3Q9YA 2HENA 3FMJA 3SOCA 3CKXA 2PZPA 2YIXA 4U8ZA 3ZO1A 1UNGA 4YP8A 3OCBA 3LXKA 4IANA 2VWBA 5AP0A 3PJ8A 4RVKA 4D2PA 2ITTA 5AMNA 4DTKA 2ETKA 2CKOA 3M42A 1SMHA 4GJ2A 1QPDA 4U42A 4KIKA 3R9DA 2YCQA 1SVHA 3V5QA 4DH8A 5TKDA 2VTOA 4TT7A 2BR1A 5IUGA 2W4OA 3HV4A 3HYHA 4FSQA 3NUXA 4ZSEA 3R9NA 5IZFA 3OFMA 2PMOX 4BC6A 3QTSA 3GP0A 1Y6AA 2GFSA 4PTEA 3AD5A 3FKOA 4GS6A 4IB5A 1BI7A 3HAMA 2JGZA 4IWQA 4G1WA 3UPZA 3NPCA 4G3GA 2OFUA 4FC0A 2R3GA 4A4LA 1R0EA 2EWAA 3MTFA 1E9HA 5AWMA 3TV7A 3Q4UA 4DG0E 4RIOA 2HELA 4LYNA 1H1WA 2VTNA 3MA6A 3O8TA 3PE2A 4BZDA 3F2NA 4O6EA 3RM7A 3UVPA 4O91A 3EMGA 4FNWA 5AR7A 2XIXA 1UWJA 3E3PA 4MNEB 4QPAA 1IEPA 1Q8WA 4IBMA 4RX9A 4BTKA 4DEGA 4NM3A 2OF2A 2Z02A 1MRYA 5CASA 3PLAE 4DEAA 3K5UA 2JEDA 5HBHA 3D7TA 2RFDA 4YJTA 3ZEWA 4GCJA 4FZ7A 5DA3A 3ZO2A 1JKKA 4QMQA 2I7QA 4P2KA 1FMOE 3A60A 5C8MA 4EZ5A 4HVDA 1W98A 4CRSA 4FIJA 2Y4IC 3ULZA 5M4CA 3DXQA 1QCFA 5DR9A 2BTSA 4ZMFA 4QMWA 2CN8A 2VTSA 1P4FA 5DVRA 4S34A 4CYIA 2XF0A 4TYHA 2OJFE 3I5NA 1OI9A 2QOCA 3QQGA 4FZ6A 3OD6X 3VS0A 4NTTA 3UP2A 4OUCA 3UP7A 3QBNA 5J79A 4IADA 3VUMA 4DH7A 1OL1A 2GDOA 2DQ7X 3GUBA 4L6QA 4EWQA 3A4OX 3O17A 2CDZA 4YTHA 3VUTA 3TN8A 4NL0A 5HZNA 2V55A 4ZS0A 4GU9A 3UOJA 4HYSA 1PMEA 3D2IA 2WXVA 2VO0A 4ZTHA 3UZTA 5JGDA 4J52A 3ACJA 3SW7A 2O65A 1NVQA 4FKRA 2BRBA 4F9YA 4YNOA 3TZ8A 4U3ZA 3VUGA 4BI2A 2VWXA 4O2PA 4EQCA 2YN8A 2YM7A 3TUBA 1PKGA 4OTFA 5E7RA 2XK9A 4HYIA 1H24A 1ZMVA 2YLEA 4M69A 4FTJA 4R7IA 1W7HA 2CLQA 4ZTNA 4B9DA 1JKLA 4OBQA 5JQ8A 1BKXA 3D94A 2PUUA 2QO9A 2VGPA 4IC8A 3IOPA 3AC5A 4DGMA 3WF8A 3RVGA 4K1BA 1Q8TA 4X2GA 3PRFA 2C47A 4N6ZA 3BWFA 4XX9A 2I0EA 3KN6A 3V51A 4D55A 1JSVA 2C6TA 2CKQA 4ZZOA 1ZXEA 3HGKA 4FE2A 4GIHA 4D2RA 4BWPA 3AGMA 3NNXA 3UYSA 2BUJA 3TXOA 5IF1A 3RAKA 3QQKA 2BHHA 4G3CA 4FKLA 1M7NA 5FEDA 3RWQA 4NYEA 5KMLA 5AIKA 2WTKB 2WTWA 2J0JA 2UVYA 3CEKA 4Z3VA 3DK7A 3BELA 4WBBB 1O6LA 5DT3A 4EL9A 3EN6A 4RWLA 4WUAA 3OS3A 2F2UA 4WRSA 5FD2A 2OICA 4EHEA 4YURA 5LVOA 4YO4A 4HNIA 4RWJA 4S2ZA 4BCQA 3NUPA 2PWLA 5CU4A 2ZDUA 1YXXA 2QOQA 1XBAA 2ITVA 3IW8A 4OTDA 3NVMB 5HU9A 3HMOA 4BDJA 4E1ZA 3N4UA 4M13A 4APPA 2H34A 2PVYA 4YZCA 4RZWA 5E8ZA 4XG6A 4HYUA 4QQ5A 4C36A 5FEQA 2UW8A 2A1AB 5EI6A 2PE1A 3EQFA 3WZDA 1IASA 4FKUA 3L9LA 3QLGA 5JEBA 4LV8A 3MBLA 5M06A 3LXLA 1U59A 4YSMA 2FYSA 2C1BA 1Q5KA 5A4LA 2G9XA 4G9CA 3UMXA 3DKCA 4AZEA 2ITYA 4C59A 4Y5HA 5HD7A 5T68A 4CLIA 2BFYA 4ZZNA 3R7GA 4WG4A 3U6IA 3D5XA 2Y7JA 3UGCA 3IW7A 4RRVA 3KCKA 3R7OA 4O7TA 5C01A 3VIDA 2XJ2A 4F6SA 4WA9A 3UNZA 1M14A 4EH4A 5H9BA 1YXVA 5TR6A 4C33A 5C8NA 3FXZA 3A7HA 1H08A 3KEXA 2VTHA 4I24A 1YXUA 4FT3A 2YACA 2OU7A 5K3YA 4QP3A 3E88A 1OKZA 5CAVA 4PY1A 3I0QA 3MTLA 1W8CA 2YEXA 3ZS5A 2P55A 4BDGA 2VWVA 2HXLA 1YKRA 4EH5A 5HVKA 2WELA 3TJDA 3ZHPC 3TTIA 1FGIA 4DG3E 3CD8A 4G5JA 4MBIA 4C3RA 2QQ7A 1UU8A 4QYGA 2X8DA 3MYGA 4J99A 4BGGA 2C5VA 4XS2A 4I92A 4E4MA 2B1PA 2VX3A 4DGLC 3ORPA 3CGFA 2A19B 3DKFA 4I4EA 3MFUA 3V5TA 4NZWB 5JMSA 4O82A 2IW8A 4RX8A 3U9CA 2Q83A 5GJFA 3FZTA 5E1SA 3QU0A 2ZM1A 4YGAA 5CXHA 4X3FC 5L6WL 4ZZMA 4I6FA 4CMUA 2E9PA 2C6EA 2UVZA 2VWYA 5JFVA 5FXSA 1VEBA 4ACHA 4FYNA 3NUAA 2Z7LA 3JUHA 3PUPA 2NP8A 4GT4A 3UO6A 4YC6A 4E5WA 5BQ0A 2BAKA 2RFNA 3WZJA 5J7BA 3PY3A 1APME 4XOYA 3DFAA 4JRVA 5LMAA 3FMNA 1YXTA 5CAQA 4DCAA 3FSKA 3QD0A 4ZK5A 4EORA 5GINE 1WCCA 3LXPA 3NUUA 4MXAA 5FQDC 3VBXA 4AA4A 2FSTX 4BDBA 4LUDA 4AN9A 1XQZA 5L8KA 3A99A 3HVCA 3SXSA 3LLTA 4KA3A 1R78A 2BPMA 4DGGA 4KRDA 1JSUA 2IW9A 3ZM9A 3VBTA 2HIWA 2JDTA 3MA3A 3E8DA 3LIJA 3NYNA 4LOOA 4LRJA 5DR2A 3LQ8A 4O0UA 4UYNA 1H01A 3PWYA 3OCSA 3V8SA 3QHRA 3FHIA 3W10A 2W5BA 3OUNB 3KXHA 3QTZA 3W2PA 2OK1A 2C5YA 4QTEA 1Q8YA 2C69A 4IAKA 3ROYA 4WG3A 2BRNA 4HPTE 2YDJA 3DK3A 4F0GA 4D28A 5CSWA 3F5XA 3L9MA 4FIFA 3ZZWA 3OVVA 3NUYA 3DBEA 4XHKB 2Z7QA 2QLQA 4K77A 3QGYA 4UXQA 1L3RE 4W4VA 2OSCA 2GS7A 2WQNA 4QOXA 4ZTRA 5IH5A 3QCQA 3POOA 3R0TA 4E5AX 3OWPA 4EI4A 2UZBA 3KKVA 3UIMA 2QNJA 4DLIA 4GVAA 5KMIA 4IIRA 2F7XE 3FMDA 2CPKE 4LGDA 4TN6A 4FUXA 5FP6A 1ZY4A 2VV9A 4U41A 4A4OA 1VZOA 1ZY5A 4X2JA 3WF7A 3ZC5A 1U54A 2XJ1A 1J91A 1LR4A 3ALOA 5ANDA 5FM3A 4BDHA 4JDIA 3DQXA 2OIBA 3GU8A 4NJ3A 3UNKA 4IEBA 3EL8A 3TM0A 2NRUA 5I9XA 3V04A 1H07A 3Q60A 4FGBA 2FO0A 3ANRA 4LL5A 4D2VA 4XV9A 4EHZA 3SQQA 5IQGA 3HDNA 1FINA 2EXEA 3FC2A 4OTHA 3ZYAA 4AA5A 3G33A 4QTDA 3PIXA 3Q5ZA 4CFUA 2VTJA 4IVAA 3ORMA 4J96A 5HE3A 5CNNA 4RZVA 4CRLA 3LJ0A 3QC9A 2WEVA 5HE0A 5F20A 3H4JA 3Q6UA 5HO7A 4JRNA 1OIUA 2V7AA 3EFWA 5IUIA 3UC4A 2PZIA 1MUOA 2OJIA 5DLSA 4YZBA 2YAKA 4PDSA 1OUYA 4ERWA 4JR7A 4BL1A 4IAAA 1PYXA 4M14A 3V5JA 4RX5A 1H1RA 2CGXA 2XEYA 3VWAA 4BCPA 2I0VA 5D11A 3HV5A 2AC5A 3F61A 4RC3A 4CFFA 1OL2A 1SNUA 3DAKA 5L2QA 4F65A 1S9IA 4TY1A 2ITZA 3QCXA 4AGWA 3JVSA 3B2TA 3W2QA 4JLCA 5M4IA 1UNHA 3NEWA 3PXZA 4JIKA 4PTCA 4PWNA 4PPAA 1UV5A 5DOSA 3ROCA 4W9XA 3RAHA 4QQTA 2QOLA 4CFXA 3ZMMA 1GOLA 2W9ZB 3LCKA 4RIXA 5EYMA 3LFDA 2VN9A 4W9WA 4USEA 2JAMA 4LMUA 4R5SA 4E6QA 4C4JA 5KKRB 4BY9E 4AE6A 2G15A 4QMVA 3FKLA 4CYJA 2ZM3A 5GZ8A 4JR3A 3EQGA 1R0PA 3O0GA 2CKPA 3CBLA 3MI9A 3UZRA 3OUKA 5EDQA 3MIYA 4AW2A 2Y4IB 1VYWA 3PTGA 4EH3A 4EH8A 4N6YA 4EH7A 4UX9A 1OITA 2P3GX 1SVGA 3C7QA 3NAYA 3VS7A 3CC6A 4FGRA 4YZNA 3V8WA 1KSWA 2R2PA 2W1DA 1B38A 3EKNA 3KULB 2ZMDA 5HU3A 4FKTA 5L2WA 2VWUA 3MPAA 4PDPA 4WUNA 5E8UA 4K0YA 3T9TA 2UZDA 5BYYA 3SG9A 1TVOA 1J1BA 2R9SA 3D4QA 3DB8A 4BCMA 4PMMA 3SLSA 4F0FA 4O0SA 3K2LA 3Q3BA 5AIRA 2JBOA 4BCFA 4G2FA 5B2KA 3UOKA 4C4EA 3UQGA 4YUQA 4U43A 3TZ7A 2OO8X 4K2RA 3SRVB 4AG8A 5AAGA 4OTIA 2QR8A 4L43A 4C4HA 1OPJA 3OXZA 4UEUA 5AP3A 3FI4A 5AUZA 4BDAA 5M4FA 4O6LA 5AX9A 3QL8A 1UVRA 4XV2A 4W4XA 4YHTA 4AS0A 4EK5A 5IA3A 3CSVA 3ZFYA 3MN3A 1K3AA 3TCPA 3VS1A 2G01A 3RPSA 1J3HA 3LJ2A 3O2MA 3NYVA 5M44A 4IZAA 4DLJA 1I44A 4BI1A 4M68A 3SC1A 4AWIA 5IQEA 4IE9A 4L01A 5IQDA 4BF2A 3CQEA 3FEGA 5HORA 4FV4A 4J8MA 4NUSA 4YZ9A 4XG9A 4LQMA 3C4EA 5E8YA 5FLFA 3KK9A 2IZTA 3KF4A 3QXPA 5ICPA 5BNJA 5I9VA 5IEYA 3QC4A 3GC8A 4FBXA 3A8WA 2WTKC 4LOPA 3FYKX 4EZ3A 3RWPA 5FTGA 1WZYA 2J0IA 4QQCA 2XK8A 4EQMA 5HVYA 4YTCA 3CGOA 5FTOA 3QF9A 5JRQA 2XVDA 4E3CA 4IHPA 3OEZA 1JVPP 3MVMA 4FK6A 4ASZA 4KS7A 5EKOA 3L9NA 1M7QA 4FNZA 2BHEA 3KRWA 4D2WA 4ZMEA 1OKYA 3FZ1A 3FI3A 4B6LA 2LGCA 1YW2A 3R9OA 5E92A 3F88A 2IW6A 2YA9A 5TO8A 5EM5A 4F08A 5BUJA 2JLDA 4BDFA 1OL6A 1IAHA 4BCNA 5C4LA 4RWIA 2GNGA 4EKLA 4YZDA 1XR1A 3PFQA 4KABA 2VWZA 3HV6A 5CQWA 3EKKA 2R3FA 4RSSA 2RF9A 2XNMA 5EHLA 5LCKA 4CNHA 2O3PA 3R1QA 1B39A 3FUPA 3KCFA 3MB7A 4IWOA 4R3PA 4DG2E 3ZLXA 2VTRA 3O96A 1O6KA 1SVEA 1GNGA 2VUWA 4U9AA 2WOUA 4F99A 5GNKA 1M2RA 2P4IA 3QYWA 4G3FA 4R1VA 4C57A 3AC2A 3I0OA 4CMTA 2XNBA 1P14A 4NCTC 1YWRA 4KIKB 3G2FA 5GHVA 1NA7A 5LXMA 5A6OA 5DFPA 3BGZA 4JI9A 3DTWA 1YRPA 2OG8A 3TNPC 4DFYA 2ERKA 3QZFA 4UWCA 2YITA 4D4VA 1ZRZA 5KNJA 3N4VA 4YBKA 2YIQA 3EN4A 3LAUA 4DBXA 3CE3A 1XH6A 4AAAA 1OVEA 4F9AA 2O63A 2J90A 2HZ4A 2PUPA 5IPJA 4H58A 4O7VA 3ZRKA 1YI6A 5EG3A 3VBYA 4NTSA 5E8XA 2GNFA 3G0FA 5KHXA 2VAGA 3JR1A 2JBPA 3TJCA 3UDBA 3LCDA 4FIIA 2XMYA 4QMOA 3DB6A 4QMSA 3HZTA 3VS5A 2Z2WA 5CZIA 4CSVA 1U5RA 3LFCA 3IGGA 4O7WA 3EN7A 4GG7A 3QRJA 2FUMA 2OJJA 4I94A 3VF8A 3HKOA 4P5ZA 3D7TB 4WSYA 3I81A 4MBLA 4CQEA 4GYIA 2REIA 2PUNA 3PE1A 3LFFA 2XKCA 1PXIA 3F7WA 3A7IA 4IJPA 3R22A 4I93A 1IRKA 2HY81 3PXYA 4WG5A 1H1QA 2X4FA 3CQUA 4C37A 3UVQA 5IA4A 5EDPA 1SYKA 2OH4A 4EH9A 1LP4A 3S4QA 2R4BA 5HQ0A 5JKGA 4TZRA 4R77A 4F7NA 4RIWA 4PP7A 3BPRA 5FXQA 4FSYA 1K9AA 1CKJA 4DTAA 2AC3A 4MXYA 1PXMA 2WMWA 4KD1A 4BDIA 1PXOA 4G17A 5CEKA 4HJOA 4UXLA 4RA4A 3TV4A 2F57A 4A9SA 4IWDA 4X2NA 3POZA 3AQVA 4JT3A 3HNGA 3I5ZA 4ANMA 3DA6A 5BYZA 4ZLOA 4BYJA 4ITHA 4J95A 1ZWSA 3BU3A 3MY5A 3ZRMA 2QOFA 4BGQA 4YR8A 1H4LA 3RMFA 1DS5A 4AN3A 1UKIA 3QRIA 3QALE 4FK3A 3JY9A 2YWVA 4FV8A 3C4WA 5I3OA 1YDTE 4CKRA 3O7LD 1KWPA 2JD5A 5BVDA 1ZMUA 4L3LA 5BPYA 3OWJA 3H30A 4AF3A 3FZSA 3COMA 5ETFA 2Z7SA 4FYOA 4O7LA 4IB3A 3V3VA 4USFA 5AR4A 4Q9ZA 4TWOA 1SNXA 3KRLA 3ITZA 4R5YA 3EB0A 5E91A 1JKSA 2P2HA 4QYHA 4KKEA 1Y8YA 3BGPA 5B7VA 5IDPA 2VTLA 2YIWA 3I79A 3Q96A 3C0HA 4IX3A 5BVWA 1PMNA 1VYZA 3E92A 3GCSA 5CAOA 3R28A 4NU1A 3DBDA 2YIYA 5FG8A 4DEEA 3LFBA 3Q32A 4DHFA 3ZUUA 5K4IA 2R3RA 3HA8A 3LMGA 4NW6A 2JDOA 3G15A 4GL9A 4RLKA 3CTHA 2R3NA 3I60A 3JPVA 4CKIA 5CSHA 3Q9ZA 4MHAA 4MKCA 3QCSA 4O0RA 2VTTA 4C0TA 1O6YA 3R30A 4AP7A 5LMBA 3U87A 4PV0A 3PXRA 4USDA 1YOMA 3G9NA 4GH2A 3COHA 3R02A 2OZOA 5CVHA 4DFBA 4H3PA 1DAWA 5EM6A 4V0GB 4N57A 5I9WA 1Q99A 4CMOA 2Y0AA 4TNBA 2HK5A 3MVJA 5J1WA 2IVTA 1OMWA 3U8WA 2ZMCA 2OXYA 3TG1A 2BVAA 4WNKA 3TKIA 4BHZA 2I6LA 2BZIB 3KGAA 2J4ZA 3RCDA 3KXMA 4JDKA 3LXNA 5EM7A 2BAQA 2PY3A 2E9OA 1PXNA 4EZ7A 4WT6A 4M0YA 4FG9A 5C26A 3RZBA 5ACBC 2P0CA 4OR5A 4TWCA 5M53A 2PMIA 4NIFA 3C0IA 3EQIA 4X3JA 3WIKA 4EH6A 3E62A 4O27B 4ZJIA 1KE8A 3S0OA 5HLWA 2WAJA 1A48A 3D5VA 3EQDA 3GFEA 1J7IA 2W5HA 4YPSA 3R7EA 1NVSA 3I7CA 3MW1A 1P5EA 5EHYA 4DAWA 1KV2A 1YOLA 2W1CA 2FSOX 5M08A 4HZSA 4JL9A 5L4QA 3PA4A 4IZYA 4TWPA 5LWMA 1ZMWA 2FGIA 4UMUA 2JFLA 4QP9A 2YCRA 1GZ8A 2R3JA 4QQJA 5KZ0A 3ZLYA 3PDTA 3BYMA 3FLSA 3FLYA 3N9XA 2B9IA 4G6NA 1PRYA 1LPUA 4BCOA 4I5MA 4O2ZA 2EB2A 5AP2A 2XK6A 2OI4X 3BYVA 3EFJA 5HE1A 3AC8A 3RNIA 3GCQA 4K11A 4DT8A 2QOBA 2F4JA 5IUHA 5AUWA 5HCZA 3H10A 4LUEA 1UA2A 5CEMA 4C62A 2IVVA 5KKRC 4M12A 3C4CA 3QXOA 4CEGA 1QPJA 3QZIA 1XWSA 5AUVA 4D4RA 2CNVA 4R1YA 4O0WA 2WMVA 3VJNA 4OT5A 4AU8A 2WHBA 4C38A 4FODA 2QCSA 4OBOA 4X6RA 2QG5A 4QD6A 2IVSA 2PVFA 4CLJA 4HVSA 4O1OA 3PPKA 4C7TA 2XH5A 5FM2A 4JIAA 4AOJA 1UWHA 3PJCA 2XA4A 3FSFA 4PPCA 3SAYA 4BBEA 2WU7A 3WIGA 2HYYA 3HLLA 4MEDA 3QTRA 3CR0A 3RALA 4I3ZA 1BX6A 3OWKA 4RJ8A 5EK7A 5IQCA 5EQEA 1YVJA 3U54A 4FSRA 2QHMA 4OAVB 2X7GA 5FUTA 5TF9A 2JDSA 3ZC6A 3FI2A 4RC4A 4EONA 2X81A 5AA9A 2IZSA 1T45A 3JY0A 3GU5A 3QTXA 4NT4A 2X2LA 4LRKA 3RGFA 5E90A 4C35A 4B8MA 5CAPA 5I0BA 1H00A 3NUNA 3PA3A 3C9WA 2JIUA 2PVJA 2XK7A 3EH9A 3G90X 2R64A 3RK7A 3Q53A 4R6VA 2RL5A 5D9HA 2BRHA 4AZSA 2ONLA 4KNBA 1G8AA 3MIAA 4NSTA 3LM0A 3QTIA 4LGHA 2GPHA 2W4KA 3MWUA 5JT2A 1NT2A 4UN0C 4FOBA 4L00A 5B2MA 4ORKA 3WYYA 5AUUA 3D7ZA 5CS6A 4RQKA 4FMQA 3KY2A 4YTIA 3L9PA 1NXKA 3VO3A 4L3JA 2YJSA 2B52A 2VX0A 4YHFA 4FKVA 4FTQA 2WMUA 4XRLA 4FTUA 1HCLA 1QPCA 3PYYA 2OKRA 4Q5EA 3CY3A 2X8EA 5AR3A 4CCUA 4V04A 2EB3A 2JDVA 4GMYA 3GCPA 3QQLA 4S31A 4F1MA 1MRVA 4ENXA 3LMHA 2VX1A 3OW3A 4J1RA 3R83A 5I9YA 3F5PA 5KE0A 1L8TA 3DAEA 5AM7A 4FV2A 1VJYA 2XZSA 2GTNA 4AFJA 2H6DA 5J7HA 1Q97A 3PVUA 3LFEA 5CY3A 3ZLSA 3FLQA 3IQ7A 3VRYA 3HMNA 3A8XA 1V0OA 4E6CA 4QTCA 4MQ2A 4IB1A 4OAUC 1WBNA 2QONA 2UZNA 3R8ZA 4F0IA 2W4JA 2QHNA 4FVRA 3MPTA 3BBWA 1JNKA 1XBCA 2XNEA 3RPOA 1U54B 3W8LA 2CKEA 4E20A 3PSBA 4FI1A 3PZEA 4EBVA 3GU6A 2QD9A 5D41A 2R3QA 4OBPA 5A14A 3F5GA 3ZRLA 1CTPE 2P2IA 5D10A 4AW1A 5IH4A 1ZYCA 3THBA 3OBGA 4XV1A 2XKDA 4O22A 5F4NA 1P2AA 3A2CA 3TIZA 4QTAA 2XNNA 1FQ1B 3QLFA 5CEQA 3ACKA 4A9RA 3AG9A 4FTRA 4CVAA 3QKLA 3P78A 2YCSA 4Q5HA 1YWVA 4XEYA 2BKZA 2OZAA 4FUYA 3I4BA 5FP5A 3UG1A 3ZU7A 4BDDA 1ZZLA 5C03A 2CJMA 4E93A 3LLAA 3F2AA 2UW7A 3BLRA 5CU2A 3V5PA 2C6MA 3DLZA 4ZSJA 4O7ZA 1RDQE 2YLFA 3LOKA 4EC8A 4UMPA 3TI1A 2WB8A 4XJ0A 3EQBA 3CLYA 3ORNA 4M3QA 1QPEA 3HRBA 2PE0A 1U4DA 3R73A 3DXNA 3GC0A 5AEPA 2YJRA 5F1ZA 4EEVA 2BZKB 4ZP5A 4IAFA 2W0JA 2Y6MA 4WKQA 3R8LA 4QP2A 2G1TA 5GZAA 5HG8A 4XLVA 3R7IA 4FSNA 4FOCA 2XIYA 4FKQA 4MNFA 3NCGA 4F70A 3SHEA 3P1AA 1UU7A 5HG7A 5C4KA 4YC3A 4C02A 3PXQA 2WNTA 3W33A 2C5OA 4IFGA 5AAFA 1STCE 4GUEA 4V01A 4O0VA 2Q0BA 1PXKA 4A9UA 4MXXA 3R9HA 1WBSA 4DH5A 4NKAA 3FQSA 4PNKA 2YAAA 5GJDA 4ZAUA 4FV3A 3IW4A 3S2PA 2BRMA 2XYUA 5JH6A 3L8PA 2F9GA 3IGOA 4AGDA 3FZPA 5IQIA 2OH0E 4FZFB 3WARA 5KUPA 4AZFA 3KC3A 4NWMA 3OC1A 4RMZA 1YI4A 4WSQA 4BN1A 3NMUF 1YXSA 4PL5A 4BGHA 1ZYLA 4XG8A 2R3LA 2W5AA 3BHYA 3FLWA 4G6OA 2HWPA 3Q9WA 3NW6A 3F6XA 2CN5A 1DAYA 2ITXA 2UW3A 3DJ7A 1FMKA 3NNVA 3OY3A 4F9CA 1SM2A 3DDQA 4H1JA 4JG7A 2ZAZA 2DUVA 4MNEA 4S30A 5HI2A 3HP5A 3TIYA 4ASEA 4G6LA 5M09A 2V62A 4GIIA 2AYPA 4UV0A 5KMMA 5KO1A 4C3PA 4GT3A 3DTCA 4FEWA 5IEVA 3KXXA 3MGYA 3RINA 5L8LA 4HVGA 4ACDA 2UZOA 3QUEA 4BDEA 2UW9A 2C4GA 4QMTA 1RQQA 4IX4A 3FDNA 3ODZX 4EK3A 1IAJA 4CD0A 2BTRA 2W99B 3CJFA 4HYHA 4KKGA 5KMKA 3BQCA 3TZ9A 5IA0A 4I1ZA 1NVRA 2JKMA 2PVHA 4FL3A 2XIZA 3QRTA 4O21A 4WOVA 2NNWB 3O71A 3QD3A 1R39A 3ET7A 5CEOA 3CD3A 4IFCA 5LMKC 1UU9A 1G5SA 3OP5A 3KFAA 1H0WA 5FBOA 3KU2A 3OMVA 4UBAA 4L8MA 3OW4A 2XK4A 3HRCA 3O7LB 4ITIA 1OECA 3AC4A 3PPZA 5CF8A 5AV1A 2NPQA 3NIZA 4B7TA 5H8GA 5KMJA 2XYNA 1URCA 4C61A 4EBWA 3R6XA 1ZARA 3P0MA 4KAOA 4GFMA 4QMPA 2CLXA 2GQGA 2CMWA 1GIJA 3OOMA 1GIIA 3G0EA 2PYWA 2XEZA 4O0YA 5HOAA 3C1XA 4P5QA 5F94A 3W16A 5BX0A 2PE2A 4CXAA 4JOAA 2PK9A 4QYEA 3A7GA 5HTCA 2X4ZA 4XOZA 4DC2A 1AGWA 1W0XC 5A3XA 3BQRA 4JXFA 4RIYB 2QR7A 2R7BA 2XNPA 2PHKA 5HE2A 3PP1A 1KOBA 3TL8A 4TYJA 4ZJJA 3E5AA 4RPVA 3KRJA 4AOTA 5JFSA 2PPQA 2QG7A 3DBQA 5K5NA 1T46A 3BU5A 2ZYBA 2GNLA 2Z8CA 3VUKA 4KB8A 4YTFA 5JFWA 4IJ9A 3W32A 5JK3A 1XJDA 4E4LA 3UMWA 4FKIA 5HHWA 3UQFA 5AV3A 4XP2A 5D7AA 2QU6A 1OIRA 3LFNA 4K9YA 4EJ7A 4CV8A 4O7RA 4JBVA 3WYXA 3CPCA 3FC1X 2EU9A 4CFMA 3FJQE 5DMZA 5IQHA 2ITWA 5M55A 4J98A 1MP8A 4UY9A 5DEWA 3R1NA 4XUFA 4D58A 4BKYA 1J7UA 3P5KA 2WIHA 3LW0A 4QP8A 3UC3A 4Z9LA 3MESA 4QTBA 3T3UA 3IKAA 4R8QA 4K18A 4R7HA 5DI1A 2WZJA 3RZFA 4YJUA 3EZVA 3T8OA 5A6NA 3DJ6A 1Y8GA 5ANKA 4RFMA 3LHJA 3QTUA 3TNHA 3NCZA 4YLJA 1KE6A 3C13A 5DT0A 3ETAA 4IWPA 1W82A 4L46A 5EYDA 3MVHA 1YI3A 4XMOA 3TEIA 5LQFA 4CKJA 3PP0A 4TRLA 3SV0A 2RIOA 2VGOA 4X0MA 4MQ1A 3DOGA 2OXXA 3FAAA 4ZSGA 3W1FA 2QLUA 4APCA 1KOAA 4RT7A 5CTPA 3Q4ZA 5EFQA 4AUAA 3SG8A 4N0SA 2PU8A 5I4NA 3RPRA 1M17A 1YDSE 4JX7A 2GQSA 2WTCA 4FG7A 4YJQA 2XM9A 2V0DA 4WHZA 2R3MA 1OL5A 2WMTA 4O84A 3SX9A 3COKA 1JBPE 4DT9A 4M8TA 5E8WA 2WMXA 2OLCA 4PDYA 5L6PA 4NCTA 2QVSE 2WMQA 4UYAA 4F09A 1DM2A 3PXKA 2XNGA 2E9NA 1PXPA 5ETIA 4GRBA 4BYIA 5CAUA 3P23A 4ZSLA 1GZNA 3BV3A 3E8CA 3U4UA 5A4TA 5CENA 3BHVA 3AMBA 2WOTA 3R1SA 4RJ4A 3SW4A 3NDMA 5GZ9A 3W2SA 3AOXA 2BCJA 3OCGA 3DQWA 4AN2A 1PMVA 3QQHA 4FKJA 1Y6BA 1PJKA 1LUFA 3FMMA 3FLZA 4GFOA 4MX9A 2GQRA 3ORTA 4QMLA 1BL6A 1YHWA 3KXNA 5DRBA 3VW8A 4RFZA 4JQEA 4L9IA 4RVTA 2SRCA 3A7JA 4KBAA 3FYJX 3GENA 3VHEA 3NRMA 3GBZA 4EH2A 3QKKA 2BFXA 4ZY6A 2GHMA 5TT7A 2UUEA 3WE8A 4E8AA 5IH6A 5E9EA 5FBNC 4FSZA 2ETRA 3UO4A 4K6ZA 1H26A 2O5KA 1MQ4A 1YQJA 4W4WA 4Y73A 4BCGA 3Q6WA 5A9UA 4ZTSA 4GKHA 4W8EA 2CGWA 5DR6A 2HCKA 2HZIA 5FXRA 5F9EA 4KIQA 3R8PA 4WBOA 3ZTXA 4HGSA 4QNYA 4BICA 4FR4A 4B99A 2BKKA 3WZUA 4U97A 4AOIA 4JAJA 3B8QA 4JNWA 2HOGA 1BMKA 5DN3A 5M07A 3G9LX 4LOQA 2Y4PA 4TYIA 3OF0A 3KF7A 4OTPA 4Q9SA 4F64A 3DNEA 1WBPA 3RK5A 1OZ1A 3P7AA 2BAJA 3IG7A 2WIPA 4RVMA 3RPYA 2F7EE 2XCHA 4M66A 2W17A 4G3EA 3EJ1A 2X0GA 2XBAA 2HAKA 3IONA 3NNWA 3ALNA 3PVBA 1OKVA 2X39A 3H9RA 2UW4A 4DYMA 2ITOA 3HV3A 2G2FA 2XKFA 3RHXA 3IPHA 4KSQA 4XG7A 5AP6A 2CCHA 2YABA 5EH0A 3GI3A 3GU7A 3VUIA 5J1VA 3FZRA 4LI5A 3CPBA 4U6RA 1F3MC 2B9JA 3HUBA 4FTIA 2ZDTA 1H1SA 1Y91A 1ZYDA 3PSCA 2UW0A 4MWIA 4F1OA 2XP2A 3P08A 2GNJA 4FT5A 4D5KA 3LZBA 3DGKA 4BCIA 3EFLA 4EOSA 2HWOA 4FSUA 2Y8OA 1XH8A 5GIPE 3PPJA 5AADA 3ZFMA 4BB4A 4MBJA 4O86A 3LFQA 2XRUA 3PIZA 3NAXA 3UODA 4RJ7A 3UVRA 2C68A 4FVQA 1Q61A 4N4SA 3DNDA 4F6WA 3TWJA 5HBJA 3QA0A 3R9RA 2X9FA 2E9UA 3W18A 3MY0A 2FSMX 1F0QA 3DK6A 3Q5IA 4I0SA 3QQFA 5E1EA 4FNXA 1IR3A 4RA5A 3V6RA 2PZRA 4JG8A 3ZEPA 4D4SA 4U44A 3JVRA 3QUPA 5D7VA 5KMOA 3OWLA 5EQPA 3B8RA 3FMEA 5HKMA 4D0XA 2CCIA 4FTOA 4EOKA 4KIOA 3HV7A 2YM4A 3PVWA 4I6QA 4Y46A 4ONAA 4DINA 3BI6A 5HIEA 4LG4A 5ANEA 4DH3A 2I1MA 2IN6A 3VS6A 2WMRA 4CFVA 4RJ5A 3PLSA 2XS0A 4YC8A 1OM1A 5H3QA 5FDPA 3FXXA 4U79A 4EOQA 4YJSA 5I5ZA 3DKGA 4IC7A 3MFRA 1XH5A 4O7SA 3FMHA 2FSLX 2V7OA 2QURA 5CVFA 2X6EA 3BU6A 4HGEA 4W8DA 2C6DA 4PMTA 1JAMA 4U3YA 4Y5QA 4RFYA 5T6KA 3FMKA 3QKMA 5IG1A 1OGUA 1DI8A 3DZQA 4O38A 4ZY5A 5J9ZA 3RP9A 4BIDA 4EK4A 2PZ5A 3IECA 3WF9A 5E8VA 1PW2A 3FV8A 1PKDA 4WRGA 4BKJA 3TTJA 1JLUE 4ZTQA 1JOWB 4FKWA 4D2SA 4R78A 2CNQA 4PPBA 5AR8A 4YJPA 4E6DA 4YLKA 4E4XA 1FGKA 5E8TA 3HMPA 2B9HA 3LVPA 1HCKA 3DPKA 3R63A 4UWYA 5DRDA 2YHVA 3K3IA 4YJRA 4C4IA 4EWHA 5EKNA 5AUXA 4E73A 4GG5A 3UNJA 4MD7E 2PVRA 4ANBA 4EHGA 1OIQA 3PRIA 1U5QA 4IX6A 2ETMA 4MTAA 5L8JA 2JDRA 2R5TA 4CG8A 4TYHB 3CTJA 1ERKA 3S95A 4IAYA 3PJ1A 2GMXA 3EIDA 5ANOA 1H25A 5HCXA 3DV3A 4DE4A 2OJ9A 4RLLA 3DBCA 4U81A 5G1XA 3CQWA 2YM5A 2C0TA 4UB7A 2I0YA 5CF5A 3ENMA 4ZTLA 3WOWA 4A06A 1LEWA 4ZEGA 3TNIA 4WNPA 4B0GA 1EH4A 3EHAA 4KKHA 5JFXA 3LCTA 3VULA 2ZV9A 2WMAA 1REKA 4BBMA 4I23A 5AP4A 3SA0A 4IB0A 5LWNA 1ZOGA 3HUCA 2YCFA 4M69B 3EFKA 5DHJA 4IM3A 3O50A 3GOPA 4UZHA 3NIEA 5CT7A 3K3JA 4IAIA 4MXZA 3TNQB 5K0XA 3ZH8A 3PSDA 2C5NA 4KINA 3PY0A 3ATSA 4MXOA 4MD8E 3RPVA 4DFXE 3F2RA 2HZ0A 3C4FA 4I6BA 2RSVA 2EVAA 1JPAA 4JBPA 3VS2A 2GS2A 2X7FA 5I9ZA 1XH4A 2NO3A 1WAKA 4FVPA 4GVJA 4A07A 4C4GA 2RKUA 4DGOA 4DGNA 2BROA 1Q3DA 2J2IB 3NW5A 3CXWA 3F3ZA 3NW7A 4KIPA 2DYLA 1URWA 4LMNA 4DFNA 5LVNA 3KULA 3PA5A 3LQ5A 1TQIA 4XH6A 4R3RA 5HEZA 4NH1A 3WE4A 4NM7A 3R1YA 4IM2A 1M52A 2B53A 2OF4A 5HESA 4B4LA 1KUTA 2UVXA 2YDIA 3D15A 4CQGA 4EOIA 4GFGA 3MS9A 3TDVA 5HCYA 3SRVA 3V5WA 4FL1A 2YDKA 5HBEA 4YHJA 4NM5A 3RJCA 2O64A 4IQ6A 4FV5A 4N70A 3IK3A 4ENYA 4QRCA 3DT1A 5CI6A 3FPQA 3IOKA 4XP3A 3LCSA 2E9VA 4RJ6A 4I21A 4EOOA 2R0UA 3LQ3A 5TOZA 2PVLA 2WTDA 5KBQA 3DLSA 4K8AA 3ZFXA 3CP9A 2GTMA 4PTGA 2W96B 3TUDA 5FTQA 5AP7A 1RE8A 4CZTA 3F3VA 2A4LA 5A54A 5CU0A 2C3LA 1UKHA 1Y57A 4C3FA 4QMYA 3RCJA 1CSNA 4YZMA 3ORIA 2VD5A 3BEGA 1PMUA 4EOMA 5EM8A 4IZ5A 3ELJA 1CKIA 5BVKA 2PMLX 3QWJA 5IMXA 3C4ZA 5JGBA 4PMSA 5CQUA 1FOTA 3GNIB 2XCKA 1R1WA 1W84A 3SXFA 4AZTA 2B4SB 4L3PA 1FVVA 2WTJA 3IO7A 4ZIMA 1OBDA 1Q8UA 3GC9A 4X2FA 4OLIA 3EQRA 4O1PA 4ANOA 4BFMA 2QO2A 3GT8A 3O8UA 5HTBA 5K5XA 5E4HA 4F9BA 3EQHA 2W1GA 3G6GA 4OTRA 2ZB0A 3BE2A 4U80A 1GZKA 2OJGA 4F7JA 4L68A 2BZJA 2FA2A 3ZZEA 3ZXZA 5KX8A 2IJMA 5BUIA 1V0BA 4P7EA 4ANQA 3BYSA 5L2SA 4DH1A 4I22A 4EOJA 2X8IA 5HLNA 3ANQA 2VRXA 5CWZA 3FLNC 4HNFA 3WILA 1KE5A 3DU8A 4F63A 4D2TA 3P79A 2NRYA 3F69A 3LJ1A 3NZ0A 1ZYJA 3P4KA 4WO5A 3R2YA 4ANLA 1H1PA 3KXZA 4NW5A 3MH0A 2DS1A 4IVDA 1H28A 3BHHA 2ZV8A 4GK4A 4QMXA 3FHRA 2XKEA 4IACA 5ETCA 3K5VA 3NWWA 4D1ZA 4O0TA 3NVKI 2KULA 2JIIA 5IQAA 4I5PA 3VVHA 3S3IA 3QD2B 4CFNA 3MSSA 2Z60A 5CSXA 3VS3A 3LFAA 4NK9A 4Z16A 4L44A 3D0EA 4WNMA 3O8PA 4L52A 3SVVA 4WD5A 3P7CA 4O81A 5ANGA 4ALUA 2VTMA 2YZLA 5C8KA 2WQBA 4RVLA 3FL5A 3VBWA 4TTHB 2IO6A 4JG6A 4W4YA 2ZV2A 4AW5A 5KMNA 3RHKA 4ZLZA 5IA5A 3C50A 3AMYA 4X7QA 3LMIA 2YM8A 2ZVAA 4FT7A 4ACGA 3WZKA 4ALVA 4QNAA 4ARKA 5CEIA 4H05A 3UE4A 1WBTA 5HNIX 1OB3A 5CU3A 2FH9A 1ZAOA 1GZOA 3QGWA 3KXGA 5DPVA 4ZLYA 3VW6A 3FY0A 5AUTA 1VR2A 2VO7A 4JX3A 5CU6A 5HVJA 4F7LA 3ZOSA 4OTGA 2CGVA 2IVUA 2X9EA 5DH3A 5DEYA 5IQFA 1UU3A 3BCEA 3R7VA 3H3CA 3I6UA 5DIAA 3AC1A 2VWIA 3DJ5A 3L8VA 4JVGA 2R0IA 3EOCA 2R3OA 4BI0A 5DT4A 3A61A 5AA8A 1SZMA 2C6IA 4X3FA 4JAIA 4EC9A 2HXQA 5LVPA 5LCJA 3NNUA 1BYGA 5I3RA 5HX8A 2JKQA 1NW1A 2JKKA 3Q9XA 5A4EA 1A06A 3ZO3A 4QPMA 3BBTB 4I6HA 4F1TA 2V5QA 3FPMA 2W1ZA 3QQJA 3KRXA 4EOPA 5CEPA 3MDYA 4GYGA 5EQYA 3TT0A 5DBXA 1Q24A 3L1SA 5BVFA 3ENHA 4KUJA 2ZOQA 2BRGA 3EN5A 1CKPA 3CCNA 1FVRA 4FKGA 5T3QA 1BL7A 3F3TA 1KV1A 4MD9E 4AA0A 3BV2A 4CZYB 5JZNA 2YM3A 3AXWA 4ACCA 3B2WA 1YDRE 4ERKA 4ZSAA 5IU2A 3OEFX 3BGQA 3EN9A 4ZY4A 5L3AA 3MB6A 4R7BA 4O83A 1PXJA 4GW8A 4QMUA 5C27A 3S00A 1H0VA 2BILB 3LE6A 1BUHA 3PWDA 5KHWA 4UWBA 4YLLA 3OCTA 3QHWA 2OXDA 3UOLA 3ZUTA 3QUDA 4G16A 4AE9A 1KE9A 3BWJA 4BWXA 3EQPA 3JYAA 3E8EA 1BI8A 4I5CA 4EKKA 5GIOE 2J0LA 4FIHA 5LMKA 3NR9A 1IA8A 3QQUA 4U7ZA 3ODYX 4AX8A 4ZJVA 4BRXA 3U6JA 1XBBA 3IS5A 3REPA 3TACA 3HECA 1JWHA 2AUHA 3R8MA 3DKOA 3GB2A 3I7BA 4J71A 3E63A 4TL0A 3G6HA 4Y8DA 1OPKA 3ZM4A 2C0OA 3UOHA 3HAVA 2W06A 2VNWA 3R01A 3UZPA 4ID7A 3OBJA 3C51A 5BYLA 4C8BA 3AT4A 4YO6A 4BWKA 5AR5A 2C1AA 3KMUA 2FB8A 3GXLA 4Y95A 4ANNA 2B9FA 4X2KA 3I1AA 4XYFA 3QD4A 5CANA 3H0ZA 3WF5A 4AT4A 1ZZ2A 4GKIA 1PY5A 5HNGA 2WTVA 4UMQA 4P90A 3IW5A 2QKRA 5HLPA 4K33A 3SDJA 4I20A 1TKIA 2YZAA 4JBOA 4ZOGA 2C6KA 4CTCA 4V0GA 2W1HA 3F66A 2YIRA 3KVWA 2CHLA 2QI8A 1AQ1A 2QO7A 4PL4A 4U45A 3VN9A 2BZHB 4DF3A 3BX5A 2G2HA 4DA5A 1WBWA 2O2UA 5EYCA 4RBLA 3ORLA 3HL7A 2UW5A 4L67A 3V6SA 4CTBA 2ZV7A 3ZSIA 2EXCX 3RM6A 4I5HA 4WNOA 1M2PA 1OL7A 4O0XA 4DEIA 3ORKA 5ETAA 4HVIA 3IDBA 4JJRA 2WFYA 4UZDA 5HD4A 2GFCA 2W9FB 3VUDA 3G51A 1Z9XA 4QP1A 2RG5A 2VZ6A 1WMKA 3MH3A 4PP9A 1KE7A 5GJGA 2VNYA 2GS6A 3AC3A 4LRMA 5EOBA 5AX3A 5HTIA 3PVGA 3ZSHA 5DE2A 2VTPA 4AZWA 3P86A 4RIXB 3JXWA 3TKHA 4AGCA 1ZOHA 2R3IA 1GJOA 3BYOA 4BBFA 4DFLA 3O51A 3H9FA 2HZNA 4IVCA 3R8VA 4FT9A 4JQ8A 3FE3A 4BZOA 2OIQA 5CNOA 4MH7A 4CG9A 2JAVA 5JN2A 3O23A 5EI2A 2F49A 2PVNA 3UG2A 3ZSGA 5HIBA 3CS9A 4DITA 5BMMA 3UJGA 1PXLA 4DTBA 2HY0A 3COIA 4S33A 2ITNA 3DY7A 4EYJA 5C1QB 3CY2A 3GGFA 3CJGA 2W1EA 4PQNA 4Q2AA 4Y85A 3EQCA 4E4NA 5DG5A 4BIEA 2GHGA 3FBVA 4Z7GA 3TDWA 3KREA 2QOIA 5FDXA 3H0YA 2ITUA 4RX7A 4IVBA 3FL4A 4FTCA 3MY1A 4EJNA 3NSZA 4F4PA 3U51A 4S32A 2ONLC 4C34A 1MQBA 5IQBA 2CGUA 3QWKA 4GJ3A 2XUUA 4BTFA 3W8QA 3W2RA 1WVYA 4WIHA 4LFIA 3WI6A 3TUCA 5IA2A 2VU3A 5AM6A 1MRUA 1FPUA 3A4PA 2F7ZE 2W1IA 1S9JA 1XH9A 3K54A 3R00A 3VRZA 3VQHA 5K4JA 4BR3A 3L8SA 5AP5A 4IH8A 2QU5A 5CF4A 4X6QC 4KWPA 4MAOA 4J8NA 3ZDIA 2A0CX 4FV0A 3OXIA 2IZUA 4TNDA 3OY1A 3QX4A 3UTOA 3OG7A 4FV1A 4A9YA 5IMEA 5IDNA 5CI7A 4KRCA 5CT0A 3DXPA 4HCVA
chains in the Genus database with same CATH superfamily
4Z7HA 3V8TA 4D0WA 4JDJA 4CCBA 3E93A 2ZM4A 1W83A 4H3QA 4XLIA 4XP0A 3MFSA 3SGCA 3NS9A 4AZVA 4CZUA 5IISA 3PG1A 4FEQA 3DS6A 4IX5A 4V05A 1ZLTA 5BMSA 5JGAA 2XBJA 3GCVA 4XV3A 3NLBA 5AV0A 2ERZE 2WKMA 2R3PA 3E8NA 3PZHA 4U0IA 3QA8A 4E7WA 2C3IB 4DCEA 5CXZA 5M4UA 2PSQA 3D14A 3HX4A 3VUHA 3LPBA 2H96A 4FZDB 5CZHA 3ZONA 3GCUA 2X0OA 3GQLA 4PL3A 5BUEA 1Q4LA 1LEZA 4XCUA 4D5HA 4QYYA 2X1NA 4GSBA 3HMIA 3ORXA 4FSWA 4QMMA 4FKSA 5BVEA 5KBRA 3ULIA 2ITQA 3VBVA 4H36A 5HICA 2Y9QA 4EK8A 1IA9A 2BDWA 2OW3A 3EYHA 2O0UA 3QRKA 5EHOA 4UMTA 5L2TA 4YMJA 2GNIA 3OROA 4FG8A 1REJA 1TQPA 2EUFB 3EWHA 1QMZA 3NUSA 1V0PA 3BE9A 3WZEA 2GU8A 3MVLA 5LJJA 3M2WA 3F3WA 5D1JA 5EW8A 4BHNA 5ANIA 4QP7A 3E7OA 3QRUA 3ZO4A 4LM5A 3BLHA 3Q4CA 4GV1A 5DYJA 4FX3A 3U55A 2GHLA 4DHZA 3HRFA 5CX9A 5CSVA 2Z7RA 3RTPA 1Q41A 3U9NA 2R3HA 3FI8A 4KBCA 4GK3A 3BHTA 1G8SA 3BKBA 1A9UA 4QO9A 5HNBA 1I09A 4HGTA 4YJNA 3VS4A 4JBQA 3FXWA 4D9TA 2P33A 3UQCA 3I6WA 5JZJA 2H9VA 1AD5A 3GQIA 3N51A 4XG2A 5F95A 1YHVA 3DBFA 4ASXA 2XM8A 4R3CA 1XKKA 2C6OA 4C58A 3KB7A 3DAJA 4OTQA 3BLQA 4FTAA 3OOGA 3F82A 4L53A 2PULA 2J5FA 3A7FA 1OIYA 1PYEA 4XBUA 3IDCA 4IMYA 3T9IA 5J87A 3DFCB 3FKNA 3E7VA 4I4FA 3OHTA 3FMLA 4QMZA 4DN5A 4LL0A 3V5LA 4RG0A 4F9WA 2BIYA 2ZJWA 4MVFA 3SOAA 3LFSA 5HO6A 2OGVA 4PNIA 5HIDA 3CTQA 4BTJA 3MFTA 5M57A 3ORZA 2IG7A 3EZRA 2W05A 4XBRA 3F5UA 4X21A 4HCTA 4FEUA 3JS2A 2WTIA 5CF6A 2X2MA 1ZOEA 4HOKA 3GOKA 3BZ3A 3Q2MA 3QX2A 3CKWA 2B0QA 4FEXA 2B7AA 4AXAA 4TXCA 1WFCA 1J7LA 1O9UA 2YERA 5B0XA 3RK9A 3VNTA 3AKLA 4MK0A 4ALWA 2PTKA 4QPSA 2PVKA 4ASDA 3Q4TA 2BDJA 4UALA 2V22A 5JQ5A 4EOLA 5IEXA 4CT1A 3OZ6A 4XG4A 3D5UA 2VWWA 2PL0A 3R2BA 4IDVA 4TYEA 4OT6A 4FTLA 4HGLA 1OKWA 3RKBA 4RIWB 5FEEA 2XIKA 2J9MA 3HA6A 3HDMA 2VO3A 4FIGA 1RW8A 1CMKE 4QYFA 4D9UA 3OXTA 5L6OA 2RFSA 4AQCA 2CNUA 1E1VA 1PF8A 2J5EA 2PMNX 5AJQA 4IXPA 1WVWA 3TNWA 4O7YA 5AR2A 3II5A 3A62A 4FTNA 3SKCA 3PG3A 3AD4A 2ACXA 1GAGA 3VC4A 3H9OA 4L42A 2Y6OA 2AEGA 2C30A 2J50A 3C4XA 4GK2A 2EXMA 4OW8A 5G6VA 3T3VA 3MJ1A 4EHVA 5KCVA 4MCVA 1G3NA 1YOJA 2WPAA 4TKSA 2XJ0A 3SXRA 2A27A 3PIYA 2WU6A 4GEOA 4H1MA 4ITJA 2RGPA 4IW0A 1M2QA 5A4QA 4BZNA 4FICA 4EUUA 1U46A 1E1XA 4AT5A 4BTMA 2JKOA 1RJBA 2XNOA 4GUBA 4OGRA 3PJ2A 5LVLA 2QC6A 4KSPA 1NY3A 4YNEA 4ANSA 5AFVA 3UPXA 3NYXA 4CFWA 5J5TA 2IPXA 3QCYA 3N4TA 4ZS4A 3WF6A 4QP4A 3QFVA 2IZRA 4H3BA 4FV7A 4ACMA 4O4CA 2LAVA 1OUKA 2B55A 3P7BA 5KZIA 4G31A 3W0OA 1H27A 3ZUVA 3RAIA 5EDRA 3ZBFA 3OT8A 5DNRA 4J53A 3FQEA 3MH1A 3BHUA 3M1SA 4IAZA 2RFEA 2XK3A 4I0TA 3ZCLA 4QP6A 5EW3A 3GU4A 3PJ3A 4KS8A 4TWNA 4U40A 4BKZA 4PDOA 4BCJA 5J8IA 5A46A 5AAEA 5AV2A 3F7ZA 4A7CA 4C2WA 3D9VA 3U6HA 4YSJA 5M56A 3RNYA 2UV2A 2VO6A 3QZHA 4RGJA 4MF0A 3LM5A 2J6MA 3KA0A 4TYGA 3SD0A 3P9JA 4QT1A 2OFVA 1P4OA 2WGJA 4J7BA 5HGIA 2IEWA 2C6LA 2VTQA 3AT2A 2OBJA 4FF8A 3D2KA 4FV6A 1PHKA 2FVDA 2QOKA 4J97A 5DGZA 1Q62A 4O96A 2BMCA 2QOOA 4BIBA 4Y72A 4C2VA 5ITAA 4YBJA 3G5DA 3HP2A 5ACKA 4RJ3A 5H2UA 1R3CA 2OWBA 2WMSA 4D4YA 4JDHA 4MF1A 1HOWA 2WO6A 5JRSA 4D1XA 1WBOA 5J95A 1JSTA 3W2OA 4IDTA 1ATPE 1WBVA 3E3BX 3PXFA 3Q04A 4RC2A 3QYZA 5ANJA 3VF9A 3D83A 4FSTA 1JKTA 4LV5A 5HG9A 4HW7A 3BL7A 4AT3A 4FIEA 3ZDUA 2XIRA 3D5WA 3IW6A 4I41A 4XRJA 4LV7A 4A9TA 1GY3A 4L45A 4NFMA 4NIFB 3RAWA 5JSMA 3FZOA 3UBDA 4U5JA 5J5SA 4XNEA 4FV9A 3R21A 3RBWA 4RIYA 2E2BA 1XH7A 4EQUA 4NJDA 5E8SA 2CSNA 3UYTA 4O7NA 4P4CA 3R8UA 2OIDA 4MXCA 2WEIA 3VHKA 5IA1A 3C5UA 4IM0A 3TV6A 2W1FA 2G2IA 2WMBA 3LKMA 2J0KA 3FWQA 3QTQA 4FKPA 4LGGA 4RWKA 1UNLA 1XHAA 4M97A 5CLPA 3ML1A 3ATTA 5TE0A 3L8XA 4CGAA 4PMPA 4NKSA 2QODA 1H8FA 3DDPA 3R7YA 4FEVA 3WBLA 4JS8A 5AP1A 2WD1A 1DI9A 5J9YA 5M51A 2UZEA 4TW9A 2WQMA 3FY2A 2I0HA 5H8EA 3NYOA 2YM6A 4NM0A 3KMWA 3Q52A 4CT2A 3ZXTA 3QAME 4G3DA 5BVNA 2IWIA 2J51A 3HMMA 2C0IA 4I0RA 4AFEA 4E6AA 2JFMA 2GSFA 4L7SA 3IDPA 2BALA 4YU2A 2JIVA 5K0KA 3BYUA 4G9RA 5LOHA 5HX6A 3ZLWA 3EL7A 4MYGA 5J9LA 2X7OA 4M67A 1ZYSA 5C9CA 4DEDA 4CV9A 2JITA 4E5BA 4UMRA 2ZB1A 4PRJA 2ESMA 1Z57A 4A4XA 3U4WA 4B8LA 1WVXA 4MWHA 2H8HA 3KK8A 4BCKA 3AT3A 3ERKA 3GVUA 4HCUA 4HZRA 5AUYA 3NGAA 3KRRA 4F6UA 2PUIA 1J1CA 3RI1A 4Y83A 4DDGA 4C4FA 4FTKA 5CALA 4GU6A 4YJOA 5EI8A 5FWKK 3VJOA 3OTUA 5LVMA 3C5IA 3C0GA 4EK6A 4PUZA 4BVUA 1FVTA 2PVMA 4HPUE 2YISA 4FT0A 4FTTA 5BVOA 1QL6A 4NFNA 2Q0NA 3FQHA 3W2CA 4X3FB 5DWRA 3E87A 4EUTA 4ZTMA 3VQUA 2XB7A 2B54A 3F9NA 4M84A 5CVGA 4NEUA 2X6DA 3R71A 4RQVA 2QKWB 3MH2A 5IKWA 2HW7A 3UIUA 3NX8A 1ND4A 5FRIA 3ZBXA 2KTYA 3DCVA 5HG5A 4BDKA 2YFXA 3AGLA 5D12A 4BDCA 2PZYA 5EOLA 1K2PA 2ITPA 3UIXA 3BRBA 4AGUA 4DDIA 5H8BA 2XRWA 1Q3WA 3MJ2A 5LARA 3QZGA 3QTWA 3AD6A 3TKUA 2C3KA 2J7TA 2R7IA 3GFWA 5K9IA 3F3UA 4YPDA 4M0ZA 4FTMA 1CDKA 1TQMA 3TZMA 3VAPA 3V01A 4FZAB 1YWNA 3CIKA 3KL8A 4PF4A 4DBNA 4OTWA 3EYGA 4E26A 5A4CA 5EYKA 2QOHA 2UZWE 2R3KA 1TFFA 2UZVA 1YHSA 1Q8ZA 5HO8A 1IG1A 4QMNA 3ID6C 2UZLA 4DFZE 4H39A 1BLXA 2UZUE 4G5PA 4AXFA 1F5QA 3AMAA 4GT5A 3KMMA 4FKOA 1Z5MA 1CM8A 2C3JA 1OPLA 2GCDA 2W7XA 2C5XA 4L7FA 4DEHA 3W55A 4F7SA 3LCOA 2J0MB 2WQEA 3KN5A 4PX6A 4XG3A 4EYMA 4M15A 5AV4A 2DWBA 2UW6A 4BCHA 3Q2JA 4ZXTA 5FGKA 2F2CB 2A2AA 3BEAA 3HEGA 4HVHA 5B2LA 2RG6A 3KVXA 2YWPA 3OT3A 1GIHA 4II5A 4TPTA 4FA2A 3R04A 3OTVA 5L2IA 3S1HA 2HW6A 2OZAB 4M7IA 5EW9A 3UIBA 2X2KA 5CSPA 2JC6A 3M11A 1FBNA 2BDFA 4JQ7A 3KQ7A 4D1SA 2I40A 1X8BA 3VBQA 4YJVA 4G34A 1V1KA 1XO2B 3MV5A 2VTAA 2BIKB 4FNYA 1B6CB 4IZ7A 3R7UA 2WQOA 4AW0A 3GEQA 4Z55A 4AACA 2GNHA 2O8YA 3GC7A 2UZTA 5CYIA 4DEBA 4FL2A 3MPMA 4FSMA 2VTIA 3DZOA 3E64A 1JQHA 3PY1A 5I9UA 1OBGA 3BIZA 4KBKA 4DFUA 3Q9YA 2HENA 3FMJA 3SOCA 3CKXA 2PZPA 2YIXA 4U8ZA 3ZO1A 1UNGA 4YP8A 3OCBA 3LXKA 4IANA 2VWBA 5AP0A 3PJ8A 4RVKA 4D2PA 2ITTA 5AMNA 4DTKA 2ETKA 2CKOA 3M42A 1SMHA 4GJ2A 1QPDA 4U42A 4KIKA 3R9DA 2YCQA 1SVHA 3V5QA 4DH8A 5TKDA 2VTOA 4TT7A 2BR1A 5IUGA 2W4OA 3HV4A 3HYHA 4FSQA 3NUXA 4ZSEA 3R9NA 5IZFA 3OFMA 2PMOX 4BC6A 3QTSA 3GP0A 1Y6AA 2GFSA 4PTEA 3AD5A 3FKOA 4GS6A 4IB5A 1BI7A 3HAMA 2JGZA 4IWQA 4G1WA 3UPZA 3NPCA 4G3GA 2OFUA 4FC0A 2R3GA 4A4LA 1R0EA 2EWAA 3MTFA 1E9HA 5AWMA 3TV7A 3Q4UA 4DG0E 4RIOA 2HELA 4LYNA 1H1WA 2VTNA 3MA6A 3O8TA 3PE2A 4BZDA 3F2NA 4O6EA 3RM7A 3UVPA 3UDSA 4O91A 3EMGA 4FNWA 5AR7A 2XIXA 1UWJA 3E3PA 4MNEB 4QPAA 1IEPA 1Q8WA 4IBMA 4RX9A 4BTKA 4DEGA 4NM3A 2OF2A 2Z02A 1MRYA 5CASA 3PLAE 4DEAA 3K5UA 3PFYA 2JEDA 5HBHA 3D7TA 2RFDA 4YJTA 3ZEWA 4GCJA 4FZ7A 5DA3A 3ZO2A 1JKKA 4QMQA 2I7QA 4P2KA 1FMOE 3A60A 5C8MA 4EZ5A 4HVDA 1W98A 4CRSA 4FIJA 2Y4IC 3ULZA 5M4CA 3DXQA 1QCFA 5DR9A 2BTSA 4ZMFA 4QMWA 2CN8A 2VTSA 1P4FA 5DVRA 4S34A 4CYIA 2XF0A 4TYHA 2OJFE 3I5NA 1OI9A 2QOCA 3QQGA 4FZ6A 3OD6X 3VS0A 4NTTA 3UP2A 4OUCA 3UP7A 3QBNA 5J79A 4IADA 3VUMA 4DH7A 1OL1A 2GDOA 2DQ7X 3GUBA 3W0RA 4L6QA 4EWQA 3A4OX 3O17A 2CDZA 4YTHA 3VUTA 3TN8A 4NL0A 5HZNA 2V55A 4ZS0A 4GU9A 3UOJA 4HYSA 1PMEA 3D2IA 3TMOA 2WXVA 2VO0A 4ZTHA 3UZTA 5JGDA 4J52A 3ACJA 3SW7A 2O65A 1NVQA 4FKRA 2BRBA 4F9YA 4YNOA 3TZ8A 4U3ZA 3VUGA 4BI2A 2VWXA 4O2PA 4EQCA 2YN8A 2YM7A 3TUBA 1PKGA 4OTFA 5E7RA 2XK9A 4HYIA 1H24A 1ZMVA 2YLEA 4M69A 4FTJA 4R7IA 1W7HA 2CLQA 4ZTNA 4B9DA 1JKLA 4OBQA 5JQ8A 1BKXA 3D94A 2PUUA 2QO9A 2VGPA 4IC8A 3IOPA 3AC5A 4DGMA 3WF8A 3RVGA 4K1BA 1Q8TA 4X2GA 3PRFA 2C47A 4N6ZA 3BWFA 4XX9A 2I0EA 3KN6A 3V51A 4D55A 1JSVA 2C6TA 2CKQA 4ZZOA 1ZXEA 3HGKA 4FE2A 4GIHA 4D2RA 4BWPA 3AGMA 3NNXA 3UYSA 2BUJA 3TXOA 5IF1A 3RAKA 3QQKA 2BHHA 4G3CA 4FKLA 1M7NA 5FEDA 3RWQA 2XARA 4NYEA 5KMLA 5AIKA 2WTKB 2WTWA 2J0JA 2UVYA 3UDZA 3CEKA 4Z3VA 3DK7A 3BELA 4WBBB 1O6LA 5DT3A 4EL9A 3EN6A 4RWLA 4WUAA 3OS3A 2F2UA 4WRSA 5FD2A 2OICA 4EHEA 4YURA 1XMMA 5LVOA 4YO4A 4HNIA 4RWJA 4S2ZA 4BCQA 3NUPA 2PWLA 5CU4A 2ZDUA 1YXXA 2QOQA 1XBAA 2ITVA 3IW8A 4OTDA 3NVMB 5HU9A 3HMOA 4BDJA 4E1ZA 3N4UA 4M13A 4APPA 2H34A 2PVYA 4YZCA 4RZWA 5E8ZA 4XG6A 4HYUA 4QQ5A 4C36A 5FEQA 2UW8A 2A1AB 5EI6A 2PE1A 3EQFA 3WZDA 1IASA 4FKUA 3NFFB 3L9LA 3QLGA 5JEBA 4LV8A 3MBLA 5M06A 3LXLA 1U59A 4YSMA 2FYSA 2C1BA 1Q5KA 5A4LA 2G9XA 4G9CA 3UMXA 3DKCA 4AZEA 2ITYA 4C59A 4Y5HA 5HD7A 5T68A 4CLIA 2BFYA 4ZZNA 3R7GA 4WG4A 3U6IA 3D5XA 2Y7JA 3UGCA 3IW7A 4RRVA 3KCKA 3R7OA 4O7TA 5C01A 3VIDA 2XJ2A 4F6SA 4WA9A 3UNZA 1M14A 4EH4A 5H9BA 1YXVA 5TR6A 4C33A 5C8NA 3FXZA 3A7HA 1H08A 3KEXA 2VTHA 4I24A 1YXUA 4FT3A 2YACA 2OU7A 5K3YA 4QP3A 3E88A 1OKZA 5CAVA 4PY1A 3I0QA 3MTLA 1W8CA 2YEXA 3ZS5A 2P55A 4BDGA 2VWVA 2HXLA 1YKRA 4EH5A 5HVKA 2WELA 3TJDA 3ZHPC 3TTIA 1FGIA 4DG3E 3CD8A 4G5JA 4MBIA 4C3RA 2QQ7A 1UU8A 4QYGA 2X8DA 3MYGA 4J99A 4BGGA 2C5VA 4XS2A 4I92A 4E4MA 2B1PA 2VX3A 4DGLC 3ORPA 3VONA 3CGFA 2A19B 3DKFA 4I4EA 3MFUA 3V5TA 4NZWB 5JMSA 4O82A 2IW8A 4RX8A 3U9CA 2Q83A 1ST4A 5GJFA 3FZTA 5E1SA 3QU0A 2ZM1A 4YGAA 5CXHA 4X3FC 5L6WL 4ZZMA 4I6FA 4CMUA 2E9PA 2C6EA 2UVZA 2VWYA 5JFVA 5FXSA 1VEBA 4ACHA 4FYNA 3NUAA 2Z7LA 3JUHA 3PUPA 2NP8A 4GT4A 3UO6A 4YC6A 4E5WA 5BQ0A 2BAKA 2RFNA 3WZJA 5J7BA 3PY3A 1APME 4XOYA 3DFAA 4JRVA 5LMAA 3FMNA 1YXTA 5CAQA 4DCAA 3FSKA 3QD0A 4ZK5A 4EORA 5GINE 1WCCA 3LXPA 3NUUA 4MXAA 5FQDC 3VBXA 4AA4A 2FSTX 4BDBA 4LUDA 4AN9A 1XQZA 5L8KA 3A99A 3HVCA 3SXSA 3LLTA 4KA3A 1R78A 2BPMA 4DGGA 4KRDA 4AQKA 1JSUA 2IW9A 3ZM9A 3VBTA 2HIWA 2JDTA 3MA3A 3E8DA 3LIJA 3NYNA 4LOOA 4LRJA 5DR2A 3LQ8A 4O0UA 4UYNA 1H01A 3PWYA 3OCSA 3V8SA 3QHRA 3FHIA 3W10A 2W5BA 3OUNB 3KXHA 3QTZA 3W2PA 2OK1A 2C5YA 4QTEA 1Q8YA 2C69A 4IAKA 3ROYA 1W2DA 4WG3A 2BRNA 4HPTE 2YDJA 4FRFA 3DK3A 4F0GA 4D28A 5CSWA 3F5XA 3L9MA 4FIFA 3ZZWA 3OVVA 3NUYA 3DBEA 4XHKB 2Z7QA 2QLQA 4BJJB 4K77A 3QGYA 4UXQA 1L3RE 4W4VA 2OSCA 2GS7A 2WQNA 4QOXA 4ZTRA 5IH5A 3QCQA 3POOA 3R0TA 4E5AX 3OWPA 4EI4A 2UZBA 3KKVA 3UIMA 2QNJA 4DLIA 4GVAA 5KMIA 4IIRA 2F7XE 3FMDA 2CPKE 4LGDA 4TN6A 4FUXA 5FP6A 1ZY4A 2VV9A 4U41A 4A4OA 1VZOA 1ZY5A 4X2JA 2ZFYA 3WF7A 3ZC5A 1U54A 2XJ1A 1J91A 1LR4A 3ALOA 5ANDA 5FM3A 4BDHA 4JDIA 3DQXA 2OIBA 3GU8A 4NJ3A 3UNKA 4IEBA 3EL8A 3TM0A 2NRUA 5I9XA 3V04A 1H07A 3Q60A 4FGBA 2FO0A 3ANRA 4LL5A 4D2VA 4XV9A 4EHZA 3SQQA 5IQGA 3HDNA 1FINA 2EXEA 3FC2A 4OTHA 3ZYAA 4AA5A 3G33A 4QTDA 3PIXA 3Q5ZA 4CFUA 2VTJA 4IVAA 3ORMA 4J96A 5HE3A 5CNNA 4RZVA 4CRLA 3LJ0A 3QC9A 2WEVA 5HE0A 5F20A 4DHIB 3H4JA 3Q6UA 5HO7A 4JRNA 1OIUA 2V7AA 3EFWA 5IUIA 3UC4A 2PZIA 1MUOA 2OJIA 5DLSA 4YZBA 2YAKA 4PDSA 1OUYA 4ERWA 4JR7A 4BL1A 4IAAA 1PYXA 4M14A 3V5JA 4RX5A 1H1RA 2CGXA 2XEYA 3VWAA 4BCPA 2I0VA 5D11A 3HV5A 2AC5A 3F61A 4RC3A 4CFFA 1OL2A 1SNUA 3DAKA 5L2QA 4F65A 1S9IA 4TY1A 2ITZA 3QCXA 4AGWA 3JVSA 3B2TA 3W2QA 4JLCA 5M4IA 1UNHA 3NEWA 3PXZA 4JIKA 4PTCA 4PWNA 4PPAA 1UV5A 5DOSA 3ROCA 4W9XA 3RAHA 4QQTA 2QOLA 4CFXA 3ZMMA 1GOLA 2W9ZB 3LCKA 4RIXA 5EYMA 3LFDA 2VN9A 4W9WA 4USEA 2JAMA 4LMUA 4R5SA 4E6QA 4C4JA 5KKRB 4BY9E 4AE6A 2G15A 4QMVA 2IF8A 3FKLA 4CYJA 2ZM3A 5GZ8A 4JR3A 3EQGA 1R0PA 3O0GA 2CKPA 3CBLA 3MI9A 3UZRA 3OUKA 5EDQA 3PUFC 3MIYA 4AW2A 4O4BB 2Y4IB 1VYWA 3PTGA 4EH3A 4EH8A 4N6YA 4EH7A 4UX9A 1OITA 2P3GX 1SVGA 3C7QA 3NAYA 3VS7A 3CC6A 4FGRA 4YZNA 3V8WA 1KSWA 2R2PA 2W1DA 1B38A 3EKNA 3KULB 2ZMDA 5HU3A 4FKTA 5L2WA 2VWUA 3MPAA 4PDPA 4WUNA 5E8UA 4K0YA 3T9TA 2UZDA 5BYYA 3SG9A 1TVOA 1J1BA 2R9SA 3D4QA 3DB8A 4BCMA 4PMMA 3SLSA 4F0FA 4O0SA 3K2LA 3Q3BA 5AIRA 2JBOA 4BCFA 4G2FA 5B2KA 3UOKA 4C4EA 3UQGA 4YUQA 4U43A 3TZ7A 2OO8X 4K2RA 3SRVB 4AG8A 5AAGA 4OTIA 2QR8A 4L43A 4C4HA 1OPJA 3OXZA 4UEUA 5AP3A 3FI4A 5AUZA 4BDAA 5M4FA 4O6LA 5AX9A 3QL8A 1UVRA 4XV2A 4W4XA 4YHTA 4AS0A 4EK5A 5IA3A 3CSVA 3ZFYA 3MN3A 1K3AA 3TCPA 3VS1A 2G01A 3RPSA 1J3HA 3LJ2A 3O2MA 3NYVA 5M44A 4IZAA 4DLJA 1I44A 4BI1A 4M68A 3SC1A 4AWIA 5IQEA 4IE9A 4L01A 5IQDA 4BF2A 3CQEA 3FEGA 5HORA 4FV4A 4J8MA 4NUSA 4YZ9A 4XG9A 4LQMA 3C4EA 5E8YA 5FLFA 3KK9A 2IZTA 3KF4A 3QXPA 5ICPA 5BNJA 5I9VA 5IEYA 3QC4A 3GC8A 4FBXA 3A8WA 2WTKC 4LOPA 3FYKX 4EZ3A 3RWPA 5FTGA 1WZYA 2J0IA 4QQCA 2XK8A 4EQMA 5HVYA 4YTCA 3CGOA 5FTOA 3QF9A 5JRQA 2XVDA 4E3CA 4IHPA 3OEZA 1JVPP 3MVMA 4FK6A 4ASZA 4KS7A 5EKOA 3L9NA 1M7QA 4FNZA 2BHEA 3KRWA 4D2WA 4ZMEA 1OKYA 3FZ1A 3FI3A 4B6LA 2LGCA 1YW2A 3R9OA 5E92A 3F88A 2IW6A 2YA9A 5TO8A 5EM5A 4F08A 5BUJA 2JLDA 4BDFA 1OL6A 1IAHA 4BCNA 5C4LA 4RWIA 2GNGA 4EKLA 4YZDA 1XR1A 3PFQA 4KABA 2VWZA 3HV6A 5CQWA 3EKKA 2R3FA 4RSSA 2RF9A 2XNMA 5EHLA 5LCKA 4CNHA 2O3PA 3R1QA 1B39A 3FUPA 3KCFA 3MB7A 4IWOA 4R3PA 4DG2E 3ZLXA 2VTRA 3O96A 1O6KA 1SVEA 1GNGA 2VUWA 4U9AA 2WOUA 4F99A 5GNKA 1M2RA 2P4IA 3QYWA 4G3FA 4R1VA 4C57A 3AC2A 3I0OA 4CMTA 2XNBA 1P14A 4NCTC 1YWRA 4KIKB 3G2FA 5GHVA 1NA7A 5LXMA 5A6OA 5DFPA 3BGZA 4JI9A 3DTWA 1YRPA 2OG8A 3TNPC 4DFYA 2ERKA 3QZFA 4UWCA 2YITA 4D4VA 1ZRZA 5KNJA 3N4VA 4YBKA 2YIQA 3EN4A 3LAUA 4DBXA 3CE3A 1XH6A 4AAAA 1OVEA 4F9AA 2O63A 2J90A 2HZ4A 2PUPA 5IPJA 4H58A 4O7VA 3ZRKA 1YI6A 5EG3A 3VBYA 4NTSA 5E8XA 2GNFA 3G0FA 5KHXA 2VAGA 3JR1A 2JBPA 3TJCA 3UDBA 3LCDA 4FIIA 2XMYA 4QMOA 3DB6A 4QMSA 3HZTA 3VS5A 2Z2WA 5CZIA 4CSVA 3BL9A 1U5RA 3LFCA 3IGGA 4O7WA 3EN7A 4GG7A 3QRJA 2FUMA 2OJJA 4I94A 3VF8A 3HKOA 4P5ZA 3D7TB 4WSYA 3I81A 4MBLA 4CQEA 4GYIA 2REIA 2PUNA 3PE1A 3LFFA 2XKCA 1PXIA 3F7WA 3A7IA 4IJPA 3R22A 4LDTA 4I93A 1IRKA 2HY81 3PXYA 4WG5A 1H1QA 2X4FA 3CQUA 4C37A 3UVQA 5IA4A 5EDPA 1SYKA 2OH4A 4EH9A 1LP4A 3S4QA 2R4BA 5HQ0A 5JKGA 4TZRA 4R77A 4F7NA 4RIWA 4PP7A 3BPRA 5FXQA 4FSYA 1K9AA 1CKJA 4DTAA 2AC3A 4MXYA 1PXMA 2WMWA 4KD1A 4BDIA 1PXOA 4G17A 5CEKA 4HJOA 4UXLA 4RA4A 3TV4A 2F57A 4A9SA 4IWDA 4X2NA 3POZA 3AQVA 4JT3A 3HNGA 3I5ZA 4ANMA 3DA6A 5BYZA 4ZLOA 4BYJA 4ITHA 4J95A 1ZWSA 3BU3A 2A98A 3MY5A 2QOFA 3ZRMA 4BGQA 1H4LA 4YR8A 3RMFA 1DS5A 4AN3A 1UKIA 3QRIA 3QALE 4FK3A 3JY9A 2YWVA 4FV8A 3C4WA 5I3OA 1YDTE 4CKRA 3O7LD 1KWPA 2JD5A 5BVDA 1ZMUA 4L3LA 5BPYA 3OWJA 3H30A 4AF3A 3FZSA 3COMA 5ETFA 2Z7SA 4FYOA 4O7LA 4IB3A 3V3VA 4USFA 5AR4A 4Q9ZA 4TWOA 1SNXA 3KRLA 3ITZA 4R5YA 3EB0A 5E91A 1JKSA 2P2HA 4QYHA 4KKEA 1Y8YA 3BGPA 5B7VA 5IDPA 2VTLA 2YIWA 3I79A 3Q96A 3C0HA 4IX3A 5BVWA 1PMNA 1VYZA 3E92A 3GCSA 5CAOA 3R28A 4NU1A 3DBDA 2YIYA 5FG8A 4DEEA 3LFBA 3Q32A 4DHFA 3ZUUA 5K4IA 2R3RA 3HA8A 3LMGA 4NW6A 2JDOA 3G15A 4GL9A 4RLKA 3CTHA 2R3NA 3I60A 3JPVA 4CKIA 5CSHA 3Q9ZA 4MHAA 4MKCA 3QCSA 4O0RA 2VTTA 4C0TA 1O6YA 3R30A