3GNIB

Structure of strad and mo25
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
388
structure length
304
Chain Sequence
AHHHHHHMENLYFQSSFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEKFSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIASEALPELLRPVTPITEVDDWEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Mo25
publication title ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/signaling protein
total genus 79
structure length 304
sequence length 388
ec nomenclature
pdb deposition date 2009-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3gniB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3gniB01
2YM7A 2WMRA 2P33A 3NGAA 3VHEA 4DG3E 2UW3A 2VRXA 2UZDA 4C57A 1OKWA 4F6SA 5HZNA 3QCYA 2X0GA 2CNQA 5DT4A 4DGMA 1OGUA 1ZYSA 2GMXA 4WD5A 3AQVA 3L9NA 4KRDA 3LCTA 2UVXA 1Y57A 5F20A 4FZAB 3VS0A 3U9NA 3JR1A 2WIHA 4H05A 4ACCA 4RWKA 2OK1A 3E3PA 3CXWA 2Y6OA 2R0UA 5GJDA 1O9UA 5L6PA 4D4RA 4X2KA 4QPAA 4JXFA 4LYNA 4DBNA 4HVIA 1BL6A 1QL6A 1R3CA 2PVFA 3LOKA 4IZYA 1M2RA 3ULZA 4L53A 2C47A 3O8PA 1MRVA 4X6RA 2XBAA 5CAUA 3TM0A 2JDOA 4NTSA 1UU7A 4IB3A 3G6HA 4C59A 1J7UA 2Q0BA 3P0MA 1QCFA 1U46A 4IIRA 4BI1A 5LCKA 4QMNA 3KCKA 3LVPA 4RA4A 3K3JA 3Q53A 5JFWA 4IVDA 3OT3A 2R64A 4L68A 4LRKA 1MUOA 3LCOA 2OH0E 1Y8YA 3VF8A 5LWNA 3NWWA 4JL9A 2PZPA 2AUHA 3M2WA 3EN5A 3O23A 4MBIA 3CTJA 2VTJA 2WQMA 1GOLA 4ZAUA 3F5GA 2ITVA 3I7CA 5CLPA 3A8XA 4MXYA 4BCFA 3RVGA 3MFSA 5KMKA 3ZO4A 1PXIA 3LFNA 4JR7A 4GYIA 1XKKA 4E5WA 3U8WA 2RIOA 1WBTA 2HZIA 2YN8A 4IM0A 3SV0A 4ENYA 3FAAA 2WTVA 1Q8ZA 3ZXTA 4DFYA 3HV4A 3BLRA 2QR8A 3QQGA 1KE9A 3JY9A 1WBPA 3KGAA 5DT0A 4CFVA 4JVGA 2WO6A 3ZYAA 5IA1A 2GNJA 5FM3A 1LP4A 1W84A 3EIDA 3BWFA 3PVWA 1Y8GA 4MXAA 2WKMA 4AN2A 2ONLA 2ITYA 1YWNA 5DE2A 3CGOA 3GC9A 4WNMA 4BKJA 1A48A 4C38A 4MQ1A 5ETCA 2BDWA 3E64A 2BROA 4O7LA 1CSNA 2VWIA 2BPMA 2CNUA 5HX6A 3IDCA 4D0XA 2NRUA 1ZOGA 4GFOA 4RSSA 4PRJA 5BYZA 3ZO3A 4H3QA 3TNWA 5KX8A 1YOLA 2W1CA 3R28A 3R1YA 5ITAA 3A62A 4BHNA 1QPDA 5BYYA 1SVGA 2JIIA 3QWJA 4ZZMA 2E9OA 2XJ1A 3UQGA 4MBJA 4TYEA 5KHWA 5LVOA 1TQPA 4LFIA 1PMEA 3K3IA 5M08A 1KE6A 1TQMA 2J9MA 3K2LA 4AZTA 2BRHA 4EQUA 4QP4A 1H0VA 3JVSA 4ZSAA 4BF2A 2EWAA 5EOLA 4NZWB 3SW4A 3NUSA 4HGLA 2H34A 4F7SA 4QYYA 4DH1A 3BKBA 2W1FA 2JDRA 4DEEA 3KU2A 4YTCA 2J90A 3UQFA 4X2GA 3W2QA 4D0WA 4A9TA 4FTTA 5AM7A 5CYIA 5AUUA 2QI8A 3G9NA 1R0PA 3TKUA 4H1JA 3I81A 4KIQA 3VS1A 5EDPA 3OOGA 3KB7A 4Y5QA 4N57A 3QTSA 3C4WA 5CSWA 3CJGA 4FSMA 4DHFA 5IUHA 1KE7A 3C0IA 5AEPA 4I23A 3VBYA 1YI4A 4AW5A 4GFGA 2E9UA 1MQ4A 4DGGA 5JQ5A 5J1VA 1V0PA 3QRIA 3QZFA 3NUNA 2A19B 4O27B 1XH6A 4RWJA 4A9SA 3TCPA 1KV2A 3I7BA 5HX8A 3QCXA 3TJDA 3OHTA 4G1WA 2OIDA 5DR9A 3TN8A 1APME 3R9OA 4ZTMA 4O83A 4QQTA 1OI9A 4BCNA 2WIPA 2OWBA 3HZTA 4N70A 4WT6A 5K3YA 4EC9A 3W2RA 4ERKA 4Y72A 3S00A 3UJGA 4ALUA 3KF4A 4YTFA 2VTIA 3AC2A 4IWPA 4QYFA 4A7CA 3FI3A 1W83A 2WMVA 5GJFA 4E5AX 1J1CA 2PWLA 3N9XA 1OIUA 4RJ3A 4EOMA 4ZY5A 3O2MA 4GK3A 5TE0A 4YP8A 5IQGA 4BCQA 4EK8A 4K18A 3I79A 4FKIA 3POOA 3TKIA 3CLYA 2XNEA 3RNIA 3WZEA 2WTCA 3EB0A 4RFMA 2VZ6A 2O0UA 2JIVA 1PMUA 3BQCA 4F9WA 2ESMA 2PULA 2ETMA 2YM8A 5A6OA 1AGWA 3DOGA 1FQ1B 2XIXA 4I5CA 2VTOA 2YM6A 4NT4A 3C1XA 4DFXE 4L42A 2P3GX 1P4FA 3V5TA 4FIHA 2ZV2A 4UYAA 1VZOA 4IHPA 4Q5EA 2XRWA 2WAJA 2H96A 3PRIA 5AV3A 3PXYA 4DC2A 1URCA 4FV5A 4U45A 4YO6A 4MWIA 4O96A 1V0BA 3RAWA 1U4DA 3ZLXA 5HESA 3F5PA 4FTKA 1OL2A 3OS3A 4D1ZA 3F3TA 3FMMA 4W4XA 3EQPA 3UG1A 4D1SA 3LM0A 4O91A 4FSQA 3WZDA 2YEXA 2R5TA 4M3QA 2VUWA 4NTTA 4GT5A 3CSVA 3E7OA 4FEWA 3IS5A 2ITUA 2ZV8A 3SGCA 1T45A 4N4SA 3C4ZA 3RJCA 4JBOA 1PKGA 2CCIA 3EN7A 3FXXA 2HWPA 4FSYA 4L8MA 2X2KA 4O1PA 2F57A 2RKUA 3R6XA 3NIZA 3R04A 1DI8A 2OXYA 2IVVA 3Q5ZA 4DFZE 5I5ZA 4MX9A 5B0XA 3KRXA 5GIPE 3KXZA 3FLZA 3QGWA 4B6LA 2GSFA 3QXPA 1WBOA 3AD5A 3LXLA 4EK3A 4CKRA 4I22A 5HNIX 3EQIA 3KL8A 4IDVA 2XCKA 2WMAA 4Y73A 1Q24A 3ZDUA 5K4JA 3HVCA 5A14A 4KBAA 4XV9A 4LUDA 3BU3A 4YGAA 3CP9A 4RA5A 3QZHA 5FP6A 3OFMA 4FI1A 4MTAA 3HAMA 3COIA 5IQDA 2IPXA 4AT4A 4Y8DA 3PXQA 2PUUA 2EVAA 3VBQA 1OIRA 1XH5A 2R3QA 3SOCA 4I0RA 3O51A 3ZM4A 3QTWA 3DV3A 4GV1A 4AW1A 2LGCA 4FYNA 4BFMA 4FZFB 4JR3A 3PDTA 4AT5A 4E3CA 2ITNA 4CGAA 4FZDB 2X7GA 3D7ZA 3WF7A 3EQHA 4II5A 2OICA 3W2PA 2JEDA 4XV3A 4PMMA 4WO5A 5FM2A 4AOTA 4O0RA 2HZNA 4QP8A 5KE0A 5BYLA 3IW6A 4LRJA 3V5JA 2REIA 3G5DA 5KKRC 5L6WL 3KY2A 3UPXA 2WEIA 4E26A 4MNFA 1UKIA 5ACKA 3QKLA 3P7BA 5HE0A 3UIBA 4I6BA 2PMLX 3VN9A 3EQGA 1PHKA 2CDZA 2X81A 3DBEA 4PUZA 2JKOA 4NCTA 3KXNA 2GNFA 3WZJA 3G15A 4EOOA 4FKJA 3DU8A 2ZM3A 5JRQA 2CKQA 4DT8A 3NNUA 3BZ3A 4P5QA 3ZMMA 3RALA 5IKWA 1CDKA 4KABA 3ZONA 3DT1A 4E73A 1WZYA 2VWVA 3QCQA 5H8GA 3DA6A 5M4IA 5AUVA 4RRVA 5CX9A 3ANRA 5HG9A 2PYWA 4R6VA 4ORKA 4DF3A 3KQ7A 2C6DA 5F1ZA 3PP0A 1MRYA 3C0HA 3DXQA 4W4YA 4EBVA 1R0EA 3KEXA 4D5KA 3ZTXA 3MH3A 2Y7JA 4HVGA 3FKLA 5K9IA 3CD8A 2R3IA 4UMUA 5M4UA 2XM8A 4QOXA 5KKRB 4XV2A 3QGYA 4ANMA 5CEOA 3GCUA 5AP6A 4EUUA 4I24A 3RWPA 3TDVA 4ASXA 3OCBA 4U6RA 3VUGA 1GAGA 1W8CA 2VTAA 2ZYBA 3C7QA 3FZOA 5JKGA 2CN5A 1MP8A 1K3AA 3VJNA 5AAEA 3PIXA 4RX5A 4ACDA 4AW2A 3CGFA 2HK5A 2ZMCA 2WQBA 2V0DA 2HAKA 1P5EA 2UZNA 2WTWA 1OPLA 5L8LA 4NM5A 2WMTA 4FC0A 4YC3A 3GCSA 4CYIA 2PE2A 4PL4A 4FOBA 4M0YA 4D2SA 1BYGA 3OZ6A 3E8NA 3F7WA 4MHAA 3LHJA 4AFJA 1CKIA 2ZV9A 4AT3A 3BWJA 2YIXA 4QMZA 4ONAA 4DFLA 5AFVA 2BRGA 2QO9A 2OJFE 3HL7A 4OT6A 4BDKA 4EH7A 1RE8A 2QONA 2VTLA 4RVMA 4XJ0A 2HIWA 3PXKA 1AQ1A 3GFWA 4X21A 3OEZA 4XBRA 3V01A 5AAGA 3KCFA 4HCUA 2WNTA 4BIDA 4AZFA 3ORLA 4QTDA 4CTBA 4PF4A 4RQVA 4KS8A 4LG4A 3OWLA 4U79A 4V04A 1YWVA 5C4LA 3KXGA 2WMBA 4FT3A 2ZDUA 5L4QA 1JAMA 5HU9A 4RFYA 5CWZA 1Q5KA 4MWHA 2J0JA 2FGIA 5I9UA 3E8DA 4DCEA 3KXXA 4O6EA 5KCVA 4USDA 4F65A 2OXXA 5HTCA 1OM1A 2JKQA 5CI7A 5L2SA 3QQJA 3O8TA 4DCAA 4JI9A 4K77A 2W4JA 4XEYA 5J79A 3VS5A 3CQEA 5AA8A 2R2PA 3KMWA 4KKGA 2FO0A 3WE4A 5KMLA 3RTPA 2ZVAA 3F3ZA 3FYJX 3CY3A 2ZM4A 4TRLA 2B9HA 3TT0A 2IW6A 4FTAA 4BDEA 3NMUF 3DLSA 5C8NA 5FP5A 3DZOA 5K5XA 5AWMA 5IDNA 3R2YA 4FKVA 4LV5A 3Q60A 1FGKA 5BUJA 4KUJA 2I0VA 1AD5A 3WARA 3NPCA 4PNKA 5LVMA 3IOPA 3GGFA 2Z8CA 3CC6A 1Q3DA 3VS3A 1R39A 2WOTA 4O1OA 5BMMA 4RIXA 4BGHA 3Q9ZA 2OLCA 3KN5A 1YWRA 3TTJA 4KIKA 4BYJA 1G8AA 5CF6A 2ITTA 1FBNA 2HZ4A 3GU6A 1WFCA 3EHAA 3RK5A 2F4JA 5CXZA 4ALWA 1RDQE 3D5XA 4R3PA 4BCJA 4BY9E 5HQ0A 4XG2A 4PMPA 2BZJA 5E1EA 1XR1A 2ETKA 4C4IA 5KMOA 4V01A 3VQUA 4LOPA 3FHIA 3LFBA 4WSQA 5EYDA 4O7YA 4GUEA 2C6OA 3R63A 1REKA 1H27A 2V7OA 4X2FA 4ANQA 2J5FA 2P2IA 4ALVA 1YOMA 2ERZE 3F5XA 2UW0A 5EH0A 2W9FB 5GINE 4BCPA 5B2KA 5EYMA 4CV9A 3QAME 5G6VA 4BDIA 3Q04A 4FIFA 2C30A 3ENMA 3QYZA 2AC5A 3PXRA 2C6LA 5ANGA 4YHTA 2V22A 3CTQA 2PY3A 3FZPA 2XNPA 3HDNA 4HPUE 3PPJA 4JIAA 3RM6A 4LGHA 2X4FA 2UZWE 2YM5A 5M06A 2VX3A 4L46A 2C6MA 1LEZA 3CQWA 4PP9A 4BWXA 3QRJA 4QPSA 5BVWA 2WTDA 2CLQA 2QHMA 3UO6A 3LW0A 4UN0C 4M12A 2VWBA 4R3RA 5CALA 4UWBA 3UVPA 5K5NA 4O7WA 4PPBA 1KV1A 3MH2A 2OJJA 4I0TA 3DK6A 4F7NA 3D7TA 3D5UA 3VW6A 3MJ1A 3UO4A 4IC8A 4IZ5A 2R7IA 5C4KA 3ZDIA 4UEUA 4XG8A 1PXNA 5GNKA 4GUBA 4J95A 4MXCA 3Q96A 4A9RA 3RAIA 4YJOA 3SRVB 4CQGA 5HIBA 1H1RA 4UYNA 4A07A 3F3UA 3V6RA 4E8AA 4RZWA 2W1DA 3KMMA 1CKJA 4O38A 2XYNA 3PE2A 3EKKA 1W0XC 2F49A 2XNGA 3NNXA 3OP5A 4QMXA 4BYIA 4EWHA 3TNIA 4Y85A 3QQHA 2W7XA 4JBPA 4YJPA 3GUBA 3PXZA 4IAYA 5BUIA 1YXXA 3G0FA 5HTIA 2YIRA 4O2PA 4FICA 5D10A 4IDTA 2WTIA 3FMJA 5E4HA 2R3HA 5FUTA 3SDJA 5A4LA 3ORXA 3FYKX 2VAGA 4FKGA 4BDGA 1ZZLA 4TN6A 2JC6A 5E8WA 2X7FA 4UV0A 2HXLA 3KXMA 2GNLA 3LQ8A 2YDIA 5D7AA 1EH4A 4EHVA 1OKYA 3UMXA 4DG2E 1ZYDA 2WD1A 5IQHA 2UW5A 4L3LA 4PDYA 4YURA 4NM7A 2BR1A 1JNKA 3R7OA 3SC1A 3UYTA 3BGZA 3ZU7A 1STCE 5J5SA 4KD1A 5TOZA 3GENA 2P55A 5IA3A 4YJUA 4DTAA 4FTIA 1LPUA 2QR7A 2GHLA 3VULA 3HUBA 4YNOA 3T8OA 3FSFA 4G3FA 4Q9ZA 2HW6A 3QALE 3ZSHA 2UW4A 4BTJA 3O71A 4C34A 4CZUA 3EN4A 4J96A 2XK3A 4N6ZA 3VS7A 3CQUA 3F9NA 1YRPA 3WOWA 1HCLA 2R4BA 3NX8A 5DI1A 1PXKA 5J9ZA 3FKNA 3K5UA 4EEVA 4D4VA 2GNIA 4NSTA 4TY1A 4EUTA 5C26A 4HNFA 3ATSA 3NW5A 4NIFB 4GKHA 3HMIA 3UNKA 4RIWA 4LOQA 4K2RA 5DHJA 3NR9A 1YXVA 3HP2A 3L8VA 3OXTA 3QKKA 3RGFA 3THBA 5FXSA 3LCSA 3WF5A 3E8CA 3BYOA 1UV5A 2FB8A 3P5KA 3R8MA 1OL5A 1WVYA 2RL5A 2BHEA 4EBWA 5CAOA 2OXDA 3C4FA 4WNPA 2GQSA 3PJCA 4ZTNA 5DLSA 5C27A 3NNVA 2B9IA 1MQBA 4PMSA 4XG7A 4BWPA 4IB0A 4EZ5A 3NYVA 3CR0A 4ASZA 2QOFA 1KOAA 3COMA 4BTMA 4F7LA 5JK3A 3EQCA 3VS6A 2QOKA 3E7VA 3B8RA 2QO2A 4HGSA 3RWQA 3ZOSA 3ORPA 4E6DA 5CEIA 2YABA 3BBWA 3ORMA 4C58A 4AXAA 2CN8A 3QTXA 2XNOA 3N4VA 3F61A 4PL3A 1H01A 1H08A 2GHMA 2EU9A 4MXZA 3EFJA 1BX6A 2W4KA 4XX9A 1XH9A 4E5BA 4IFCA 4AZWA 1I09A 4FIGA 5DGZA 3GC0A 4IAAA 5EW9A 4GT3A 3W33A 3NDMA 3RPOA 2R3JA 3D5WA 4FNYA 3I0OA 2PZRA 5KNJA 4FSTA 2QU5A 3GXLA 4FX3A 5FBNC 3SX9A 4V0GB 4RVTA 3QTQA 4M15A 3P9JA 3UP2A 3LFSA 2I0HA 3OC1A 3DAJA 5DNRA 2XNMA 4FKOA 1UNGA 3II5A 3GU8A 4Y95A 3FY2A 4R7BA 4MXOA 3U54A 4BGQA 4JJRA 5DH3A 5M4CA 4YR8A 3E3BX 3AG9A 3MPTA 4HCVA 2R3RA 5F94A 3PG1A 4K0YA 1M7QA 3A8WA 4EOSA 2C5NA 3DGKA 3DY7A 5JFSA 4XUFA 1IAJA 3VNTA 5EI2A 1BKXA 3E93A 2DWBA 1PXMA 4TYJA 3UMWA 4MBLA 4YZCA 4UZDA 1XHAA 5FTOA 4HJOA 4IVCA 5EI8A 5AX3A 3RP9A 2YLFA 3V8SA 4UMTA 5DRDA 4O0TA 4XCUA 4G5JA 5AR7A 4NJDA 4UALA 4FF8A 3AT3A 3FMHA 1YI3A 3QL8A 3P7CA 3LZBA 1QPEA 4FK6A 4QTCA 3AC5A 3R7YA 3SXSA 4E6AA 4DEBA 5HHWA 1IAHA 4OUCA 4F4PA 4B7TA 3OOMA 4OTIA 3RNYA 4KSPA 4QTAA 3U6JA 1FGIA 1JOWB 5CXHA 3QC9A 4Q5HA 4EOQA 2OH4A 1NXKA 4XP3A 3TZMA 3R8LA 3JS2A 4JBVA 2ZMDA 3FXWA 4D2TA 3QQUA 2W5HA 5AR4A 4AG8A 1YHVA 4Y46A 2YZLA 4GJ3A 4LGGA 3RAHA 3RINA 3P78A 3A7HA 3DPKA 2IJMA 2QKWB 2WXVA 4NW6A 1ZYJA 4HZRA 4FNWA 1JWHA 3ZM9A 4OBPA 3PSDA 2W1GA 3BHYA 4CEGA 3O0GA 2BZIB 1RQQA 3W55A 3UVRA 3BCEA 3HLLA 3UP7A 5K0XA 3BV3A 4UB7A 5J95A 4LM5A 5DN3A 4EOKA 3H4JA 2PHKA 4O7RA 3O17A 5DR6A 4BIEA 3HA8A 2XM9A 5A4TA 3MI9A 5C03A 3DAEA 4LI5A 4DH7A 4O0VA 5H2UA 4CD0A 4FGRA 4OTQA 2QURA 4PTCA 3NRMA 1OKZA 3GVUA 4MVFA 5HNGA 3S95A 3Q4UA 3LCKA 3MA6A 4JNWA 3IDBA 4MCVA 4U3YA 2G2FA 4XOYA 5H3QA 4CG8A 5B2MA 2PZ5A 3EH9A 3NIEA 3QC4A 2IW8A 2BILB 3RPSA 3MFTA 5LVNA 2QD9A 1X8BA 5AUWA 3HMNA 4EHEA 1R78A 3MVHA 2PVLA 3P1AA 3M1SA 3QQLA 4E93A 2GQGA 2F7EE 2OZAA 2UVZA 3LFFA 3CD3A 4QMUA 4C61A 2CKOA 3LQ3A 4NM0A 3D4QA 3POZA 1URWA 3QA0A 5JT2A 1WVWA 3VUMA 4L7SA 4WRSA 3V8TA 5TO8A 2ERKA 2W1IA 4KRCA 3A4PA 5TKDA 4FKUA 5BMSA 3WILA 3OROA 4M67A 4O84A 4FT5A 5CS6A 4GS6A 5BX0A 2PMIA 4IFGA 4FVPA 3TXOA 4FV2A 3Q6WA 3UZPA 3ZUUA 3UIUA 3WIGA 3AT2A 2XIZA 5CENA 4GCJA 2B55A 1DAYA 2O65A 3BI6A 3NAXA 4XG3A 2V62A 4M69A 4HVHA 3LFEA 2R3GA 3DJ5A 4U9AA 4C2VA 1YKRA 2X8DA 3L9PA 3FLWA 4BCHA 5FDXA 2XKEA 4F64A 2Q0NA 2WB8A 3EFKA 3RPRA 4FIEA 3GU7A 3KFAA 4EOLA 4F0FA 1H1SA 3A99A 4WSYA 3WF9A 2JBPA 2BCJA 3PJ2A 4K6ZA 4C4HA 3I5ZA 4C02A 5I3OA 4FTMA 4ZJJA 1FMOE 2GS7A 4RC4A 2IVSA 5AP7A 3Q9YA 3G6GA 3R73A 3SAYA 3E8EA 2SRCA 3GU5A 4BHZA 4ACGA 4EH8A 1VEBA 5M4FA 2VO6A 3OCTA 4OW8A 3MV5A 3N4UA 5TR6A 4YLLA 1CM8A 2FH9A 3FL4A 2IZUA 4DEGA 3GP0A 1FOTA 4KINA 4IACA 3IPHA 4AZVA 3QWKA 4WBOA 4A4OA 2ITZA 4YJQA 3Q4CA 5BNJA 4WHZA 5CQWA 5TT7A 2BKKA 5HLPA 4ZTSA 3FZ1A 4U41A 2Z7RA 3MWUA 4RC2A 5HCZA 3KRRA 3LIJA 3QFVA 4ANNA 4JOAA 5ANJA 2QOQA 1OKVA 4R7IA 4E4LA 4EYJA 4FTJA 5C1QB 1UNHA 3PP1A 4X6QC 1PMVA 2VTSA 4B0GA 3LJ0A 3AD4A 3NYOA 4ZJIA 2PE1A 3PA4A 3R30A 4QP3A 3VIDA 1GY3A 4IB5A 5E92A 3Q32A 4U44A 1ND4A 3FMDA 3RCDA 4QMVA 3BPRA 3LFQA 4GFMA 4J53A 3TZ7A 2V7AA 4E6QA 3HMMA 4QMYA 2G2IA 4ANSA 1WCCA 4DEHA 5IH4A 2VN9A 3U4WA 2YIYA 3SW7A 1ERKA 3W2CA 4IH8A 3LFCA 1LEWA 4KIPA 4I6QA 3R9HA 4M68A 2GS2A 4A4XA 2C69A 4IJPA 4JDKA 4XG9A 4ACHA 3QKMA 5IMEA 1DAWA 3F82A 3CKXA 5JMSA 4DTKA 3E5AA 4CRSA 3MGYA 4RX7A 5AP4A 4ZSJA 2CGWA 5IQEA 1UU9A 2FSTX 3GU4A 3COHA 1JSVA 4G2FA 1PXPA 2GU8A 3HX4A 4ITHA 4DFBA 1B38A 4I20A 1JKLA 3O7LB 3FXZA 1Q8WA 3L8SA 5J1WA 4TYHA 4MNEA 4X7QA 4JLCA 5L8JA 3ZLSA 5DYJA 1IG1A 3KK9A 3OY1A 4DFUA 5ANEA 2UW6A 4I5MA 4OTWA 5EI6A 4H3PA 3UZRA 3KVXA 5LVLA 2XIKA 4M0ZA 5IEVA 4FA2A 3QQKA 1Q8YA 4ZY4A 5DIAA 3W2SA 3FMKA 3EFWA 3NVMB 4R5YA 3RMFA 3ZFMA 2YM3A 4FV3A 3ELJA 2WU7A 5LMKA 3D15A 2PE0A 3PY0A 4CFWA 4HPTE 2LAVA 3D94A 4S32A 2VTNA 3H3CA 3ERKA 3R1SA 3DKGA 3MSSA 1OL1A 3V5QA 5EDQA 4BL1A 4USFA 5IU2A 3NW6A 1B39A 4ERWA 4DEIA 5JGAA 4PPAA 5A4CA 3HRFA 2B53A 3PZEA 4J7BA 3QA8A 2JITA 4NYEA 2GPHA 2YJSA 4W4WA 3DB8A 3WYYA 3EL8A 1PXOA 1OIQA 2CSNA 4IQ6A 5AP3A 3FLYA 3ROYA 4BCKA 2B0QA 1V0OA 4WG5A 3VF9A 4EKLA 2G9XA 4F70A 1Q4LA 4GMYA 4I6HA 4YZ9A 4LQMA 1YHWA 2QOOA 4UWYA 5GJGA 2YCSA 3EKNA 4Q2AA 2BFXA 2XVDA 3JVRA 4ZP5A 3TG1A 1J7IA 2YIWA 4GYGA 2DUVA 3ZFYA 2VX0A 2BZKB 2C6KA 4AP7A 3BGPA 3S1HA 3PVUA 4JDJA 4NWMA 2VGOA 2WTKC 3A7GA 4M13A 4BICA 2GFSA 5FTGA 4FNZA 2PVYA 4WKQA 2BIKB 2WTJA 4FV1A 3R8PA 4O6LA 4BRXA 3WZUA 5EDRA 4F08A 2BRNA 5IH5A 4KSQA 4W8EA 4EH6A 4GT4A 3KRLA 3QTRA 1PRYA 3QQFA 5AAFA 4S2ZA 1FVTA 2JFMA 2QG5A 4L3PA 3QTIA 5CU2A 5K0KA 5AR3A 3G90X 1J91A 2VWZA 1U54A 5L2QA 4AGCA 4C62A 5IZFA 4ASEA 2XK4A 3E63A 3IG7A 1GZNA 2J0LA 5BVEA 4B99A 3AC8A 4CFMA 5M51A 5AA9A 4JDIA 4UX9A 3RK9A 3A4OX 2UV2A 1SVEA 4NUSA 1LR4A 3SOAA 4BCIA 1JVPP 1PXLA 2DYLA 2UUEA 3R00A 4IADA 3G9LX 1XWSA 3KMUA 3DKOA 4FSUA 4JQ7A 4QPMA 2PSQA 5JQ8A 3QTZA 5JZJA 1WBNA 4OR5A 2Q83A 4D28A 5A4EA 2WTKB 5L2WA 5E8XA 4RVKA 3LJ1A 4Z7HA 4G6OA 2NP8A 3SHEA 3UVQA 1SYKA 1TKIA 4PP7A 2PK9A 5KMMA 4P2KA 2IWIA 3BHVA 4C4EA 5DVRA 4RIYA 2PMNX 3RHXA 1Z57A 2XKFA 3VBVA 5CU3A 2ITQA 3IECA 4AOIA 2CPKE 3MIYA 1U59A 4IAKA 4AZSA 4I6FA 4KNBA 3C5IA 3KA0A 4L67A 3P7AA 4RLLA 3BEGA 2CGXA 2OGVA 4RQKA 3EL7A 5ANDA 5JGBA 2W96B 3OWKA 2A27A 4RT7A 2ONLC 1JQHA 2PMOX 4I0SA 3CJFA 4C3FA 3OG7A 3AC4A 3KK8A 2R3NA 2V5QA 5DRBA 3N4TA 4RMZA 2QOLA 3DBCA 3V5PA 4DH8A 5J5TA 2V55A 4KKEA 5CQUA 4HYSA 4BDDA 3UQCA 2QC6A 4W9XA 5FRIA 4ZY6A 3HNGA 4X0MA 3ET7A 4FV0A 3UNZA 3W32A 4I94A 2YIQA 3ENHA 5EOBA 2XIYA 3N51A 4O81A 3UGCA 4XLIA 3MFRA 1H8FA 2VWWA 3ALNA 4XP0A 5LQFA 5DFPA 3VS2A 1Z5MA 4IX4A 3LXKA 1DI9A 2ITOA 4QYHA 2PZIA 3U51A 3SKCA 3VW8A 1A06A 1RJBA 4PWNA 4UXLA 3SA0A 2PVJA 4CLJA 3HV3A 3MJ2A 2IW9A 3TDWA 4ZMFA 3MS9A 5B7VA 2ZAZA 2B4SB 3ANQA 1VYWA 3HRBA 3BIZA 3CIKA 4WUAA 4IB1A 3QF9A 1Z9XA 4M69B 4BDAA 2W05A 1K2PA 2FUMA 4O7VA 3A61A 2BRBA 3HDMA 3KVWA 1XH4A 2AYPA 2PL0A 2WOUA 3PSBA 1FVRA 3FI2A 4RWIA 2WMSA 3HV6A 2FSMX 4FG9A 1YI6A 5CSVA 2C68A 3CCNA 2B52A 3FKOA 4TPTA 4IAIA 4X3FA 3NUUA 3QD0A 2Y8OA 4GSBA 4QMPA 4DEAA 3S3IA 1W98A 3A7JA 4FKRA 4AA5A 1JKSA 1SM2A 4KS7A 4CYJA 1Q99A 3OXIA 3FUPA 3AD6A 5HNBA 4NU1A 3ZEPA 1IASA 1Y6BA 4ZEGA 1YXSA 2ETRA 3QRTA 4ARKA 2YLEA 3U9CA 3CY2A 1XQZA 3PWYA 3QD3A 5AIRA 2JD5A 5D1JA 1WBSA 3W10A 4MKCA 4ZJVA 4QMOA 3IGGA 2Z2WA 2G15A 3QUDA 4FIJA 3TJCA 2EXEA 2XH5A 1JKKA 4BDHA 4MQ2A 3QRUA 1H26A 4EQCA 5LJJA 1G3NA 1XBCA 2C6EA 2G01A 3D14A 4MH7A 3FC1X 4YJSA 3R8UA 1PKDA 3LMGA 4HVSA 2XF0A 1GIHA 3HMOA 1OUYA 4G5PA 5AX9A 5C8MA 5CY3A 4LV8A 3EYGA 4EZ3A 3PVGA 3LKMA 2YZAA 2RGPA 3DS6A 3L9LA 4Z55A 4IMYA 3H30A 4BBFA 5J87A 4ZZOA 4E7WA 2X2MA 3R7UA 2F2UA 1NY3A 4PTGA 1ATPE 2PTKA 4CT1A 4CTCA 1IRKA 4MF0A 3I0QA 3EMGA 3PVBA 3ACKA 3F69A 4XYFA 3V6SA 5CI6A 3QZGA 4DYMA 3UOJA 4UMQA 1Q41A 2C0OA 3IW8A 5H9BA 3EOCA 5KO1A 5GIOE 3JYAA 4MXXA 5I9VA 5EW3A 3OCGA 1XH8A 4ZLOA 2JAVA 4TT7A 4NM3A 5EG3A 4FV4A 4TWPA 2BMCA 3PJ8A 4YSJA 3IQ7A 3VC4A 3PYYA 4ZS4A 1GNGA 3ALOA 4FG8A 2CLXA 3LAUA 4BIBA 3IONA 4QP9A 3ORIA 4QP6A 3FY0A 2GFCA 2FSOX 3HEGA 2Y9QA 3VBWA 2R3FA 3ZZEA 4FE2A 3M42A 4MYGA 2I6LA 3AC1A 1IA9A 3PTGA 3FQHA 1PJKA 4FYOA 4ASDA 5CEPA 3CS9A 4ZLZA 3ZUVA 5AP2A 3DDPA 3UC4A 3U4UA 2Z02A 5CTPA 5CNOA 3H9OA 3F7ZA 3RI1A 4C8BA 3E87A 3T9TA 3V04A 5HE2A 2FYSA 2J0MB 4N6YA 4FTQA 4J8NA 4BKZA 3EZRA 4KKHA 2JLDA 5IA0A 1OITA 3OY3A 3TNPC 2ZOQA 4EH4A 4WOVA 4ZTHA 4QP1A 4FOCA 4R5SA 4C4GA 3FQEA 3ODYX 3W8QA 3FZRA 5I9YA 5HE1A 2QOIA 2IG7A 3O96A 2BHHA 2C5XA 4J1RA 3PPKA 4IZ7A 4WUNA 3WF8A 3DFAA 3HRCA 3QD4A 3ZS5A 4C36A 5A3XA 3R7EA 4DA5A 2OFVA 5EW8A 1FVVA 3F66A 5EHYA 1K9AA 4ZXTA 2OI4X 2UW8A 4MAOA 3FLQA 4F1MA 4J98A 4DAWA 1XBAA 5EQEA 4L00A 3VBTA 2WU6A 5AUYA 4L45A 4DG0E 5BQ0A 4O0YA 3OWJA 4F9BA 4P90A 5IEYA 1JKTA 3RBWA 4U0IA 3OD6X 3Q2JA 4AX8A 2BVAA 3NNWA 2PU8A 5AV2A 5G1XA 2XIRA 3CE3A 4R1YA 2X4ZA 4EJ7A 4H36A 4AN9A 4F1OA 1M17A 1PW2A 4WG4A 4FTCA 4JRNA 1OZ1A 5AV4A 4NCTC 4IVBA 3UIMA 4U40A 4G17A 4O82A 1HOWA 4TNBA 3TV7A 3ID6C 2QLUA 3P23A 5EYCA 4OT5A 3VS4A 1G5SA 5E1SA 2Z60A 3W2OA 4EHGA 4FL2A 3G33A 5BVKA 1OIYA 4EWQA 3R7VA 3QD2B 3LLTA 4F1TA 4IANA 3NYXA 5IEXA 3VVHA 4YJRA 4FEUA 3U55A 4C7TA 1OL6A 3RAKA 2E9PA 3C5UA 5I9WA 1TVOA 5CAQA 3UOKA 4EH5A 4MK0A 4C4FA 4LL0A 1OPJA 4NKSA 5JN2A 2RFSA 4BN1A 4EZ7A 1PYXA 1PF8A 4F09A 3IW7A 4YTIA 4J71A 5EM8A 3CEKA 4OTFA 3GFEA 2X6DA 5BVOA 5CF5A 1IEPA 4U8ZA 2O5KA 4FZ6A 5DA3A 2X39A 2JKMA 4FKTA 2Y4IC 4S33A 5C01A 2VO0A 3ORNA 1I44A 2Z7QA 4YHJA 1VR2A 3CTHA 4L3JA 4IBMA 3H10A 4A9UA 4JDHA 5AR5A 3BV2A 4QT1A 2B54A 4A06A 5E7RA 4TKSA 2CMWA 3MDYA 2C0TA 4Y83A 2C3JA 3TNQB 1UWHA 2JDVA 1OL7A 3VO3A 1MRUA 2ITXA 2YITA 3KN6A 3MB7A 5DPVA 4CFXA 3OCSA 2W4OA 4NK9A 4WIHA 2YAAA 4F9AA 3O50A 5E8ZA 1U5QA 2DQ7X 1NVQA 3H0YA 4A4LA 4BI0A 3BQRA 3R1QA 1RW8A 2O2UA 2E9VA 4PDOA 4F9CA 5IPJA 4GW8A 3C9WA 3U87A 3GOPA 5M09A 1KE5A 4JAJA 5HU3A 4BGGA 3BX5A 3B2TA 3ATTA 3AMYA 3VBXA 3ZSGA 2A2AA 2QKRA 3A60A 2BIYA 4RZVA 5HBHA 4AE9A 3MESA 3IW5A 4WBBB 3QX4A 4HYHA 2Y4IB 3AC3A 4GU6A 4FV9A 4EKKA 3GI3A 5IMXA 2GNGA 4P7EA 3W16A 4FT9A 4D2VA 3MPAA 2I40A 4JBQA 4JT3A 2E9NA 4QYGA 2C5OA 5J8IA 4DFNA 2W06A 1ZRZA 2BZHB 3HP5A 3QHRA 4YJVA 2W0JA 3ZC6A 1OUKA 3DB6A 3LMIA 2W1EA 3W8LA 3S4QA 5HIEA 4O7ZA 2YACA 2ZB1A 5IQBA 3DBQA 5M57A 2PUIA 3A2CA 4FT0A 2XKDA 4OTGA 5CVGA 4CCBA 3R9DA 3EJ1A 2XRUA 1E1XA 3I4BA 5HE3A 2PVKA 4GL9A 5E8TA 4R3CA 2OKRA 5CASA 4G3CA 1L8TA 4IE9A 4XH6A 4NKAA 5CU4A 3DJ7A 2HY0A 3FI4A 3PUPA 4AQCA 4X3FB 2R7BA 4I92A 3ZBXA 4IX3A 4G3DA 5FD2A 1L3RE 3C51A 2GTNA 3OWPA 4M14A 5EFQA 3ORZA 4XOZA 4B4LA 4FTLA 4O7NA 4C33A 3ACJA 5FEEA 5HEZA 4BZNA 4C35A 3SG9A 1JSUA 1H1QA 5IUIA 4ZMEA 4GK4A 2ZJWA 4FSRA 4O0UA 2VWYA 3KKVA 5HCYA 2C5VA 3VUKA 2HWOA 5ANIA 1H1WA 2XJ2A 2UZTA 3AT4A 4YO4A 3MTLA 3NW7A 5K4IA 2FA2A 5EKNA 5E9EA 4EK5A 5ICPA 4O0XA 5CT0A 1IA8A 3GQIA 3DBFA 3MVJA 2W17A 4AE6A 4KB8A 4CFFA 4X2JA 4QQJA 5HBJA 3DFCB 2UZOA 4CMOA 2XMYA 1Q8TA 4YC8A 2X9EA 4FTRA 4CKIA 4L7FA 1SNUA 3I6WA 1YOJA 3R22A 3BRBA 5IQFA 3DAKA 4K11A 4RJ7A 3F3VA 1ZZ2A 3KXHA 4GIIA 2QO7A 3R7GA 3RPVA 5J7HA 3SVVA 3DLZA 5HG7A 2PPQA 5DBXA 3QBNA 1WBWA 5HD4A 4DEDA 3P86A 3TEIA 5LARA 4E4NA 5HVJA 5JEBA 4BTKA 2XA4A 1XJDA 2VO3A 3FDNA 3MY1A 3RPYA 2BALA 2O64A 4PL5A 3V3VA 5CANA 4EOJA 2C3KA 1YHSA 2H9VA 3C50A 3PE1A 5IA5A 4RIXB 5AM6A 3ZHPC 4YC6A 5D12A 5L3AA 2WMQA 3I6UA 4KIKB 5ANOA 1ZOHA 4B9DA 4EI4A 3MIAA 3CPBA 3OF0A 4D2WA 2HYYA 1BI7A 1R1WA 3LQ5A 2XCHA 1JPAA 2HXQA 4UXQA 3FI8A 4KAOA 4FTUA 4MD8E 4U81A 3MYGA 2R3OA 4G34A 4LOOA 4O22A 5BPYA 3F2NA 4GVJA 4RIOA 4U97A 4D4SA 3PA3A 4O7SA 3BHHA 1Q3WA 4H39A 3SLSA 5GZ8A 2A1AB 3FC2A 3SQQA 4XLVA 3Q52A 5ETIA 4APPA 2QLQA 5J9YA 2UW7A 3FQSA 3VAPA 4TWCA 3ZSIA 3V5LA 4EC8A 3FZTA 1ZYCA 4GG7A 5EQYA 2BAJA 2CGVA 4FKQA 4RJ4A 5CF4A 3QUPA 4G3GA 4FIIA 3KRWA 1PY5A 4RJ8A 4AGDA 4XNEA 3R0TA 5DR2A 4QRCA 4YJTA 2QODA 4OGRA 5CNNA 5JSMA 5BVFA 4QTBA 4FGBA 3PJ3A 5JH6A 3TTIA 3NLBA 4QMLA 1FINA 2RG5A 5CEQA 5J9LA 4IWQA 4O21A 2R3MA 1ZYLA 4BBMA 3WZKA 5DOSA 5FEDA 2WGJA 4G6LA 3DNEA 4L44A 3TZ9A 2B7AA 4XG6A 4XRJA 4DGOA 5EQPA 3ITZA 1GIIA 2BRMA 4GRBA 4BZOA 5EKOA 5IDPA 5FG8A 4FBXA 3QUEA 3D7TB 5ETAA 1WAKA 4K8AA 4JQEA 2OJGA 4BB4A 4D58A 3Q4TA 4USEA 3UODA 4OTDA 4L52A 4R1VA 5HKMA 4C37A 3K5VA 5AUZA 5HLNA 2W5AA 4L01A 4RX8A 4FSZA 5I9XA 1G8SA 4LRMA 3NUXA 5CT7A 4I3ZA 3A7FA 3TUBA 5EK7A 2YCRA 2PUNA 5EHLA 5IF1A 2GQRA 3UDBA 3QX2A 4O0WA 1GJOA 2OW3A 3F2AA 5E90A 1ZOEA 3UPZA 2C6TA 3KREA 3BHTA 3BEAA 2XBJA 3C4EA 4DN5A 5DEWA 4LUEA 4EH3A 2YERA 4M97A 4XMOA 4HZSA 3F6XA 4AGUA 4CFUA 4RLKA 4DH3A 2OJIA 5C9CA 1P2AA 3L1SA 4OLIA 2HOGA 2OJ9A 3BYVA 3R01A 4IM2A 5E8UA 5AP0A 2QHNA 5HD7A 4R77A 4GU9A 3FLSA 1IR3A 4FL1A 4Z3VA 2Y0AA 3WF6A 2O3PA 3MH0A 4TXCA 2R3LA 2Y6MA 5ETFA 4RJ5A 4ZTRA 5E91A 2I0YA 4M8TA 2C1BA 4QMSA 4CT2A 3AXWA 3MVLA 4AZEA 4KBCA 2RG6A 2JDTA 5B2LA 4YJNA 3NUYA 2O63A 2PVNA 3G51A 3TV4A 4BKYA 2I7QA 4PV0A 1ZY4A 3EN6A 2HZ0A 4YLKA 2UZLA 1E1VA 5L2IA 4CG9A 3GBZA 3H0ZA 5E8YA 4BDBA 2F9GA 4C3PA 3PXFA 5AIKA 4DGNA 4JX3A 2C5YA 4RVLA 3EYHA 4V05A 3FEGA 5HCXA 3GT8A 1XH7A 4J99A 2GCDA 3QCSA 5T6KA 3RCJA 2YWVA 2QCSA 5HVKA 1SMHA 2XS0A 1VJYA 3C13A 3VHKA 5CU0A 4OAVB 4IJ9A 4PTEA 4QNAA 4RX9A 1WVXA 2NRYA 3R02A 4G9RA 3T9IA 4CV8A 1A9UA 3DK3A 5HIDA 1SNXA 3NUAA 2CCHA 3HV7A 4ANBA 1QPCA 2WFYA 2XK9A 4PDSA 5DG5A 4RIWB 5EHOA 4F0IA 2J7TA 2G2HA 4BVUA 2CNVA 4D5HA 5HLWA 4S31A 3NS9A 4P5ZA 2GTMA 4YSMA 4CLIA 1NW1A 1S9IA 3UOLA 4WG3A 4LMNA 2BTSA 2OF2A 1XO2B 4HCTA 2GS6A 3Q9XA 5AR8A 3DXNA 2IN6A 4NL0A 2BAKA 4ZTLA 3FL5A 2W1ZA 5HG8A 5L2TA 4BR3A 3PRFA 3VQHA 2XB7A 1JSTA 3HGKA 4WNOA 5JFVA 4RC3A 5I3RA 3TUDA 4PY1A 1Y6AA 3DQWA 2F2CB 4RWLA 4CVAA 5KMNA 1Q8UA 4K33A 3TNHA 4ANOA 5I9ZA 2ITWA 3ROCA 2E2BA 5F4NA 4TTHB 1F3MC 2XNBA 4LGDA 4D4YA 3F2RA 4R78A 4FT7A 3ZFXA 3NAYA 4I93A 4FSNA 3MPMA 2YDJA 1SVHA 2C1AA 4QMTA 1ZMUA 3IDPA 4JQ8A 1YXUA 2XKCA 3MY5A 5I4NA 3BHUA 4RGJA 3LE6A 4QMQA 5HI2A 5DWRA 2HENA 4QMMA 5JRSA 3R9NA 3HV5A 4RPVA 3RZBA 4EONA 1YW2A 4RBLA 3Q6UA 4AWIA 3OBGA 4QMWA 2BKZA 4FKWA 4FVQA 3GNIB 2WEVA 2GDOA 3REPA 5IA4A 4FL3A 3ZO1A 3I60A 5LMAA 4XG4A 4YZMA 4JAIA 4K9YA 3TUCA 4YTHA 4KIOA 4AS0A 3P4KA 1CMKE 3E62A 4AA0A 4EHZA 4F6UA 4PPCA 1OBGA 4IW0A 3QZIA 2PVMA 2XZSA 4RFZA 4BBEA 5DT3A 4I21A 4TZRA 3C4XA 3R2BA 2W5BA 4IX6A 4LL5A 5DMZA 1TQIA 3SRVA 3R21A 1SZMA 3KF7A 1J7LA 3C0GA 2ZV7A 2YAKA 2F7XE 1ZXEA 3CBLA 2H6DA 1H28A 1P4OA 2VV9A 4W9WA 5D11A 3ZRMA 4EQMA 3DDQA 4XP2A 3FZSA 3JY0A 4PNIA 2YCQA 5E8SA 3FLNC 4GH2A 1OPKA 2RF9A 2VTMA 5J7BA 4EJNA 1ZAOA 4AAAA 2EB3A 3NCZA 2NNWB 2VWUA 3ODZX 2QVSE 3LJ2A 3R71A 4I4EA 3R83A 4DTBA 1YXTA 5A54A 3EZVA 4LMUA 4WRGA 3BE2A 4DLJA 4G3EA 4IC7A 5KMIA 4D1XA 5FXRA 4I1ZA 4KBKA 4FZ7A 5H8BA 2JAMA 5FDPA 4GKIA 1O6LA 2XP2A 3DZQA 3IW4A 4JX7A 4CQEA 4JIKA 1BLXA 2UZUE 2EXMA 3RKBA 4O2ZA 3PSCA 3FHRA 3IO7A 3HAVA 5FLFA 3UBDA 4DINA 2VNYA 3TV6A 1HCKA 2O8YA 3BYSA 3IK3A 5LMBA 3FE3A 2R3PA 1NVSA 3V8WA 4ANLA 5HTBA 4IZAA 5A6NA 4HYIA 2OF4A 4ZSGA 3F88A 3GEQA 3NCGA 2BTRA 1ZMWA 1U5RA 2J0IA 2OIBA 1DM2A 2OU7A 3PPZA 3DBDA 4OTPA 4S30A 4Z7GA 2X1NA 3F5UA 4S34A 4BDJA 4U5JA 3G0EA 4YU2A 5HGIA 3GOKA 4L6QA 3VJOA 1GZ8A 3UYSA 4EH2A 1P14A 4TWNA 4HGEA 3LM5A 4IXPA 2HY81 3PY3A 3GCPA 2C6IA 1YDRE 2AC3A 3KULA 4C0TA 3JXWA 4XS2A 4QTEA 3DKCA 1BUHA 4NIFA 3SXFA 4BCOA 4DH5A 2X6EA 3IOKA 4AA4A 4BI2A 2VD5A 3ZC5A 4R7HA 3NZ0A 4WA9A 4YZBA 1QPJA 2ZM1A 2PVHA 2IVUA 4IVAA 5IUGA 4MD7E 3MTFA 4X3JA 3TIZA 3CKWA 2QOHA 2OZAB 4NJ3A 4AGWA 4Z16A 4BTFA 3PLAE 3OW4A 2EB2A 4BDCA 2XNNA 4QYEA 3JUHA 2HCKA 4AF3A 5IQIA 4QP7A 3S2PA 3OVVA 3P08A 4IX5A 3BGQA 1OVEA 4J8MA 5JFXA 4GK2A 2YJRA 3RK7A 4EYMA 1H24A 1NVRA 1KWPA 1UU3A 5EYKA 3WBLA 1J3HA 2W99B 4YUQA 5GHVA 2IVTA 3MB6A 5D41A 4BCGA 4O0SA 3HYHA 4YZDA 2C0IA 1M2QA 4L9IA 1H25A 1M7NA 2BDJA 4YPSA 1WMKA 2J4ZA 4APCA 1H4LA 2JDSA 3PJ1A 3LPBA 2C3IB 4DLIA 2VWXA 3NSZA 3OUNB 4EH9A 2P0CA 2CKEA 3SG8A 3ZRLA 1UWJA 2VTPA 4A9YA 2QQ7A 3RZFA 3WIKA 2WQNA 2OIQA 3G2FA 4JRVA 4OTRA 4R8QA 3UNJA 3VUDA 4ACMA 1UA2A 2JBOA 4IAZA 1OECA 4BWKA 3GB2A 2YHVA 3HKOA 2VTHA 2Y4PA 4V0GA 4ZOGA 1LUFA 2QNJA 2VNWA 3D2IA 1OMWA 4FSWA 3W1FA 3B8QA 5AP5A 4XBUA 3PIYA 4CNHA 3BYMA 3PWDA 3OW3A 3DXPA 3NVKI 4FVRA 1NA7A 2X9FA 2YA9A 2VGPA 1ZWSA 1F5QA 4FMQA 5KZ0A 3QRKA 3R8VA 2VX1A 4FKLA 3TKHA 2DS1A 3PY1A 3OBJA 3DCVA 5D9HA 2J0KA 2YFXA 4AOJA 2WPAA 5KUPA 3E92A 2BFYA 4FK3A 3L8XA 5IG1A 2Z7LA 3LXNA 1OBDA 5A46A 5CZIA 2CKPA 5KMJA 3ULIA 4UBAA 2J50A 3F3WA 4U3ZA 3ZCLA 1F0QA 4IWDA 5CU6A 3DQXA 5D7VA 5HO8A 2H8HA 2XK6A 3FBVA 3T3UA 2C3LA 5BUEA 5CAVA 3U6HA 4YZNA 5I0BA 4YBKA 1UU8A 2FSLX 3EQBA 1ZY5A 3PZHA 3R7IA 5M44A 1YQJA 4EOIA 4F9YA 4FEVA 3ORTA 4C3RA 3EFLA 4G16A 2CGUA 3PIZA 1NT2A 2YCFA 4NFNA 5ANKA 5AADA 5A9UA 2PUPA 5L8KA 5LWMA 5CF8A 1KUTA 5FBOA 3FV8A 3UZTA 3D9VA 2RFEA 5FGKA 3FPMA 1YDTE 4UWCA 2X7OA 3SXRA 1REJA 3FPQA 4B8LA 4FV7A 3ZZWA 1GIJA 2XK8A 5KBRA 4DGLC 4WNKA 4DBXA 5LMKC 1KSWA 3FMEA 3IGOA 4PMTA 5BVDA 2CJMA 4YHFA 1CKPA 1DS5A 2Z7SA 1CTPE 1O6YA 2A0CX 3H9RA 4M7IA 4H3BA 1V1KA 3DNDA 1H00A 3B2WA 3QXOA 5KBQA 3MH1A 3PLSA 5DEYA 5EM6A 1T46A 3P79A 3ZLYA 4E6CA 3Q3BA 4EORA 4FUXA 4JG8A 3UG2A 4XRLA 4I5PA 3TIYA 4CZYB 4U43A 4HVDA 2B9FA 3NYNA 3AGLA 3A7IA 4NW5A 5CSXA 2VU3A 2FVDA 5GZAA 3IKAA 4MNEB 4TYHB 3ZRKA 2KTYA 4HGTA 2I1MA 2R3KA 1W7HA 3BLQA 3D83A 3EQRA 5CSHA 5KZIA 3EN9A 5T68A 4BZDA 4F7JA 1ZMVA 5T3QA 2IZSA 3FWQA 5AV1A 4D9TA 4N0SA 5F95A 4KA3A 3VRYA 3VWAA 1UNLA 1B6CB 4UMRA 4GEOA 4PQNA 5EM5A 2RFNA 2WMWA 4AU8A 4CRLA 4FG7A 4AACA 2J2IB 2YDKA 2XEYA 4U42A 4ZZNA 3LFAA 1VYZA 4CSVA 1FMKA 2XK7A 5LCJA 1GZOA 4TYGA 4XV1A 5H8EA 2UZBA 2R9SA 4JG6A 1W82A 4PDPA 3U6IA 2GHGA 3R1NA 3CPCA 3DKFA 4FKPA 4CXAA 4E4XA 2ITPA 3DJ6A 3OUKA 5M53A 2OG8A 3I5NA 4QP2A 4FEXA 5IQAA 2A4LA 5HO6A 4EOPA 4I41A 3D5VA 3FJQE 3H9FA 4EK6A 2X2LA 2X8IA 3HA6A 4QD6A 1QMZA 4G9CA 4RJ6A 3GCVA 3AMBA 2UZEA 4J97A 4TNDA 3ZO2A 2VTQA 2F7ZE 2IO6A 3MBLA 5LOHA 3UC3A 5AR2A 2YWPA 4CZTA 3T3VA 1H1PA 1Q97A 4HOKA 3QTUA 3BU5A 3BE9A 2OZOA 3PFQA 4U80A 1ZLTA 4TYIA 2OO8X 3BBTB 3D2KA 3E88A 3LFDA 3Q9WA 3TZ8A 5LXMA 4IAFA 5F9EA 2JKKA 3RM7A 2IZRA 4NFMA 4AUAA 4KWPA 2W9ZB 3HMPA 2PVRA 4UY9A 1XBBA 4BC6A 1JLUE 3OMVA 5EM7A 2XUUA 2VTRA 5CEMA 2ZDTA 4OAUC 3HECA 2QG7A 2VTTA 3GCQA 3VRZA 4HYUA 4D9UA 3C4CA 2OBJA 3AGMA 4ZSEA 3ETAA 5TF9A 5HG5A 4XHKB 1GZKA 3QU0A 3ZEWA 2WMXA 3D0EA 5CZHA 3KRJA 1J1BA 1H07A 2EXCX 3EQFA 3EQDA 4IM3A 2KULA 2RFDA 3PG3A 3ZLWA 1U54B 3MN3A 3Q2MA 5KHXA 4YNEA 5HORA 3K54A 2VO7A 4EK4A 4Y5HA 4O86A 3MY0A 4AW0A 4FODA 2C4GA 2UW9A 1BI8A 3Q5IA 4D2RA 4TWOA 4F99A 4D55A 1Q62A 4ZS0A 3ZUTA 1O6KA 3ORKA 3Q4ZA 2NO3A 5E8VA 3FMLA 4ZLYA 3L9MA 2XEZA 3DTWA 4ZIMA 2BAQA 2X8EA 3LCDA 3OXZA 3PA5A 2BUJA 3MVMA 3JPVA 4I4FA 3OTVA 1M14A 5FWKK 3MW1A 4W8DA 3UE4A 2UZVA 2CHLA 3M11A 2HW7A 4FUYA 4JG7A 2QOCA 3NUPA 2NPQA 4RIYB 4FV6A 2OSCA 3TWJA 4FKSA 4BDFA 3ZBFA 3UIXA 5AV0A 3V51A 4FR4A 4E20A 4BCMA 3NEWA 4OBQA 4QQ5A 2J5EA 2P4IA 4GVAA 4MF1A 4DITA 4ITIA 3DK7A 4NH1A 3BYUA 2ZB0A 4I5HA 4L43A 4TW9A 3SD0A 4CCUA 3UTOA 4ENXA 3GQLA 3BLHA 5HBEA 5AJQA 4AN3A 3FMNA 3KULB 1H0WA 2OFUA 4HNIA 4E4MA 5HO7A 4UZHA 5CVFA 2JIUA 5CAPA 1M2PA 5AP1A 4C2WA 1E9HA 4G31A 5GZ9A 1M52A 5CVHA 3R8ZA 4J52A 3V5WA 2W1HA 4IWOA 1ZARA 4YLJA 3WI6A 5FQDC 1PMNA 3QLGA 3OTUA 4FEQA 5CSPA 5A4QA 3MFUA 3COKA 2JFLA 1PXJA 2UVYA 2RSVA 2WHBA 3QYWA 2BDFA 4Q9SA 5FXQA 4YMJA 4OTHA 4FV8A 2JGZA 4X3FC 3TACA 3LXPA 4HW7A 3I1AA 3WYXA 1YDSE 3UO5A 5HICA 4DE4A 2XYUA 3O7LD 4NEUA 5ACBC 2QOBA 2R0IA 5AUTA 5IA2A 3R9RA 5C8KA 3LMHA 4Z9LA 3ZXZA 1WBVA 4G6NA 5HVYA 2WZJA 3TL8A 1BMKA 4CFNA 4ID7A 5JGDA 2G1TA 4UMPA 3UOHA 4M66A 4FNXA 2J51A 4GG5A 4B8MA 3OEFX 4H58A 4H1MA 4F6WA 4CKJA 4DT9A 1FPUA 3BELA 3DTCA 3S0OA 4W4VA 3AOXA 3LLAA 4PX6A 5HOAA 5JZNA 2GNHA 4YBJA 3QHWA 3W18A 3VUHA 4D2PA 1Y91A 4MEDA 4YPDA 4F63A 4QO9A 4OBOA 4AFEA 2I0EA 5M07A 3OT8A 5IH6A 1KOBA 4O7TA 4F0GA 4QQCA 5CEKA 3HUCA 4GJ2A 1UKHA 2P2HA 2WMUA 4FTOA 3RHKA 4FTNA 1UVRA 3O8UA 3EWHA 2WQOA 3VUTA 2WQEA 4E1ZA 2YISA 1KE8A 3ZH8A 4M84A 5M55A 5FTQA 2B9JA 4QNYA 5AMNA 4EL9A 4K1BA 4CMUA 3GC7A 4JS8A 3GC8A 4MD9E 3KC3A 2EUFB 1BL7A 1PYEA 1YVJA 2WELA 3QLFA 3FSKA 3VUIA 3TI1A 4RG0A 5BVNA 5IISA 3BU6A 4X2NA 2PZYA 4ZTQA 1Q61A 3L8PA 5IQCA 4U7ZA 2XJ0A 2ACXA 1OB3A 3MA3A 2J6MA 1JBPE 4ITJA 4C4JA 2QU6A 5AUXA 2IZTA 4CMTA 4TL0A 2B1PA 3AMAA 5L6OA 5M56A 4IEBA 4P4CA 5FEQA 1S9JA 4ZSLA 2HELA 4ZK5A 2YM4A 5LVPA 3WE8A 4GIHA
chains in the Genus database with same CATH superfamily
2YM7A 2WMRA 2P33A 3NGAA 3VHEA 4DG3E 2UW3A 2VRXA 2UZDA 4C57A 1OKWA 4F6SA 5HZNA 3QCYA 2X0GA 2CNQA 5DT4A 4DGMA 1OGUA 1ZYSA 2GMXA 4WD5A 3AQVA 3L9NA 4KRDA 3LCTA 2UVXA 1Y57A 5F20A 4FZAB 3VS0A 3U9NA 3JR1A 2WIHA 4H05A 4ACCA 4RWKA 2OK1A 3E3PA 3CXWA 2Y6OA 2R0UA 5GJDA 1O9UA 5L6PA 4D4RA 4X2KA 4QPAA 4JXFA 4LYNA 4DBNA 4HVIA 1BL6A 1QL6A 1R3CA 2PVFA 3LOKA 4IZYA 1M2RA 3ULZA 4L53A 2C47A 3O8PA 1MRVA 4X6RA 2XBAA 5CAUA 3TM0A 2JDOA 4NTSA 1UU7A 4IB3A 3G6HA 4C59A 1J7UA 2Q0BA 3P0MA 1QCFA 1U46A 4IIRA 4BI1A 5LCKA 4QMNA 3KCKA 3LVPA 4RA4A 3AKLA 3K3JA 3Q53A 5JFWA 4IVDA 3OT3A 2R64A 4L68A 4LRKA 1MUOA 3LCOA 2OH0E 1Y8YA 3VF8A 5LWNA 3NWWA 4JL9A 2PZPA 2AUHA 3M2WA 3EN5A 3O23A 4MBIA 3CTJA 2VTJA 2WQMA 1GOLA 4ZAUA 3F5GA 2ITVA 3I7CA 5CLPA 3A8XA 4MXYA 4BCFA 3RVGA 3MFSA 5KMKA 3ZO4A 1PXIA 3LFNA 4JR7A 4GYIA 1XKKA 4E5WA 3U8WA 2RIOA 1WBTA 2HZIA 2YN8A 4IM0A 3SV0A 4ENYA 3FAAA 2WTVA 1Q8ZA 3ZXTA 4DFYA 3HV4A 3BLRA 2QR8A 3QQGA 1KE9A 3JY9A 1WBPA 3KGAA 5DT0A 4CFVA 4JVGA 2WO6A 3ZYAA 5IA1A 2GNJA 5FM3A 1LP4A 1W84A 3EIDA 3BWFA 3PVWA 1Y8GA 4MXAA 2WKMA 4AN2A 2ONLA 2ITYA 1YWNA 5DE2A 3CGOA 3GC9A 4WNMA 4BKJA 1A48A 4C38A 4MQ1A 5ETCA 2BDWA 3E64A 2BROA 4O7LA 1CSNA 2VWIA 2BPMA 2CNUA 5HX6A 3IDCA 4D0XA 2NRUA 1ZOGA 4GFOA 4RSSA 4PRJA 5BYZA 3ZO3A 4H3QA 3TNWA 5KX8A 1YOLA 2W1CA 3R28A 3R1YA 5ITAA 3A62A 4BHNA 1QPDA 5BYYA 1SVGA 2JIIA 3QWJA 4ZZMA 2E9OA 2XJ1A 3UQGA 4MBJA 4TYEA 5KHWA 5LVOA 1TQPA 4LFIA 1PMEA 3K3IA 5M08A 1KE6A 1TQMA 2J9MA 3K2LA 4AZTA 2BRHA 4EQUA 4QP4A 1H0VA 3BL9A 3JVSA 4ZSAA 4BF2A 2EWAA 5EOLA 4NZWB 3SW4A 3NUSA 4HGLA 2H34A 4F7SA 4QYYA 4DH1A 3BKBA 2W1FA 2JDRA 4DEEA 3KU2A 4YTCA 2J90A 3UQFA 4X2GA 3W2QA 4D0WA 4A9TA 4FTTA 5AM7A 5CYIA 5AUUA 2QI8A 3G9NA 1R0PA 3TKUA 4H1JA 3I81A 4KIQA 3VS1A 5EDPA 3OOGA 3KB7A 4Y5QA 4N57A 3QTSA 3C4WA 5CSWA 3CJGA 4FSMA 4DHFA 5IUHA 1KE7A 3C0IA 5AEPA 4I23A 3VBYA 1YI4A 4AW5A 4GFGA 2E9UA 1MQ4A 4DGGA 5JQ5A 5J1VA 1V0PA 3QRIA 3QZFA 3NUNA 2A19B 4O27B 1XH6A 4RWJA 4A9SA 3TCPA 1KV2A 3I7BA 5HX8A 3QCXA 3TJDA 3OHTA 4G1WA 2OIDA 5DR9A 3TN8A 1APME 3R9OA 4ZTMA 4O83A 4QQTA 1OI9A 4BCNA 2WIPA 2OWBA 3HZTA 4N70A 4WT6A 5K3YA 4EC9A 3W2RA 4ERKA 4Y72A 3S00A 3UJGA 4ALUA 3KF4A 4YTFA 2VTIA 3AC2A 4IWPA 4QYFA 4A7CA 3FI3A 1W83A 2WMVA 5GJFA 4E5AX 1J1CA 2PWLA 3N9XA 1OIUA 4RJ3A 4EOMA 4ZY5A 4O4FA 3O2MA 4GK3A 5TE0A 4YP8A 5IQGA 4BCQA 4EK8A 4K18A 3I79A 4FKIA 3POOA 2XANA 3TKIA 3CLYA 2XNEA 3RNIA 3WZEA 2WTCA 3EB0A 4RFMA 2VZ6A 2O0UA 2JIVA 1PMUA 3BQCA 4F9WA 2ESMA 2PULA 2ETMA 2YM8A 4DHZA 5A6OA 1AGWA 3DOGA 1FQ1B 2XIXA 4I5CA 2VTOA 2YM6A 4NT4A 3C1XA 4DFXE 4L42A 2P3GX 1P4FA 3V5TA 4FIHA 2ZV2A 4UYAA 1VZOA 4IHPA 4Q5EA 2XRWA 2WAJA 2H96A 3PRIA 5AV3A 3PXYA 4DC2A 1URCA 4FV5A 4U45A 4YO6A 4MWIA 4O96A 1V0BA 3RAWA 1U4DA 3ZLXA 5HESA 3F5PA 4FTKA 1OL2A 3UDSA 3OS3A 4D1ZA 3F3TA 3FMMA 4W4XA 3EQPA 3UG1A 4D1SA 3LM0A 4O91A 4FSQA 3WZDA 2YEXA 2R5TA 4M3QA 2VUWA 4NTTA 4GT5A 3CSVA 3E7OA 4FEWA 3IS5A 2ITUA 2ZV8A 3SGCA 1T45A 4N4SA 3C4ZA 3RJCA 4JBOA 4I6LA 1PKGA 2CCIA 3EN7A 3FXXA 2HWPA 4FSYA 4L8MA 2X2KA 4O1PA 2F57A 2RKUA 3R6XA 3NIZA 3R04A 1DI8A 2OXYA 2IVVA 2AEGA 2AQXA 3Q5ZA 4DFZE 5I5ZA 4MX9A 5B0XA 3KRXA 4BJJA 5GIPE 3KXZA 3FLZA 3QGWA 4B6LA 2GSFA 3QXPA 1WBOA 3AD5A 3LXLA 4EK3A 4CKRA 4I22A 5HNIX 3EQIA 3KL8A 4IDVA 2XCKA 2WMAA 4Y73A 1Q24A 3ZDUA 5K4JA 4JMQA 3HVCA 5A14A 4KBAA 4XV9A 4LUDA 3BU3A 4YGAA 3CP9A 4RA5A 3QZHA 5FP6A 3OFMA 4FI1A 4MTAA 3HAMA 3COIA 5IQDA 2IPXA 4AT4A 4Y8DA 3PXQA 2PUUA 2EVAA 3VBQA 1OIRA 1XH5A 2R3QA 3SOCA 4I0RA 3O51A 3ZM4A 3QTWA 3DV3A 4GV1A 4AW1A 2LGCA 4FYNA 4BFMA 4FZFB 4JR3A 3PDTA 4AT5A 4E3CA 2ITNA 4CGAA 4FZDB 2X7GA 3D7ZA 3WF7A 3EQHA 1OGYA 4II5A 2OICA 3W2PA 2JEDA 4XV3A 4PMMA 4WO5A 5FM2A 4AOTA 4O0RA 2HZNA 4QP8A 5KE0A 5BYLA 3IW6A 4LRJA 3V5JA 2REIA 3G5DA 5KKRC 2IF8A 3KY2A 5L6WL 2WEIA 3UPXA 4E26A 4MNFA 1UKIA 5ACKA 3QKLA 3P7BA 5HE0A 3UIBA 4I6BA 2PMLX 3VN9A 3EQGA 1PHKA 2CDZA 2X81A 3DBEA 4PUZA 2JKOA 4NCTA 3KXNA 2GNFA 3WZJA 3G15A 4EOOA 4FKJA 3DU8A 2ZM3A 5JRQA 2CKQA 4DT8A 3NNUA 3BZ3A 4P5QA 3ZMMA 3NFGB 3RALA 5IKWA 1CDKA 4KABA 3ZONA 3DT1A 4E73A 1WZYA 2VWVA 3QCQA 5H8GA 3DA6A 5M4IA 5AUVA 4RRVA 5CX9A 3ANRA 5HG9A 2PYWA 4R6VA 4ORKA 4DF3A 3KQ7A 2C6DA 5F1ZA 3PP0A 1MRYA 3C0HA 3DXQA 4W4YA 4EBVA 1R0EA 3KEXA 4D5KA 3ZTXA 3MH3A 2Y7JA 4HVGA 3FKLA 5K9IA 3CD8A 2R3IA 4UMUA 5M4UA 2XM8A 4QOXA 5KKRB 4XV2A 3QGYA 4ANMA 5CEOA 3GCUA 5AP6A 4EUUA 4I24A 3RWPA 3TDVA 4ASXA 3OCBA 4U6RA 3VUGA 1GAGA 1W8CA 2VTAA 2ZYBA 3C7QA 3FZOA 5JKGA 2CN5A 1MP8A 1K3AA 3VJNA 5AAEA 3PIXA 4RX5A 4ACDA 4AW2A 3CGFA 2HK5A 2ZMCA 2WQBA 2V0DA 2HAKA 1P5EA 2UZNA 2WTWA 1OPLA 5L8LA 4NM5A 2WMTA 4FC0A 4YC3A 3GCSA 4CYIA 2PE2A 4PL4A 4FOBA 4M0YA 4D2SA 1BYGA 3OZ6A 3E8NA 3F7WA 3TYKA 4MHAA 3LHJA 4AFJA 1CKIA 2ZV9A 4AT3A 3BWJA 2YIXA 4QMZA 4ONAA 4DFLA 5AFVA 2BRGA 2QO9A 3W0PA 2OJFE 3HL7A 4OT6A 4BDKA 4EH7A 1RE8A 2QONA 2VTLA 2ZFYA 4RVMA 4XJ0A 2HIWA 3PXKA 1AQ1A 3GFWA 4X21A 3OEZA 4XBRA 3V01A 5AAGA 3KCFA 4HCUA 2WNTA 4BIDA 4AZFA 3ORLA 4QTDA 4CTBA 4PF4A 4RQVA 4KS8A 4LG4A 3OWLA 4U79A 4V04A 1YWVA 5C4LA 3KXGA 2WMBA 4FT3A 2ZDUA 5L4QA 1JAMA 5HU9A 4RFYA 5CWZA 1Q5KA 4MWHA 2J0JA 2FGIA 5I9UA 3E8DA 4DCEA 3KXXA 4O6EA 5KCVA 4USDA 4F65A 3W0NA 2OXXA 5HTCA 1OM1A 2JKQA 5CI7A 5L2SA 3QQJA 3O8TA 4DCAA 4JI9A 4K77A 2W4JA 4XEYA 5J79A 3VS5A 3CQEA 5AA8A 2R2PA 3KMWA 4KKGA 2FO0A 3WE4A 5KMLA 3RTPA 1XMLA 2ZVAA 3F3ZA 3FYJX 3CY3A 2ZM4A 4TRLA 2B9HA 3TT0A 2IW6A 4FTAA 4BDEA 3NMUF 3DLSA 5C8NA 5FP5A 3DZOA 5K5XA 5AWMA 5IDNA 3R2YA 4FKVA 2XARA 4LV5A 4O4DA 3Q60A 1FGKA 5BUJA 1ST4A 2I0VA 1AD5A 3WARA 4KUJA 3NPCA 4PNKA 5LVMA 3IOPA 3GGFA 2Z8CA 3CC6A 1Q3DA 3VS3A 1R39A 2WOTA 4O1OA 5BMMA 4RIXA 4BGHA 3Q9ZA 2OLCA 3KN5A 1YWRA 3TTJA 4KIKA 4BYJA 1G8AA 5CF6A 2ITTA 1FBNA 2HZ4A 4DDIA 3GU6A 1WFCA 3EHAA 3RK5A 2F4JA 5CXZA 4ALWA 1RDQE 3D5XA 4R3PA 4BCJA 4BY9E 5HQ0A 4XG2A 4PMPA 2BZJA 5E1EA 1XR1A 2ETKA 4C4IA 5KMOA 4V01A 3VQUA 4LOPA 3FHIA 3LFBA 4WSQA 5EYDA 4O7YA 4GUEA 2C6OA 3R63A 1REKA 1H27A 2V7OA 4X2FA 4ANQA 2J5FA 2P2IA 4ALVA 1YOMA 2ERZE 3F5XA 2UW0A 5EH0A 2W9FB 5GINE 4BCPA 5B2KA 5EYMA 4CV9A 3QAME 5G6VA 4BDIA 3Q04A 4FIFA 2C30A 3ENMA 3QYZA 2AC5A 3PXRA 2C6LA 5ANGA 4YHTA 2V22A 3CTQA 2PY3A 3FZPA 2XNPA 3HDNA 4HPUE 3PPJA 4JIAA 3RM6A 4LGHA 2X4FA 2UZWE 2YM5A 5M06A 2VX3A 4L46A 2C6MA 1LEZA 3CQWA 4PP9A 4BWXA 3QRJA 4QPSA 5BVWA 2WTDA 2CLQA 2QHMA 3UO6A 3LW0A 4UN0C 4M12A 2VWBA 4R3RA 5CALA 4UWBA 3UVPA 5K5NA 4O7WA 4PPBA 1KV1A 3MH2A 2OJJA 4I0TA 3DK6A 4F7NA 3D7TA 3D5UA 3VW6A 3MJ1A 3UO4A 4IC8A 4IZ5A 2R7IA 5C4KA 3ZDIA 4UEUA 4XG8A 1PXNA 5GNKA 4GUBA 4J95A 4MXCA 3Q96A 4A9RA 3RAIA 4YJOA 3SRVB 4CQGA 3NFFB 5HIBA 1H1RA 4UYNA 4A07A 3F3UA 1G8KA 3V6RA 4E8AA 4RZWA 2W1DA 3KMMA 1CKJA 4O38A 2XYNA 3PE2A 3EKKA 1W0XC 2F49A 2XNGA 3NNXA 3OP5A 4QMXA 4BYIA 4EWHA 3TNIA 4Y85A 3QQHA 2W7XA 4JBPA 4YJPA 3GUBA 3PXZA 4IAYA 5BUIA 1YXXA 3G0FA 5HTIA 2YIRA 4O2PA 4FICA 5D10A 4IDTA 2WTIA 3FMJA 5E4HA 2R3HA 5FUTA 3SDJA 5A4LA 3ORXA 3FYKX 2VAGA 4FKGA 4BDGA 1ZZLA 4TN6A 2JC6A 5E8WA 2X7FA 4UV0A 2HXLA 3KXMA 2GNLA 3LQ8A 2YDIA 5D7AA 1EH4A 4EHVA 1OKYA 3UMXA 4DG2E 1ZYDA 2WD1A 5IQHA 2UW5A 3UDTA 3ML1A 4L3LA 4PDYA 4YURA 4NM7A 2BR1A 1JNKA 3R7OA 3SC1A 1W2DA 3BGZA 3UYTA 3ZU7A 1STCE 5J5SA 4KD1A 5TOZA 3GENA 2P55A 5IA3A 4YJUA 4DTAA 4FTIA 1LPUA 2QR7A 2GHLA 3VULA 4MUQA 3HUBA 4YNOA 3T8OA 3FSFA 4G3FA 4Q9ZA 2HW6A 3QALE 3ZSHA 2UW4A 4BTJA 3O71A 4C34A 4CZUA 3EN4A 4J96A 2XK3A 4N6ZA 3VS7A 3CQUA 3F9NA 1YRPA 3WOWA 1HCLA 2R4BA 3NX8A 5DI1A 1PXKA 5J9ZA 3FKNA 3K5UA 4EEVA 4D4VA 2GNIA 4NSTA 4TY1A 4EUTA 5C26A 4HNFA 3ATSA 3NW5A 4NIFB 4GKHA 3HMIA 3UNKA 4RIWA 4LOQA 4K2RA 5DHJA 3NR9A 1YXVA 3HP2A 3L8VA 3OXTA 3QKKA 3RGFA 3THBA 5FXSA 3LCSA 3WF5A 3E8CA 3BYOA 1UV5A 2FB8A 3P5KA 3R8MA 1OL5A 1WVYA 2RL5A 2BHEA 4EBWA 5CAOA 2OXDA 3C4FA 4WNPA 2GQSA 3PJCA 4ZTNA 5DLSA 5C27A 3NNVA 2B9IA 1MQBA 4PMSA 4XG7A 4BWPA 4IB0A 4EZ5A 3NYVA 3CR0A 4ASZA 2QOFA 1KOAA 3COMA 4BTMA 4F7LA 5JK3A 3EQCA 3VS6A 2QOKA 3E7VA 3B8RA 2QO2A 4HGSA 3RWQA 3ZOSA 3ORPA 4E6DA 5CEIA 2YABA 3BBWA 3ORMA 4C58A 4AXAA 2CN8A 3QTXA 2XNOA 3N4VA 3F61A 4PL3A 1H01A 1H08A 2GHMA 2EU9A 4MXZA 3EFJA 1BX6A 2W4KA 4XX9A 1TFFA 1XH9A 4E5BA 4IFCA 4AZWA 1I09A 4FIGA 5DGZA 3GC0A 4IAAA 5EW9A 4GT3A 3W33A 3NDMA 3RPOA 2R3JA 3D5WA 4FNYA 3I0OA 2PZRA 3BLAA 5KNJA 4FSTA 2QU5A 3GXLA 4FX3A 5FBNC 3SX9A 4V0GB 4RVTA 3QTQA 4M15A 3P9JA 3UP2A 3LFSA 2I0HA 3OC1A 3DAJA 5DNRA 2XNMA 4FKOA 1UNGA 3II5A 3GU8A 4Y95A 3FY2A 4R7BA 4MXOA 3U54A 4BGQA 4JJRA 5DH3A 5M4CA 4YR8A 3E3BX 3AG9A 3MPTA 4HCVA 2R3RA 5F94A 3PG1A 4K0YA 1M7QA 3A8WA 4EOSA 2C5NA 3DGKA 3DY7A 5JFSA 4XUFA 1IAJA 3VNTA 5EI2A 1BKXA 3E93A 2DWBA 1PXMA 4TYJA 3UMWA 4MBLA 4YZCA 4UZDA 1XHAA 5FTOA 4HJOA 4IVCA 5EI8A 5AX3A 3RP9A 2YLFA 3V8SA 4UMTA 5DRDA 4O0TA 4XCUA 4G5JA 5AR7A 4NJDA 4UALA 4FF8A 3AT3A 3FMHA 1YI3A 3QL8A 3P7CA 3LZBA 1QPEA 4FK6A 4QTCA 3AC5A 3R7YA 3SXSA 4E6AA 4DEBA 5HHWA 1IAHA 4OUCA 4F4PA 4B7TA 3OOMA 4OTIA 3RNYA 4KSPA 4QTAA 3U6JA 1FGIA 1JOWB 5CXHA 3QC9A 4Q5HA 4EOQA 2OH4A 1NXKA 4XP3A 3TZMA 3R8LA 3JS2A 4JBVA 2ZMDA 3FXWA 4D2TA 3QQUA 2W5HA 5AR4A 4AG8A 1YHVA 4Y46A 2YZLA 4GJ3A 4LGGA 3RAHA 3RINA 3P78A 3A7HA 3DPKA 2IJMA 2QKWB 2WXVA 4NW6A 1ZYJA 4HZRA 4FNWA 1JWHA 3ZM9A 4OBPA 3PSDA 2W1GA 3BHYA 4CEGA 3O0GA 2BZIB 1RQQA 3W55A 3UVRA 3BCEA 3HLLA 3UP7A 5K0XA 3BV3A 4UB7A 5J95A 4LM5A 5DN3A 4EOKA 3H4JA 2PHKA 1ST0A 4O7RA 3O17A 5DR6A 4BIEA 3HA8A 2XM9A 5A4TA 3MI9A 5C03A 3DAEA 4LI5A 4DH7A 4O0VA 5H2UA 4CD0A 4FGRA 4OTQA 2QURA 4PTCA 3NRMA 1OKZA 3GVUA 4MVFA 5HNGA 3S95A 3Q4UA 3LCKA 3MA6A 4JNWA 3IDBA 4MCVA 4U3YA 2G2FA 4XOYA 5H3QA 4CG8A 5B2MA 2PZ5A 3EH9A 3NIEA 3QC4A 2IW8A 2BILB 3RPSA 3MFTA 5LVNA 2QD9A 1X8BA 5AUWA 3HMNA 4EHEA 1R78A 3MVHA 2X0PA 2PVLA 3P1AA 3M1SA 3QQLA 4E93A 2GQGA 2F7EE 2OZAA 2UVZA 3LFFA 3CD3A 4QMUA 4C61A 2CKOA 3LQ3A 4NM0A 3D4QA 3POZA 1URWA 3QA0A 5JT2A 1WVWA 3VUMA 4L7SA 4WRSA 3V8TA 5TO8A 2ERKA 2W1IA 4KRCA 3A4PA 5TKDA 4FKUA 5BMSA 3WILA 3OROA 4M67A 4O84A 4FT5A 5CS6A 4GS6A 5BX0A 2PMIA 4IFGA 4FVPA 3TXOA 4FV2A 3Q6WA 3UZPA 3ZUUA 3AKKA 3UIUA 3WIGA 3AT2A 2XIZA 5CENA 4GCJA 2B55A 1DAYA 4QEBA 2O65A 3BI6A 3NAXA 4XG3A 2V62A 4M69A 4HVHA 3LFEA 2R3GA 3DJ5A 4U9AA 4C2VA 1YKRA 2X8DA 3L9PA 3FLWA 4BCHA 5FDXA 2XKEA 4F64A 2Q0NA 2WB8A 3EFKA 3RPRA 4FIEA 3GU7A 3KFAA 4EOLA 4F0FA 1H1SA 3A99A 4WSYA 3WF9A 2JBPA 2BCJA 3PJ2A 4K6ZA 4C4HA 3I5ZA 4C02A 5I3OA 4FTMA 4ZJJA 1FMOE 2GS7A 4RC4A 2IVSA 5AP7A 3Q9YA 3G6GA 3R73A 3SAYA 3E8EA 4LV7A 2SRCA 3GU5A 4BHZA 4ACGA 4EH8A 1VEBA 5M4FA 2VO6A 3OCTA 4OW8A 3MV5A 3N4UA 5TR6A 4YLLA 1CM8A 2FH9A 3FL4A 2IZUA 4DEGA 3GP0A 1FOTA 4KINA 4IACA 3IPHA 4AZVA 3QWKA 4WBOA 4A4OA 2ITZA 4YJQA 3Q4CA 5BNJA 4WHZA 5CQWA 5TT7A 2BKKA 5HLPA 4ZTSA 3FZ1A 4U41A 2Z7RA 3MWUA 4RC2A 5HCZA 3KRRA 3LIJA 3QFVA 4ANNA 4JOAA 5ANJA 2QOQA 1OKVA 4R7IA 4E4LA 4EYJA 4FTJA 5C1QB 1UNHA 3PP1A 4X6QC 1PMVA 2VTSA 4B0GA 3LJ0A 3AD4A 3NYOA 4ZJIA 2PE1A 3PA4A 3R30A 4QP3A 3VIDA 1GY3A 4IB5A 5E92A 3Q32A 4U44A 1ND4A 3FMDA 3RCDA 4QMVA 3BPRA 3LFQA 4GFMA 4J53A 3TZ7A 2V7AA 4E6QA 3HMMA 4QMYA 2G2IA 4ANSA 1WCCA 4DEHA 5IH4A 2VN9A 3U4WA 2YIYA 3SW7A 1ERKA 3W2CA 4IH8A 3LFCA 1LEWA 4KIPA 4I6QA 3R9HA 4M68A 2GS2A 4A4XA 2C69A 4IJPA 4JDKA 4XG9A 4ACHA 3QKMA 5IMEA 1DAWA 3F82A 3CKXA 5JMSA 4DTKA 3E5AA 4CRSA 3MGYA 4RX7A 5AP4A 4ZSJA 2CGWA 5IQEA 1UU9A 2FSTX 3GU4A 3COHA 1JSVA 4G2FA 1PXPA 2GU8A 3HX4A 4ITHA 4DFBA 1B38A 4I20A 1JKLA 3O7LB 3FXZA 1Q8WA 3L8SA 5J1WA 4TYHA 4MNEA 4X7QA 4JLCA 5L8JA 3ZLSA 5DYJA 1IG1A 3KK9A 3OY1A 4DFUA 5ANEA 2UW6A 4I5MA 4OTWA 5EI6A 4H3PA 3UZRA 3KVXA 5LVLA 2XIKA 4M0ZA 5IEVA 4FA2A 3QQKA 1Q8YA 4ZY4A 5DIAA 3W2SA 3FMKA 3EFWA 3NVMB 4R5YA 3RMFA 3ZFMA 2YM3A 4FV3A 3ELJA 2WU7A 5LMKA 3D15A 2PE0A 3PY0A 4CFWA 4HPTE 2LAVA 3D94A 4S32A 2VTNA 3H3CA 1W2CA 3ERKA 3R1SA 3DKGA 3MSSA 1OL1A 3V5QA 5EDQA 4BL1A 4USFA 5IU2A 3NW6A 1B39A 4ERWA 4DEIA 5JGAA 4PPAA 5A4CA 3HRFA 2B53A 3PZEA 4J7BA 3QA8A 2JITA 4NYEA 2GPHA 2YJSA 4W4WA 3DB8A 3WYYA 3EL8A 1PXOA 1OIQA 2CSNA 4IQ6A 5AP3A 3FLYA 3ROYA 4BCKA 2B0QA 1V0OA 4WG5A 3VF9A 4EKLA 2G9XA 4F70A 1Q4LA 4GMYA 4I6HA 4YZ9A 4LQMA 1YHWA 2QOOA 4UWYA 5GJGA 2YCSA 4AXEA 3EKNA 4Q2AA 2BFXA 2XVDA 3JVRA 4ZP5A 3TG1A 1J7IA 2YIWA 4GYGA 2DUVA 3ZFYA 2VX0A 2BZKB 2C6KA 4AP7A 3BGPA 3S1HA 3PVUA 4JDJA 4NWMA 2VGOA 2WTKC 3A7GA 4M13A 4BICA 2GFSA 5FTGA 4FNZA 2PVYA 4WKQA 2BIKB 2WTJA 4FV1A 3R8PA 4O6LA 4BRXA 3WZUA 5EDRA 4F08A 2BRNA 5IH5A 4KSQA 4W8EA 4EH6A 4GT4A 3KRLA 3QTRA 1PRYA 3QQFA 5AAFA 4S2ZA 1FVTA 2JFMA 2QG5A 4L3PA 3QTIA 5CU2A 5K0KA 5AR3A 3G90X 1J91A 2VWZA 1U54A 5L2QA 4AGCA 4C62A 5IZFA 4ASEA 2XK4A 3E63A 3IG7A 1GZNA 2J0LA 5BVEA 4B99A 3AC8A 4CFMA 5M51A 5AA9A 4JDIA 4UX9A 2IEWA 3RK9A 3A4OX 2UV2A 1SVEA 4NUSA 1LR4A 3SOAA 4BCIA 1JVPP 1PXLA 2DYLA 2UUEA 3R00A 4IADA 3G9LX 1XWSA 3KMUA 3DKOA 4FSUA 4JQ7A 4QPMA 2PSQA 5JQ8A 3QTZA 5JZJA 1WBNA 4OR5A 2Q83A 4D28A 5A4EA 2WTKB 5L2WA 5E8XA 4RVKA 3LJ1A 4Z7HA 4G6OA 2NP8A 3SHEA 3UVQA 1SYKA 1TKIA 4PP7A 2PK9A 5KMMA 4P2KA 2IWIA 3BHVA 4C4EA 5DVRA 4RIYA 2PMNX 3RHXA 1Z57A 2XKFA 3VBVA 5CU3A 2ITQA 3IECA 4AOIA 2CPKE 3MIYA 1U59A 4IAKA 4AZSA 4I6FA 4KNBA 3C5IA 3KA0A 4L67A 3P7AA 4RLLA 3BEGA 2CGXA 2OGVA 4RQKA 3EL7A 5ANDA 5JGBA 2W96B 3OWKA 2A27A 4RT7A 2ONLC 1JQHA 2PMOX 4I0SA 3CJFA 4C3FA 3OG7A 3AC4A 3KK8A 2R3NA 2V5QA 5DRBA 3N4TA 4RMZA 2QOLA 3DBCA 3V5PA 4DH8A 5J5TA 2V55A 4KKEA 5CQUA 4HYSA 4BDDA 3UQCA 2QC6A 4W9XA 5FRIA 4ZY6A 3HNGA 4X0MA 3ET7A 4FV0A 3UNZA 3W32A 4I94A 2YIQA 3ENHA 5EOBA 2XIYA 3N51A 4O81A 3UGCA 4XLIA 3MFRA 1H8FA 2VWWA 3ALNA 4XP0A 5LQFA 5DFPA 3VS2A 1Z5MA 4IX4A 3LXKA 1DI9A 2ITOA 4QYHA 2PZIA 3U51A 3SKCA 2XALA 3VW8A 1A06A 1RJBA 4PWNA 4UXLA 3SA0A 2PVJA 4CLJA 3HV3A 3MJ2A 2IW9A 3TDWA 4ZMFA 3MS9A 5B7VA 2ZAZA 2B4SB 3ANQA 1VYWA 3HRBA 3BIZA 3CIKA 4WUAA 4IB1A 3QF9A 1Z9XA 4M69B 4BDAA 2W05A 1K2PA 2FUMA 4O7VA 3A61A 2BRBA 3HDMA 3KVWA 1XH4A 2AYPA 2PL0A 2WOUA 3PSBA 1FVRA 3FI2A 4RWIA 2WMSA 3HV6A 2FSMX 4FG9A 1YI6A 5CSVA 2C68A 3CCNA 2B52A 3FKOA 4TPTA 4IAIA 4X3FA 3NUUA 3QD0A 2Y8OA 4GSBA 4QMPA 4DEAA 3S3IA 1W98A 3A7JA 2XAMA 4FKRA </