3GNIB

Structure of strad and mo25
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
388
structure length
304
Chain Sequence
AHHHHHHMENLYFQSSFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEKFSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIASEALPELLRPVTPITEVDDWEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/signaling protein
molecule keywords Protein Mo25
publication title ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 304
sequence length 388
ec nomenclature
pdb deposition date 2009-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3gniB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3gniB01
5CAVA 1ZRZA 1NT2A 1Q8YA 3AT4A 2F7XE 4DFZE 2GFSA 3QGWA 1KV1A 1REJA 4I3ZA 3UO4A 5CAQA 3QRJA 4BZDA 3FLSA 2R5TA 5HCZA 4ZY6A 5IEXA 2QLQA 2WTCA 4EHZA 2GDOA 4QT1A 2R0IA 1DAWA 3GEQA 2YM7A 3D15A 5C1QB 3QZHA 1FINA 1DI9A 5IQCA 5HIDA 3ZXZA 3HDMA 5CT7A 5F95A 3TDWA 5A4QA 3SG9A 3FC2A 1WVWA 3UVQA 4EOSA 3VIDA 2GS7A 2QONA 2VTTA 4IMYA 3NUAA 1XH6A 4CMTA 2XIYA 5J5TA 4DEDA 4F6UA 2C5XA 3MYGA 5AUZA 3MW1A 3R7GA 2GQRA 5KKRB 3C0HA 3L8PA 4CV8A 4F65A 2X6DA 2ETKA 3C4WA 4HVDA 3WILA 3QZIA 4DFLA 1P5EA 4CMUA 4MXCA 4IWDA 3OT3A 5CU0A 3LJ2A 2FYSA 4E5AX 2OKRA 4D2SA 4FKWA 4RWLA 3K2LA 1CKJA 4M66A 1UA2A 4YZBA 3MY5A 2QVSE 3UNZA 4CSVA 2RKUA 4APCA 5H8BA 4AT3A 5GJFA 5CEIA 3RAIA 3O51A 4NJ3A 4MCVA 3OWLA 5AP3A 4AN2A 3SXRA 4EYJA 4FV7A 4J1RA 2XK9A 3OWPA 2FA2A 5EHYA 4JI9A 3HV3A 4AN9A 5HTCA 3IONA 3DZQA 4G31A 1IA8A 4PDOA 3O50A 4KRDA 3RHKA 3L9LA 1NVQA 2C4GA 2OI4X 4QMXA 4MBLA 4RGJA 3CE3A 5IMXA 3G9LX 3IS5A 2F7ZE 4AFEA 3BLQA 3CQEA 4I4EA 2XH5A 3UMXA 1BX6A 2W1EA 2JFLA 2XRWA 3HLLA 1PXLA 3FLWA 2UV2A 4X2KA 3QTRA 3NNXA 4KIOA 3BV3A 4QQJA 5AIRA 4E8AA 5FDPA 2DQ7X 4ASZA 3D4QA 3Q9YA 4QYFA 3VF9A 3NNUA 3PPZA 4ZZMA 3UP2A 5JK3A 3F2NA 4TYIA 2XK8A 3QXPA 3FC1X 1PJKA 4G6OA 4U45A 4I94A 5H3QA 1VYZA 4AZTA 2W99B 3KCKA 3E8CA 5HQ0A 2WTIA 3R8MA 3RCDA 4BDIA 3O8TA 2C5NA 4O38A 4Y46A 4P4CA 5GIPE 2H6DA 3SVVA 4O7ZA 2YM6A 2DUVA 3RCJA 3MN3A 4JBVA 4C2VA 2UZBA 4OLIA 3AD4A 3AGLA 4NFMA 3R04A 4D2RA 5HO8A 4F7LA 5DMZA 4ASEA 4MQ1A 3MY0A 3A7IA 4BKJA 1VEBA 2OZAA 2FB8A 2WEIA 3JPVA 1E1XA 2B52A 2YEXA 2B1PA 4FIJA 4QMLA 2H9VA 3N51A 1SM2A 4IW0A 2KULA 5HI2A 3OFMA 4U97A 4G3CA 5BMMA 3NIEA 3PIXA 2OXYA 2WQEA 3VJOA 1Q3WA 2X39A 4BDJA 3DKFA 4W4WA 4GIIA 4YJRA 4KD1A 3WF7A 4KS8A 4BDAA 3IDBA 4ONAA 3VRYA 3WI6A 4BICA 1IRKA 3BELA 4OTWA 1TVOA 3QRTA 3U9NA 1QL6A 2ETRA 3OXIA 3GU8A 2WD1A 4O27B 4EWHA 1Y6BA 4GK3A 4E6QA 5ANIA 1CDKA 5K5NA 4WD5A 2Y6OA 3UOLA 4Y5QA 2CNQA 3HX4A 1PMVA 4D4SA 4BCPA 5EYCA 3LXPA 4QTCA 5A4LA 3UOKA 3W18A 2QC6A 4BL1A 3D14A 4O7VA 1PXIA 2W9ZB 4A4LA 4O91A 4O84A 3W2RA 4BF2A 2RGPA 4MXXA 5JKGA 3L9MA 5GJDA 1SVEA 2BAJA 2IJMA 3BU5A 4IDVA 4BCHA 3FQHA 4YO4A 4QP9A 2B0QA 3DBQA 3R28A 3ZEWA 3R1NA 3AC8A 2G2HA 4HYIA 4DFUA 2IZRA 4ZTLA 4EOLA 2OJGA 3FMKA 2UW0A 3F5UA 5LCJA 2R3GA 3ORKA 1PXJA 1Q3DA 3RZBA 3H0YA 4UWBA 2C0OA 5AX9A 3Q5ZA 1FGKA 3FZOA 4QPMA 4GK4A 4USEA 4RIOA 5EW8A 5AP4A 3VUDA 1OUKA 2LAVA 4C37A 2PE2A 4F9WA 1W0XC 2YERA 3MTLA 4IEBA 2GHGA 3PE2A 4FTJA 3QTZA 4FZAB 4KIKA 5AR7A 4FNWA 5AUUA 2ITQA 5KBQA 4L43A 2BDWA 4KBKA 4R8QA 5CALA 4OGRA 2P2HA 1W82A 3V8WA 1JNKA 5E8UA 4OTDA 4TPTA 4DA5A 5L6PA 4WHZA 4BCGA 4UWYA 1Q8WA 4BR3A 4UXQA 4D0XA 4XBUA 2C6OA 3A7FA 4M12A 3RALA 3BBWA 5BUJA 2YM4A 2WGJA 3ZLYA 3KEXA 1EH4A 4LG4A 2AC5A 5C9CA 4UMUA 4RVLA 4QP7A 5E8SA 2YFXA 5CI6A 3QZGA 4NJDA 5DVRA 4ZLZA 1CMKE 5ACBC 1V0PA 2CGWA 2PMNX 2SRCA 1FPUA 2ZOQA 4WNPA 1DM2A 3RVGA 4ZP5A 2B53A 4G3GA 4L68A 2XIRA 5E8YA 1Y8GA 3D5XA 1GZOA 4NW5A 5I5ZA 3COHA 1SVHA 3D2IA 2QOFA 5CU3A 2WKMA 3RAKA 3KA0A 5C26A 4DCAA 4PDPA 5AP5A 1B6CB 2OG8A 3M2WA 3TKIA 3VQUA 5AR8A 4XUFA 5LOHA 1PXKA 3HNGA 5LXMA 3CR0A 3KK9A 4MF0A 3VW8A 2ZM4A 1U46A 1WBNA 3Q53A 4PMSA 4XOYA 2UW5A 5AV0A 3BWFA 2IW8A 3A60A 2YIXA 4O1OA 2R3LA 1NXKA 1OIRA 1B38A 2VO6A 3KXGA 4MBJA 4PPAA 3PVGA 2CGXA 3OOMA 2WMVA 5FGKA 2Y0AA 3FMMA 1KV2A 4B99A 4FYNA 4TYGA 4O7YA 1X8BA 3PPKA 3BV2A 3F7ZA 3GCUA 3A99A 4EBVA 4AGWA 1CTPE 4L44A 3D83A 2GTMA 4YHTA 4WNKA 4EH4A 1OKVA 3NLBA 5KMJA 3UNKA 3GUBA 2GS6A 2WMSA 3LFEA 4CT2A 3GNIB 3OS3A 1H1PA 4ANOA 1UWHA 4C3PA 2W1DA 4IVBA 1FVTA 3VRZA 3ZZEA 4C4GA 4MXOA 2F49A 4PV0A 5ANKA 4BGQA 4KB8A 4BWXA 3ATTA 3DXNA 5AP0A 3SOAA 3TNQB 1FOTA 2JFMA 1W98A 5FP5A 1KOAA 4NIFA 1OGUA 4HPUE 3W33A 5AM6A 3E63A 4FR4A 4FSYA 3EQGA 3PRIA 3OVVA 3VWAA 2WOUA 2JDOA 3FPMA 3OT8A 4V05A 5EM8A 4RC4A 3UIUA 3R0TA 3T3UA 1YW2A 3MH0A 1MRYA 4I6HA 3TCPA 4B9DA 4U9AA 2C5VA 4QMUA 5C4KA 5BYZA 3OBJA 4PTCA 3BPRA 4ERWA 3WF5A 3FZRA 2VRXA 4PNIA 1XWSA 4ACDA 3NWWA 2E9NA 4AGUA 3VS2A 2PMLX 3LXKA 3CKWA 4XLIA 3R30A 3UIMA 4RRVA 3OCGA 3QD3A 1UKIA 3TIZA 1GIIA 4HGSA 3BU6A 4FTUA 5LMKA 4XP2A 4QQCA 3P23A 1ZYSA 3EZVA 4ZLOA 2C3LA 4LUDA 3TT0A 4C57A 2ZAZA 2YDJA 4X6QC 4ZJVA 3MPTA 4EL9A 4U79A 3DTCA 4FVRA 2YABA 4IB0A 1OKYA 2BAQA 4FTMA 2WU7A 4RZWA 1Y91A 5ANGA 2WPAA 3UODA 5M55A 4F7NA 4AG8A 3OCBA 2WOTA 4JG8A 4R5SA 5L8KA 4FSQA 3KMMA 1M14A 4IB3A 4YHFA 4BIDA 1L8TA 3GCSA 4FT7A 2ERZE 3NNVA 3RPVA 3R8VA 4JDHA 4EBWA 4L3JA 4RX9A 1P2AA 3TV4A 3VS5A 5JFSA 2OLCA 2B9FA 2CSNA 3LVPA 4EORA 1KWPA 1GNGA 4ZMEA 3DA6A 4OTPA 5IQDA 3MWUA 4D58A 2C30A 4R5YA 3QRIA 2YM8A 4HNIA 1A48A 1OIYA 2CLQA 3JVRA 5AV4A 2EUFB 3FI2A 5BVKA 3HEGA 4FOBA 5EW9A 5TE0A 4AE6A 3BWJA 4FIIA 4PL4A 3GC9A 4ZSAA 5EKOA 4KS7A 3O7LD 3S0OA 4U3YA 1YQJA 1XHAA 3ZO3A 4LRJA 1SNXA 4IADA 3ZO4A 1K3AA 4DAWA 3WF6A 4NZWB 4O0VA 4FI1A 4MQ2A 5EI6A 4TWCA 4D1SA 2YLFA 4E4XA 4EOQA 3TUDA 5EDPA 3C0IA 1MQBA 2ZV2A 4FTKA 4ZTSA 4KUJA 1ZY4A 1WBWA 2Q0BA 4C36A 4XLVA 4BHZA 3L8XA 4GYIA 3Q4ZA 3E8DA 5CSHA 4ZK5A 2IZSA 3FMEA 3NDMA 5FTOA 4ERKA 1H28A 3QFVA 1PMNA 3QUDA 4FKJA 3MFUA 3U55A 5CAUA 3ZM9A 5E4HA 3TJDA 3KKVA 3ZBXA 5K5XA 4BFMA 4I92A 4EOOA 2YA9A 4C61A 4CGAA 4QP6A 1PXNA 2H34A 1J1BA 2ZB0A 1WZYA 4FE2A 2PULA 3F82A 4M68A 5IG1A 4FKIA 1A9UA 3R01A 5IDNA 2CCIA 5CS6A 2YJSA 4OT5A 1VYWA 4C59A 2AYPA 3PA4A 3VS0A 1MQ4A 1ZZ2A 3CD8A 4YZDA 4CTBA 4P90A 3EQDA 4CRSA 4QMZA 5HIEA 4EONA 4IE9A 5FEDA 3CIKA 2O5KA 4FZ6A 4DTKA 2C5OA 3SLSA 4JQ8A 3Q9WA 3N4VA 3BQRA 3JR1A 3I81A 5D7AA 3KFAA 3ELJA 3WOWA 4JR7A 5HNGA 4J71A 3KB7A 3S00A 2GU8A 4K2RA 4NM0A 1FGIA 2R3NA 3CPBA 2IVTA 5K4IA 5FG8A 3UG2A 3CSVA 3GCPA 4DE4A 3EHAA 1G3NA 2WMBA 4YBKA 2BZHB 3UQFA 2V22A 2Y4IB 3A4PA 5AV1A 1H24A 5HO6A 2ITZA 5HD7A 4EZ7A 4CKIA 2OJJA 1LR4A 3VBWA 4B6LA 4E6CA 5EK7A 5AX3A 5HG9A 3QCXA 3EIDA 3II5A 4XG4A 3R9NA 3GGFA 2XVDA 3ZU7A 3UIXA 4RC3A 2BKKA 3RK9A 4DFBA 4LGGA 1BUHA 5ICPA 5IPJA 4EUUA 5EDRA 2C6KA 2RF9A 3VUIA 2ERKA 3F3TA 4XEYA 5CTPA 4YTFA 2O65A 3ERKA 4FKVA 4EZ5A 4NL0A 5F20A 1CKIA 3C13A 4L7SA 2VTIA 4O7TA 2UW6A 5GZAA 2JAVA 3HMOA 4QMNA 4DGNA 1RJBA 2FO0A 5EM7A 2Z7SA 5E1EA 2O64A 3DK6A 3ZC5A 3C5UA 3C50A 4FTNA 4CQGA 5DYJA 2X8EA 3CGFA 5H8EA 2Z02A 3IOKA 2F2CB 2XA4A 5IUIA 4EC9A 4MYGA 1G8AA 4WBOA 5DNRA 5FEEA 1M17A 3BE2A 3PUPA 5DR9A 1F5QA 3MFSA 3SC1A 4G34A 5KHXA 4YTHA 3IPHA 4I6QA 3F2AA 2JKMA 3IW5A 3FZTA 4ZY4A 4M13A 3ORMA 5D11A 4AU8A 5M4FA 4GT3A 5A4TA 2AC3A 1YRPA 4ZSJA 4FYOA 2X9EA 2QR8A 4RVKA 2XS0A 3NEWA 4B4LA 5TOZA 5BX0A 2WMQA 4GL9A 2XIKA 4KRCA 4ZLYA 3PSBA 3HP2A 4GJ3A 5BVFA 3HP5A 5DN3A 3QLGA 2DS1A 3VUMA 4R7IA 3KRWA 3RAHA 2XK7A 3TNHA 1GIJA 1JVPP 4APPA 2Y7JA 4AXAA 3EFJA 2OW3A 4JIAA 5FD2A 4CNHA 4QMMA 4FVPA 3R2BA 3LFCA 3QQGA 3VUGA 5F9EA 4FKTA 5B2KA 3SX9A 4MNEB 2EXMA 3OEZA 4RFMA 1H07A 3QXOA 4PL3A 4DLIA 4O1PA 2XRUA 4F0GA 3QHRA 4IM0A 4RWKA 3D5UA 3PE1A 4HGTA 4QMQA 3M1SA 4JJRA 1CSNA 3U54A 1U4DA 3NVMB 5DBXA 5AFVA 1RW8A 4ZIMA 3UYTA 2X81A 4PQNA 2FVDA 3VBTA 1JKTA 3LFSA 4UYAA 3RM7A 3SV0A 5I0BA 2GNIA 4USFA 2I0EA 3P9JA 4C4IA 3BHVA 3ULIA 4GVAA 4KKGA 4FMQA 2HAKA 3EN4A 4JAJA 4HVGA 1XQZA 4IB5A 4O2PA 1WFCA 3BI6A 4YJTA 2WMWA 5DE2A 4LOOA 3NAYA 3I6WA 5CAPA 2ZMDA 3O96A 4JG6A 4CFWA 1OITA 4G5JA 3F5GA 1T45A 5EG3A 5CEQA 3F5PA 2VX3A 5FLFA 3ZFYA 1XO2B 4Z16A 3NYNA 4ACMA 3GFEA 5IQAA 1GZNA 2FSMX 3H9FA 4PRJA 3FZPA 1Q8UA 3MVMA 2GTNA 3PYYA 1B39A 2WZJA 4V0GB 3RINA 3PDTA 4H36A 4N6ZA 4QO9A 4CZYB 4L3PA 4USDA 4C4JA 4EH8A 4FTQA 3KCFA 3PXRA 4MAOA 4GKIA 2BROA 2VTMA 4KWPA 3HV4A 4Z9LA 3UTOA 3IW4A 4FKGA 5GZ9A 3AC3A 3SOCA 4FT5A 3GC7A 4F09A 1FQ1B 2A4LA 2IVVA 1BI7A 1Q24A 4O7SA 3WARA 5DHJA 2W1ZA 1E1VA 3TEIA 4RJ7A 1O6YA 4EYMA 5AJQA 3DBCA 4A06A 3SD0A 4BBEA 3VS3A 5IA4A 1XH4A 5HICA 4BRXA 3VBXA 1IEPA 4F1MA 5CF5A 2DWBA 3HRCA 2OBJA 4FNZA 1AQ1A 3ITZA 4A9SA 4CTCA 3GU7A 3HMNA 3HUCA 3KVWA 3OG7A 5AAEA 5HE3A 4XG6A 3ACKA 4JBQA 4DTAA 5HG5A 5A6NA 4BI0A 1PW2A 3DAKA 5T68A 5J5SA 1OECA 2OF2A 3SA0A 3MPAA 4W9XA 4YLKA 2OK1A 3TZMA 2R3KA 2JDRA 1UNHA 2PSQA 2UZOA 3I5ZA 1YXUA 3KL8A 4IAFA 2EU9A 2WMUA 4OTQA 4RG0A 5M57A 1JOWB 2R4BA 5FTGA 2W06A 3O23A 4YHJA 2PVKA 3WZKA 2CCHA 3BHTA 5BVDA 4NYEA 1TQPA 1Q62A 4K11A 4JRVA 3LM0A 4I0SA 3PA3A 4C4FA 2P2IA 3B8RA 2VU3A 5J79A 2IWIA 1WAKA 3ZSHA 2YAKA 1UU7A 5JEBA 4H05A 4PDYA 1U54B 3DLZA 4ALUA 1CKPA 2VV9A 3FKOA 4TNDA 3CD3A 5AUTA 4D4VA 4B8MA 3VHKA 2W5BA 2WB8A 3E62A 3NUNA 5HNIX 4EI4A 4UMQA 2UZLA 1XJDA 3MB6A 5LJJA 4N4SA 3RAWA 4DH1A 4AZWA 3COMA 4EHGA 3NZ0A 3LJ1A 3I1AA 4QMTA 4BZNA 5HTBA 5LQFA 5FXQA 2XEYA 1OM1A 3QRUA 2YIWA 5DRBA 1Q5KA 5CF8A 5AA8A 1LPUA 2O0UA 4J97A 2P3GX 4G17A 3QAME 1TQMA 4IVDA 4DGOA 5HG7A 3QL8A 2RFEA 4E1ZA 3E7OA 3QRKA 2Y4PA 4EH6A 3S95A 3A8XA 4EH2A 3R9OA 3W55A 2WMRA 4IAAA 4D5KA 1IASA 2PVHA 3WE4A 2OIQA 2WTVA 4JLCA 4MD7E 1R0PA 2G9XA 4IFCA 2QQ7A 1ZXEA 2HXQA 4JRNA 4H1JA 4JVGA 3N4UA 1PKGA 3R1YA 3PY0A 4D55A 1O9UA 2C5YA 3BE9A 4FSRA 4YPSA 4RJ3A 4EEVA 5C4LA 2C6LA 4L8MA 3H30A 1BLXA 1M7QA 2PZPA 3MIAA 4HPTE 3PXKA 3VAPA 5IDPA 4BDHA 1BKXA 3DKCA 4LGDA 5I3RA 5J1WA 5EQEA 1RDQE 2VGOA 3F3ZA 5DT0A 3GVUA 3IQ7A 4I5CA 3ZSIA 2XKFA 3QTQA 3L9NA 4KSPA 3V5PA 4O7NA 3NX8A 5I9WA 2VWZA 3NUXA 4YZCA 3C9WA 3R9DA 4QMYA 4ZTQA 5EFQA 2V62A 4PMMA 5AR4A 4QP3A 3I79A 2PWLA 2J5FA 1YVJA 4D2VA 3KGAA 3O71A 3C4EA 5I9UA 1IG1A 3DK3A 1YXSA 4OBQA 4JDJA 4NUSA 3BGQA 4L45A 1SMHA 4O7LA 4F0IA 2FGIA 3TIYA 4I24A 2IPXA 4IZ5A 3RPOA 3L8SA 5CVGA 2PE1A 1PXMA 4FV4A 4BCIA 1JPAA 4F1TA 3QYWA 2W7XA 5JGBA 5L2IA 4R7BA 1ZMVA 4IX5A 1GZ8A 2E9OA 4ZEGA 4U80A 4FIGA 2X2KA 4AQCA 3MTFA 3DBDA 2WTKB 4Y8DA 4OBPA 3H0ZA 2Y8OA 4LI5A 4UEUA 2B7AA 1OKWA 2NO3A 3NW6A 2PUPA 2QO7A 2WQNA 4A07A 4EKLA 4BC6A 4AGCA 1Q8ZA 1J3HA 2VTOA 4AWIA 2HK5A 3PWYA 4UWCA 5FTQA 2XKDA 3PZEA 3PPJA 4PTGA 3ZLWA 1UWJA 3O8UA 3QCSA 5AIKA 3P08A 5BYYA 4JX7A 2JKQA 4EK3A 2X7FA 3OY3A 4IBMA 5CWZA 3KRRA 4DGGA 3EQBA 2RL5A 4P5ZA 1Q8TA 3Q04A 4NCTC 2XNMA 4GFOA 1Q4LA 1ZOGA 1ZAOA 4U43A 4G5PA 4M97A 2XJ2A 4I5HA 4XH6A 2OF4A 5HLPA 3ZDUA 5EKNA 4OTFA 4KIPA 3AC4A 4ORKA 3F66A 1XBBA 4K33A 4MBIA 4O7RA 4DBNA 4D0WA 4GKHA 3F9NA 4WIHA 2FSLX 3W2OA 1F3MC 1H27A 2H96A 3BQCA 5J9ZA 4FEVA 2PVFA 2VTJA 2W1HA 2C6IA 4NK9A 4S30A 1V0BA 4X2JA 3FQSA 1JWHA 4BIBA 5IQGA 3QQFA 4O0SA 4FV2A 4E4LA 4M69B 4BN1A 4O22A 1JQHA 2XP2A 2PE0A 4ZZOA 3OD6X 2C3IB 3TTIA 3KXZA 4E73A 3PWDA 2HY81 4QOXA 4EZ3A 4EOMA 2X0GA 3FY0A 4M8TA 3V51A 5CEMA 1J7UA 1REKA 3EQFA 3LFAA 2W1GA 4IAKA 3S4QA 3UPZA 1J7LA 2WQMA 4N0SA 1OVEA 3KC3A 1OL5A 4CZUA 1ZYJA 3FE3A 4QQTA 2ITWA 2A27A 3EH9A 4BCMA 1DAYA 4FKUA 4U81A 5IA0A 5JT2A 5J7BA 5TO8A 5ETCA 3DZOA 2Z2WA 4MNEA 4Y73A 4IDTA 5B7VA 4RIYB 5C03A 2OIBA 1YI6A 1ZOEA 4CFFA 2PMIA 2GPHA 5FM2A 4O83A 2ZJWA 1H1RA 2VUWA 5DEWA 3TNPC 4QMVA 2O63A 4R6VA 2J7TA 2WMXA 2QKWB 4J95A 1U5RA 4EH7A 1OPLA 3I5NA 3H9RA 4M14A 4MK0A 2ONLA 3RNYA 4GSBA 3VQHA 3BRBA 4EOIA 4ALWA 4X21A 5FEQA 5AAFA 4O7WA 1PYEA 1MRVA 2VO3A 3H9OA 4YJVA 2PZIA 4DEEA 3TUBA 2PYWA 3LCSA 4YO6A 3SXSA 4PPBA 4FGRA 4G9CA 3QD0A 1XH5A 4II5A 3W2CA 2PZRA 5KMOA 3CJGA 1PRYA 2C1BA 2OZOA 3HV7A 2JKKA 3BEAA 4RZVA 5GNKA 1M2QA 2VX0A 4WSQA 3R1SA 4XJ0A 5EHLA 4CCUA 3R63A 4IM3A 3NW5A 4Q9ZA 4PP7A 4V0GA 4X2NA 5DLSA 4JBPA 5IH6A 3FY2A 3TN8A 3KN6A 3A7GA 3OWJA 4DHFA 2Z60A 3BYMA 4C33A 4XYFA 4IJPA 5CX9A 4LM5A 3OY1A 3PG3A 3GI3A 5M44A 1BYGA 4I41A 3QQKA 4QP1A 3LQ5A 3T9IA 4JX3A 2WO6A 5A4CA 4D2PA 4UV0A 3GCVA 1LEZA 4I23A 4JQ7A 4X3FB 5AUWA 3AOXA 4ACHA 5JFXA 2YWVA 4C0TA 4IHPA 2BIYA 4YJSA 4CCBA 1R3CA 1WVXA 3TZ9A 4OW8A 3LFQA 5DA3A 3W2PA 3PY1A 3WZEA 1IAJA 4XBRA 4YGAA 3PJ1A 4BWKA 4E7WA 3TG1A 4DEBA 2VTLA 3QWKA 4BCOA 2ITNA 1NW1A 3G0EA 3GU4A 5AUXA 3SQQA 3THBA 1UNGA 2XJ1A 3UVRA 3AG9A 3ET7A 3B2WA 4RMZA 1H26A 2H8HA 4X6RA 5FXSA 2PPQA 2WQBA 5CNOA 3NUPA 3ODYX 4FTLA 1Y6AA 3COIA 4ZS0A 3W10A 3WYYA 2VTSA 5DFPA 3AT3A 2QOKA 4IWPA 2QR7A 2IO6A 2EVAA 4YPDA 4BCJA 4D9UA 5IEVA 2BDJA 2NRUA 3R7EA 1I09A 3R9RA 2XF0A 2B54A 2J0IA 3GOKA 2HZNA 2QOBA 2R3QA 3LOKA 4RX5A 2JBOA 2BTSA 3FUPA 1STCE 4EQMA 2E2BA 3OC1A 3VVHA 2R2PA 5IKWA 3FJQE 5EI8A 4FVQA 2P55A 3Q6UA 1XBCA 4UY9A 4AUAA 1U54A 3NSZA 4YJQA 2Z7RA 2A1AB 3LLTA 2EXCX 4FIHA 3ZRKA 3EFLA 4IH8A 3NW7A 4S34A 4ZMFA 5C8MA 5FDXA 4A9RA 4R3CA 5L2SA 3R7YA 2GHMA 3UC3A 4C02A 5HCYA 5A9UA 4BCKA 1BL7A 4HVHA 4HVSA 3ZMMA 3PVBA 4L52A 2W0JA 3U8WA 3S2PA 2Z7QA 4DINA 1H1WA 3BCEA 4OAVB 1JKSA 3WZDA 3PXYA 4DH5A 4FGBA 3C4XA 3HV5A 4Z55A 4U42A 1YXVA 5KZ0A 4WRSA 3EB0A 3LQ8A 5CQWA 2G01A 3ZOSA 3DBEA 3Q9ZA 2FH9A 2ZDTA 2JGZA 5CU4A 1JBPE 3WIGA 4FODA 3QCYA 3ZO1A 4CYIA 2BAKA 4AOJA 4BDFA 5LVNA 3UZTA 4J52A 1H4LA 4WNMA 4UMPA 2HWOA 4BBFA 3CTJA 4W8EA 2IZTA 4EOPA 3P0MA 4QTAA 3UPXA 3BYSA 3UO5A 2QOHA 2ZYBA 3QC9A 4ZJJA 2X9FA 2CGVA 5J87A 4PF4A 2YLEA 4ASXA 3AC5A 3AT2A 5I9ZA 3LCKA 4CVAA 2QG7A 3RPRA 4XP0A 2WTJA 1UVRA 5HKMA 2VWYA 2YM3A 1OL7A 3ZLSA 3C1XA 5F94A 3FBVA 3PXFA 4M7IA 5M56A 2BKZA 5DGZA 4CD0A 1ZYLA 3EFKA 3KF7A 4NSTA 2QODA 5AV3A 3TKHA 1JSVA 4E4NA 2HOGA 3D7ZA 3KXXA 3V3VA 4F9YA 1IA9A 2F2UA 3QQJA 2HZ4A 3R9HA 5B2MA 3FLQA 4ITHA 3CGOA 3FXWA 5CNNA 3ZTXA 2DYLA 3G0FA 5LMAA 3PLSA 2YIQA 4A4XA 2BZKB 4RJ8A 5IQFA 5CEKA 4O0YA 3R83A 4TYHB 4FV3A 2VWXA 4XG7A 5FXRA 4KBCA 3Q3BA 1O6LA 2FSTX 2PZYA 4E20A 4YZMA 2BZJA 3E8EA 2WIHA 4OTGA 3V8TA 4FUXA 3F61A 4RA4A 1NVRA 4H39A 4RFZA 4RIXB 5DIAA 3FMHA 4LMUA 1Q61A 2OGVA 4JG7A 3AGMA 2J0KA 3C4ZA 3CTQA 2HCKA 5IQBA 3EQPA 1JKLA 2JEDA 3EN7A 3IGOA 1WBOA 2VTHA 1LEWA 2QOOA 4QTBA 1W84A 2YM5A 4RC2A 3G90X 2UW4A 3OMVA 4OBOA 5HNBA 4U40A 3UYSA 3R7OA 3VBQA 3I4BA 5CANA 3WF8A 2HIWA 5E8ZA 2R3MA 4FSUA 1YHSA 2J4ZA 4RX7A 3FI4A 4P2KA 5M4IA 2CKOA 1SVGA 3ZH8A 1IAHA 1UU8A 2BRNA 4Q2AA 2GSFA 1R78A 3HAVA 5IA5A 4D1ZA 3W16A 1YI4A 3TV6A 1GAGA 2J6MA 5IA2A 2PVRA 3DBFA 5J9YA 2J5EA 2VX1A 4F6SA 1G8SA 2HW7A 1KE7A 3GOPA 4BCQA 5CSXA 4DN5A 5HZNA 2O8YA 4EJ7A 3R22A 4XG9A 2HZ0A 3Q52A 5J8IA 1ZZLA 4N57A 4FV8A 2XNOA 5GIOE 2R3FA 3G6GA 5G1XA 2OFVA 4WA9A 2V0DA 4BIEA 5HX6A 2XEZA 3DKGA 4Y83A 3A4OX 4M3QA 4K8AA 2QOIA 5H2UA 5DWRA 4FEWA 4LQMA 2VD5A 4CMOA 3NCGA 3UIBA 4HYSA 4JL9A 5HD4A 1WBVA 2PL0A 2R3RA 3ZUVA 3CTHA 3KMUA 1J91A 2BFYA 2VNWA 3DAJA 3FI3A 3O17A 3QU0A 4FZDB 2QU6A 3DOGA 4WG5A 4YLLA 2ITXA 2V5QA 4O2ZA 3OTUA 4BVUA 2HXLA 3ANRA 4M69A 4C4HA 3QUPA 2Y9QA 4GJ2A 5ETFA 2R7BA 2XNPA 4O0XA 3DXPA 5EH0A 5T3QA 1GZKA 1DS5A 3FLYA 3K5VA 3TZ7A 3MJ2A 1YXTA 4AFJA 5IA3A 4J96A 4FTRA 1Y8YA 1QMZA 5BVWA 3MH3A 3RWPA 4CKJA 1YWVA 3FXZA 1ZARA 5FRIA 3PXQA 1SYKA 3ETAA 3QTWA 4DGLC 1OBDA 2AUHA 4DLJA 2Q0NA 3BLHA 3D94A 3MDYA 5ANOA 3SW7A 4CLJA 3AQVA 3KVXA 3C5IA 1BMKA 3UP7A 5HGIA 5T6KA 4WG4A 2JITA 1QPEA 3RNIA 5CEOA 4RIYA 5M4UA 3GCQA 3S1HA 3GT8A 4IJ9A 4IAIA 2J90A 4KABA 4RLKA 4TTHB 2RG5A 5B2LA 4U6RA 2PVNA 2VZ6A 2X4ZA 5BVEA 5FM3A 2G2FA 4DEAA 4RFYA 3UO6A 4BDDA 5IUHA 1F0QA 2E9PA 5IQHA 5FWKK 5J1VA 5L6WL 4MXAA 5M06A 2BIKB 3I0QA 2ZB1A 4YU2A 5EQPA 4LL5A 2OH4A 5KHWA 2PK9A 2WQOA 3LQ3A 4QPSA 5AP7A 3LXLA 4EOJA 2OJIA 4FTIA 4DCEA 5K0KA 2CPKE 2R3HA 2YCFA 2CLXA 3MPMA 3KXHA 2B9JA 4ITIA 3MH2A 4I5MA 5D1JA 3V6SA 4IZYA 1QPJA 4RIWB 4YSMA 5CYIA 3RPSA 5E9EA 5KMMA 2QCSA 4PWNA 4AOTA 1OIQA 4IWOA 2R3JA 2XCKA 3QA0A 1URWA 3DDPA 4DFNA 3L9PA 2X7GA 5AV2A 2VTRA 4DG2E 5AA9A 2XYUA 5HBHA 1SZMA 2R3OA 4EKKA 3KF4A 1UU3A 4C3RA 3IKAA 4BI2A 1LP4A 4B8LA 4PMPA 2UZNA 1ATPE 1KE8A 3VHEA 3VW6A 5IA1A 4FSWA 4X3FA 3EFWA 3G9NA 2ITVA 2XM9A 3TWJA 3R7VA 4WSYA 3FHRA 4WG3A 2BRHA 5CF6A 3COKA 5L8JA 5D12A 4FTOA 1MRUA 4FSMA 3V5QA 5HHWA 2CMWA 2UZWE 4XS2A 4FZ7A 2A19B 3CCNA 4G9RA 2GCDA 2XNGA 3F3WA 5HIBA 4ANMA 3W32A 4IX3A 2YJRA 3OWKA 2C6DA 4IWQA 2JD5A 3K3JA 2J50A 2W4OA 3AXWA 3AD6A 3D5VA 4TRLA 3E7VA 2I0YA 3KRLA 2GS2A 3CQWA 3QD4A 2XIXA 4HW7A 5DG5A 4BDBA 1YWNA 5LMKC 3DJ5A 4DH8A 3HVCA 5F4NA 3LFFA 4DT9A 2Y6MA 3R21A 4O6EA 5HESA 2J0JA 5AADA 1TQIA 4U44A 3WF9A 1PXOA 5KKRC 5BUEA 2X8IA 5J7HA 2UUEA 3PLAE 3GENA 4L53A 4M67A 2VWUA 5E1SA 3ZS5A 4ANBA 3FHIA 3JYAA 3QUEA 3ROCA 5A14A 4FNXA 5ITAA 1H1QA 1UNLA 1ZY5A 4XRJA 3BZ3A 3C7QA 4F9BA 3N9XA 4GIHA 5KMIA 4D2TA 4FT3A 1XH8A 4J7BA 4AX8A 1FVRA 2NP8A 3DB8A 2IW9A 4ZTMA 4IAZA 2IG7A 4FSZA 4QMPA 5AM7A 3OP5A 4UYNA 4A9TA 3PIZA 3NCZA 1R1WA 2BDFA 3GQLA 2UZUE 2ETMA 4G3DA 5BVOA 4I6BA 3JY9A 3OF0A 4OTIA 3ZUTA 5E8WA 4AT5A 3F3VA 1S9IA 3DV3A 3QX4A 4GG7A 3RTPA 2V7OA 3OW3A 2I0HA 3MSSA 4JDKA 3TTJA 1YWRA 3QLFA 4FTAA 4GUEA 3IGGA 2BR1A 4QP2A 3R6XA 4F0FA 2W1CA 3OOGA 4PX6A 4TNBA 4MNFA 2JDVA 5M4CA 4DH3A 3F69A 4FK6A 5LCKA 5KNJA 2HZIA 4QP8A 2B55A 2I40A 3LFBA 4DEGA 5GZ8A 3ENMA 5HE2A 2GHLA 3ORPA 2QNJA 2IZUA 4PDSA 5A4EA 1Z57A 4GFGA 3TL8A 2HW6A 1A06A 3P7BA 4ITJA 2BVAA 1H25A 3R2YA 1QCFA 4IX4A 3EJ1A 4FV0A 4X3JA 3BX5A 2R7IA 2ZVAA 1G5SA 3EL7A 4NT4A 4EWQA 4UZHA 3E92A 1PF8A 2YCQA 3IDCA 4E5BA 4LRMA 5B0XA 1YOLA 1H00A 2PY3A 4D5HA 3NUUA 3HMIA 2GNLA 3FLNC 4BTFA 4UX9A 4EH5A 2OJFE 5FUTA 2BMCA 3F2RA 3A61A 1XKKA 2GMXA 3BHHA 1Z5MA 2J0MB 2YN8A 5CU6A 2UW3A 1E9HA 3SRVB 4KIKB 4F70A 5HTIA 4XV9A 4G2FA 4U41A 3VUKA 4AE9A 2CKQA 2CDZA 3JY0A 5IF1A 2VTNA 4XOZA 1M52A 2YDIA 4BB4A 3I7BA 4IZAA 1H0VA 1FMOE 3Q6WA 4FBXA 4C7TA 3ZFMA 5BVNA 3JUHA 3ORNA 3OZ6A 4FEQA 4AZEA 1W7HA 3H3CA 3W2SA 4KKHA 4CLIA 2XUUA 4E3CA 3DNDA 4RJ5A 4M0ZA 5JFVA 4N70A 1QPDA 5EM5A 3BIZA 3ZZWA 3RK7A 4ARKA 4NM5A 3VS1A 3PP0A 4NH1A 3UZPA 5K3YA 1J1CA 4ENYA 5HORA 2C3JA 2YACA 4RIXA 4XCUA 4ACGA 4L6QA 3TM0A 4GT5A 3VF8A 4E5WA 4AW5A 5A3XA 5AEPA 4X2GA 3ORLA 3F88A 3FSKA 3IO7A 4F7SA 2JDTA 4MF1A 4EC8A 3ZFXA 4RJ4A 3I0OA 2EXEA 5CSPA 4CT1A 4ZZNA 2UW8A 4E93A 3GC8A 3ZSGA 5JSMA 4UZDA 4BTKA 5A6OA 3VNTA 1LUFA 3ALNA 4L7FA 2G15A 2XNNA 3MFRA 4Y5HA 5H9BA 2YIRA 3LMGA 4FL2A 2W96B 5CSWA 3DQXA 4G3FA 4GVJA 3AMAA 5HBJA 2QKRA 3REPA 4ASDA 2EB2A 5CXHA 4I93A 3CY2A 2CJMA 2E9VA 3F6XA 4JNWA 3FSFA 5AWMA 3LXNA 4TN6A 3RHXA 3ZRMA 1KE9A 2REIA 4Y85A 3E3PA 3NS9A 3FYJX 2BRMA 2UZDA 3OHTA 4P7EA 4QNAA 3V01A 4IACA 3A2CA 4I0RA 4AF3A 3AD5A 4QQ5A 4DFXE 5KE0A 4PP9A 4AN3A 5J9LA 3S3IA 4QPAA 1Q97A 5ANEA 4GCJA 4S32A 4YNEA 3E5AA 3MB7A 1WCCA 3PP1A 1YDSE 5IQIA 3IOPA 4QTDA 2YCRA 3QKLA 2XBAA 4YZ9A 3W8LA 2A2AA 3NAXA 2RIOA 1NY3A 3UVPA 1ZOHA 3D9VA 2OH0E 4NU1A 4RQKA 3OCTA 4P5QA 5IZFA 2C69A 5KMNA 3OXZA 3RMFA 4KIQA 5CU2A 4DFYA 4XHKB 3P7CA 3GQIA 5HVKA 3ID6C 4KBAA 2X2MA 3OROA 5FQDC 2ZV8A 3MH1A 4YJUA 1FMKA 3PY3A 3MS9A 3FZ1A 3FL4A 4BDGA 5LVLA 5AP6A 2W1IA 3QZFA 4H1MA 4OT6A 2VWBA 4ALVA 1PKDA 3QALE 3UQCA 3PJ3A 4FL1A 5IMEA 3MV5A 3TKUA 1YKRA 2HENA 3ENHA 4LV8A 2ZDUA 4CFUA 4FA2A 2JAMA 2W4JA 4PY1A 4YC6A 3IW6A 4TXCA 3CKXA 2PVYA 2P33A 2BRGA 2PVMA 3E87A 3Q4CA 4JIKA 3C4FA 4MVFA 1ZYCA 5TR6A 1TKIA 2IW6A 2J0LA 3E64A 4EK4A 3EQIA 4GS6A 4J8MA 5IU2A 3TUCA 3TDVA 5M09A 4BCNA 2O2UA 4O96A 5ANJA 3KMWA 4YJNA 4U5JA 2CKEA 4GV1A 3RI1A 4GT4A 3FDNA 4G6LA 4MH7A 3POZA 5HE1A 4F9CA 4FIEA 1MP8A 3UOHA 4AOIA 4AS0A 4BDKA 4UXLA 3UZRA 3QA8A 3NUSA 4L42A 3VO3A 5CI7A 5EYKA 3W1FA 4BDCA 3DY7A 3FMJA 3GU5A 4NM7A 4NKSA 4TL0A 4MD9E 3BGZA 3QQUA 3PVWA 3QTXA 2F57A 5TKDA 4BY9E 4RIWA 3Q4UA 4MXZA 5GJGA 5HBEA 2PMOX 3WIKA 4TWPA 4BKYA 4O0TA 1OKZA 5GHVA 3R8PA 5CEPA 3SGCA 1WBPA 3ZCLA 4CYJA 1ZMUA 3QKKA 2CHLA 5CVHA 5M07A 4AACA 5IISA 4C62A 2JLDA 4LOQA 2ZM1A 3KREA 3DT1A 4K18A 3L8VA 3R73A 1OL1A 5ETAA 3E93A 4DTBA 4K1BA 4F6WA 3DLSA 3P86A 1H1SA 3LFNA 4NW6A 3ODZX 4EQCA 1UKHA 2B4SB 4I21A 3SW4A 5DRDA 4PMTA 4FV5A 2W05A 3HZTA 3QQHA 3NMUF 2VGPA 4KSQA 4JOAA 4DBXA 3EQRA 4FG8A 3IG7A 2YCSA 5A46A 4U0IA 3I60A 5JH6A 4O81A 5KO1A 4D4YA 4IX6A 5HLNA 1AD5A 4EK5A 4WOVA 4IC8A 4MD8E 3LMIA 2LGCA 3HUBA 5JGDA 3KK8A 5GINE 2JBPA 3FKLA 2C47A 2JIIA 4R1YA 3EQCA 4PPCA 3MA6A 3NPCA 2PZ5A 3P5KA 3LPBA 4S33A 4TKSA 1HCLA 4IXPA 1R39A 2WHBA 4ZTRA 4ANQA 5BQ0A 2I7QA 3DJ7A 5I9XA 3NGAA 4CXAA 2BZIB 4GK2A 1OBGA 4IZ7A 4QYHA 3EYHA 3V5JA 2C68A 4IAYA 4QD6A 4W9WA 4GFMA 3I7CA 3FPQA 3MGYA 3HA8A 3QGYA 5HVJA 3VJNA 2R3IA 3UE4A 2BCJA 4I20A 4IQ6A 1OPKA 4FL3A 4MEDA 5I3OA 3Q4TA 4FIFA 2IN6A 4FK3A 4RVTA 1JSUA 4E26A 4D28A 4Z7HA 2ZV9A 3LE6A 4DT8A 4XG3A 1K2PA 3DB6A 3QTIA 4MXYA 4C3FA 3RPYA 5JMSA 3BEGA 2WELA 1KOBA 3MJ1A 3O7LB 4L46A 3L1SA 2R9SA 5EQYA 2UW7A 2G2IA 3MY1A 4K77A 4CFNA 4PUZA 3ZBFA 2QURA 1XH9A 5L2QA 4Y95A 4F4PA 4ZS4A 2BTRA 4TYEA 2W1FA 4R3RA 3ULZA 3CQUA 5KUPA 5JZJA 3B8QA 4J53A 5L2WA 4LL0A 2GNHA 4FKQA 5TF9A 3R7UA 3VS7A 5LARA 4H3PA 2G1TA 5HU3A 2JIVA 3QQLA 4O6LA 2VTPA 4BCFA 2QHMA 4ZTNA 3VN9A 3ZLXA 4C34A 4YZNA 4HZRA 3GU6A 3RKBA 2XK4A 3PG1A 1QPCA 3UQGA 3DXQA 3HECA 3TV7A 4XG2A 4O0UA 4W4XA 3RP9A 4TY1A 4Z3VA 2BHHA 3EOCA 3V8SA 1R0EA 3K54A 4LYNA 1OMWA 2YZLA 3BLRA 4HCVA 4EJNA 4F99A 1W83A 1WVYA 5DEYA 5JQ5A 4G3EA 5JN2A 3EKKA 3P78A 4XV2A 4F08A 5L8LA 1S9JA 3MA3A 4HJOA 3BHYA 3P4KA 2P4IA 4LOPA 2PU8A 5HG8A 3SRVA 3FZSA 3VS6A 3KRXA 4JR3A 4O0WA 2VO7A 4O82A 1MUOA 3P79A 3GB2A 4DG3E 4GYGA 3R1QA 4BGHA 3GFWA 3VC4A 2VNYA 4ZSLA 5KX8A 3DU8A 4ENXA 4YTIA 4GW8A 3HKOA 4EHEA 5EHOA 2PVJA 4BTMA 2C3KA 2V55A 4QMWA 3OXTA 1HOWA 3NRMA 4CEGA 4JDIA 3PVUA 3HRBA 2GNFA 2UW9A 3EQHA 2RG6A 4NEUA 5G6VA 4YURA 4LV5A 4XRLA 4CKRA 4YC8A 5EOLA 3CC6A 5LVOA 3FI8A 3HRFA 1VJYA 3AC1A 2WIPA 3WZUA 4EHVA 4YR8A 4XX9A 3TNIA 3WYXA 1JLUE 4K6ZA 3ANQA 4OTHA 4O21A 4YLJA 3QYZA 2IVSA 4ZAUA 3PSDA 3EMGA 3LFDA 4TZRA 4HGEA 3LKMA 2WTWA 2BPMA 4EOKA 4OAUC 3Q2JA 4R78A 4BHNA 4BI1A 5ANDA 1CM8A 2Y4IC 1OPJA 2XK6A 2VTAA 3SXFA 2RSVA 3ORIA 2CN5A 2EWAA 2R64A 4LRKA 2BRBA 5AP1A 4MTAA 3TJCA 4TWNA 3HGKA 3U9CA 4I4FA 4FICA 3ATSA 2JC6A 5IQEA 3Q32A 4UN0C 4FV9A 1DI8A 4GRBA 4R7HA 4BYJA 3ROYA 1YI3A 3R8ZA 2XNEA 3UNJA 3W8QA 4K0YA 5EDQA 2KTYA 2I1MA 3ORXA 4YBJA 5KMKA 4C4EA 2Z8CA 3FMNA 3V6RA 1UV5A 4HNFA 1URCA 5FBNC 4AW1A 4RLLA 4DEHA 3CEKA 2YHVA 1JSTA 4H3QA 3BYOA 4FTTA 2W5HA 3UJGA 3FAAA 2GNGA 5JFWA 4JT3A 4QMOA 3G5DA 1OL2A 2OIDA 5M08A 2XJ0A 3ORTA 3HV6A 2WEVA 2X2LA 3ORZA 4I0TA 4NTSA 3KXNA 3UDBA 4GU6A 4AZSA 3K3IA 3QBNA 4K9YA 4FV1A 3PJCA 5EYDA 1JKKA 4BWPA 1BI8A 4J99A 4WT6A 3TNWA 4AP7A 3PIYA 1KSWA 4X0MA 3AMYA 5DH3A 2CN8A 5EW3A 3QWJA 3DS6A 4XV1A 3UGCA 4IFGA 1U5QA 4JQEA 2ESMA 4R1VA 5DPVA 3VUHA 3UC4A 2VTQA 4YJOA 2OU7A 2ZV7A 4YNOA 5AUVA 3NVKI 5D41A 1WBSA 3QTUA 4CRLA 3LLAA 4KNBA 3NYVA 5EI2A 4W4VA 2W5AA 3C51A 5BPYA 5H8GA 5L6OA 4FNYA 5HX8A 5E8VA 4FOCA 5K9IA 3R7IA 3R71A 5K0XA 4N6YA 3F3UA 4MHAA 2VN9A 4TWOA 4O0RA 4AAAA 4ANSA 3ZC6A 3LCTA 3MVLA 3FMDA 4D9TA 4ANNA 5IH5A 2UZVA 2PUNA 3Q2MA 3KULB 5ETIA 4AZVA 5M53A 2UZTA 3G2FA 4WNOA 5DT4A 4IVCA 4GU9A 5CVFA 3CLYA 3DPKA 1ZWSA 4L9IA 4RWJA 5E90A 4AW0A 2R3PA 1O6KA 2ITUA 2XNBA 2V7AA 4QNYA 4U8ZA 3FKNA 4DGMA 2QLUA 3BYUA 3HAMA 4C38A 4ANLA 3BYVA 5HE0A 4EK6A 2W9FB 2WAJA 3TI1A 2ONLC 3D7TB 5CF4A 5I9VA 3MESA 4YP8A 4A9UA 4C58A 1PMEA 1KE6A 3HMMA 3RGFA 5HOAA 1OZ1A 4I1ZA 5D7VA 4RWIA 1T46A 4CV9A 1ERKA 4RVMA 1WBTA 3TZ8A 4E6AA 3B2TA 5EYMA 3VUTA 2FUMA 2RFNA 3EZRA 2A0CX 5CXZA 3D0EA 4O86A 5HVYA 3KRJA 4FT0A 3QF9A 5D10A 4CQEA 3FQEA 3LCDA 4GMYA 5CENA 5F1ZA 4FG9A 3PRFA 4IIRA 2YISA 4J98A 1KUTA 4FKRA 3EN6A 2X7OA 4HOKA 5C01A 5C8KA 3TXOA 3C0GA 3HA6A 3MI9A 1Q41A 3VS4A 2Q83A 4E6DA 2UVYA 3GXLA 1M2PA 4IC7A 3HL7A 4MWHA 1RQQA 2X6EA 3BBTB 3QKMA 3KXMA 3WBLA 2E9UA 2YIYA 3KY2A 2OXDA 4DC2A 3GP0A 3IDPA 2B9IA 5CLPA 3R02A 5BUIA 4ZTHA 3ZDIA 2HWPA 3PJ8A 4CG9A 3HDNA 4YMJA 1BL6A 5HO7A 2UZEA 3QHWA 3ZUUA 2PHKA 3T8OA 4L00A 3ZM4A 4ZSGA 2ZMCA 3MBLA 4JBOA 5FP6A 5L3AA 3LM5A 4QRCA 3IW8A 1XR1A 4W8DA 2QG5A 3Q5IA 4YUQA 3AMBA 5E7RA 2J2IB 3PSCA 5HCXA 2WMAA 4KKEA 3ZXTA 2I6LA 2Z7LA 3G33A 4HGLA 5HU9A 1NA7A 4XV3A 2EB3A 4DEIA 2XBJA 3DGKA 3D5WA 4FT9A 3ZHPC 5HLWA 5LVPA 2QHNA 2QOQA 3OW4A 4U3ZA 4FTCA 1M2RA 4AW2A 4EK8A 3DKOA 4YTCA 2ITYA 2W17A 5BYLA 2F4JA 2OFUA 4F1OA 3QTSA 2X8DA 3EYGA 3DDQA 4C35A 2XCHA 1P4OA 3HMPA 4PL5A 1UU9A 4GEOA 2RFDA 4W4YA 4TT7A 1XH7A 3LMHA 1PY5A 3GBZA 3TACA 3IW7A 2RFSA 3FLZA 4ID7A 4A4OA 5LVMA 4MX9A 4IVAA 3FXXA 5AR3A 1OL6A 5AR2A 2QO9A 5LMBA 1V1KA 2OICA 4DYMA 4B7TA 2QO2A 1V0OA 2XIZA 3PJ2A 4Q9SA 3ZYAA 4AGDA 1VZOA 3ACJA 4QYYA 3ZEPA 1P14A 4NKAA 3H10A 4EH9A 3EN9A 2UVXA 1J7IA 2VWWA 2YZAA 4FKLA 3V5WA 4XMOA 2F9GA 5CZHA 4H58A 3PTGA 4FKPA 3V5TA 2I0VA 3IK3A 1XBAA 4EH3A 2BHEA 3C4CA 3QD2B 4IM2A 1P4FA 4PTEA 2YDKA 3UMWA 5LWNA 1WMKA 3CPCA 3OTVA 4OR5A 4FEUA 4GUBA 3SG8A 4ZJIA 3ZONA 3LHJA 3DCVA 2HY0A 1YOJA 1H08A 5BMSA 1YOMA 4ZY5A 1PHKA 4RQVA 5AMNA 1H0WA 1YXXA 4DITA 4DH7A 1H01A 4UB7A 1GJOA 4QTEA 3DTWA 2VAGA 3O0GA 4TYJA 5J95A 3AC2A 4XNEA 4LFIA 1RE8A 4HYUA 4RT7A 2BUJA 5ACKA 3SDJA 3U4UA 3V04A 4CFMA 3T9TA 3V5LA 4RX8A 3ZO2A 1H8FA 3DNEA 4NTTA 1YDRE 5DI1A 3MVHA 2X1NA 5CAOA 3OCSA 4UALA 4AA0A 2BFXA 4S31A 3CP9A 3H4JA 5JQ8A 4UMTA 3R8UA 4NM3A 4TW9A 1SNUA 2P0CA 4IB1A 4PNKA 1PMUA 2OSCA 3RJCA 4FEXA 4LUEA 1ZLTA 2XKEA 2OO8X 2XYNA 4M0YA 3E88A 4RSSA 4V01A 4U7ZA 3Q9XA 4BGGA 4L67A 2XB7A 4RJ6A 3QCQA 1Q99A 4V04A 2OZAB 3M42A 5E92A 2XK3A 2C6EA 3KU2A 2PTKA 4S2ZA 3N4TA 3IECA 3FV8A 3PFQA 3CJFA 5L4QA 3OUKA 3MVJA 3LAUA 1OIUA 5CZIA 2O3PA 3T3VA 5CT0A 4R3PA 2YITA 1PYXA 4OUCA 4F7JA 2ZM3A 5M51A 4CG8A 3E3BX 3JS2A 4G16A 2WTKC 5KZIA 3QX2A 4D2WA 2CNVA 1JAMA 4WRGA 2GNJA 1NVSA 3NYXA 4FF8A 5DT3A 3UG1A 4RPVA 1GIHA 2NNWB 4F63A 1M7NA 4WBBB 3FMLA 4FSNA 5AP2A 3NIZA 3A7JA 2OXXA 4R77A 3WE8A 4AT4A 5CSVA 5DR6A 4ZOGA 2ITTA 3FL5A 3POOA 2XMYA 4I6FA 1Z9XA 1L3RE 2WTDA 5DR2A 4M15A 4WO5A 4FC0A 4QMSA 3U6IA 2QOCA 4FSTA 4H3BA 3U51A 5LWMA 1FVVA 2VO0A 3LZBA 2J9MA 3PXZA 4L01A 4AA4A 3RWQA 4FV6A 4LGHA 1ZYDA 3FYKX 4NFNA 2PUIA 3O8PA 4KA3A 3PZHA 5EOBA 2WFYA 2OWBA 3DAEA 5EM6A 3U87A 2CKPA 4QYGA 3F5XA 2JKOA 4YC3A 3CBLA 5AUYA 4NCTA 4C2WA 1YHVA 4FG7A 4HCTA 5L2TA 5JGAA 3LW0A 4RA5A 2VWVA 4L3LA 5JRQA 4JXFA 2BALA 3E8NA 3DQWA 3F7WA 1OUYA 2WMTA 2CGUA 4FX3A 2OJ9A 5AAGA 3G6HA 5I4NA 4Y72A 3R00A 5FBOA 3RM6A 1AGWA 4RBLA 4DG0E 4FKOA 1IR3A 5IEYA 1KE5A 1YHWA 2QD9A 3P1AA 4MWIA 2JIUA 4X7QA 3VBYA 4BTJA 3A62A 1YDTE 3UBDA 5CY3A 2F7EE 4NWMA 5CQUA 5KMLA 3LCOA 4HZSA 4WUNA 4EQUA 4HCUA 4XG8A 4WKQA 2PUUA 2UVZA 3OEFX 4F9AA 4KAOA 4ZSEA 4Z7GA 4GG5A 2CNUA 3KN5A 2WU6A 2ACXA 2XM8A 3QC4A 1HCKA 5HEZA 4TYHA 3ZRLA 3O2MA 1GY3A 5TT7A 3RK5A 2WXVA 3U4WA 3PA5A 2C1AA 2XZSA 3A8WA 4I22A 4KINA 3RBWA 5A54A 3BU3A 3DFAA 2VWIA 3EKNA 3NYOA 5IH4A 4BKZA 2QI8A 2YAAA 3KULA 5E8TA 3U6HA 2W4KA 2QOLA 4X2FA 1FBNA 4CFVA 2GQSA 5I9YA 4OTRA 1ZMWA 3HYHA 5KCVA 3LJ0A 3WZJA 3BGPA 3NR9A 5BNJA 3DK7A 3NNWA 4M84A 4XP3A 1U59A 3SKCA 1PXPA 5E91A 3RZFA 4A9YA 4D4RA 3JXWA 3K5UA 3VBVA 2QU5A 5CASA 1APME 3I6UA 4QP4A 4YJPA 4ACCA 4Q5HA 3SAYA 4DF3A 2BILB 1GOLA 2GQGA 3Q60A 4Q5EA 3D7TA 3NUYA 4EUTA 4J8NA 3MFTA 3W2QA 1Y57A 4A7CA 3A7HA 3DJ6A 4AZFA 4BBMA 3ALOA 1OI9A 2C0IA 4QYEA 4UBAA 3R8LA 4AA5A 4E4MA 5C27A 3UOJA 3FWQA 4I5PA 3EN5A 3OUNB 5JRSA 2ITPA 4JS8A 4HYHA 2IVUA 3BKBA 4FZFB 4LMNA 5AR5A 1K9AA 3LIJA 5C8NA 4BDEA 3Q96A 3BHUA 3EWHA 3CXWA 2R0UA 1I44A 4JAIA 2B9HA 2NPQA 3SHEA 3D2KA 4G6NA 4CZTA 3G15A 4BYIA 4CFXA 4D1XA 5KBRA 5DOSA 1ND4A 2YWPA 2HYYA 3DFCB 4B0GA 3GC0A 2J51A 4ZXTA 2WNTA 3EL8A 2X4FA 2HELA 3OBGA 2C6MA 2C0TA 5D9HA 2XKCA 4UMRA 3G51A 1W8CA 5JZNA 5IUGA 3MIYA 4G1WA 4X3FC 2GFCA 2ITOA 4GH2A 4FUYA 3P7AA 4C8BA 3JVSA 2PVLA 4BZOA 4MKCA 4NIFB 4WUAA 5K4JA 4IANA 2FSOX 3KQ7A 1VR2A 3CY3A 3M11A 2C6TA 4F64A 3VULA 5E8XA 3CS9A 2NRYA 4HVIA 2JDSA 3U6JA 4YSJA 4FKSA 1OB3A 3FEGA
chains in the Genus database with same CATH superfamily
5CAVA 1ZRZA 1NT2A 1VLRA 1Q8YA 3AT4A 2F7XE 4DFZE 2GFSA 3QGWA 1KV1A 1REJA 4I3ZA 3UO4A 5CAQA 3QRJA 4BZDA 3FLSA 2R5TA 5HCZA 4ZY6A 5IEXA 2QLQA 2WTCA 4EHZA 2GDOA 4QT1A 2R0IA 1DAWA 3GEQA 2YM7A 3D15A 5C1QB 3QZHA 1FINA 1DI9A 5IQCA 5HIDA 3ZXZA 3HDMA 5CT7A 5F95A 3TDWA 5A4QA 2XALA 3SG9A 3FC2A 1WVWA 3UVQA 4EOSA 3VIDA 2GS7A 2QONA 2VTTA 4IMYA 3NUAA 1XH6A 4CMTA 2XIYA 5J5TA 4DEDA 4F6UA 2C5XA 3MYGA 5AUZA 3MW1A 3R7GA 2GQRA 5KKRB 3C0HA 3L8PA 4CV8A 4F65A 2X6DA 2ETKA 3C4WA 4HVDA 3WILA 3QZIA 4DFLA 1P5EA 4CMUA 4MXCA 4IWDA 3OT3A 5CU0A 3LJ2A 2FYSA 4E5AX 2OKRA 4D2SA 4FKWA 4RWLA 3K2LA 1CKJA 4M66A 1UA2A 4YZBA 3MY5A 2QVSE 3UNZA 4CSVA 2RKUA 4APCA 5H8BA 4AT3A 5GJFA 5CEIA 3RAIA 3O51A 4NJ3A 4MCVA 3OWLA 5AP3A 4AN2A 3SXRA 4EYJA 4FV7A 4J1RA 2XK9A 3OWPA 2FA2A 5EHYA 4JI9A 3HV3A 4AN9A 5HTCA 3IONA 3DZQA 4G31A 1IA8A 4PDOA 3O50A 4KRDA 3RHKA 3L9LA 1NVQA 2C4GA 2OI4X 4QMXA 4MBLA 4RGJA 3CE3A 5IMXA 4O4CA 3G9LX 3IS5A 2F7ZE 4AFEA 3BLQA 3CQEA 4I4EA 2XH5A 3UMXA 1BX6A 2W1EA 2JFLA 2XRWA 3HLLA 1PXLA 3FLWA 2UV2A 4X2KA 3QTRA 3NNXA 4KIOA 3BV3A 4QQJA 5AIRA 4E8AA 5FDPA 2DQ7X 4ASZA 4QEBA 3D4QA 3Q9YA 4QYFA 3VF9A 3NNUA 3PPZA 4ZZMA 3UP2A 5JK3A 3F2NA 4TYIA 2XK8A 3QXPA 3FC1X 1PJKA 4G6OA 4U45A 4I94A 5H3QA 1VYZA 4AZTA 2W99B 3KCKA 3E8CA 5HQ0A 2WTIA 3R8MA 3RCDA 4BDIA 3O8TA 4LV7A 2C5NA 4O38A 4Y46A 4P4CA 5GIPE 2H6DA 3SVVA 4O7ZA 2YM6A 2DUVA 3RCJA 3MN3A 4JBVA 4C2VA 2UZBA 4OLIA 3AD4A 3AGLA 4NFMA 3R04A 4D2RA 5HO8A 4F7LA 5DMZA 4ASEA 4MQ1A 3MY0A 3A7IA 4BKJA 1VEBA 2OZAA 2FB8A 2WEIA 3JPVA 1E1XA 2B52A 2YEXA 2B1PA 4FIJA 4QMLA 2H9VA 3N51A 1SM2A 4IW0A 2KULA 5HI2A 3OFMA 4U97A 4G3CA 5BMMA 3NIEA 3PIXA 2OXYA 2WQEA 3VJOA 1Q3WA 2X39A 4BDJA 3DKFA 4W4WA 4GIIA 4YJRA 4KD1A 3WF7A 4KS8A 4BDAA 3IDBA 4ONAA 3VRYA 3WI6A 4BICA 1IRKA 3BELA 4OTWA 1TVOA 3QRTA 3U9NA 1QL6A 2ETRA 3OXIA 3GU8A 2WD1A 4O27B 4EWHA 1Y6BA 4GK3A 4E6QA 5ANIA 1CDKA 5K5NA 4WD5A 2Y6OA 3UOLA 4Y5QA 2CNQA 3HX4A 1PMVA 4D4SA 4BCPA 4O4EA 5EYCA 3LXPA 4QTCA 5A4LA 3UOKA 3W18A 2QC6A 4BL1A 3D14A 4O7VA 1PXIA 2W9ZB 4A4LA 4O91A 4O84A 3W2RA 4BF2A 2RGPA 4MXXA 5JKGA 3L9MA 5GJDA 1SVEA 2BAJA 2IJMA 3BU5A 4IDVA 4BCHA 3FQHA 4YO4A 4QP9A 2B0QA 3DBQA 3R28A 3ZEWA 3R1NA 3AC8A 2G2HA 4HYIA 4DFUA 2IZRA 4ZTLA 4EOLA 2OJGA 3FMKA 2UW0A 3F5UA 5LCJA 2R3GA 3ORKA 1PXJA 1Q3DA 3RZBA 3H0YA 4UWBA 2C0OA 5AX9A 3Q5ZA 1FGKA 4AXCA 3FZOA 4QPMA 4GK4A 4USEA 4RIOA 5EW8A 5AP4A 3VUDA 1OUKA 2LAVA 4C37A 2PE2A 4F9WA 1W0XC 2YERA 3MTLA 4IEBA 2GHGA 3PE2A 4FTJA 3QTZA 4FZAB 4KIKA 5AR7A 4FNWA 5AUUA 2ITQA 5KBQA 4L43A 2BDWA 4KBKA 4R8QA 5CALA 4OGRA 2P2HA 1W82A 3V8WA 1JNKA 5E8UA 4OTDA 4TPTA 4DA5A 5L6PA 4WHZA 4BCGA 4UWYA 1Q8WA 4BR3A 4UXQA 4D0XA 4XBUA 2C6OA 3A7FA 4M12A 3RALA 3BBWA 5BUJA 2YM4A 2WGJA 3ZLYA 3KEXA 1EH4A 4LG4A 2AC5A 5C9CA 4UMUA 4RVLA 4QP7A 5E8SA 2YFXA 5CI6A 3QZGA 4NJDA 5DVRA 4ZLZA 1CMKE 5ACBC 1V0PA 2CGWA 2PMNX 2SRCA 1FPUA 2ZOQA 4WNPA 1DM2A 3RVGA 4ZP5A 2B53A 4G3GA 4L68A 2XIRA 5E8YA 1Y8GA 3D5XA 1GZOA 4NW5A 5I5ZA 3COHA 1SVHA 3D2IA 2QOFA 5CU3A 2WKMA 3RAKA 3KA0A 5C26A 4DCAA 4PDPA 5AP5A 1B6CB 2OG8A 3M2WA 3TKIA 3VQUA 5AR8A 4XUFA 5LOHA 1PXKA 3HNGA 5LXMA 3CR0A 3KK9A 4MF0A 3VW8A 2ZM4A 1U46A 1WBNA 3Q53A 4PMSA 4XOYA 2UW5A 5AV0A 3BWFA 2IW8A 3A60A 2YIXA 4O1OA 2R3LA 1NXKA 1OIRA 1B38A 2VO6A 3KXGA 4MBJA 4PPAA 3PVGA 2CGXA 3OOMA 2WMVA 5FGKA 2Y0AA 3FMMA 1KV2A 4B99A 4FYNA 4TYGA 4O7YA 1X8BA 3BLAA 3PPKA 3BV2A 3F7ZA 3GCUA 3A99A 4EBVA 4AGWA 1CTPE 4L44A 3D83A 2GTMA 4YHTA 4WNKA 4EH4A 1OKVA 3NLBA 5KMJA 3UNKA 3GUBA 1XMLA 2GS6A 2WMSA 3LFEA 4CT2A 3GNIB 3OS3A 1H1PA 4ANOA 1UWHA 4C3PA 2W1DA 4IVBA 1FVTA 3VRZA 3ZZEA 4C4GA 4MXOA 2F49A 4PV0A 5ANKA 4BGQA 3PUFC 4KB8A 4BWXA 3ATTA 3DXNA 5AP0A 3SOAA 3TNQB 1FOTA 2JFMA 1W98A 5FP5A 1KOAA 4NIFA 1OGUA 4HPUE 3W33A 5AM6A 3E63A 4FR4A 4FSYA 3EQGA 3PRIA 3OVVA 3VWAA 2WOUA 2JDOA 3FPMA 3OT8A 4V05A 5EM8A 4RC4A 3UIUA 3R0TA 3T3UA 1YW2A 3MH0A 1MRYA 4I6HA 3TCPA 4B9DA 4U9AA 2C5VA 4QMUA 5C4KA 5BYZA 3OBJA 4PTCA 3BPRA 4ERWA 3WF5A 3FZRA 2VRXA 4PNIA 1XWSA 4ACDA 3NWWA 2E9NA 4AGUA 3VS2A 2PMLX 3LXKA 3CKWA 4XLIA 3R30A 3UIMA 4RRVA 3OCGA 3QD3A 1UKIA 3TIZA 1GIIA 4HGSA 3BU6A 4FTUA 5LMKA 4XP2A 4QQCA 3P23A 1ZYSA 3EZVA 4ZLOA 2C3LA 4LUDA 3TT0A 4C57A 2ZAZA 2YDJA 4X6QC 4ZJVA 3MPTA 4EL9A 4U79A 3DTCA 4FVRA 2YABA 4IB0A 1OKYA 2BAQA 4FTMA 2WU7A 4RZWA 1Y91A 5ANGA 2WPAA 3UODA 5M55A 4F7NA 4AG8A 3OCBA 2WOTA 4JG8A 4R5SA 5L8KA 4AXEA 4FSQA 3KMMA 1M14A 4IB3A 4YHFA 4BIDA 1L8TA 5BV3A 3GCSA 4FT7A 2ERZE 3NNVA 3RPVA 3R8VA 4JDHA 4EBWA 4L3JA 4RX9A 1P2AA 3TV4A 3VS5A 5JFSA 2OLCA 2B9FA 2CSNA 3LVPA 4EORA 1KWPA 1GNGA 4ZMEA 3DA6A 4OTPA 5IQDA 3MWUA 4D58A 2C30A 4R5YA 3QRIA 2YM8A 4HNIA 1A48A 1OIYA 2CLQA 3JVRA 5AV4A 2EUFB 3FI2A 5BVKA 3HEGA 4FOBA 5EW9A 5TE0A 4AE6A 3BWJA 4FIIA 4PL4A 3GC9A 4ZSAA 5EKOA 4KS7A 3O7LD 3S0OA 4U3YA 1YQJA 1XHAA 3ZO3A 4LRJA 1SNXA 4IADA 3ZO4A 1K3AA 4DAWA 3WF6A 4NZWB 4O0VA 4FI1A 4MQ2A 5EI6A 4TWCA 4D1SA 2YLFA 4E4XA 4EOQA 3TUDA 5EDPA 3C0IA 1MQBA 2ZV2A 4FTKA 4ZTSA 4KUJA 1ZY4A 1WBWA 2Q0BA 4C36A 4XLVA 4BHZA 3L8XA 4GYIA 3Q4ZA 3E8DA 5CSHA 4ZK5A 2IZSA 3FMEA 3NDMA 5FTOA 4ERKA 1H28A 2X0OA 3QFVA 1PMNA 3QUDA 4FKJA 3MFUA 3U55A 5CAUA 3ZM9A 5E4HA 3TJDA 3KKVA 3ZBXA 5K5XA 4BFMA 4I92A 4EOOA 2YA9A 4C61A 4CGAA 4QP6A 1PXNA 2H34A 1J1BA 2ZB0A 1WZYA 4FE2A 2PULA 3F82A 4M68A 5IG1A 4FKIA 1A9UA 3W0OA 3R01A 5IDNA 2CCIA 5CS6A 2YJSA 4OT5A 1VYWA 3W0SA 4C59A 2AYPA 3PA4A 3VS0A 1MQ4A 1ZZ2A 3CD8A 4YZDA 4CTBA 4P90A 3EQDA 4CRSA 4QMZA 5HIEA 4EONA 4IE9A 5FEDA 3CIKA 2O5KA 4FZ6A 4DTKA 2C5OA 3SLSA 4JQ8A 3Q9WA 3N4VA 3BQRA 3JR1A 3I81A 5D7AA 3KFAA 3ELJA 3WOWA 4JR7A 5HNGA 4J71A 3KB7A 3S00A 2GU8A 4K2RA 4NM0A 1FGIA 2R3NA 3CPBA 2IVTA 5K4IA 5FG8A 3UG2A 3CSVA 3GCPA 4DE4A 3EHAA 1G3NA 2WMBA 4YBKA 2BZHB 3UQFA 2AEGA 2V22A 2Y4IB 3A4PA 5AV1A 1H24A 5HO6A 2ITZA 5HD7A 4EZ7A 4CKIA 2OJJA 4I6LA 1LR4A 3VBWA 4B6LA 4E6CA 5EK7A 5AX3A 5HG9A 3QCXA 3EIDA 3II5A 4XG4A 3R9NA 3GGFA 2XVDA 3ZU7A 3UIXA 4RC3A 2BKKA 3RK9A 4DFBA 4LGGA 1BUHA 5ICPA 5IPJA 4EUUA 5EDRA 2C6KA 2RF9A 3VUIA 2ERKA 3F3TA 4XEYA 5CTPA 4YTFA 2O65A 3ERKA 4FKVA 4EZ5A 4NL0A 5F20A 1CKIA 3C13A 4L7SA 2VTIA 4O7TA 2UW6A 5GZAA 2JAVA 3HMOA 4QMNA 4DGNA 1RJBA 2FO0A 5EM7A 2Z7SA 5E1EA 2O64A 3DK6A 3ZC5A 3C5UA 3C50A 4FTNA 4CQGA 5DYJA 2X8EA 3CGFA 5H8EA 2Z02A 3IOKA 2F2CB 2XA4A 5IUIA 4EC9A 4MYGA 1G8AA 4WBOA 5DNRA 5FEEA 1M17A 3BE2A 3PUPA 5DR9A 1F5QA 3MFSA 3SC1A 4G34A 5KHXA 4YTHA 3IPHA 4I6QA 3F2AA 2JKMA 3IW5A 3FZTA 2AQXA 4ZY4A 4M13A 3ORMA 5D11A 4AU8A 5M4FA 4GT3A 5A4TA 2AC3A 1YRPA 4ZSJA 4FYOA 2X9EA 2QR8A 4RVKA 2XS0A 3NEWA 4B4LA 5TOZA 5BX0A 2WMQA 4GL9A 2XIKA 4KRCA 4ZLYA 3PSBA 3HP2A 4GJ3A 5BVFA 3HP5A 5DN3A 3QLGA 2DS1A 3VUMA 4R7IA 3KRWA 3RAHA 2XK7A 3TNHA 1GIJA 1JVPP 4APPA 2Y7JA 4AXAA 3EFJA 2OW3A 4JIAA 5FD2A 4CNHA 4QMMA 4FVPA 3R2BA 3LFCA 3QQGA 3VUGA 5F9EA 4FKTA 5B2KA 3SX9A 4MNEB 2EXMA 3OEZA 4RFMA 1H07A 3QXOA 4PL3A 4DLIA 4O1PA 2XRUA 4F0GA 3QHRA 4IM0A 4RWKA 3D5UA 3PE1A 4HGTA 4QMQA 3M1SA 4JJRA 1CSNA 3U54A 1U4DA 3NVMB 5DBXA 5AFVA 1RW8A 4ZIMA 3UYTA 2X81A 4PQNA 2FVDA 3VBTA 1JKTA 3LFSA 4UYAA 3RM7A 3SV0A 5I0BA 2GNIA 4USFA 2I0EA 3P9JA 4C4IA 3BHVA 3ULIA 4GVAA 4KKGA 4FMQA 2HAKA 3EN4A 4JAJA 4HVGA 1XQZA 4IB5A 4O2PA 1WFCA 3BI6A 4YJTA 4DDGA 2WMWA 5DE2A 4LOOA 3NAYA 3I6WA 5CAPA 2ZMDA 3O96A 4JG6A 4CFWA 1OITA 4G5JA 3F5GA 1T45A 5EG3A 5CEQA 3F5PA 2VX3A 5FLFA 4JMQA 3ZFYA 1XO2B 4Z16A 3NYNA 4ACMA 3GFEA 5IQAA 1GZNA 2FSMX 3H9FA 4PRJA 3FZPA 1Q8UA 3MVMA 2GTNA 3PYYA 1B39A 2WZJA 4V0GB 3RINA 3PDTA 4H36A 4N6ZA 4QO9A 4CZYB 4L3PA 4USDA 4C4JA 4EH8A 4FTQA 3KCFA 3PXRA 4MAOA 4GKIA 2BROA 2VTMA 4KWPA 3HV4A 4Z9LA 3UTOA 3IW4A 4FKGA 5GZ9A 3AC3A 3SOCA 4FT5A 3GC7A 4F09A 1FQ1B 2A4LA 2IVVA 1BI7A 1Q24A 4O7SA 3WARA 5DHJA 2W1ZA 1E1VA 3TEIA 4RJ7A 1O6YA 4EYMA 5AJQA 3DBCA 4A06A 3SD0A 4BBEA 3VS3A 5IA4A 1XH4A 5HICA 4BRXA 3VBXA 1IEPA 4F1MA 5CF5A 2DWBA 3HRCA 3W0QA 2OBJA 4FNZA 1AQ1A 3ITZA 4A9SA 4CTCA 3GU7A 3HMNA 3HUCA 3KVWA 3OG7A 5AAEA 5HE3A 4XG6A 3ACKA 4JBQA 4DTAA 5HG5A 5A6NA 4BI0A 1PW2A 3DAKA 5T68A 5J5SA 1OECA 2OF2A 3SA0A 2IF8A 3MPAA 4W9XA 4YLKA 2OK1A 3TZMA 2R3KA 2JDRA 1UNHA 2PSQA 2UZOA 3I5ZA 1YXUA 3KL8A 4IAFA 2EU9A 2WMUA 4OTQA 4RG0A 5M57A 1JOWB 2R4BA 5FTGA 2W06A 3O23A 4YHJA 2PVKA 3WZKA 2CCHA 3BHTA 5BVDA 4NYEA 1TQPA 1Q62A 4K11A 4JRVA 4LDTA 3LM0A 4I0SA 3PA3A 4C4FA 2P2IA 4DHZA 3B8RA 2VU3A 5J79A 2IWIA 1WAKA 3ZSHA 2YAKA 1UU7A 5JEBA 4H05A 4PDYA 1U54B 3DLZA 4ALUA 1CKPA 2VV9A 3FKOA 4TNDA 3CD3A 5AUTA 4D4VA 4B8MA 3VHKA 2W5BA 2WB8A 3E62A 3NUNA 5HNIX 3W0NA 4EI4A 4UMQA 2UZLA 1XJDA 3MB6A 5LJJA 4N4SA 3RAWA 4DH1A 4AZWA 3COMA 4EHGA 3NZ0A 3LJ1A 3I1AA 4QMTA 4BZNA 5HTBA 5LQFA 5FXQA 2XEYA 1OM1A 3QRUA 2YIWA 5DRBA 1Q5KA 5CF8A 5AA8A 1LPUA 2O0UA 3NFGB 4J97A 2P3GX 4G17A 3QAME 1TQMA 4IVDA 4DGOA 5HG7A 3QL8A 2RFEA 4E1ZA 3E7OA 3QRKA 2Y4PA 4EH6A 3S95A 3A8XA 4EH2A 3R9OA 3W55A 2WMRA 4IAAA 4D5KA 4QDVA 1IASA 2PVHA 3WE4A 3AKKA 2OIQA 2WTVA 4JLCA 4MD7E 1R0PA 2G9XA 4IFCA 2QQ7A 1ZXEA 2HXQA 4JRNA 4H1JA 4JVGA 3N4UA 1PKGA 3R1YA 3PY0A 4D55A 1O9UA 2C5YA 3BE9A 4FSRA 4YPSA 4RJ3A 4EEVA 5C4LA 2C6LA 4L8MA 3H30A 1BLXA 1M7QA 2PZPA 3MIAA 4HPTE 3PXKA 3VAPA 5IDPA 4BDHA 1BKXA 3DKCA 4LGDA 5I3RA 5J1WA 5EQEA 1RDQE 2VGOA 3F3ZA 5DT0A 3GVUA 3IQ7A 4I5CA 3ZSIA 2XKFA 3QTQA 3L9NA 4KSPA 3V5PA 4O7NA 3NX8A 5I9WA 2VWZA 3NUXA 4YZCA 3C9WA 3R9DA 4QMYA 4ZTQA 5EFQA 2V62A 4PMMA 5AR4A 4QP3A 3I79A 2PWLA 2J5FA 1YVJA 4D2VA 3KGAA 3O71A 3C4EA 5I9UA 1IG1A 3DK3A 1YXSA 4OBQA 4JDJA 4NUSA 3BGQA 4L45A 1SMHA 4O7LA 4F0IA 2FGIA 4O4DA 3TIYA 4I24A 2IPXA 4IZ5A 3RPOA 3L8SA 5CVGA 2PE1A 1PXMA 4FV4A 4BCIA 1JPAA 4F1TA 3QYWA 2W7XA 5JGBA 5L2IA 4R7BA 1ZMVA 4IX5A 1GZ8A 2E9OA 4ZEGA 4U80A 4FIGA 2X2KA 4AQCA 3MTFA 3DBDA 2WTKB 4Y8DA 4OBPA 3H0ZA 2Y8OA 4LI5A 4UEUA 2B7AA 1OKWA 2NO3A 3NW6A 2PUPA 2QO7A 2WQNA 4A07A 4EKLA 4BC6A 4AGCA 1Q8ZA 1J3HA 2VTOA 4AWIA 2HK5A 3PWYA 4UWCA 5FTQA 1OGYA 2XKDA 3PZEA 3PPJA 4PTGA 3ZLWA 1UWJA 3O8UA 3QCSA 5AIKA 3P08A 5BYYA 4JX7A 2JKQA 4EK3A 2X7FA 3OY3A 4IBMA 5CWZA 3KRRA 4DGGA 3EQBA 2RL5A 4P5ZA 1Q8TA 3Q04A 4NCTC 2XNMA 4GFOA 1Q4LA 1ZOGA 1ZAOA 4U43A 4G5PA 4M97A 2XJ2A 4I5HA 4XH6A 2OF4A 5HLPA 3ZDUA 5EKNA 4OTFA 4KIPA 3AC4A 4ORKA 3F66A 1XBBA 4K33A 4MBIA 4O7RA 4DBNA 4D0WA 4GKHA 3F9NA 4WIHA 3BL7A 2FSLX 3W2OA 1F3MC 1H27A 2H96A 3BQCA 5J9ZA 4FEVA 2PVFA 2VTJA 2W1HA 2C6IA 4NK9A 4S30A 1V0BA 4X2JA 3FQSA 1JWHA 4BIBA 5IQGA 3QQFA 4O0SA 4FV2A 4E4LA 4M69B 4BN1A 4O22A 1JQHA 2XP2A 2PE0A 4ZZOA 3OD6X 2C3IB 3TTIA 3KXZA 4E73A 3PWDA 2HY81 4QOXA 4EZ3A 4EOMA 2X0GA 3FY0A 4M8TA 3V51A 5CEMA 1J7UA 1REKA 3EQFA 3LFAA 2W1GA 4IAKA 3S4QA 3UPZA 1J7LA 2WQMA 4N0SA 1OVEA 3KC3A 1OL5A 4CZUA 1ZYJA 3FE3A 4QQTA 2ITWA 2A27A 3EH9A 4BCMA 1DAYA 4FKUA 4U81A 5IA0A 5JT2A 5J7BA 5TO8A 5ETCA 3DZOA 2Z2WA 4MNEA 4Y73A 4IDTA 5B7VA 4RIYB 5C03A 2OIBA 1YI6A 1ZOEA 4CFFA 2PMIA 2GPHA 5FM2A 4O83A 2ZJWA 1H1RA 2VUWA 5DEWA 3TNPC 4QMVA 2O63A 4R6VA 2J7TA 2WMXA 2QKWB 4J95A 1U5RA 4EH7A 1OPLA 3I5NA 3H9RA 4M14A 4MK0A 2A98A 2ONLA 3RNYA 4GSBA 3VQHA 3BRBA 4EOIA 4ALWA 4X21A 5FEQA 5AAFA 4O7WA 1PYEA 1MRVA 2VO3A 3H9OA 4YJVA 2PZIA 4DEEA 3TUBA 2PYWA 3LCSA 4YO6A 3SXSA 4PPBA 4FGRA 4G9CA 3QD0A 1XH5A 4II5A 3W2CA 2PZRA 5KMOA 3CJGA 1PRYA 2C1BA 2OZOA 3HV7A 2JKKA 3BEAA 4RZVA 5GNKA 1M2QA 2VX0A 4WSQA 3R1SA 4XJ0A 5EHLA 4CCUA 3R63A 4IM3A 3NW5A 4Q9ZA 3P5JC 4PP7A 4V0GA 4X2NA 5DLSA 4JBPA 5IH6A 3FY2A 3TN8A 3KN6A 3A7GA 3OWJA 4DHFA 2Z60A 3BYMA 4C33A 4XYFA 4IJPA 5CX9A 4LM5A 3OY1A 3PG3A 3GI3A 5M44A 1BYGA 4I41A 3QQKA 4QP1A 3LQ5A 3T9IA 4JX3A 2WO6A 5A4CA 4D2PA 4UV0A 3GCVA 1LEZA 4I23A 4JQ7A 4X3FB 5AUWA 3AOXA 4ACHA 5JFXA 2YWVA 4C0TA 4IHPA 2BIYA 4YJSA 4CCBA 1R3CA 1WVXA 3TZ9A 4OW8A 3LFQA 5DA3A 3W2PA 3PY1A 3WZEA 1IAJA 4XBRA 4YGAA 3PJ1A 4BWKA 4E7WA 3TG1A 4DEBA 2VTLA 3QWKA 4BCOA 2ITNA 1NW1A 3G0EA 3GU4A 5AUXA 3SQQA 3THBA 1UNGA 2XJ1A 3UVRA 3AG9A 3ET7A 3B2WA 4RMZA 1H26A 2H8HA 4X6RA 5FXSA 2PPQA 2WQBA 5CNOA 3NUPA 3ODYX 4FTLA 1Y6AA 3COIA 4ZS0A 3W10A 3WYYA 2VTSA 5DFPA 3AT3A 2QOKA 4IWPA 2QR7A 2IO6A 2EVAA 4YPDA 4BCJA 4D9UA 5IEVA 2BDJA 2NRUA 3R7EA 1I09A 1TFFA 3R9RA 2XF0A 2B54A 2J0IA 3GOKA 2HZNA 2QOBA 2R3QA 3LOKA 1G8JA 4RX5A 2JBOA 2BTSA 3FUPA 1STCE 4EQMA 2E2BA 3OC1A 3VVHA 2R2PA 5IKWA 3FJQE 5EI8A 4FVQA 2P55A 3Q6UA 1XBCA 4UY9A 4AUAA 1U54A 3NSZA 4YJQA 2Z7RA 2A1AB 3LLTA 2EXCX 4FIHA 3ZRKA 3EFLA 4IH8A 3NW7A 4S34A 4ZMFA 5C8MA 5FDXA 4A9RA 4R3CA 5L2SA 3R7YA 2GHMA 3UC3A 4C02A 5HCYA 5A9UA 4BCKA 1BL7A 4HVHA 4HVSA 3ZMMA 3PVBA 4L52A 2W0JA 3U8WA 3S2PA 2Z7QA 4DINA 1H1WA 3BCEA 4OAVB 1JKSA 3WZDA 3PXYA 4DH5A 4FGBA 3C4XA 3HV5A 4Z55A 4U42A 4QDEA 1YXVA 5KZ0A 4WRSA 3EB0A 3LQ8A 5CQWA 2G01A 3ZOSA 3DBEA 3Q9ZA 2FH9A 2ZDTA 2JGZA 5CU4A 1JBPE 3WIGA 4FODA 3QCYA 3ZO1A 4CYIA 2BAKA 2X0PA 4AOJA 4BDFA 5LVNA 3UZTA 4J52A 1H4LA 4WNMA 4UMPA 2HWOA 4BBFA 3CTJA 4W8EA 2IZTA 4EOPA 3P0MA 4QTAA 3UPXA 3BYSA 3UO5A 2QOHA 2ZYBA 3QC9A 4ZJJA 2X9FA 2CGVA 5J87A 4PF4A 2YLEA 4ASXA 3AC5A 3AT2A 5I9ZA 3LCKA 4CVAA 2QG7A 3RPRA 4XP0A 2WTJA 1UVRA 5HKMA 2VWYA 2YM3A 1OL7A 3ZLSA 3C1XA 5F94A 3FBVA 3PXFA 4M7IA 5M56A 2BKZA 5DGZA 4CD0A 1ZYLA 3EFKA 3KF7A 4NSTA 2QODA 5AV3A 3TKHA 1JSVA 4E4NA 2HOGA 3D7ZA 3KXXA 3V3VA 4F9YA 1IA9A 2F2UA 3QQJA 2HZ4A 3R9HA 5B2MA 3FLQA 4ITHA 3CGOA 3FXWA 5CNNA 3ZTXA 2DYLA 3G0FA 5LMAA 3PLSA 2YIQA 4A4XA 2BZKB 4RJ8A 5IQFA 5CEKA 4O0YA 3R83A 3BL9A 4TYHB 4FV3A 2VWXA 4XG7A 5FXRA 4KBCA 3Q3BA 1O6LA 2FSTX 2PZYA 4E20A 4YZMA 2BZJA 3E8EA 2WIHA 4OTGA 3V8TA 4FUXA 3F61A 4RA4A 1NVRA 4H39A 4RFZA 4RIXB 5DIAA 3FMHA 4LMUA 1Q61A 2OGVA 4JG7A 3AGMA 2J0KA 3C4ZA 3CTQA 2HCKA 5IQBA 3EQPA 1JKLA 2JEDA 3EN7A 3IGOA 1WBOA 2VTHA 1LEWA 2QOOA 4QTBA 1W84A 2YM5A 4RC2A 3G90X 2UW4A 3OMVA 4OBOA 5HNBA 4U40A 3UYSA 3R7OA 3VBQA 3I4BA 5CANA 3WF8A 2HIWA 5E8ZA 2R3MA 4FSUA 1YHSA 2J4ZA 4RX7A 3FI4A 4P2KA 5M4IA 2CKOA 1SVGA 3ZH8A 1IAHA 1UU8A 2BRNA 4Q2AA 2GSFA 1R78A 3HAVA 5IA5A 4D1ZA 3W16A 1YI4A 3TV6A 1GAGA 2J6MA 5IA2A 2PVRA 3DBFA 5J9YA 4AQKA 2J5EA 2VX1A 4F6SA 1G8SA 2HW7A 1KE7A 3GOPA 4BCQA 5CSXA 4DN5A 5HZNA 2O8YA 4EJ7A 3R22A 4XG9A 2HZ0A 3Q52A 5J8IA