5ETFA

Structure of dead kinase mapk14 with bound the kim domain of mkk6
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
350
structure length
338
Chain Sequence
b'ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVRKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Structural Basis for the Subversion of MAP Kinase Signaling by an Intrinsically Disordered Parasite Secreted Agonist.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 110
structure length 338
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5etfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5etfA01
3V5TA 4QMLA 4O1OA 3GOKA 2JLDA 5FDXA 2NPQA 2BTSA 5H3QA 4DEBA 3WILA 4V0GB 3KY2A 5L6WL 4DA5A 5CEIA 3VBVA 3UYTA 4B0GA 4FSZA 3QRUA 4BZNA 2R3JA 3KMUA 2WOTA 3NUAA 3EQGA 4C37A 5M09A 4RGJA 4ENXA 2WPAA 3F82A 2VTJA 5B0XA 2E9VA 4B6LA 3MI9A 3ZS5A 4DE4A 4QNYA 3D5VA 2C6IA 3BV2A 4KIKB 3JVSA 4X2NA 2X9FA 3JUHA 4O22A 3R8VA 2J7TA 1SZMA 3GCVA 3UBDA 4D4VA 4WNMA 4AZVA 4GCJA 3ZLYA 1WVWA 4A9SA 4EK3A 2GNFA 4FNXA 5HTIA 4F0IA 4KIPA 4OTRA 4WNOA 3UZRA 4D2TA 2GS6A 3A7HA 5JRQA 5HOAA 4PQNA 3RAIA 1UKIA 2ZB0A 2F49A 4OR5A 4OTFA 2ZM3A 3OBGA 2CDZA 4EL9A 4IVCA 2CGUA 2XK4A 3BCEA 4WG4A 3LQ3A 4EH4A 4YLLA 1T46A 1R0EA 1GZNA 3PXQA 4QOXA 5C8NA 4ERWA 2JD5A 4O7SA 5IMEA 4H05A 5L3AA 1H1SA 4EOJA 5A14A 4BGHA 3PE2A 4YPDA 1ZMVA 2HXQA 5I0BA 2JKKA 5TOZA 5JQ5A 2ITYA 4A9UA 1VZOA 5ANIA 3OXTA 3VS3A 3OT3A 4DBNA 5KNJA 1ZARA 3R8UA 4P5QA 4D1SA 3SXFA 4AZWA 4C2WA 4UEUA 2V22A 2QOKA 4I0TA 3IW7A 4YNEA 1Q99A 5EYMA 4BCFA 1OM1A 5KHXA 3OWKA 3OP5A 5DR9A 2IO6A 4YJTA 2Y4IB 1H8FA 4IACA 3KCFA 5K3YA 3VF9A 4DFZE 4ZLZA 1Q41A 2PK9A 1UU8A 5CENA 2XYUA 3D15A 2J90A 4EBWA 2QHNA 1S9IA 4MNEA 3LQ5A 2C3JA 4GV1A 2PVLA 2IVSA 2Y0AA 4GJ3A 2XUUA 3C0GA 4XV3A 1Q62A 5E8ZA 4BZOA 1GZKA 1Z9XA 2BFXA 2QKRA 4UMTA 5KKRB 1YDSE 3NX8A 3TXOA 2OJIA 2A0CX 1W0XC 2YFXA 4G2FA 4M84A 4JOAA 2CLQA 5ANOA 3VBXA 3ZDUA 2BALA 3NNXA 4J1RA 1L3RE 3MVJA 3NWWA 4O91A 4PL4A 4QQCA 2VTHA 3V3VA 2VRXA 5J1VA 3OWPA 3QA0A 3BPRA 3FZPA 3QD2B 4TPTA 1GZOA 3EFWA 1LPUA 4DTBA 2UZOA 2ZMCA 1Q5KA 1PF8A 2FH9A 2VN9A 4EORA 4U81A 4BBMA 1RDQE 3FI8A 3R6XA 4G31A 5AP0A 3PJ2A 3IO7A 4I22A 4IFGA 3SKCA 3BGQA 4AU8A 4JBQA 4JIKA 5CSXA 2UVXA 4YMJA 5AEPA 4CFFA 5FBNC 4PL5A 1VEBA 4NJ3A 3ALOA 4MVFA 4FKGA 4Y8DA 4YBKA 5CAUA 2VO7A 4RQKA 4V0GA 3NCGA 3WE8A 3WZUA 4CQGA 2QOLA 4ZTNA 4BDDA 3PUPA 2HIWA 4GU9A 4E20A 1DM2A 4KBAA 3P5KA 2XNGA 4UN0C 4QMYA 1P5EA 5CVHA 3HV6A 3QTIA 5IDNA 4CNHA 2F2UA 3MJ1A 2H9VA 3O8PA 4HZSA 2DQ7X 3EQBA 2YEXA 3QGWA 5KZ0A 4L7FA 4JX7A 4CKRA 5EQPA 2AYPA 1LEWA 3A99A 5EYKA 3R7UA 2GTNA 2CMWA 3CY2A 3IDPA 3C51A 1JWHA 4FTAA 1KE6A 5K9IA 3CPBA 4GG7A 4BCJA 4L46A 2QO7A 4EONA 5JGAA 3UC3A 3CC6A 3ZYAA 4BN1A 3O50A 4ZZNA 4DT9A 3VS0A 2PMNX 4XNEA 3RAHA 4AAAA 5LMBA 5D10A 4FTJA 4X6QC 2PSQA 2PWLA 5ETCA 3HP2A 3HRFA 3OROA 4JDIA 4E6CA 3CJGA 2XNNA 3QQUA 4NFNA 4BL1A 5GJFA 3LFNA 5CYIA 3PXRA 2R3PA 3R7VA 3TKUA 5A4TA 4YJRA 2Z7LA 4X2KA 4CXAA 3ZBXA 4FTLA 1Y8GA 5K4IA 3G15A 4BDGA 4FL2A 5CI7A 4FKQA 3MH0A 3WZEA 1ERKA 5HU3A 3Q9ZA 3E87A 3E7VA 4YR8A 2I0HA 4XG3A 4Y46A 1R78A 3FQEA 3LXLA 4L01A 4B8LA 1XO2B 3KN6A 4XJ0A 3NUPA 3TIZA 1IEPA 4FVRA 3UVQA 1WMKA 5E8SA 2Z02A 4L53A 3S3IA 3UODA 3PP1A 5JEBA 1NW1A 4ZSLA 1QL6A 4N6ZA 2J51A 4UXQA 3THBA 2PVFA 3QQGA 5JFSA 1I09A 3R1YA 4H3PA 4D4YA 3FLSA 2YIQA 3PXZA 4QRCA 5BVNA 4U45A 4DGMA 5AUXA 4IWPA 4PDOA 3EL7A 4XMOA 4IAKA 4I5HA 1H1PA 4E5WA 2J0KA 1SNUA 5M57A 4G1WA 4A06A 3HUBA 4TN6A 5K5XA 4DT8A 4GT5A 2WXVA 4FK3A 4DEEA 4X6RA 4MWHA 4AF3A 3EN9A 3QCSA 2F57A 5IA5A 2WTDA 3P7BA 3V5PA 4F6WA 3O71A 3F3VA 2IZTA 4U7ZA 4PP7A 1PKDA 4AGWA 5AV0A 5AWMA 3CJFA 4ZTRA 4C34A 4EOQA 3DY7A 3RZBA 4YSMA 3C0IA 3ULZA 2R3RA 2RFSA 2EXMA 1BL7A 3RK5A 2RGPA 1U5QA 4WT6A 1GOLA 1H24A 4QTCA 3MBLA 5FQDC 2WGJA 3LFEA 3OY1A 1XBAA 5EFQA 1Z5MA 3A7IA 5CXZA 1AGWA 3NAYA 1QPCA 2BAQA 2QU5A 4BBFA 3UIUA 4IAYA 3H10A 4FT7A 4RIWB 5HVJA 4MEDA 1XH9A 3EH9A 4FICA 2HZ0A 2ITNA 3GP0A 1APME 3KXGA 4IB1A 4Z16A 2J50A 4L68A 3VS6A 3SGCA 1KE8A 4DGGA 1M2PA 2OJJA 3FEGA 4ZTQA 4UWBA 4AQCA 3BELA 3HNGA 3NCZA 2YWPA 3TNIA 4ZAUA 2YM8A 3OD6X 2O64A 3DAJA 5IA1A 3TUBA 3E88A 3IOPA 2ITZA 3QTZA 4FZ6A 5BMMA 5J7BA 4G3DA 3HMIA 3MH2A 3N51A 5IEVA 4HPUE 3ZDIA 2W5HA 3P4KA 2OXYA 1Q8WA 4K2RA 3Q5ZA 3BE9A 3KF7A 4F9BA 3GOPA 4U80A 2XH5A 3U9NA 2QVSE 2X6EA 3FUPA 2YM4A 4LMUA 4RZWA 4D9TA 4L7SA 4CV9A 2BHHA 5IQEA 5CLPA 1IA9A 5B7VA 5E8WA 4HVGA 5AV1A 5E7RA 3KXHA 4LG4A 2C6LA 4UB7A 4FL1A 2OW3A 4MQ1A 4CYIA 2YWVA 3QZHA 2CSNA 3SC1A 2WTIA 4HGEA 5EW9A 3EQIA 4DN5A 4Y83A 2XYNA 3MY5A 4FX3A 4H58A 2PZYA 2XIXA 2VTNA 3HGKA 5ANEA 1TQMA 3AMBA 3BRBA 3O17A 3SXRA 3WYXA 2FUMA 3R63A 4GRBA 4EH6A 4KSPA 5AAGA 3BLHA 2Z2WA 4YGAA 3GI3A 3HX4A 2UZLA 4GYIA 2BUJA 4ZTSA 4S34A 4ZJIA 1QPDA 4KA3A 3FHIA 3QLFA 4I0SA 3IW6A 4A9TA 5GZ8A 2JIUA 4YP8A 5KMIA 4G6LA 4AT3A 3NS9A 3QCQA 1YI6A 2C6DA 4KINA 3N9XA 3UQGA 3C4ZA 1L8TA 4BIDA 5FM3A 3BX5A 2PUUA 4XV2A 4AXAA 3QTWA 4JIAA 1XH5A 3S1HA 3MIYA 3UTOA 1G8SA 4A9RA 4IM3A 5FXSA 2VNYA 2YCQA 1H1QA 4LM5A 4ASXA 2XNOA 5CVFA 4IM0A 3NW5A 3NNUA 3PG3A 4O7VA 3L1SA 4NW5A 4EC8A 5FRIA 4DGLC 4W9WA 4M12A 4XBUA 4X2JA 4K1BA 3CP9A 1ZY4A 2P3GX 3KRWA 2R2PA 5J9YA 3BYVA 2V5QA 3VUMA 4UMRA 5KZIA 5DLSA 5EHYA 1CTPE 3RAKA 4J99A 2XEYA 4IB3A 4F65A 3DBCA 3ELJA 3E5AA 4O0UA 4ASZA 4FUXA 1Q3DA 2C47A 4DEDA 5DOSA 3DLZA 5T3QA 4L43A 2PE2A 4MD9E 2DS1A 5K0KA 5HBHA 5E8VA 4CFWA 4YLKA 3E93A 3I0QA 5CY3A 2ITUA 3DXQA 3GVUA 2B9IA 3VUHA 4FKLA 5E8TA 2O2UA 4MXOA 4NEUA 3EZVA 2WHBA 5KCVA 1GZ8A 3BQCA 2O0UA 3MW1A 3NGAA 3O51A 2X7FA 3O7LB 3OUKA 3SW4A 2ZV7A 1UVRA 4BCMA 2GCDA 3DAEA 4DFYA 5I5ZA 4FVPA 3PJ3A 4R5YA 3DJ6A 5CS6A 1WBSA 4E4LA 4FKSA 2C3IB 3ZXTA 3V5QA 2YIXA 4GS6A 3PPKA 4KS7A 1PY5A 4CMUA 3BHYA 4F09A 3AG9A 3ORTA 4I6HA 1OGUA 4JXFA 5HI2A 3QQKA 3UNJA 3ZXZA 1R39A 5AM7A 4ACDA 4RVKA 2YJRA 3A60A 3FZ1A 2WMTA 1VJYA 3EFJA 4O2ZA 3WOWA 4RC2A 1V0PA 3ZLWA 1NXKA 3ZSGA 4AW0A 4EOOA 3H3CA 3R0TA 1RJBA 2B52A 4RX5A 3ORXA 2H96A 5C27A 4RJ5A 4BTMA 3R9NA 5AM6A 4UXLA 5JMSA 3QRKA 4ORKA 3DCVA 1H07A 3BWJA 4MF1A 3OVVA 4WG3A 2IW8A 3A7GA 4GT4A 4F6SA 5AUZA 2P55A 4MBJA 2KULA 4LGGA 5AJQA 3AT2A 4AA5A 4C62A 3G6GA 2ITXA 4Q5HA 4TNBA 3RINA 3BLRA 2W96B 3D2KA 3RHXA 5IKWA 3Q6WA 3I79A 5BUEA 5I9VA 2R5TA 4GT3A 4FIHA 2WMSA 2YERA 3W16A 4A4XA 5IUIA 2OIBA 3IW5A 5CEPA 2ZVAA 4GFOA 4JAJA 3K54A 5EH0A 1OITA 2XIKA 3FLWA 4YSJA 4AZEA 3LXNA 3FLYA 4W8EA 4O7WA 1E9HA 3HV7A 3R02A 4FVQA 2WIHA 2XA4A 4BKJA 4D4SA 3EN4A 2YABA 3QUEA 1Q8YA 3C4WA 5F95A 3DU8A 4ZZOA 3GCUA 1JSUA 3BLQA 1O6KA 2ITWA 2IVUA 3FC1X 4JS8A 3EQPA 5HICA 1ZOEA 4DTAA 3GCSA 3VUKA 3LCKA 5L2WA 3HV5A 3WZDA 4TWCA 3VQHA 3WIGA 4AE9A 4USDA 4AZTA 4NT4A 2WTCA 3PSBA 4DTKA 3NYNA 4R7HA 4ID7A 3AD6A 4XLVA 5AA8A 2EWAA 2XRUA 3C7QA 3BIZA 4L9IA 2YDKA 3VHKA 3MB7A 5DNRA 4BDBA 5DFPA 3R2YA 2XCKA 5JN2A 4OT6A 2BDFA 3V51A 3G9LX 1F3MC 4YBJA 3UC4A 3COIA 4Z9LA 2BZJA 3ORLA 3GC9A 4HVDA 2V7OA 5AR8A 2C0IA 2YN8A 2CLXA 3FMDA 4IHPA 2VO3A 5IUHA 4CRSA 1OVEA 2C1BA 5KMNA 5L6OA 4QNAA 2QNJA 5L6PA 3RPSA 3PIZA 4D2PA 2WMAA 3U6HA 1W82A 3NUSA 1MRYA 3ZMMA 2P2HA 3R8PA 2GHLA 5CU2A 3Q52A 3NVMB 5AR4A 4GKIA 2WMXA 5FUTA 3LLTA 5CAQA 1H01A 5GIOE 5A9UA 2A2AA 2OH4A 4U6RA 3FMMA 1K2PA 1URCA 2LAVA 3QC9A 1OPKA 1UWHA 5JZNA 3O96A 4M8TA 3FPMA 4RX7A 3FMNA 4DFUA 2W4KA 3DFCB 2OIQA 4MTAA 4DEHA 2VUWA 2WTWA 1XJDA 4KB8A 2UZDA 3DNDA 1W83A 2ITTA 2J5FA 2UW5A 4X3JA 2QOCA 2RF9A 3UE4A 3EKNA 3HUCA 4QP1A 3T3UA 5CNNA 2ITPA 4V01A 5EDRA 4QQTA 3PWDA 3I5NA 2RFNA 3UIBA 1OL1A 3HA8A 3HDMA 3KRLA 2EUFB 1FGIA 4TYEA 2VWZA 3WZJA 4AN9A 3C1XA 2JDSA 3EMGA 3IW4A 5IA3A 3BV3A 5CSVA 4RMZA 1XBCA 4DEGA 4Y95A 5AP5A 5CSHA 3NUYA 5TR6A 4IX4A 4DEIA 4AFEA 4C4EA 4JBPA 4O0YA 3OEZA 2B9FA 4WOVA 4RFMA 3Q9YA 3FL5A 3WI6A 1YHWA 5JSMA 1YHSA 4BHNA 4YC8A 3CD3A 3HZTA 4PF4A 5I9UA 1XQZA 4XH6A 3IPHA 4RPVA 5KBRA 4PMTA 3RPRA 3UMXA 2PULA 4EH8A 3UO6A 1PXOA 4XG9A 4UWCA 2SRCA 4EOSA 2QQ7A 3ETAA 2G9XA 3NNWA 3DBEA 4Z3VA 5AA9A 4OBQA 5H8GA 3VBQA 3UO5A 5AR3A 4O21A 4EBVA 3JY9A 2OLCA 3NUNA 3KULB 1GY3A 1OKYA 3O2MA 5BVWA 4IDVA 4YZCA 3TTJA 3U4UA 4RRVA 1MRUA 4C4JA 2HY0A 4H36A 4IM2A 3ERKA 2JDTA 3EQCA 3ZFYA 3NEWA 2X4FA 2X4ZA 4XS2A 4UMQA 4KAOA 3VC4A 3UIMA 5CAOA 5AR7A 2BR1A 3F66A 2CHLA 2ETRA 2W1HA 5HCYA 3DQXA 4RC3A 4I93A 3ZFXA 4HPTE 1CDKA 4FSRA 4GUEA 4B99A 3LJ1A 4IAFA 3Q60A 3EOCA 3TJCA 5JFWA 5AFVA 3NW7A 5DIAA 2Y6MA 5M4IA 5CEKA 2XF0A 1WCCA 3MY0A 1H26A 3FKOA 3M1SA 1F0QA 4IC8A 5HG5A 4EK8A 3OOMA 3U55A 4OTIA 2W1CA 2B9JA 2CGXA 4IXPA 4QMPA 3OW3A 5E91A 4DHFA 3TEIA 4O7ZA 4P5ZA 5EM7A 3C4EA 5EK7A 2JGZA 4YNOA 4BIEA 1YI3A 4JJRA 4M68A 3OHTA 3VJNA 3AC1A 3AD5A 3CQEA 1DS5A 2W1ZA 4QP3A 1OECA 4X0MA 4DCEA 4QMNA 2R3IA 4OAUC 4M0YA 2YCSA 5JRSA 4F70A 5BQ0A 3PP0A 2WAJA 3LFAA 2A27A 2BRBA 3ODZX 4EYJA 4G17A 4EQCA 2B4SB 2G15A 2FSMX 3A8XA 3Q32A 2ESMA 4GH2A 4MHAA 4YJPA 3ZH8A 4BFMA 4CZUA 5FTQA 3QF9A 4E26A 1UNLA 2JEDA 4D9UA 3NYOA 2WMBA 2W4JA 2XJ0A 5ACKA 2ZB1A 3RM7A 2EXEA 4HJOA 4FGRA 2IVTA 2VO6A 2A19B 1OPJA 3ZC6A 4E4XA 3MPTA 4YTFA 4JVGA 3PXYA 1GIJA 2QR7A 3W18A 3UZPA 1P2AA 3AT3A 3UOLA 2C4GA 3KREA 4PDSA 4AA0A 4E4MA 2UZTA 2C0OA 3G9NA 5L8LA 3Q4TA 3G5DA 3TZ7A 4JG7A 3E7OA 4JR3A 1YI4A 5F94A 4MCVA 2WTKB 4F7LA 3BGZA 4FEVA 4EOKA 4EJ7A 2FVDA 5C01A 3TZ8A 4BI0A 5IA0A 4ALUA 4FKJA 4HGLA 4WSQA 2C68A 3QWJA 3RTPA 3E8DA 3G0EA 5IH5A 1Q8TA 3VS2A 4QMVA 3LM0A 4IW0A 5DA3A 4E8AA 2W05A 2ERKA 4S32A 3LCSA 1YWRA 2CNVA 2R3KA 4W4VA 4X21A 1O9UA 4TWPA 4MXXA 3VIDA 3GNIB 2YJSA 5E8UA 3T3VA 5C26A 4FEWA 2WEVA 4WSYA 3EQFA 5H8BA 3F5XA 2QKWB 2JDVA 2BTRA 2GSFA 2WD1A 3V6SA 4YJVA 5FTGA 5T6KA 2JBOA 2VNWA 5AR2A 4MD8E 2BZIB 3FC2A 3TZ9A 1SVEA 3C5UA 4ASEA 3HRBA 4FBXA 1UV5A 3OFMA 3ANQA 4RFZA 4U97A 2W1DA 2RFDA 4EOPA 2O5KA 4GK3A 3ZSHA 2I0YA 2C6KA 2ZAZA 4TYIA 3SOCA 4DYMA 2JIIA 1IRKA 5CU4A 2VWIA 5DWRA 4GIHA 4PMPA 4MNFA 3CBLA 4C0TA 4F1MA 4XYFA 2V62A 4FA2A 2BIYA 4O84A 3RALA 2ITOA 4RJ8A 5L2TA 4NIFB 2GFCA 3GEQA 4D28A 4JG8A 4R77A 5BYYA 4GUBA 3D94A 1Y6BA 3LCTA 5EI2A 1BLXA 4NUSA 2EB3A 4KKGA 4PTCA 3UQFA 4RBLA 1ZYDA 5EKOA 3CQUA 1ZY5A 3NMUF 4NW6A 1OIYA 3CTJA 4F64A 4YZNA 4QMWA 1YOMA 3RWPA 4UYAA 3GC0A 4JLCA 2XM9A 3QU0A 5GZAA 3A7FA 5CTPA 3AC2A 4RC4A 4ZTHA 1TQPA 1Y8YA 2GNGA 3W2CA 4CD0A 3R7IA 3FMKA 2GTMA 1UA2A 4CTCA 5FBOA 5BNJA 2XNMA 3FLQA 4L8MA 2P4IA 3MB6A 4M69B 5DVRA 3R8ZA 4W4XA 4BDIA 2QCSA 2Z7SA 5L8JA 3LMIA 3TWJA 3P79A 3OCSA 2QD9A 4QMMA 2ZV2A 3OT8A 3UVPA 4FSWA 3B2WA 4FNWA 3DK7A 4FIIA 1M17A 1TVOA 3SHEA 5HNIX 4TXCA 4B9DA 1STCE 2DWBA 4FEUA 3I5ZA 2H8HA 4RX8A 4A4LA 2E9PA 3MA3A 2OXXA 4DFLA 4EHVA 4DGNA 3GCPA 3GU8A 3DJ7A 1WBPA 4C3RA 3N4UA 5AV2A 5KMLA 2C3KA 4FG7A 2X2KA 5CANA 2CCIA 5D11A 1P4FA 4F1OA 2XIRA 4FK6A 3PYYA 3MV5A 4O0WA 1G5SA 2B53A 2C0TA 4L3PA 2UZEA 4MBIA 3FXWA 4BYIA 1OUKA 2C69A 2G1TA 3BEGA 4FT5A 2W1FA 3ORZA 4IZ7A 1BMKA 5CF5A 5AUVA 1UU9A 2BRNA 2Y4IC 1YDTE 4ZTLA 4QMXA 3F6XA 5FEQA 4RWJA 3KFAA 3DOGA 5DGZA 3VRYA 4MXYA 4D2RA 4RFYA 5A4QA 5CQUA 3GUBA 2HELA 5AUUA 4UYNA 4DH8A 3DT1A 4FNYA 4HW7A 2UW7A 4NTSA 3VULA 2XK6A 4KRCA 4ITJA 1NVSA 4YTCA 3UG1A 4EHGA 1JPAA 5KKRC 1Q8ZA 4WUAA 3TNWA 3UQCA 4CFXA 2W1EA 2YIRA 4ANNA 1XH6A 4RJ4A 3H9RA 1OKWA 3VO3A 3JVRA 4DF3A 4OT5A 5AP2A 3R04A 2W7XA 1ZYLA 4TYGA 1R3CA 5EDPA 5HG7A 4F9AA 4JDKA 4QYHA 4BGQA 3E8CA 3RWQA 4DGOA 4NWMA 4EQMA 2GMXA 4JBVA 2GNHA 3QD4A 2VTPA 4CLIA 3UNZA 3NVKI 3FXXA 5HCXA 3CQWA 5L8KA 1OMWA 3FMJA 4MK0A 4MX9A 4KRDA 4NIFA 2XNPA 5HE2A 4I6BA 4KIKA 4QQJA 3O7LD 5FP6A 3ZEPA 2HW6A 3D7TB 5CU3A 3VW6A 5AV4A 4EOMA 5B2LA 4U43A 4IADA 3HV4A 2WOUA 3SVVA 2W06A 3BU6A 2G2FA 2HWOA 4C58A 4NM5A 2OK1A 2YZAA 3G2FA 4QD6A 4WG5A 4B4LA 2IZRA 5BVDA 3U54A 2C6EA 4JX3A 5I9XA 2ONLA 2ERZE 5KHWA 3MYGA 4L44A 3Q6UA 5IQHA 3L9PA 1KE5A 1LP4A 1H4LA 2VTAA 2YLFA 3WYYA 4EK5A 1XWSA 5HO8A 1B38A 3ORNA 1GJOA 1OUYA 4Q2AA 4QMZA 4ZEGA 3P86A 4XP3A 3LLAA 2JKOA 4XOZA 4BI2A 3VJOA 4M69A 5T68A 3G90X 5H9BA 1H27A 3ZRLA 4CFVA 4AS0A 2XM8A 2VWBA 2VX3A 4ZMFA 4MXCA 4EWQA 4ACGA 1SNXA 1AQ1A 2UW6A 3CKXA 3F2NA 4I3ZA 3VUIA 3DZQA 1H00A 4W4YA 1PXIA 1J91A 3FL4A 4ZSEA 2IZSA 3F5UA 3FXZA 2PMOX 4L3JA 2P33A 5IMXA 1DAYA 4HVIA 3QQJA 3S95A 3ID6C 3H9FA 3CXWA 3BYOA 4FI1A 3VW8A 3CTQA 5M4CA 2PVMA 3LCDA 4BBEA 4S31A 3KA0A 4IVAA 4FV3A 3BZ3A 3C50A 4FIFA 4ZOGA 5F20A 5KBQA 3NNVA 3BYUA 5HGIA 3UMWA 3V5WA 4BCIA 3PIYA 5AP1A 2YM3A 3Q5IA 4RIXB 2XK9A 5HHWA 1XH8A 4C61A 2XZSA 1XR1A 5DBXA 4QYEA 3DGKA 4KBKA 2E9UA 2BAKA 5IQCA 4XG8A 3FI3A 4FT0A 3D5XA 4G3EA 4FKWA 2X0GA 4AP7A 2WU7A 2AC5A 2XJ1A 3II5A 2QU6A 2R4BA 3P78A 4C36A 4CV8A 4YO4A 3F2AA 4XRLA 3L8SA 4GVAA 3OUNB 4EJNA 3VF8A 4ANQA 4TNDA 4G5JA 4X2FA 4J71A 5AUYA 4DLJA 4Y85A 3W10A 3UPZA 5IZFA 3CTHA 3QTRA 2CKPA 3KCKA 4UZHA 2YAAA 3T9IA 5IEXA 2C6MA 3QYWA 2YDIA 2PZPA 2YM5A 3EHAA 4LI5A 4OLIA 4XX9A 2C5NA 3FI4A 3H0ZA 3TKIA 4FSTA 5E90A 2A4LA 4FMQA 4XG7A 3NRMA 4AT4A 4KABA 5F1ZA 1FQ1B 4BYJA 2VZ6A 3NIEA 1RE8A 3DAKA 4C4GA 2ZDTA 4BWKA 3UIXA 4J97A 4DLIA 3D0EA 4G6OA 3TT0A 3LJ0A 5IQBA 1PHKA 3MH1A 2X6DA 4TYHB 4UY9A 3BBWA 4GEOA 1JKTA 4XRJA 4J96A 4F7SA 1FGKA 3O8TA 3VRZA 2W9ZB 2PPQA 2XBAA 4FKOA 1JSVA 4ZZMA 4GG5A 3SRVB 3VVHA 3DKFA 1PXNA 3LMGA 4FTNA 3ZO1A 3FBVA 4IZYA 1TKIA 3R9DA 4R78A 1UKHA 4XV1A 5A4EA 1YVJA 4TT7A 2KTYA 4DH7A 2OGVA 3KMMA 3W2PA 1ZMWA 2OU7A 4BCQA 4R1YA 4FC0A 3PTGA 4FTRA 4EZ7A 2X8EA 1GIIA 2YLEA 3SOAA 5J87A 2VTMA 5L2QA 4PWNA 4EOIA 4LUDA 2ZV8A 1Q24A 1BYGA 3BGPA 3EN7A 3F9NA 3M11A 1YOLA 3FKLA 3PVGA 3QBNA 4HGSA 5EOLA 5C03A 5C8MA 3SDJA 2X7GA 4BR3A 3F7ZA 4BCOA 3IONA 1WFCA 4S33A 4BC6A 4ZMEA 4IX3A 5B2MA 3LFSA 3GU5A 3PA5A 5M44A 2QI8A 4FR4A 1SYKA 4EH9A 5F4NA 1P14A 4G9CA 5ANKA 3ET7A 3O23A 4QP4A 2OICA 5LMAA 2RL5A 3VAPA 3ZZEA 1ZRZA 2NO3A 4FL3A 4R5SA 4ZS4A 4EYMA 3D9VA 1ZOGA 3DLSA 2O3PA 2VTLA 3WZKA 3TTIA 4AOTA 2BDWA 5HCZA 3IQ7A 4X3FB 2GNJA 4N57A 5LWMA 5AV3A 4BDAA 4JRVA 5C8KA 3LW0A 3OY3A 5TKDA 4JQ7A 5I9ZA 1U4DA 3BHVA 5HORA 1RW8A 3DXNA 4EEVA 2UW4A 2YHVA 1FMOE 4AG8A 4PDYA 5M55A 4G3FA 4YU2A 4U44A 3S2PA 4FGBA 1ZXEA 3PVBA 3CPCA 4DBXA 5BUIA 4U8ZA 1ZAOA 2PZ5A 4WD5A 5HE0A 2PYWA 1WVXA 2QR8A 2XJ2A 2Z7RA 4IVBA 5CAVA 4KUJA 4C02A 3DKOA 4J52A 4CKIA 4C3PA 2IWIA 4RIXA 4YJOA 4Y5HA 5KE0A 3FKNA 3D2IA 1T45A 4XBRA 4RIOA 1XKKA 3V04A 5ETFA 2QOHA 1BI8A 3LFCA 2R0UA 3LJ2A 4G3GA 3MVMA 4EH2A 4UV0A 2HY81 3PFQA 1PMUA 3R21A 2WU6A 3FY0A 2PUIA 5IQGA 4I20A 3OXZA 4AOJA 5HBJA 3AGLA 4OBOA 3EQHA 4FKPA 3PJCA 2XKDA 5BPYA 5FEEA 4PTGA 1R0PA 2H34A 4IWQA 4BTJA 3IKAA 3ZRKA 4F7JA 4HNFA 2Y4PA 4HNIA 4XOYA 5LVPA 1WBOA 1JKKA 3NLBA 4PL3A 2WMUA 3F3ZA 4EZ3A 3BU3A 1Z57A 1FMKA 5AADA 4ITHA 1WAKA 1ZYCA 2C5XA 2REIA 3QALE 4R3CA 5BVKA 2A1AB 2WQEA 4PNKA 5HTBA 3UOKA 5J1WA 4RLKA 1HCLA 4QP2A 1V1KA 3P9JA 2QC6A 3TL8A 4UWYA 1IA8A 2W9FB 1J7LA 2ITVA 2OJFE 1UNHA 4YO6A 3TDWA 5IH6A 2Y6OA 4KD1A 1ZYJA 1CM8A 5GJGA 4BDEA 3R7OA 4RIWA 1I44A 2E2BA 3HLLA 3QTUA 1VR2A 4TYHA 5JK3A 4QTEA 2WMRA 4LQMA 4A9YA 3PZHA 1OL5A 4NU1A 4IJPA 2C3LA 4OTHA 3PY0A 5HX6A 3EIDA 3BBTB 3GU6A 4JNWA 5AIRA 3ENMA 3SRVA 3TM0A 3ZEWA 1BI7A 3R83A 3NZ0A 4LL5A 3QHRA 2XK3A 4IAIA 3KXNA 2OWBA 3ZUUA 4BZDA 4BWPA 2FSOX 2VTIA 5AUWA 5HIEA 4LYNA 4CFNA 5CWZA 3GU4A 3PXKA 3A62A 3EYGA 3UO4A 3PJ8A 4FV2A 5CAPA 5FGKA 3VUTA 4XG4A 5HG8A 5E4HA 2JITA 3Q3BA 5CZHA 3UG2A 4DG3E 5JQ8A 3KGAA 4WHZA 3W33A 4UBAA 5JGBA 3BI6A 4ASDA 4G5PA 2YZLA 1JLUE 3QUDA 4DAWA 3Q04A 4GW8A 5CXHA 3CEKA 2PZIA 2QONA 3DZOA 4IH8A 4AWIA 4QMQA 3MA6A 4RVMA 2J4ZA 3RKBA 4X3FA 3L8VA 2X2MA 4R3RA 4ANOA 3GT8A 3P7CA 1CKIA 3ALNA 3MTFA 3JS2A 3OCBA 2OJGA 4UX9A 3HYHA 4G6NA 3TV6A 3U87A 3LOKA 2QLUA 3Q4UA 3DKGA 3ZSIA 3LHJA 1FVRA 2C1AA 5HO6A 4JBOA 3JXWA 2F9GA 4J8MA 3I4BA 1A9UA 3EKKA 4IDTA 2ZJWA 2UUEA 2R3OA 4I1ZA 4TW9A 2AC3A 5CZIA 2EVAA 2VWWA 2C6OA 1TQIA 4QMOA 3EFKA 2IG7A 3Q2JA 3HECA 3GU7A 3KK9A 2JKQA 3UGCA 2CPKE 4NKSA 5JFVA 1PW2A 3N4TA 5HEZA 2R7IA 4JL9A 3K3IA 4USEA 4K33A 3SA0A 4ANBA 2BPMA 3DFAA 1WBTA 1UWJA 4FE2A 4FNZA 4MXZA 5HLWA 2FSTX 3LZBA 1OB3A 1OKVA 3MWUA 4D1ZA 1DI8A 3FLNC 3UP2A 2RFEA 3G0FA 3COMA 3FYJX 4D2SA 1OKZA 1IAJA 4TKSA 5DPVA 1M7NA 2VGPA 3CD8A 4HCTA 4AGCA 4QP8A 4YHFA 2B54A 4LOOA 5IQIA 3DA6A 1LUFA 4FTKA 2BCJA 3FLZA 3FZRA 3QKKA 4PPAA 4Z7HA 3OXIA 4MXAA 4S2ZA 3L8XA 3EWHA 4IZ5A 2GU8A 1H1RA 2WQOA 4E6QA 5K4JA 2R3FA 4ALVA 3KVXA 4DFXE 3QCXA 5A54A 4BICA 2WO6A 1BUHA 1B6CB 2IZUA 1UU3A 3DTCA 3QYZA 4GYGA 2PE1A 4DFBA 3R9RA 5LWNA 1NVRA 2QO9A 5FP5A 4WNPA 3QTXA 3RMFA 3UOHA 5KMJA 4F99A 3C9WA 3R22A 4BDHA 1QPEA 3T8OA 2OF2A 4FV0A 4AUAA 3NYVA 1KWPA 5IEYA 3OG7A 5JGDA 3F69A 5HTCA 3D5WA 3VQUA 3OOGA 3I0OA 3POZA 3E62A 2WNTA 3UP7A 4AZFA 2RIOA 1P4OA 4IB0A 5EM5A 1MQBA 3ZZWA 3H30A 2OFVA 3RVGA 2WQBA 3DK6A 3MFTA 2UZWE 4XV9A 2ZV9A 4YC6A 1KSWA 3KRJA 3MJ2A 3UOJA 3MVHA 3F2RA 4DCAA 3OCGA 1A06A 3RPVA 3COKA 4TL0A 5L4QA 4UMUA 3MGYA 4HCVA 1V0BA 5H2UA 5J5SA 4X2GA 4BHZA 5HESA 3HAMA 1JVPP 4HGTA 3FI2A 4NM0A 4PTEA 3WIKA 1J7IA 5FTOA 3TIYA 4KSQA 4O81A 4U3YA 2OJ9A 2F7XE 1LEZA 4O0VA 4BTKA 4HYSA 2HZNA 3KRRA 3QC4A 3TACA 3OS3A 1FVTA 3EQRA 3G6HA 4CLJA 3VWAA 1KUTA 2WZJA 4HVHA 3HMMA 4H3BA 4I23A 3Q9WA 3LFFA 5HD7A 4EK4A 1KV2A 1B39A 2BDJA 2C6TA 4NSTA 3R00A 4M13A 2PMLX 5CSPA 3OMVA 3V01A 2FGIA 3ACKA 4QPSA 4PUZA 5LMKC 4GK2A 2F4JA 3PLSA 3QD0A 3C13A 2XB7A 1BKXA 3OF0A 4U3ZA 4WIHA 3DV3A 3TZMA 2HAKA 2BIKB 5IDPA 4F9CA 5E92A 3E8NA 2BVAA 3KU2A 3ZONA 4CTBA 3OTVA 5ACBC 5A4CA 2C5OA 3O8UA 3LFDA 4UALA 4O82A 1HOWA 5D7AA 2W99B 2JAVA 5M56A 4GFMA 5LCJA 5DN3A 3P7AA 2PVJA 2OZAB 4YZ9A 1IR3A 5KMMA 2YACA 3WF7A 4I94A 1J3HA 3NIZA 4K9YA 4U9AA 4O6EA 5M53A 3MPAA 4NTTA 4BDCA 3IDBA 5EW8A 4A4OA 4II5A 4YUQA 5FLFA 5EW3A 3QLGA 4F9WA 5AIKA 2QG7A 1OZ1A 3RP9A 2ETMA 2CNQA 1Y91A 4QYFA 5GIPE 4EQUA 3FWQA 3I1AA 3QUPA 3FSFA 2W5BA 3KC3A 3LQ8A 4FKRA 5DE2A 5HU9A 3LKMA 4FSMA 3MFUA 3RHKA 4XUFA 3AC3A 5M4UA 2JC6A 4QYYA 3TDVA 3F7WA 4ZP5A 4CSVA 3OCTA 3QFVA 4CYJA 1REJA 4C2VA 4I92A 3NPCA 4BF2A 4IFCA 1MUOA 4QP6A 4XP0A 1KV1A 3MVLA 4PPBA 3TNPC 5IA4A 5LVNA 3PZEA 4Z55A 4OBPA 4O7RA 1F5QA 1OL6A 3LPBA 4KIQA 5D41A 4O0XA 2VU3A 2X9EA 4YURA 3DK3A 4MYGA 5TT7A 3W2RA 3VS7A 4FTUA 4O6LA 4ALWA 2IW6A 4BVUA 4RG0A 4ANMA 3PDTA 3ATSA 5LARA 3EL8A 3RAWA 3HP5A 1PXMA 4QMSA 2J0IA 3R1NA 5DRDA 5AAFA 2JIVA 3U9CA 2BFYA 3AQVA 3V6RA 5BUJA 1DI9A 3E3BX 4D5HA 2IN6A 3KVWA 2QOBA 2WQMA 3SXSA 3ZHPC 4OTQA 4QYGA 3B8QA 1OBGA 5BX0A 1Y57A 4U42A 4DG2E 1YXVA 4FT3A 5E8XA 1Q3WA 1REKA 3PSCA 4L3LA 4N0SA 3R9OA 4WUNA 5CT0A 3BYMA 2QG5A 3D7ZA 3CE3A 4YJUA 2UW3A 3HEGA 5LMKA 2GNLA 4XLIA 2HOGA 2UVYA 3R01A 4FOBA 4PMSA 4MNEB 3LCOA 4IC7A 4WO5A 5FEDA 3REPA 2UZUE 2WTKC 4XCUA 3RGFA 3ZUTA 5KO1A 2YAKA 4E93A 3L9NA 4WRSA 5ANDA 3QL8A 3RBWA 3MDYA 2R9SA 4AT5A 4BKYA 1NY3A 5TO8A 4BI1A 3BKBA 5I9YA 3CSVA 5AP7A 4NCTA 4N70A 2XKEA 3P08A 4OUCA 3SD0A 2VTRA 3MSSA 3JYAA 4IQ6A 3W32A 1JAMA 3D14A 3KULA 4H3QA 4CVAA 1OIRA 1PMVA 2ACXA 4FKTA 3EFLA 2OH0E 4E5BA 5IPJA 5CVGA 3H9OA 3ORIA 3I6WA 5CALA 3QKMA 2OXDA 4YJSA 4UMPA 3KKVA 3DPKA 2PY3A 4U0IA 1J1CA 3CKWA 4QTAA 3BHUA 1AD5A 2B9HA 1H28A 2V7AA 3ANRA 4YPSA 3PRFA 1OPLA 3RCJA 1FOTA 4KNBA 3ZLSA 4N6YA 2CN5A 2OZAA 3AC5A 3TI1A 4MD7E 3GFWA 1PXKA 1K9AA 3RK9A 1YKRA 4FTTA 3VBTA 1KOAA 4XG2A 4FV1A 3K3JA 3QHWA 4FIJA 2PE0A 2PVYA 4IEBA 4YLJA 5CX9A 3LMHA 3G33A 1ZWSA 4M3QA 3R7GA 2JDOA 5DR2A 2C5YA 4O0SA 3I60A 1JOWB 4WRGA 3JY0A 3RNYA 5EOBA 4FOCA 3WF9A 1NVQA 3GXLA 1GNGA 5F9EA 2OSCA 4QPMA 4ZSGA 3FMEA 4BB4A 4FTOA 2P2IA 3R28A 4RIYB 2VV9A 3ITZA 3HL7A 3SG8A 2VTSA 3Q96A 4HCUA 5E1EA 4E3CA 5EYDA 5E1SA 4H1JA 4ZLOA 4ACCA 4NYEA 4FKUA 5C1QB 4G16A 5KUPA 2YITA 2RG6A 5TF9A 5FXRA 4Y5QA 2GNIA 4M0ZA 4EUUA 3LAUA 4F63A 2ONLC 5DRBA 2VWVA 4WKQA 4GKHA 3TNHA 4M14A 5J7HA 3KMWA 5GZ9A 2XIZA 3PWYA 5CU0A 1G8AA 1IAHA 4I4EA 4P7EA 4TYJA 2UVZA 4LGHA 1PXLA 4FV9A 3UJGA 3F5PA 3H0YA 3MN3A 3PLAE 4AACA 3ORMA 1MP8A 5IA2A 4FZAB 2W17A 2YIWA 1MRVA 2W0JA 2WQNA 3PVWA 4C3FA 3R1QA 1ZYSA 3E63A 5ANGA 4D4RA 4EHZA 3QTQA 2WEIA 4PP9A 3M2WA 2VWUA 3NUUA 4M7IA 1ND4A 1NT2A 1JSTA 2NRUA 3Q4ZA 5FM2A 3U6JA 3FV8A 1YXUA 2OBJA 4H39A 2IVVA 3D83A 4F0GA 3W1FA 2UW0A 2WMQA 2XRWA 4AZSA 4J8NA 5M07A 3R8MA 4L00A 3R7EA 2HCKA 2ZM1A 5ITAA 2X7OA 2C30A 5A3XA 5KX8A 4XEYA 3SW7A 2BROA 4U79A 3MESA 2R0IA 1UNGA 4QO9A 4AN3A 5ICPA 5HO7A 4MWIA 5LQFA 4RT7A 4EHEA 5M4FA 1W98A 4M66A 3SLSA 3IG7A 4FG9A 4BDFA 1URWA 2JBPA 4DFNA 4FG8A 4K18A 4ZSAA 3HVCA 2EU9A 4FF8A 3QXOA 2VO0A 3DNEA 4PMMA 3VHEA 3W55A 3ZTXA 4JG6A 3TN8A 3KXMA 4LFIA 3W8LA 4QP7A 4C35A 3ACJA 3NUXA 3WE4A 3ZFMA 3U8WA 3ZO4A 1YXTA 2R3GA 5AUTA 3EQDA 5J9ZA 1W8CA 3MFRA 2VTOA 4LV5A 3ROYA 2VTTA 5DH3A 3UDBA 4BCNA 1SMHA 3F3UA 3DB8A 2YA9A 3DDPA 1CMKE 3LFQA 3CIKA 3QWKA 3VNTA 4NKAA 2W1GA 4NJDA 5D7VA 1LR4A 2OG8A 3BYSA 4OTGA 4D2VA 5JZJA 3ZRMA 2QOOA 1KOBA 4AGUA 3FAAA 3EYHA 4ZSJA 2BAJA 2B7AA 3I7CA 4AFJA 2YIYA 3QTSA 4GMYA 4FKVA 2CGWA 5IQFA 2X8DA 3PVUA 4IANA 4ANSA 2VD5A 4FYOA 5AX3A 1K3AA 3CR0A 2X2LA 3AT4A 3FZOA 1CSNA 3AMAA 4JT3A 5ETAA 3I81A 3HAVA 1CKPA 4I4FA 3COHA 5DEWA 4QTBA 4RA5A 5EYCA 3RPOA 3RM6A 3FQHA 4IX5A 4AA4A 4TZRA 4F0FA 3ODYX 4RIYA 2WELA 4W8DA 4LRMA 5DT0A 2HZ4A 3R9HA 4JDJA 4AGDA 3IOKA 4K77A 4C7TA 4IVDA 2XS0A 3IECA 2P0CA 4YC3A 4EZ5A 2FO0A 5KMOA 4ZJVA 1QCFA 2XNBA 4ZY5A 3IGOA 4I24A 3FQSA 2WMWA 4DEAA 1FBNA 5M06A 3QGYA 4RJ7A 2R7BA 2YM6A 2GQRA 1FPUA 4EUTA 4O7NA 3QD3A 4C33A 4J7BA 3W2QA 4FTCA 3P1AA 4IX6A 3B8RA 2DYLA 3F3TA 4N4SA 3DDQA 2QURA 3U51A 3A4PA 4W4WA 2PUPA 4WNKA 4IJ9A 5JFXA 5DI1A 2BILB 2Z8CA 2UZNA 3WARA 3DS6A 4KWPA 5G6VA 4BKZA 4MH7A 4TWNA 3GB2A 5CSWA 2JAMA 5A6NA 2B0QA 1U46A 3VBWA 3I6UA 3IK3A 4KS8A 3JPVA 2CN8A 2Z7QA 3V8TA 4AW1A 1M2QA 2I0VA 2BZKB 3ZO2A 4MF0A 5IISA 2DUVA 4L45A 5FG8A 3OZ6A 1WVYA 3GFEA 3V8SA 5HVKA 4ZY4A 5J9LA 3QA8A 4F7NA 1JNKA 4DG0E 4EC9A 2ZDUA 3GC7A 2VGOA 3AMYA 3PA4A 3UYSA 3ZC5A 4E73A 3A2CA 3DQWA 4IBMA 2CGVA 2XEZA 4FV8A 4P4CA 4O1PA 1J1BA 5HIDA 3DBDA 4O96A 5DMZA 5AR5A 3VS1A 3R73A 3NW6A 1XH4A 3FZSA 2XCHA 3SX9A 4YHTA 1E1XA 2R3QA 3TV7A 4GJ2A 1YW2A 5BYZA 3VN9A 1NA7A 3CY3A 2B55A 4I41A 4O7TA 3HA6A 5BYLA 3F5GA 3NDMA 3R2BA 4YTIA 3KEXA 3D4QA 2R3LA 3C4XA 4AE6A 1PXJA 4W9XA 2FA2A 2PVHA 1JKSA 2OFUA 5FWKK 3ORKA 4QPAA 4FSNA 4FUYA 2CKEA 3U6IA 4D2WA 4CT1A 4ENYA 2RG5A 4XHKB 3QCYA 5AP4A 4F08A 4LRKA 5HLNA 3F3WA 3I7BA 4Q5EA 5HIBA 4B8MA 4IE9A 3W2SA 2XMYA 3BHTA 3NSZA 3GENA 1SVHA 3QRJA 2PZRA 4LOQA 4FYNA 3D7TA 4L6QA 5CI6A 3KK8A 4ONAA 5HKMA 2QOIA 4E7WA 2XKFA 1OI9A 3QQHA 4PX6A 4IZAA 3E3PA 5EKNA 4CG8A 4U5JA 4U40A 4JQ8A 5CT7A 5HNGA 2PHKA 3VS5A 3OTUA 4FTIA 3UVRA 2GS7A 1ZZLA 1J7UA 4HYUA 4GIIA 1G3NA 2NP8A 3GC8A 5DR6A 5EHOA 3S00A 2BKZA 4CCBA 1M2RA 2PU8A 4D0WA 4BCKA 1XBBA 4YHJA 3RPYA 3MS9A 1UU7A 4ACMA 1XH7A 3C4CA 3EZRA 4F6UA 4OW8A 1W84A 5HNBA 2UW9A 3L9MA 4O2PA 2JKMA 4GSBA 1Y6AA 1PMNA 5AAEA 5CASA 1KE9A 2IW9A 4I0RA 3FSKA 4E6AA 3ATTA 4PV0A 4EH3A 1M52A 4QP9A 3HRCA 4ZIMA 3POOA 5TE0A 2W1IA 4TRLA 5AX9A 5BMSA 3ENHA 3AXWA 4BCGA 3EB0A 4BGGA 3IDCA 4GK4A 4BDKA 4BTFA 4X3FC 4LOPA 2ZOQA 3PY3A 3GBZA 3OC1A 2WIPA 4FV7A 4NK9A 3HV3A 5LCKA 4BIBA 5A6OA 5IUGA 1Q97A 3W2OA 3TUDA 3ZM4A 3L9LA 4FODA 4LGDA 4TY1A 2CNUA 3PRIA 3FJQE 5HG9A 2CKQA 4E6DA 3QRTA 4C38A 4J53A 3MTLA 5G1XA 5HE1A 5KMKA 2UV2A 3QX4A 1DAWA 2OF4A 3M42A 4O38A 2E9OA 4R3PA 4V05A 4WBBB 4A7CA 5M08A 3IW8A 4FIEA 4IWOA 4HZRA 3NAXA 4K11A 4MQ2A 4PRJA 4K0YA 2C5VA 5D9HA 4FV6A 4ZTMA 4HOKA 4FEQA 3G51A 2Y8OA 4IB5A 3CGFA 2B1PA 1X8BA 2R3MA 3HMOA 3R71A 4M97A 1ZLTA 4O0TA 3WBLA 3ZCLA 4EK6A 5EQYA 3H4JA 2X39A 1VYZA 4RWKA 2J6MA 3U4WA 4EKKA 1WBNA 3BE2A 3LXPA 4LMNA 5JT2A 3ULIA 4H1MA 5H8EA 3D5UA 4CG9A 1ZOHA 5HE3A 1IG1A 4FTQA 3FMLA 4I5MA 4RVLA 2I40A 4PY1A 4EKLA 1ZMUA 3UNKA 4WA9A 4APCA 1YOJA 2R3NA 3IGGA 5B2KA 1BX6A 1XHAA 2G01A 4AW2A 2UW8A 4F9YA 5ETIA 4BCPA 3KL8A 2VX0A 3Q53A 4E5AX 3C0HA 1OIQA 4FV4A 4DC2A 5I9WA 5LOHA 4D1XA 4ZXTA 3SG9A 2XNEA 4C57A 5IG1A 2Y7JA 5J95A 2PVRA 4O83A 4XG6A 3RK7A 1Q8UA 3PIXA 2JFMA 4XP2A 4ZLYA 1W7HA 4UZDA 2BRMA 4ACHA 5A4LA 3DBFA 3KRXA 5CF4A 3C4FA 4O86A 4L67A 1OL7A 3GQLA 2PL0A 2QOQA 4FV5A 4BY9E 4FSQA 4PPCA 4OTPA 1U5RA 4K6ZA 4Y72A 5D1JA 5I3RA 2BKKA 1PYEA 3QZIA 2HENA 4USFA 4S30A 5HVYA 4HYIA 5CF6A 2HYYA 5CEOA 1Q61A 4ZJJA 2BRGA 1HCKA 4BWXA 4O7LA 4PDPA 2QLQA 2I7QA 4KIOA 4QMTA 1A48A 4CZYB 4HYHA 5EI6A 4QMUA 2IPXA 4RLLA 1YRPA 1YWNA 4IMYA 3MIAA 3OEFX 5C4KA 3RNIA 5FD2A 4F4PA 1JQHA 4CKJA 5BVOA 3EJ1A 2EB2A 2EXCX 5IH4A 3DXPA 5IF1A 3K5VA 4B7TA 4Z7GA 4YTHA 4FSUA 2PUNA 3FMHA 1M7QA 3ROCA 4YJNA 3S4QA 5DT3A 4IAAA 5I4NA 1OBDA 5IU2A 3K5UA 1PXPA 3PPJA 3CS9A 3N4VA 5AP3A 2E9NA 2OKRA 3PSDA 1U54B 3QAME 4R1VA 3E92A 3KQ7A 3FE3A 4ZS0A 4JR7A 3RZFA 2XBJA 4C8BA 3R8LA 1H1WA 5EI8A 2JDRA 4ZK5A 4QQ5A 1QMZA 3R7YA 1M14A 2CCHA 1PMEA 2PMIA 2UZBA 2H6DA 3E64A 3E8EA 3QQFA 4I6FA 3AOXA 4FZFB 4LRJA 4GVJA 3PY1A 4LL0A 4QT1A 2BRHA 4K8AA 3V5JA 1FVVA 1H25A 3DJ5A 4IAZA 1VYWA 4O0RA 4U41A 4E1ZA 2CKOA 5DG5A 3ZUVA 5CEQA 3ZBFA 2R3HA 2UZVA 2XK8A 3L8PA 2WTVA 2NNWB 2Q83A 3JR1A 2YM7A 2YCRA 5BVEA 1WBWA 3AC8A 1IASA 2QHMA 1QPJA 2FSLX 3GQIA 3PG1A 4EI4A 4F1TA 5GINE 5HD4A 3KB7A 3TV4A 1EH4A 4NM3A 4DH3A 5LVLA 3R30A 4Q9SA 3A4OX 1GAGA 1ZZ2A 3KF4A 3DB6A 3TNQB 5A46A 3Q2MA 3S0OA 4GFGA 4CFMA 3A8WA 4YZDA 1RQQA 4RA4A 4YZMA 3MH3A 2HW7A 3LIJA 4WBOA 1WBVA 2PVNA 4L42A 1ATPE 5ANJA 4V04A 2RKUA 3CLYA 3DTWA 3VUGA 2OIDA 2XP2A 5K0XA 5JKGA 5J5TA 4FEXA 4J95A 3R1SA 5HX8A 5FDPA 4RVTA 3OBJA 4NZWB 2YDJA 3TJDA 4OTWA 3ZU7A 2O63A 3PE1A 3LXKA 3HDNA 4O27B 4RJ3A 4EH7A 2J0LA 3MPMA 3BWFA 1WZYA 4E4NA 5J79A 1YXSA 2QODA 3FYKX 2O8YA 4RQVA 1SVGA 2O65A 2WKMA 3P0MA 3BU5A 3GGFA 4FKIA 5CEMA 5E9EA 1O6YA 4GU6A 3LVPA 5EG3A 3ZO3A 4IIRA 4RX9A 4FZDB 5LVOA 2IJMA 4LV8A 5EDQA 3AD4A 3UZTA 2LGCA 2J5EA 4OAVB 2F7ZE 4OTDA 3FHRA 3T9TA 4M15A 2CJMA 5EM6A 1H0VA 2YCFA 2VTQA 3NYXA 4R7IA 2QO2A 5BVFA 2GFSA 2W4OA 4P90A 4I6QA 2R64A 3V8WA 4YJQA 4BCHA 3KN5A 4FIGA 4PNIA 2VWXA 4FT9A 3LM5A 5DEYA 3CCNA 5L2IA 3C5IA 4R6VA 3KXZA 4CFUA 4NFMA 5GHVA 2XIYA 2WTJA 4KKHA 3O0GA 4RZVA 3HMNA 5D12A 4AW5A 4O7YA 4DH1A 4BRXA 2VAGA 2WB8A 4A07A 5DYJA 4D5KA 4CGAA 2I6LA 3AC4A 4DITA 3TUCA 2OI4X 2XVDA 3Q4CA 2I0EA 4OGRA 3V5LA 3QQLA 1U59A 4ANLA 4CCUA 1PJKA 1E1VA 2GDOA 5IQAA 4NH1A 3FPQA 3W8QA 4RJ6A 4C4HA 1PRYA 1JBPE 3QZGA 5EHLA 1U54A 4AN2A 2J0MB 3VS4A 4CMTA 3Q9XA 4CZTA 4D58A 3CGOA 5M51A 4G34A 3TG1A 5CF8A 5C4LA 3DBQA 4EH5A 4GL9A 4R7BA 2X81A 1MQ4A 4YZBA 2RSVA 1O6LA 3WF5A 2BZHB 4ERKA 4C4IA 4FZ7A 4NCTC 2VX1A 1H0WA 1YDRE 2I1MA 4CMOA 5HBEA 2G2HA 4QTDA 2G2IA 2BHEA 4D0XA 2PTKA 1OIUA 2GHMA 4EOLA 2J9MA 4I21A 3WF6A 5K5NA 2W5AA 4P2KA 1KE7A 2ZM4A 4JRNA 2AUHA 4APPA 3A7JA 3BEAA 3QZFA 4RWLA 5JH6A 1YWVA 2Z60A 4KBCA 3ZLXA 2GQSA 2XKCA 2F7EE 3SAYA 5I3OA 4RWIA 2HK5A 4JI9A 2V0DA 4CQEA 4CT2A 3KXXA 2Q0BA 2PVKA 4DH5A 5LVMA 1YHVA 1PKGA 1Q4LA 3GCQA 3IS5A 2JFLA 3FY2A 3OW4A 2HZIA 3K2LA 4C4FA 3FZTA 5AMNA 1H08A 4JAIA 4JQEA 4J98A 4AOIA 2GPHA 2J2IB 2ZYBA 5EQEA 4MKCA 1OL2A 1PYXA 5AP6A 1YQJA 3PPZA 3P23A 4FSYA 5HQ0A 3WF8A 2GS2A 3UPXA 1V0OA 3OWLA 4G9RA 3QX2A 5DHJA 1JKLA 5DT4A 2QOFA 5CQWA 2YISA 3LE6A 5GJDA 4AX8A 5EM8A 4ZY6A 4EWHA 4C59A 4JDHA 1S9JA 1YXXA 3AGMA 4DINA 5HLPA 3PXFA 3MFSA 2GQGA 5GNKA 3BHHA 2ITQA 3RCDA 4TWOA 5IQDA 3VBYA 4TTHB 4Y73A 3HMPA 3SV0A 2ETKA 5C9CA 3RJCA 3PA3A 3QRIA 5CNOA 2Y9QA 3ORPA 4HVSA 3F61A 5LXMA 4LUEA 3F88A 2WFYA 2V55A 2NRYA 4R8QA 4MAOA 3EN5A 4G3CA 4NL0A 4MBLA 5E8YA 1BL6A 2BMCA 3QKLA 2VWYA 2OO8X 2GHGA 4I5PA 3TKHA 2F2CB 4NM7A 5CU6A 3ZM9A 3HKOA 3BQRA 3VUDA 4Q9ZA 5HZNA 2Q0NA 2X8IA 3QXPA 2J0JA 3DKCA 4I5CA 4ITIA 2ZMDA 3RI1A 3SQQA 3MY1A 2X1NA 4IWDA 4KKEA 1CKJA 2FYSA 1SM2A 3B2TA 2WMVA 4ARKA 4CEGA 2OZOA 3PJ1A 4D55A 2XK7A 4M67A 3ZOSA 3OWJA 4BDJA 3FDNA 3TCPA 4RSSA 5J8IA 5L2SA 3EN6A 3NR9A 5LJJA 1FINA 4FTMA 1GIHA 3LFBA 4L52A 2HXLA 3A61A 1R1WA 4X7QA 2HWPA 4CRLA 2FB8A 5FXQA
chains in the Genus database with same CATH superfamily
3V5TA 4QMLA 4O1OA 3GOKA 2JLDA 5FDXA 2NPQA 2BTSA 5H3QA 4DEBA 3WILA 4V0GB 3KY2A 5L6WL 4DA5A 5CEIA 3VBVA 3UYTA 4B0GA 4FSZA 3QRUA 4BZNA 2R3JA 3KMUA 2WOTA 3NUAA 3EQGA 4C37A 5M09A 4RGJA 4ENXA 2WPAA 3F82A 2VTJA 5B0XA 2E9VA 4B6LA 3MI9A 3ZS5A 4DE4A 4QNYA 3D5VA 2C6IA 3BV2A 4KIKB 3JVSA 4X2NA 2X9FA 3JUHA 4O22A 3R8VA 2J7TA 1SZMA 3GCVA 3UBDA 4D4VA 4WNMA 4AZVA 4GCJA 3ZLYA 1WVWA 4A9SA 4EK3A 2GNFA 4FNXA 5HTIA 4F0IA 4KIPA 4OTRA 4WNOA 3UZRA 4D2TA 2GS6A 3A7HA 5JRQA 5HOAA 4PQNA 3RAIA 1UKIA 2ZB0A 2F49A 4OR5A 4OTFA 2ZM3A 3OBGA 2CDZA 4EL9A 4IVCA 2CGUA 2XK4A 3BCEA 4WG4A 3LQ3A 4QEBA 4EH4A 4YLLA 1T46A 1R0EA 1GZNA 3PXQA 4QOXA 2X0PA 5C8NA 4ERWA 2JD5A 4O7SA 5IMEA 4H05A 5L3AA 4JMQA 1H1SA 4EOJA 5A14A 4BGHA 3PE2A 4YPDA 1ZMVA 2HXQA 5I0BA 2JKKA 5TOZA 5JQ5A 2ITYA 4A9UA 1VZOA 5ANIA 3OXTA 3VS3A 3OT3A 4DBNA 5KNJA 1ZARA 3R8UA 4P5QA 4D1SA 3SXFA 4AZWA 4C2WA 4UEUA 2V22A 2QOKA 4I0TA 3IW7A 4YNEA 1Q99A 5EYMA 3O5AA 4BCFA 1OM1A 5KHXA 3OWKA 3OP5A 5DR9A 2IO6A 4YJTA 2Y4IB 1H8FA 4IACA 3KCFA 5K3YA 3VF9A 4DFZE 4ZLZA 1Q41A 2PK9A 1UU8A 5CENA 2XYUA 3D15A 2J90A 4EBWA 2QHNA 1S9IA 4MNEA 3LQ5A 2C3JA 4GV1A 2PVLA 2IVSA 2Y0AA 4GJ3A 2XUUA 3C0GA 4XV3A 1Q62A 5E8ZA 4BZOA 1GZKA 1Z9XA 2BFXA 2QKRA 4UMTA 5KKRB 1YDSE 3NX8A 3TXOA 2OJIA 2A0CX 1W0XC 2YFXA 4G2FA 4M84A 4JOAA 2CLQA 5ANOA 3VBXA 3ZDUA 2BALA 3NNXA 4J1RA 4BJJA 1L3RE 3MVJA 3NWWA 4O91A 4PL4A 4QQCA 2VTHA 3V3VA 2VRXA 5J1VA 3OWPA 3QA0A 3BPRA 3FZPA 3QD2B 4TPTA 1GZOA 3EFWA 1LPUA 4DTBA 2UZOA 2ZMCA 1Q5KA 1PF8A 2FH9A 2VN9A 4EORA 4U81A 4BBMA 1RDQE 3FI8A 3R6XA 4G31A 5BV3A 5AP0A 3PJ2A 3IO7A 4I22A 4IFGA 3SKCA 3BGQA 4AU8A 4JBQA 4JIKA 5CSXA 2UVXA 4YMJA 5AEPA 4CFFA 5FBNC 4PL5A 1VEBA 4NJ3A 3ALOA 4MVFA 4FKGA 4Y8DA 4YBKA 5CAUA 2VO7A 4RQKA 4V0GA 3NCGA 3WE8A 3WZUA 4CQGA 2QOLA 4ZTNA 4BDDA 3PUPA 2HIWA 4GU9A 4E20A 1DM2A 4KBAA 2A98A 3P5KA 2XNGA 4UN0C 4QMYA 1P5EA 5CVHA 3HV6A 3QTIA 5IDNA 4CNHA 2F2UA 3MJ1A 2H9VA 3O8PA 4HZSA 2DQ7X 3EQBA 2YEXA 3QGWA 5KZ0A 4L7FA 4JX7A 4CKRA 5EQPA 2AYPA 1LEWA 3A99A 5EYKA 3R7UA 2GTNA 2CMWA 3CY2A 3IDPA 3C51A 1JWHA 4FTAA 1KE6A 5K9IA 3CPBA 4GG7A 4BCJA 4L46A 2QO7A 4EONA 5JGAA 3UC3A 3CC6A 3ZYAA 4BN1A 3O50A 4ZZNA 4DT9A 3VS0A 2PMNX 3AKLA 4XNEA 3RAHA 4AAAA 5LMBA 5D10A 4FTJA 4X6QC 2PSQA 2PWLA 5ETCA 3HP2A 3HRFA 3OROA 4JDIA 4E6CA 3CJGA 2XNNA 3QQUA 4NFNA 4BL1A 5GJFA 3LFNA 5CYIA 3PXRA 2R3PA 3R7VA 3TKUA 5A4TA 4YJRA 2Z7LA 4X2KA 4CXAA 3ZBXA 4FTLA 1Y8GA 5K4IA 3G15A 4BDGA 4FL2A 5CI7A 4FKQA 3MH0A 3WZEA 1ERKA 5HU3A 3Q9ZA 3E87A 3E7VA 4YR8A 2I0HA 4XG3A 4Y46A 1R78A 3FQEA 3LXLA 4L01A 4B8LA 1XO2B 3KN6A 4XJ0A 3NUPA 3TIZA 1IEPA 4FVRA 3UVQA 1WMKA 5E8SA 3W0PA 2Z02A 4L53A 3S3IA 3UODA 3PP1A 5JEBA 1NW1A 4ZSLA 1QL6A 4N6ZA 2J51A 4UXQA 3THBA 2ZFYA 2AEGA 2PVFA 3QQGA 5JFSA 1I09A 3R1YA 4H3PA 4D4YA 3FLSA 2YIQA 3PXZA 4QRCA 5BVNA 4U45A 4DGMA 5AUXA 4IWPA 4PDOA 3EL7A 4XMOA 4IAKA 4I5HA 1H1PA 4E5WA 2J0KA 1SNUA 5M57A 4G1WA 4A06A 3HUBA 4TN6A 5K5XA 4DT8A 4GT5A 2WXVA 4FK3A 4DEEA 4X6RA 2X0OA 4MWHA 4AF3A 3EN9A 3QCSA 2F57A 5IA5A 2WTDA 3P7BA 3V5PA 4F6WA 3O71A 3F3VA 2IZTA 4U7ZA 4PP7A 1PKDA 4AGWA 5AV0A 5AWMA 3CJFA 4ZTRA 4C34A 4EOQA 3DY7A 3RZBA 4YSMA 3C0IA 3ULZA 2R3RA 2RFSA 2EXMA 1BL7A 3RK5A 2RGPA 1U5QA 4WT6A 1GOLA 1H24A 4QTCA 3MBLA 5FQDC 2WGJA 3LFEA 3OY1A 1XBAA 5EFQA 1Z5MA 3A7IA 5CXZA 1AGWA 3NAYA 1QPCA 2BAQA 2QU5A 4BBFA 2AQXA 3UIUA 4IAYA 3H10A 4FT7A 4RIWB 5HVJA 4MEDA 1XH9A 3EH9A 4AQKA 4FICA 2HZ0A 2ITNA 3GP0A 1APME 3KXGA 4IB1A 1TFFA 4Z16A 2J50A 4L68A 3VS6A 3SGCA 1KE8A 4DGGA 1M2PA 2OJJA 3FEGA 4ZTQA 4UWBA 4AQCA 3BELA 3HNGA 3NCZA 2YWPA 3TNIA 4ZAUA 2YM8A 4DDIA 3OD6X 2O64A 3DAJA 5IA1A 3TUBA 3E88A 3IOPA 2ITZA 3QTZA 4FZ6A 5BMMA 5J7BA 4G3DA 3HMIA 3P5JC 3MH2A 3N51A 5IEVA 4HPUE 3ZDIA 2W5HA 3P4KA 2OXYA 1Q8WA 4K2RA 3Q5ZA 3BE9A 3KF7A 4F9BA 3GOPA 4U80A 2XH5A 3U9NA 2QVSE 2X6EA 3FUPA 2YM4A 4LMUA 4RZWA 4D9TA 4L7SA 4CV9A 2BHHA 5IQEA 5CLPA 1IA9A 5B7VA 5E8WA 4HVGA 5AV1A 5E7RA 3KXHA 4LG4A 2C6LA 4UB7A 4FL1A 2OW3A 4MQ1A 4CYIA 2YWVA 3QZHA 2CSNA 3SC1A 2WTIA 4HGEA 5EW9A 3EQIA 4DN5A 4Y83A 2XYNA 3MY5A 4FX3A 4H58A 2PZYA 2XIXA 2VTNA 3HGKA 5ANEA 1TQMA 3AMBA 3BRBA 3O17A 3SXRA 3WYXA 2FUMA 3R63A 4GRBA 4EH6A 4KSPA 5AAGA 3BLHA 2Z2WA 4YGAA 3GI3A 3HX4A 2UZLA 4GYIA 2BUJA 4ZTSA 4S34A 4ZJIA 1QPDA 4KA3A 3FHIA 3QLFA 4I0SA 3IW6A 4A9TA 5GZ8A 2JIUA 4YP8A 5KMIA 4G6LA 4AT3A 3NS9A 3QCQA 1YI6A 2C6DA 4KINA 3N9XA 3UQGA 3C4ZA 1G8KA 1L8TA 4BIDA 5FM3A 3BX5A 2PUUA 4XV2A 2XAOA 4AXEA 4AXAA 3QTWA 4JIAA 1XH5A 3S1HA 3MIYA 3UTOA 1G8SA 4A9RA 4IM3A 5FXSA 2VNYA 2YCQA 1H1QA 4LM5A 4ASXA 2XNOA 5CVFA 4IM0A 3NW5A 3NNUA 3PG3A 4O7VA 3L1SA 4NW5A 4EC8A 5FRIA 4DGLC 4W9WA 4M12A 4XBUA 4X2JA 4K1BA 3CP9A 1ZY4A 2P3GX 3KRWA 2R2PA 5J9YA 3BYVA 2V5QA 3VUMA 4UMRA 5KZIA 5DLSA 5EHYA 1CTPE 3RAKA 4J99A 2XEYA 4IB3A 4F65A 3DBCA 3ELJA 3E5AA 4O0UA 4ASZA 4FUXA 1Q3DA 2C47A 4DEDA 5DOSA 3DLZA 5T3QA 4L43A 2PE2A 4MD9E 2DS1A 5K0KA 5HBHA 5E8VA 4CFWA 4YLKA 3E93A 3I0QA 5CY3A 2ITUA 3DXQA 3GVUA 2B9IA 3VUHA 4FKLA 5E8TA 2O2UA 4MXOA 4NEUA 3EZVA 2WHBA 5KCVA 1GZ8A 3BQCA 2O0UA 3MW1A 3NGAA 3O51A 2X7FA 3O7LB 3OUKA 3SW4A 2ZV7A 1UVRA 4BCMA 2GCDA 3DAEA 4DFYA 5I5ZA 4FVPA 3PJ3A 4R5YA 3DJ6A 5CS6A 1WBSA 4E4LA 4FKSA 2C3IB 3ZXTA 3V5QA 2YIXA 4GS6A 3PPKA 4KS7A 1PY5A 4CMUA 3BHYA 4F09A 3AG9A 3ORTA 4AXFA 4I6HA 1OGUA 4JXFA 5HI2A 3QQKA 3UNJA 3ZXZA 1R39A 5AM7A 4ACDA 4RVKA 2YJRA 3A60A 3FZ1A 2WMTA 1VJYA 3EFJA 4O2ZA 3WOWA 4RC2A 1V0PA 3ZLWA 1NXKA 3ZSGA 4AW0A 4EOOA 3H3CA 3R0TA 1RJBA 2B52A 4RX5A 3ORXA 2H96A 5C27A 4RJ5A 4BTMA 3R9NA 5AM6A 4UXLA 5JMSA 3QRKA 4ORKA 3DCVA 1H07A 3BWJA 4MF1A 3OVVA 4WG3A 2IW8A 3A7GA 4GT4A 4F6SA 5AUZA 2P55A 4MBJA 2KULA 4LGGA 5AJQA 3AT2A 4AA5A 4C62A 3G6GA 2ITXA 4Q5HA 4TNBA 3RINA 3BLRA 2W96B 3D2KA 2X0QA 3RHXA 5IKWA 3Q6WA 3I79A 5BUEA 5I9VA 2R5TA 4GT3A 4FIHA 2WMSA 2YERA 3W16A 4A4XA 5IUIA 2OIBA 3IW5A 5CEPA 2ZVAA 4GFOA 4JAJA 3K54A 5EH0A 1OITA 2XIKA 3FLWA 4YSJA 4AZEA 3LXNA 3FLYA 4W8EA 4O7WA 1E9HA 3HV7A 3R02A 4FVQA 2WIHA 2XA4A 4BKJA 4D4SA 3EN4A 2YABA 3QUEA 1Q8YA 3C4WA 5F95A 3DU8A 4ZZOA 3GCUA 1JSUA 3BLQA 1O6KA 2ITWA 2IVUA 3FC1X 4JS8A 3EQPA 5HICA 1ZOEA 4DTAA 3GCSA 3VUKA 3LCKA 5L2WA 3HV5A 3WZDA 4TWCA 3VQHA 3WIGA 4AE9A 4USDA 4AZTA 4NT4A 2WTCA 3PSBA 4DTKA 3NYNA 4R7HA 4ID7A 3AD6A 4XLVA 5AA8A 2EWAA 2XRUA 3C7QA 3BIZA 4L9IA 2YDKA 3VHKA 3MB7A 5DNRA 4BDBA 5DFPA 3R2YA 2XCKA 5JN2A 4OT6A 2BDFA 3V51A 3G9LX 1F3MC 4YBJA 3UC4A 3COIA 4Z9LA 2BZJA 3ORLA 3GC9A 4HVDA 2V7OA 5AR8A 2C0IA 2YN8A 2CLXA 3FMDA 4IHPA 2VO3A 5IUHA 4CRSA 1OVEA 2C1BA 5KMNA 5L6OA 4QNAA 2QNJA 5L6PA 3RPSA 3PIZA 4D2PA 2WMAA 3U6HA 1W82A 3NUSA 1MRYA 3ZMMA 2P2HA 3R8PA 2GHLA 5CU2A 3Q52A 3NVMB 5AR4A 4GKIA 2WMXA 5FUTA 3LLTA 5CAQA 1H01A 5GIOE 5A9UA 2A2AA 2OH4A 4U6RA 3FMMA 1K2PA 1URCA 2LAVA 3QC9A 1OPKA 1UWHA 5JZNA 3O96A 4M8TA 3FPMA 4RX7A 3FMNA 4DFUA 2W4KA 3DFCB 2OIQA 4MTAA 4DEHA 2VUWA 2WTWA 1XJDA 4KB8A 2UZDA 3DNDA 1W83A 2ITTA 2J5FA 2UW5A 4X3JA 2QOCA 2RF9A 3UE4A 3EKNA 3HUCA 4QP1A 3T3UA 5CNNA 2ITPA 4V01A 5EDRA 4QQTA 3PWDA 3I5NA 2RFNA 3UIBA 1OL1A 3HA8A 3HDMA 3KRLA 2EUFB 1FGIA 4TYEA 2VWZA 3WZJA 4AN9A 3C1XA 2JDSA 3EMGA 3IW4A 5IA3A 3BV3A 5CSVA 4RMZA 1XBCA 4DEGA 4Y95A 3PFYA 5AP5A 5CSHA 3NUYA 5TR6A 4IX4A 4DEIA 4AFEA 4C4EA 4JBPA 4O0YA 3OEZA 2B9FA 4WOVA 4RFMA 3Q9YA 3FL5A 3WI6A 1YHWA 5JSMA 1YHSA 4BHNA 4YC8A 3CD3A 3HZTA 4PF4A 5I9UA 1XQZA 4XH6A 3IPHA 4RPVA 5KBRA 4PMTA 3RPRA 3UMXA 2PULA 4EH8A 3UO6A 1PXOA 4XG9A 4UWCA 2SRCA 4EOSA 2QQ7A 3ETAA 2G9XA 3NNWA 3DBEA 4Z3VA 5AA9A 4OBQA 5H8GA 3VBQA 3UO5A 5AR3A 4O21A 4EBVA 3JY9A 2OLCA 3NUNA 3KULB 1GY3A 1OKYA 3O2MA 5BVWA 4IDVA 4YZCA 3TTJA 3U4UA 4RRVA 1MRUA 4C4JA 2HY0A 4H36A 4IM2A 3ERKA 2JDTA 3EQCA 3ZFYA 3NEWA 2X4FA 2X4ZA 4XS2A 4UMQA 4KAOA 3VC4A 3UIMA 5CAOA 5AR7A 2BR1A 3F66A 2CHLA 2ETRA 2W1HA 5HCYA 3DQXA 4RC3A 4I93A 3ZFXA 4HPTE 1CDKA 4FSRA 4GUEA 4B99A 3LJ1A 4IAFA 3Q60A 3EOCA 3TJCA 5JFWA 1XMLA 4AXDA 5AFVA 3NW7A 5DIAA 2Y6MA 5M4IA 5CEKA 2XF0A 1WCCA 3MY0A 1H26A 3FKOA 3M1SA 1F0QA 4IC8A 5HG5A 4EK8A 3OOMA 3U55A 4OTIA 2W1CA 2B9JA 2CGXA 4IXPA 4QMPA 3OW3A 5E91A 4DHFA 3TEIA 4O7ZA 4P5ZA 5EM7A 3C4EA 5EK7A 2JGZA 4AAYA 4YNOA 4BIEA 1YI3A 4JJRA 4M68A 3OHTA 3VJNA 3AC1A 3AD5A 3CQEA 1DS5A 2W1ZA 4QP3A 1OECA 4X0MA 4DCEA 4QMNA 2R3IA 4OAUC 1W2FA 4M0YA 2YCSA 5JRSA 4F70A 5BQ0A 3PP0A 2WAJA 3LFAA 2A27A 2BRBA 3ODZX 4EYJA 4G17A 4EQCA 2B4SB 2G15A 2FSMX 3A8XA 3Q32A 2ESMA 4GH2A 4MHAA 4YJPA 3ZH8A 4BFMA 4CZUA 5FTQA 3QF9A 4E26A 1UNLA 2JEDA 4D9UA 3NYOA 2WMBA 2W4JA 2XJ0A 5ACKA 2ZB1A 3RM7A 2EXEA 4HJOA 4FGRA 2IVTA 2VO6A 2A19B 1OPJA 1W2DA 3ZC6A 4E4XA 3MPTA 4YTFA 1XMMA 4JVGA 3PXYA 1GIJA 2QR7A 3W18A 3UZPA 1P2AA 3AT3A 3UOLA 2C4GA 3KREA 4PDSA 4AA0A 4E4MA 2UZTA 2C0OA 3G9NA 5L8LA 3Q4TA 3G5DA 3TZ7A 4JG7A 3E7OA 4JR3A 1YI4A 5F94A 4MCVA 2WTKB 4F7LA 3BGZA 4FEVA 4EOKA 4EJ7A 2FVDA 5C01A 3TZ8A 4BI0A 5IA0A 4ALUA 4FKJA 4HGLA 4WSQA 2C68A 3QWJA 3RTPA 3E8DA 3G0EA 5IH5A 1Q8TA 3VS2A 4QMVA 3LM0A 4IW0A 5DA3A 4E8AA 2W05A 2ERKA 4S32A 3LCSA 1YWRA 2CNVA 2R3KA 4W4VA 4X21A 1O9UA 4TWPA 4MXXA 3VIDA 3GNIB 2YJSA 5E8UA 3T3VA 5C26A 4FEWA 2WEVA 4WSYA 3EQFA 5H8BA 3F5XA 2QKWB 2JDVA 2BTRA 2GSFA 2WD1A 3V6SA 4YJVA 5FTGA 5T6KA 2JBOA 2VNWA 5AR2A 4MD8E 2BZIB 3FC2A 3TZ9A 1SVEA 3C5UA 4ASEA 3HRBA 4FBXA 1UV5A 3OFMA 3ANQA 4RFZA 4U97A 2W1DA 2RFDA 4EOPA 2O5KA 4GK3A 3ZSHA 2I0YA 2C6KA 2ZAZA 4TYIA 3SOCA 4DYMA 3NFGB 2JIIA 1IRKA 5CU4A 2VWIA 5DWRA 4GIHA 4PMPA 4MNFA 3CBLA 4C0TA 4F1MA 4XYFA 2V62A 4FA2A 2BIYA 4O84A 3RALA 2ITOA 4RJ8A 5L2TA 4NIFB 2GFCA 3GEQA 4D28A 4JG8A 4R77A 5BYYA 4GUBA 3D94A 1Y6BA 3LCTA 5EI2A 1BLXA 4NUSA 2EB3A 4KKGA 4PTCA 3UQFA 4RBLA 1ZYDA 5EKOA 3CQUA 1ZY5A 3NMUF 4NW6A 1OIYA 3CTJA 4F64A 4YZNA 4QMWA 1YOMA 3RWPA 4UYAA 3GC0A 4JLCA 2XM9A 3QU0A 5GZAA 3A7FA 5CTPA 3AC2A 4RC4A 4ZTHA 1TQPA 1Y8YA 2GNGA 3W2CA 4CD0A 3R7IA 3FMKA 2GTMA 1UA2A 4CTCA 5FBOA 5BNJA 2XNMA 3FLQA 4L8MA 2P4IA 3MB6A 4M69B 5DVRA 3R8ZA 4W4XA 4BDIA 2QCSA 2Z7SA 5L8JA 3LMIA 3TWJA 3P79A 3OCSA 2QD9A 4QMMA 2ZV2A 3OT8A 3UVPA 4FSWA 3B2WA 4FNWA 3DK7A 4FIIA 1M17A 1TVOA 3SHEA 5HNIX 4TXCA 4B9DA 1STCE 2DWBA 4FEUA 3I5ZA 2H8HA 4RX8A 4A4LA 2E9PA 3MA3A 2OXXA 4DFLA 4EHVA 4DGNA 3GCPA 3GU8A 3DJ7A 1WBPA 4C3RA 3N4UA 5AV2A 5KMLA 2C3KA 4FG7A 2X2KA 5CANA 2CCIA 5D11A 1P4FA 4F1OA 2XIRA 4FK6A 3PYYA 3MV5A 4O0WA 1G5SA 2B53A 2C0TA 4L3PA 2UZEA 4MBIA 3FXWA 4BYIA 1OUKA 3KIOC 2C69A 2G1TA 3BEGA 4FT5A 2W1FA 3ORZA 4IZ7A 1BMKA 5CF5A 5AUVA 1UU9A 2BRNA 2Y4IC 1YDTE 4ZTLA 4QMXA 3F6XA 5FEQA 4RWJA 3KFAA 3DOGA 5DGZA 3VRYA 4MXYA 4D2RA 4RFYA 5A4QA 5CQUA 3GUBA 2HELA 1OGYA 5AUUA 4UYNA 4DH8A 3DT1A 4FNYA 4HW7A 2UW7A 4NTSA 3VULA 2XK6A 4KRCA 4ITJA 1NVSA 4YTCA 3UG1A 4EHGA 1JPAA 5KKRC 1Q8ZA 4WUAA 3TNWA 3UQCA 4CFXA 2W1EA 2YIRA 4ANNA 1XH6A 4RJ4A 3H9RA 1OKWA 3VO3A 3JVRA 4DF3A 4OT5A 5AP2A 3R04A 2W7XA 1ZYLA 4TYGA 1R3CA 5EDPA 5HG7A 4F9AA 4JDKA 4QYHA 4BGQA 3E8CA 3RWQA 4DGOA 4NWMA 4EQMA 2GMXA 4JBVA 2GNHA 3QD4A 2VTPA 4CLIA 3UNZA 3NVKI 3FXXA 5HCXA 3CQWA 5L8KA 3BL9A 1OMWA 3FMJA 4MK0A 4MX9A 4KRDA 4NIFA 2XNPA 5HE2A 4I6BA 4KIKA 3W0QA 4QQJA 3O7LD 5FP6A 3ZEPA 2HW6A 3D7TB 5CU3A 3VW6A 5AV4A 4EOMA 5B2LA 4U43A 4IADA 3HV4A 2WOUA 3SVVA 2W06A 3BU6A 2G2FA 2HWOA 4C58A 4NM5A 2OK1A 2YZAA 3G2FA 4QD6A 4WG5A 4B4LA 2IZRA 5BVDA 3U54A 2C6EA 4JX3A 5I9XA 2ONLA 2ERZE 5KHWA 3MYGA 4L44A 4DHIB 3Q6UA 5IQHA 3L9PA 1KE5A 1LP4A 1H4LA 2VTAA 2YLFA 3WYYA 4EK5A 1XWSA 5HO8A 1B38A 3ORNA 1GJOA 1OUYA 4Q2AA 4QMZA 4ZEGA 3P86A 4XP3A 3LLAA 2JKOA 4XOZA 4BI2A 3VJOA 4M69A 5T68A 3G90X 5H9BA 1H27A 3ZRLA 4CFVA 4AS0A 2XM8A 2VWBA 2VX3A 4ZMFA 4MXCA 4EWQA 4ACGA 1SNXA 1AQ1A 2UW6A 3CKXA 3F2NA 4I3ZA 3VUIA 2XALA 3DZQA 1H00A 4W4YA 1PXIA 1J91A 3FL4A 4ZSEA 2IZSA 3F5UA 3FXZA 2PMOX 4L3JA 2P33A 5IMXA 1DAYA 4HVIA 3QQJA 3S95A 3ID6C 3H9FA 3CXWA 3BYOA 4FI1A 3VW8A 3CTQA 5M4CA 2PVMA 3LCDA 4BBEA 4S31A 3KA0A 4IVAA 4FV3A 3BZ3A 3C50A 4FIFA 4ZOGA 5F20A 5KBQA 3NNVA 3BYUA 5HGIA 3UMWA 3V5WA 4BCIA 3PIYA 5AP1A 2YM3A 3Q5IA 4RIXB 2XK9A 5HHWA 1XH8A 4C61A 2XZSA 1XR1A 5DBXA 4QYEA 3DGKA 4KBKA 2E9UA 4I6LA 2BAKA 5IQCA 4XG8A 3FI3A 4FT0A 3D5XA 4G3EA 4FKWA 2X0GA 4AP7A 2WU7A 2AC5A 2XJ1A 3II5A 2QU6A 2R4BA 3P78A 4C36A 4CV8A 4YO4A 3F2AA 4XRLA 3L8SA 4GVAA 3OUNB 4EJNA 3VF8A 4ANQA 4TNDA 4G5JA 4X2FA 4J71A 5AUYA 4DLJA 4Y85A 3W10A 3UPZA 5IZFA 3CTHA 3QTRA 2CKPA 3KCKA 4UZHA 2YAAA 3T9IA 5IEXA 2C6MA 3QYWA 2YDIA 2PZPA 2YM5A 3EHAA 4LI5A 4OLIA 4XX9A 2C5NA 3FI4A 3H0ZA 3TKIA 4FSTA 5E90A 2A4LA 3ML1A 4FMQA 4XG7A 3NRMA 4AT4A 4KABA 5F1ZA 1FQ1B 4BYJA 2VZ6A 3NIEA 1RE8A 3DAKA 4C4GA 2ZDTA 4BWKA 3UIXA 4J97A 4DLIA 3D0EA 4G6OA 3TT0A 3LJ0A 5IQBA 1PHKA 3MH1A 2X6DA 4TYHB 4UY9A 3BBWA 4GEOA 1JKTA 4XRJA 4J96A 4F7SA 1FGKA 3O8TA 3VRZA 2W9ZB 2PPQA 2XBAA 4FKOA 1JSVA 4ZZMA 4GG5A 3SRVB 3VVHA 3DKFA 1PXNA 3LMGA 4FTNA 3ZO1A 3FBVA 4IZYA 1TKIA 3R9DA 4R78A 1UKHA 4XV1A 5A4EA 1YVJA 4TT7A 2KTYA 4DH7A 2OGVA 3KMMA 3W2PA 1ZMWA 2OU7A 4BCQA 4R1YA 4FC0A 3PTGA 4FTRA 4EZ7A 2X8EA 1GIIA 2YLEA 3SOAA 5J87A 2VTMA 5L2QA 4PWNA 4EOIA 4LUDA 2ZV8A 1Q24A 1BYGA 3BGPA 3EN7A 3F9NA 3M11A 1YOLA 3FKLA 3PVGA 3QBNA 4HGSA 5EOLA 5C03A 5C8MA 3SDJA 2X7GA 4BR3A 3F7ZA 4BCOA 3IONA 1WFCA 4S33A 4BC6A 4ZMEA 4IX3A 5B2MA 3LFSA 3GU5A 3PA5A 5M44A 2QI8A 4FR4A 1SYKA 4EH9A 5F4NA 1P14A 4G9CA 5ANKA 3ET7A 3O23A 4QP4A 2OICA 5LMAA 2RL5A 3VAPA 3ZZEA 1ZRZA 2NO3A 4FL3A 4R5SA 4ZS4A 4EYMA 3D9VA 1ZOGA 3DLSA 2O3PA 2VTLA 3WZKA 3TTIA 4AOTA 2BDWA 5HCZA 3IQ7A 4X3FB 2GNJA 4N57A 5LWMA 5AV3A 4BDAA 4JRVA 5C8KA 3LW0A 3OY3A 5TKDA 4JQ7A 5I9ZA 1U4DA 3BHVA 5HORA 1RW8A 3DXNA 4EEVA 2UW4A 2YHVA 1FMOE 4AG8A 4PDYA 5M55A 4G3FA 4YU2A 4U44A 3S2PA 4FGBA 1ZXEA 3PVBA 3CPCA 4DBXA 5BUIA 4U8ZA 1ZAOA 2PZ5A 4WD5A 5HE0A 2PYWA 1WVXA 2QR8A 2XJ2A 2Z7RA 4IVBA 5CAVA 4KUJA 4C02A 3DKOA 4J52A 4CKIA 4C3PA 2IWIA 4RIXA 4YJOA 4Y5HA 5KE0A 3FKNA 3D2IA 1T45A 4XBRA 4RIOA 1XKKA 3V04A 5ETFA 2QOHA 1BI8A 3LFCA 2R0UA 3LJ2A 4G3GA 3MVMA 4EH2A 4UV0A 2HY81 3PFQA 1PMUA 3R21A 2WU6A 3FY0A 2PUIA 5IQGA 4I20A 3OXZA 4AOJA 5HBJA 3AGLA 4OBOA 3EQHA 4FKPA 3PJCA 2XKDA 5BPYA 5FEEA 4PTGA