5ETFA

Structure of dead kinase mapk14 with bound the kim domain of mkk6
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
350
structure length
338
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVRKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Structural Basis for the Subversion of MAP Kinase Signaling by an Intrinsically Disordered Parasite Secreted Agonist.
pubmed doi rcsb
source organism Homo sapiens
total genus 110
structure length 338
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5etfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5etfA01
5HVYA 4JDIA 3LXKA 4FV9A 4QNAA 3FV8A 4TT7A 1Q62A 4J8NA 2X9FA 5CSWA 4C3RA 4FSYA 5L2TA 3BHUA 1URWA 5DA3A 3LJ0A 3FMDA 3TXOA 4DLJA 3MB7A 1BX6A 5HG7A 1NW1A 3HLLA 4RWJA 2R7BA 5AIKA 4X6QC 2BRGA 4IADA 4G6NA 2QO2A 5JH6A 2ZDUA 4D9UA 4FV3A 4QO9A 3CQUA 3S4QA 2Y8OA 3VRYA 3DXQA 1JLUE 5D1JA 2JBPA 4AGDA 2QHNA 2HK5A 5DR2A 5C4LA 3ZM9A 4FF8A 3VQHA 4I93A 4F9AA 4W4WA 5DIAA 3CCNA 5F95A 5EYDA 1H1QA 2PVYA 3POOA 3DAJA 4L9IA 4E5WA 3MS9A 4A7CA 3CD3A 3Q9YA 2BZJA 3FMNA 2LAVA 2UZBA 3C51A 4QMSA 5AX9A 3D9VA 3LQ3A 3HL7A 4E8AA 3O51A 1HCLA 4ANOA 4E73A 3F3ZA 4WNKA 1VYZA 2ZM3A 4ITHA 4EZ5A 3PXQA 1IAHA 3G90X 4Y85A 2VO0A 2WMBA 1TKIA 2YJSA 3BV3A 3QQUA 2QR8A 3F3UA 5AUXA 3R7EA 2FSTX 3RPYA 1KE6A 3LCDA 4R7IA 4FKPA 1FQ1B 4P5QA 3QD2B 4PMSA 4QOXA 4TZRA 4EH3A 4KBCA 5M57A 1ZOEA 3KY2A 5TO8A 2OZAA 3EH9A 4RJ7A 4LMNA 5DT3A 2OI4X 4D2RA 3VBXA 3N4VA 2PYWA 4XOYA 3O7LD 4MF0A 3C4CA 4QYYA 3WIKA 4V0GB 5FRIA 5HG5A 4FSZA 2XP2A 3DNDA 2OXYA 5HORA 2YLEA 3CTHA 3R1SA 5GJFA 3JR1A 3CEKA 3F9NA 3OHTA 3WF5A 4NFMA 1GZKA 3UZRA 3AC8A 4EK8A 5HCYA 3QQLA 2V7OA 4H3QA 4CKJA 3FBVA 3PP1A 2BROA 4C58A 2XIKA 3W16A 3A99A 4NTTA 2ITUA 5A46A 2P33A 3M1SA 3TIZA 2V0DA 3PE2A 2X2KA 4FTIA 2UVYA 4CMTA 1OUYA 5J5TA 2A27A 3WZEA 2C6LA 5ANIA 4O1OA 5C8MA 3TZMA 2QODA 4JOAA 4YJVA 5H8BA 5JN2A 4GYGA 1UWHA 3FZ1A 5EK7A 3SD0A 4EK3A 3DBEA 4ZTMA 4PDYA 1WCCA 1TQPA 3WI6A 4G3EA 3MFUA 1ND4A 3QD3A 2VWUA 2CJMA 2O0UA 2W5HA 1J3HA 5BUIA 3A7IA 4YR8A 2A2AA 3TCPA 2B7AA 2E9UA 4OBPA 3TWJA 3AD6A 3ENHA 1H4LA 4L3LA 5IUIA 5AUYA 3IGGA 3IO7A 4MBLA 3VN9A 3UQFA 2Q0BA 5CF4A 3QHWA 1IR3A 3EYGA 1ZWSA 5A4TA 5A6NA 2CKOA 4DCAA 5CEKA 2OFVA 4HVSA 2YIXA 4MXZA 5DT0A 5AUVA 3Q5IA 1OVEA 1W82A 4QMYA 3R9DA 4BDGA 4FTRA 2H9VA 2R7IA 5EDQA 3ZLYA 4GCJA 2HELA 3LLAA 2ZV7A 4GUBA 3LM5A 2UW5A 3R6XA 1BI7A 2WTVA 4IQ6A 4UB7A 5I3RA 3SXRA 3KN5A 4U6RA 4Q2AA 5AV4A 2Y0AA 2ZMCA 3VUIA 4AACA 4MD9E 1U4DA 3Q32A 5L2SA 1GZOA 4FODA 3WOWA 5M51A 3D5XA 2CN8A 4GIHA 2YA9A 1H1SA 1OECA 2WKMA 3Q9WA 2X0GA 3C50A 3O8UA 5ANKA 4B9DA 4GT3A 1TQIA 5AA8A 3OXIA 3A2CA 3PXYA 4MVFA 4A06A 2WQBA 3W2OA 2GS2A 4FTTA 3LFDA 3R8PA 3BGQA 4KWPA 3PJ2A 3HUBA 3LJ1A 5EYCA 4JT3A 4E5AX 2NPQA 4C4EA 4QYEA 5EH0A 5CYIA 5KMKA 1YVJA 4DT9A 1PXPA 4ZMFA 5DRBA 4FV7A 4ZLYA 2VGPA 4RJ4A 4C33A 2YITA 5FM3A 2QHMA 3PUPA 5H9BA 1YI4A 4TN6A 5EHOA 4DGGA 2REIA 4PPAA 4FT5A 1OI9A 2YAAA 4K18A 3N9XA 1FPUA 2DS1A 3SKCA 3PXZA 2IWIA 2ETKA 3QQGA 1XR1A 2VRXA 3IDBA 4E4MA 2YIYA 4KAOA 1PW2A 4F0GA 4KKEA 4QQCA 5HESA 3Q4ZA 3CTJA 4O0RA 4JDHA 3FHIA 4XJ0A 4ACGA 4DGMA 4EC8A 3UNZA 4EH9A 4BICA 4C4IA 3R7IA 5AP3A 3BYOA 4MXYA 4E6CA 2W4JA 2W99B 3DQXA 1NVQA 2CCHA 4M13A 5BMMA 5AAFA 4AXAA 1H1WA 1WBNA 1DAWA 3RJCA 3EMGA 3OWLA 3QUEA 3E7VA 2PPQA 2JIIA 3MESA 5JFVA 3KK8A 5GIOE 3MY5A 4C57A 3MVMA 4O0WA 5EOLA 3F82A 2WO6A 1WVXA 1OPLA 3H9RA 3BYSA 4QP7A 4AZEA 1PYXA 3MIYA 4RWLA 1XH4A 4NW5A 2EVAA 4U7ZA 1V0OA 4BCKA 2Y6MA 4GU6A 4E4XA 1W8CA 3TDWA 2BAQA 2CN5A 5CT0A 3HP2A 4HW7A 5HZNA 1GY3A 3H30A 2ZV9A 4RA5A 3UP7A 3JY9A 5KBQA 2QLQA 2UW0A 3GC8A 2R3GA 3F6XA 4RFZA 4YLLA 5BUEA 4AN3A 4ZEGA 3IONA 5FDXA 4E7WA 5KMIA 2YWVA 2QU6A 3R8UA 2UZWE 4Q5EA 3AC3A 4D9TA 4EYJA 1UU9A 5HHWA 3BRBA 3BHVA 3HECA 4L8MA 3VULA 5LXMA 4O21A 3SHEA 4Z7GA 3BE9A 4D5HA 3ZXTA 2JC6A 3UMWA 1CSNA 2BDWA 4J8MA 4D1ZA 5A4LA 2I0HA 4OLIA 3PSCA 4O83A 4KSQA 2V22A 2BZIB 4CQGA 5CU6A 4F1MA 3ZHPC 3PRFA 4AOTA 4I6HA 2GHGA 4DITA 3QA0A 3ZMMA 4IM0A 4QMOA 2YZAA 4X3FA 4O82A 3GC9A 4ERKA 4BYIA 4KIKB 5L2QA 5HLWA 4FKQA 2I7QA 1YOMA 3P7BA 4UEUA 4A9SA 1DI8A 3NUSA 3OCSA 4J95A 4WBBB 4Y73A 2GHLA 3W55A 1W83A 4FT7A 1JAMA 2FH9A 2QO9A 4L6QA 3NAXA 4PP7A 4QP4A 5EYMA 2XNMA 1YXXA 3DJ7A 5C03A 4QP3A 3D2IA 5A4CA 2G15A 4IAKA 3GCSA 3PVWA 3DLSA 4IAAA 4KKHA 1XH8A 3QC9A 5TF9A 5KNJA 1CMKE 3TIYA 1H0VA 2B53A 4FA2A 1OIRA 3DDPA 4F63A 3VJOA 4YBKA 4MQ2A 2Z7QA 2R4BA 4LGHA 5JGAA 5FBOA 4JRNA 4RIOA 1PXKA 5AFVA 3QRTA 3VBTA 3QYZA 3A7JA 3F3VA 1FINA 2OSCA 3TZ7A 2ITNA 5DR6A 4AU8A 1PRYA 2UW8A 4NZWB 4EOMA 5JQ8A 3OTVA 3KCKA 3WIGA 4USFA 2GNLA 2C4GA 3TNHA 4HGSA 4GKHA 3CJFA 4BTMA 5FXRA 3UNKA 4RQVA 2QG5A 5BX0A 5BYYA 5HD7A 2NRYA 3NMUF 2CPKE 3QCXA 4JNWA 5F4NA 2WMTA 3GCVA 4MQ1A 1WVYA 4XNEA 3TTIA 4QMNA 2J4ZA 4BTJA 4R3RA 3W2RA 3KRWA 1FGIA 3KEXA 4X2JA 4BGHA 1GNGA 4RZWA 5GINE 4NJ3A 4FX3A 3EYHA 1UKHA 4QPMA 4C35A 3O17A 1KE8A 3VF8A 1YWNA 4NCTC 2UZLA 3RAHA 3PSDA 2JITA 3QRUA 3PA4A 4O7TA 1P4OA 3FI8A 4KKGA 4QMUA 2JDTA 3TZ8A 4O7YA 5CZHA 4ALWA 2W1CA 1KV1A 2HAKA 4PL5A 2PVJA 3C4XA 3DK7A 4F9WA 4G3CA 2O64A 4O91A 4L45A 4XYFA 4ZZMA 4EHZA 3JUHA 5FG8A 1QCFA 5BYLA 1BUHA 2GMXA 2PMNX 4MWIA 1Q8ZA 2A0CX 2V7AA 3NUPA 1OITA 1MQBA 3ORMA 1J7IA 3QTUA 4FKWA 5IQFA 2XVDA 5IQEA 3QUDA 4UXLA 3VUTA 3COHA 1RJBA 3P0MA 5BVKA 3RNIA 4APPA 2GS7A 3SVVA 4CXAA 4I0TA 3QKKA 2X6DA 1JPAA 3RAKA 3D5WA 2EUFB 1YXVA 1TVOA 5LVPA 2YFXA 4GUEA 4IHPA 4LV8A 1Q8WA 4F0IA 2OBJA 2EU9A 4ACDA 3OW3A 4NTSA 5H8EA 2YCRA 1P2AA 5C9CA 3E87A 2AC5A 2YDJA 4BDAA 3DB8A 3PWYA 2R3PA 2B0QA 4FTMA 3OFMA 4PPBA 4C7TA 2F49A 4BIBA 5LWNA 3K5UA 5M44A 4C0TA 4D4RA 4G5JA 2CMWA 2ITPA 3BEAA 4JS8A 5I4NA 1Q4LA 3FI3A 4YBJA 3OOGA 2B1PA 3OVVA 4UZDA 4YSJA 1KE5A 4FGRA 3LXLA 4YO4A 5FUTA 2P2IA 4FSWA 3FMHA 3R7OA 3THBA 4C59A 1H08A 3O8PA 3GEQA 3V5LA 4GKIA 3QTXA 1WBWA 3CR0A 3QD4A 4O7VA 5CAVA 4FMQA 3BLQA 3MSSA 5E90A 4AGWA 3AG9A 3G51A 5CQWA 3BU3A 5D9HA 5I9ZA 1XBAA 4FKRA 1R39A 3P7AA 4KNBA 5AV1A 3EB0A 4RLLA 5HX6A 1P14A 5LQFA 5IF1A 2OH4A 2BR1A 2F7XE 2WEVA 4GRBA 4V0GA 2P2HA 1Z5MA 4E6AA 2C5VA 3VHEA 5HOAA 5C8NA 4LL0A 1HOWA 2UW7A 4I41A 3BV2A 1A06A 3MA3A 5IH5A 4B7TA 2PMLX 3A60A 3BU6A 4JLCA 4PL4A 4ZTNA 3WARA 3ZO3A 3KL8A 3VIDA 3TJCA 5HEZA 2OJIA 2PE2A 5AR3A 5LMKA 4GG7A 5AV2A 3LCKA 2QVSE 4I5CA 4RQKA 1WBVA 2UW9A 4PY1A 4KA3A 3FXZA 3DZQA 4CFWA 2GQRA 3BWFA 3AMAA 4XG2A 3AC1A 4G6LA 1Q97A 4BDFA 4Z55A 3W8QA 3HV5A 4QMWA 2R3OA 5EM5A 3R04A 5FWKK 3PIYA 3DAEA 3PA5A 3FE3A 3VUGA 4AOIA 4FIHA 5H2UA 5L2WA 4WRSA 2VWWA 4OTIA 3W18A 4F6UA 3C13A 1ZAOA 2J0KA 2JAVA 4DH1A 5LVMA 3OCTA 1AD5A 3FQHA 5A14A 5AR4A 1QL6A 4LUDA 3QGWA 3R7VA 4YJRA 4MNFA 2WTJA 3ZLXA 5IH6A 3UTOA 3MTLA 3GFWA 2UVZA 4IANA 4XHKB 4WT6A 3IK3A 4E6DA 2HZIA 4K0YA 4QPAA 3W32A 3TACA 2VO7A 5KHWA 5K3YA 4EEVA 1SM2A 2OU7A 5D12A 4BI1A 2GNHA 1W98A 4MBJA 5IEVA 4ZLZA 1OL2A 4FKTA 2WQOA 3VRZA 4O0SA 3PIXA 5L8LA 1W84A 4WUNA 2ONLC 4W4XA 4WG5A 2O2UA 2VNYA 4BN1A 3C5IA 3OZ6A 4BCMA 5KBRA 1Q8UA 5AM7A 5IH4A 1CTPE 2YEXA 3NZ0A 4IX6A 3W2PA 2X6EA 4RVMA 4YGAA 5HG8A 2ZV8A 4I22A 4S34A 4X0MA 1OIYA 3DGKA 4QTDA 2VTSA 4O0YA 4DFYA 1OPJA 4CV8A 4A4OA 1DM2A 3WE8A 2O63A 2E9OA 3DBFA 1NA7A 4IB0A 3F61A 3P86A 2JEDA 3NYOA 3QHRA 5ETFA 4BF2A 4X7QA 4QTBA 4F08A 2H6DA 2R3HA 3D83A 2A1AB 4WIHA 4XRJA 4H39A 4XS2A 4LV5A 5AR8A 4D4VA 4FTNA 3RALA 4OAUC 5M4UA 3V8SA 5DN3A 3ANQA 3CPCA 2JKQA 3P79A 1YOLA 3EHAA 4ANMA 5AV0A 4AW0A 4BIDA 4FYNA 3CSVA 4ASDA 4FE2A 2WB8A 4YHJA 5K9IA 5EM8A 4C61A 2IZUA 5DLSA 3VHKA 3SW4A 4FKJA 3I6UA 5I9YA 4ZSLA 4YTHA 3LLTA 2YABA 2CGXA 4V04A 2PZIA 1UU8A 3JY0A 3GBZA 5JFSA 1U5QA 3T9IA 4F1OA 2PVFA 2BRMA 4EONA 1BKXA 1G8SA 1B38A 2XJ1A 2J7TA 3ZXZA 3KN6A 2FB8A 2XNPA 4JR3A 3I4BA 5ANJA 4I20A 4NH1A 3ZBXA 2W1EA 4DFZE 4I5MA 1G8AA 1PYEA 2ESMA 2VX1A 4S2ZA 3E3PA 3O71A 4TWNA 4O7ZA 2C0TA 4XBRA 3R2YA 5IISA 4ZXTA 4WOVA 2CGUA 4M3QA 2Z2WA 5I3OA 3EQIA 5JGDA 2JKOA 4KBAA 3HUCA 4U9AA 3R7GA 5HO7A 2HWOA 2WAJA 4FL1A 4PDPA 4HPTE 3EQCA 3LKMA 4QP2A 5IQHA 3O7LB 5FM2A 3QC4A 2QNJA 4RRVA 4Y72A 5EI6A 3PYYA 4M14A 4XUFA 2FUMA 4EK4A 4N0SA 4BHNA 3LFBA 3UIXA 2HW6A 3MH0A 5LCJA 3FC2A 4OR5A 3QQJA 5J7HA 3C4EA 3CY3A 2FSOX 4FK3A 3HGKA 2YACA 2VNWA 1OKWA 2GPHA 3L8VA 4PF4A 4TXCA 5CU3A 3OS3A 4DH8A 1OL6A 2FO0A 3KKVA 4M69B 3ELJA 5DE2A 3ODZX 4XV3A 3ZEPA 5DPVA 2XK4A 4B8MA 3ZFYA 3UO4A 5L6OA 5EQYA 3RPSA 3UOJA 5BVWA 5TE0A 4N4SA 4C4FA 2XCHA 4L53A 4O96A 1P5EA 4BTFA 1JKSA 2GNGA 3EOCA 1UWJA 4JIKA 2W0JA 1WAKA 3SQQA 3TV7A 2YM5A 5CAQA 4N57A 4ACMA 3HV6A 3UNJA 2BZHB 2XBAA 3BPRA 2YERA 3Q6WA 3RPRA 2PZ5A 4RIWB 5J1WA 3MFSA 2W1DA 3IW4A 3EFWA 4FKUA 5CF8A 4AW1A 5J7BA 3OXZA 4AW2A 2AC3A 2XYNA 3LFQA 4JDJA 3W8LA 4RVLA 3P7CA 3W2CA 4P4CA 1H27A 3Q2MA 3QWJA 5FEQA 3LQ5A 1NT2A 1UNGA 4BGGA 2G2FA 4DT8A 3M11A 4KRDA 4CTCA 4WNOA 3PP0A 3R21A 4DN5A 3BIZA 5IEXA 5EOBA 3F7ZA 1CDKA 4YZNA 5IEYA 3UQCA 3KREA 4EOJA 2VTLA 4RPVA 4EQUA 3RAWA 3R30A 4WUAA 2PVKA 2GQSA 1Y6BA 2XK7A 3Q9ZA 4JXFA 2UZDA 3JS2A 4D2VA 2C6TA 5AP7A 4KD1A 3IG7A 5EDPA 3LXNA 3FI4A 4R5SA 5IG1A 4DA5A 1YQJA 3BQRA 4HZSA 5GHVA 4BCHA 2X2MA 3UBDA 3Q5ZA 4EH5A 3GGFA 4L01A 4LL5A 2XM9A 4USEA 1LPUA 2WMVA 1XHAA 5KMNA 2QG7A 3RCDA 3EQBA 3LFAA 4AAAA 5E1EA 2PE1A 4MWHA 5CEOA 5HU9A 3T8OA 4NWMA 1PXIA 3QWKA 4FGBA 2BRBA 3MPTA 3R00A 4TYJA 2ZMDA 4E5BA 3EKKA 4RT7A 5A4QA 2ITZA 3RINA 3IGOA 4IX5A 4FVQA 3FJQE 3OY3A 3LJ2A 4U43A 4DCEA 3VUHA 3UQGA 3P5KA 3PXFA 4FNZA 5AP4A 2XB7A 4G2FA 4IFGA 4E6QA 1MUOA 1R1WA 4QMXA 4X2KA 4PNKA 5CAOA 2RF9A 4CQEA 4IXPA 4U97A 4MH7A 2CKQA 4AWIA 2IVVA 3DFAA 4F4PA 3TUCA 3LIJA 4O7LA 2J90A 5B2LA 3EQGA 4EOLA 2PHKA 5FXSA 4EBWA 5KUPA 4GG5A 4HYHA 4FSTA 4RIXA 4IWOA 2YN8A 4DEHA 1REKA 4CG9A 4FOBA 1OKZA 4EH7A 1YXTA 2GHMA 3FLYA 4HNFA 4BCOA 2XF0A 4AF3A 3VS0A 1UKIA 5M53A 4XH6A 2XNOA 4N6ZA 4YHFA 3A4OX 5LVNA 3TT0A 1T46A 4TWPA 3NIZA 4BY9E 3QKMA 5HI2A 3DV3A 3L9MA 1GJOA 5CEIA 3RKBA 3SRVA 3SXFA 4O81A 2NP8A 4GVAA 3OY1A 4TY1A 3COMA 5EW8A 4AZWA 4UXQA 5A9UA 5IA0A 4PDSA 2PVLA 3TUBA 1MQ4A 3R0TA 4W8EA 1H28A 5D41A 5IQDA 4QT1A 4BB4A 2R3LA 1H8FA 1UV5A 3NW5A 3PA3A 4KS8A 3VQUA 1GIIA 4L44A 3WF7A 4BC6A 2BKKA 1BL6A 3NVMB 4K11A 4XG3A 1A9UA 4OBOA 4FI1A 2R3IA 3NNXA 3SA0A 2UZTA 3LCTA 1LR4A 1B6CB 2OKRA 1XBBA 3QD0A 4YNOA 5L6WL 2BRNA 2CKPA 2B54A 4HVIA 2WTKB 3PPKA 3UE4A 2PULA 2F9GA 2IW6A 1IA8A 3E88A 3NX8A 3NGAA 5JFWA 2Z7SA 1YKRA 4LFIA 4QQ5A 4CFFA 3JVSA 4C2VA 3ROCA 4CCBA 2QKWB 3PFQA 4CGAA 2DUVA 3JYAA 5FBNC 4MYGA 3PVBA 5IUGA 2J2IB 4U3YA 3TNWA 4B8LA 3HMMA 3KCFA 4IWPA 3UG2A 2YHVA 4C2WA 5B0XA 4GVJA 4M66A 3UP2A 5AX3A 5M06A 3MH2A 4MD8E 3BGZA 2W1IA 4UYAA 2W7XA 4FV8A 5LCKA 3S2PA 4PTCA 3TV4A 4B6LA 5EHYA 4A9TA 3NAYA 4O27B 4CKIA 4YZBA 2IG7A 4EH4A 3BQCA 3HMNA 3PY1A 4X3JA 4FZAB 4XOZA 4F7SA 4TNDA 3LMHA 3F66A 5DT4A 4I94A 3LQ8A 3D15A 5CQUA 4Q9ZA 1XKKA 1JSVA 1XBCA 3DKGA 2Y4IB 5DNRA 3ZRMA 2PZPA 2ITOA 2YM4A 3U55A 4HGTA 4NIFA 2X7GA 3L1SA 4FC0A 4OUCA 3F3TA 4MXAA 2YIWA 3GOPA 4HNIA 3EIDA 4I23A 4O6LA 4FKVA 1EH4A 5KCVA 5BQ0A 4NM3A 3R8VA 4I0RA 1CKJA 4QMMA 1JOWB 1Z9XA 3OW4A 4ACHA 1GIHA 3BGPA 5AUUA 3PJ3A 1Q99A 2BFYA 2PU8A 4JBPA 4F70A 4ZOGA 1LEZA 3RHXA 3MJ2A 3D0EA 3OXTA 3QYWA 4QTCA 1OL1A 3CGFA 5HE3A 4IAZA 3C1XA 4ZP5A 3VS1A 3AC2A 4FG8A 1IASA 4YJQA 4H58A 1YHWA 4FKSA 4RIYA 5IMEA 4I6FA 1JNKA 3AD4A 3BELA 3FMJA 4BDCA 5HX8A 1PKGA 5I0BA 1O6KA 4QMTA 4BDKA 2YWPA 2F7EE 2VTHA 4C4GA 3R01A 1ZOGA 4E4LA 4FIIA 3V51A 4ZAUA 3AQVA 3U6HA 4B0GA 2X8IA 4ENYA 4IDVA 4UZHA 2HIWA 5CXHA 3SG9A 4BRXA 4BWXA 2ZYBA 4I92A 1JWHA 2ITQA 2EWAA 1ZYJA 3IW5A 2XRWA 4OTDA 1ZYLA 3V5TA 5I5ZA 1PMVA 2WQEA 3IKAA 4NM5A 4U80A 4BKZA 4FYOA 4LYNA 4WKQA 3MVHA 4C38A 4EC9A 1XH9A 3HDNA 3GU7A 3AC5A 2OF2A 4GS6A 3ALOA 5TKDA 3R73A 5JKGA 4QP6A 3QTSA 4XV2A 3RM6A 5DMZA 3KXMA 3AD5A 3COIA 2I0YA 4IW0A 4Q5HA 2C5NA 4K33A 5FP6A 4BKJA 3VF9A 2V5QA 4OBQA 5ANDA 1U46A 2SRCA 2QOFA 4UWCA 3MGYA 5E92A 3ZBFA 5LJJA 4O0VA 2QR7A 3R02A 5EHLA 3RP9A 1M14A 2BALA 4ONAA 3A7GA 2PL0A 1L3RE 3U87A 1XH5A 1KUTA 3D5UA 3W2SA 2VTTA 3I60A 4XG4A 3KXNA 3TM0A 4RC4A 4BWKA 4A9UA 2BDJA 2UW4A 2X9EA 3FMMA 1O6LA 3GXLA 3VW6A 1ZLTA 4GJ2A 4FG9A 3ZONA 4JQ8A 5LARA 3NWWA 2YCQA 3LHJA 3ZZWA 5M56A 3U6IA 1M2PA 1FVRA 4M0ZA 3FLWA 4OTRA 4AW5A 2C6MA 3V8WA 3G0FA 4BCNA 1MRUA 1E1VA 3FZRA 4AUAA 3Q96A 4Q9SA 4EH2A 2FYSA 4AG8A 4FZFB 1OM1A 3MVLA 1KE7A 4FL2A 4I21A 3FKOA 5L8JA 3VBYA 3BX5A 5CF5A 1PJKA 3H9OA 3RZBA 5KHXA 4GFGA 3WF8A 2VWYA 3WF9A 4HYIA 4FTLA 3E93A 3ACJA 1J91A 3BZ3A 4IBMA 4C62A 2W5BA 3ATSA 4YTIA 1O9UA 3UPZA 3GC0A 3L9PA 4IZ7A 2HCKA 4CT1A 3HKOA 3Q52A 1UNHA 2QQ7A 3FMKA 4AE9A 4EKKA 4G6OA 4EOIA 1JSUA 2C3LA 2YZLA 3SLSA 4O7SA 3P78A 3D7TB 4LI5A 5CWZA 2Z7LA 4DFXE 3QA8A 4OTQA 1T45A 5TT7A 4I5PA 4TNBA 2XK8A 5E8ZA 4FNXA 4UMTA 2B52A 4XG9A 2JIUA 4AGCA 3AGLA 2W9FB 4NCTA 4AT4A 3KRXA 4FEQA 3WZJA 3FWQA 1PXJA 2JKKA 4RMZA 5CEPA 2XNBA 4CVAA 1XWSA 4RFMA 2G9XA 5CU0A 4TL0A 5LMAA 3R7UA 3M2WA 3KXHA 4IX4A 4G17A 1AGWA 4ANNA 1M52A 4D58A 4EOQA 4Y5QA 2VTPA 4MHAA 3RWQA 3AXWA 2YIQA 4FEXA 2GNFA 5IQAA 3GP0A 5FEEA 4PTGA 1AQ1A 3HRBA 5GJDA 3EN7A 4X6RA 4O7WA 5KE0A 5J1VA 2OXXA 2PMIA 2NNWB 4MAOA 4M12A 4Z16A 3FLZA 3RI1A 4ZY5A 4I1ZA 3DXPA 5ANOA 4G9RA 1V0PA 4BFMA 3KFAA 3LM0A 4M69A 1RQQA 1OL7A 2ETMA 4CV9A 4E20A 4IB1A 4CFUA 3UODA 4H36A 3H0YA 4FV6A 4I3ZA 4QYHA 3V5PA 4FTCA 4CFVA 3DBDA 4FZDB 4DGNA 3UVRA 3D94A 1Q5KA 2Y6OA 2W1GA 3KULA 3C4ZA 4TW9A 5HICA 3G15A 3FAAA 3MWUA 4ITIA 5J95A 1YRPA 4GL9A 3TTJA 3UOKA 2DQ7X 2OFUA 2BTSA 3OG7A 4RIWA 2ZB1A 4CMUA 4AX8A 4EHEA 3IS5A 4JL9A 4YO6A 3JPVA 1LEWA 4BCPA 4CD0A 3L8PA 5IQCA 3HP5A 4G3DA 3A62A 3PXRA 4LOPA 4FSMA 4R5YA 3RVGA 2PWLA 3NNVA 4D2PA 2HYYA 2QOKA 4S30A 3VS2A 1K2PA 4AE6A 1Y57A 2BHEA 3FI2A 5JK3A 1E1XA 4AOJA 4NM7A 3ACKA 4JR7A 5DHJA 2CGWA 4LUEA 1H1RA 4XEYA 1KOAA 2OW3A 3T3UA 3F2RA 2UZEA 1ZMVA 4AN9A 3GENA 2YDKA 4M0YA 5H8GA 3DAKA 4MKCA 4F99A 2OICA 2OJFE 3ZSGA 4CZTA 2XRUA 1Y8GA 2AYPA 1VR2A 4J96A 2W1HA 3E63A 5IKWA 1OKYA 2EXCX 2WOUA 3ZEWA 3QLGA 4EOPA 5CNOA 4BCGA 1ZZ2A 3FSKA 3DLZA 3R9HA 1JSTA 3KVWA 2QI8A 3E7OA 3ZFMA 3D14A 2WZJA 2CKEA 2GTNA 1F0QA 2WMXA 3R1YA 4M97A 4RG0A 3EN9A 3L9NA 3DKOA 5HQ0A 2Y7JA 3MIAA 4KSPA 4AA5A 5D7AA 5K4IA 3OROA 2ZM4A 4EQMA 2VWZA 3ZO2A 2B55A 3ULIA 3NVKI 1XH6A 1DAYA 4IE9A 1M17A 3Q4CA 4JG6A 4BBEA 1PHKA 3DS6A 3NNUA 2BTRA 3TKIA 5JRQA 4KB8A 3Q53A 3DBQA 4IM3A 4S33A 4DF3A 5M08A 4G5PA 5IDPA 3NSZA 2XK6A 4DBXA 1FMKA 2RKUA 3F88A 3PY3A 4TYHA 4X2NA 2BKZA 3FPQA 4GW8A 2WFYA 5K0XA 2FVDA 3CS9A 5F20A 2BCJA 3F5UA 3B8QA 4GV1A 1H0WA 2CNUA 2VX0A 3VS4A 2JFLA 3GCQA 3ORPA 2B4SB 3Q9XA 4AN2A 2XIXA 3CJGA 1J7LA 3L9LA 4O0UA 4BYJA 4E1ZA 5E91A 2C6DA 5G6VA 4AZTA 3RAIA 4UMRA 4G9CA 4QP8A 4ZJVA 4IWQA 3ZRKA 3FL5A 4FT3A 3UC4A 2WGJA 1HCKA 2VTNA 4U79A 2ONLA 3DPKA 3I7CA 4FOCA 5IA1A 4MD7E 5E8UA 4BDIA 2YM6A 4D0WA 4KUJA 4FK6A 1OGUA 4I4FA 5AAGA 3AT3A 4XRLA 5FTQA 4A07A 4R77A 5HIBA 3RGFA 1PXNA 4QMZA 4TWOA 4BCJA 5KMOA 4HCVA 2Z02A 2YM8A 4HGEA 3TL8A 2BMCA 3EZVA 3UVQA 4DFNA 4DEGA 3BBTB 3LZBA 2JD5A 2X7FA 4EJNA 2I6LA 2GTMA 3C5UA 4HJOA 3A4PA 5CSVA 3S3IA 3A8WA 5HTBA 3Q60A 1X8BA 2O5KA 3UDBA 1QPDA 2R9SA 5KO1A 4R8QA 3FEGA 3ULZA 2J0LA 2C3JA 4NW6A 3F5PA 2WU6A 1H1PA 2GU8A 3C9WA 2HZNA 2OIQA 3CC6A 4G3GA 4GYIA 4IVCA 2OZAB 2ZM1A 3GU4A 4JQEA 4GIIA 5H3QA 5EYKA 2QOLA 3P1AA 5KMMA 4TRLA 2XBJA 1GZNA 2RL5A 4H3PA 3ATTA 5BVFA 3LAUA 4G31A 1DS5A 3PG3A 4O1PA 4YZMA 3V8TA 1VEBA 4EK5A 2YJRA 5J79A 2QOBA 5JQ5A 4H3BA 3QRIA 3MDYA 5HE2A 3RPVA 3WYYA 2P0CA 3NLBA 4C3PA 2RFEA 4JBQA 4YTFA 3FUPA 3W2QA 1YWRA 4F1TA 4FKOA 4ZSGA 2HY0A 1Q3DA 3A7HA 3LXPA 4QP9A 2QKRA 5FD2A 4RJ8A 1YDTE 3IOPA 4DEEA 4ANSA 3U8WA 4EWQA 4RWIA 3IW6A 4FTAA 3RK9A 5F94A 3F5XA 2IO6A 3MTFA 4GJ3A 1UNLA 2WMQA 3MV5A 4R6VA 4LM5A 3C4FA 3F69A 3VUKA 4JDKA 4QRCA 3UYTA 4YC6A 4BI2A 2BHHA 4MEDA 1RDQE 1W7HA 3NCZA 1UA2A 3R8MA 3BYUA 2IJMA 4R7BA 3HV4A 3KB7A 3WZUA 4OAVB 4EUUA 3UOLA 4FSUA 1UVRA 1Y6AA 5DBXA 3LFFA 1M7QA 2F7ZE 4LOQA 2WU7A 4BDBA 5ITAA 2WHBA 3EWHA 2BUJA 4EKLA 3DT1A 2XNGA 4H05A 5EKOA 1SNUA 3GU6A 4ZY4A 1FGKA 1O6YA 5IUHA 3A61A 3O96A 4FR4A 4UV0A 1I44A 4PTEA 3G9LX 4C3FA 4Y5HA 1ZARA 4IVDA 1GZ8A 2XIYA 3ORKA 4B99A 1OZ1A 3IQ7A 4ZMEA 5DOSA 3FLNC 2B9HA 4NKAA 3UG1A 3ZOSA 4BHZA 4N70A 1SYKA 1Q61A 2FA2A 4MF1A 4DH7A 3UC3A 5B7VA 2C0OA 2VN9A 3KXZA 4FNYA 3V5QA 4FV4A 4DG3E 2GQGA 2Z8CA 4K8AA 2C0IA 3BI6A 4NSTA 5EQEA 3LCOA 3PXKA 4XV9A 4CZUA 4UMUA 5IQIA 4FV0A 3R63A 4C4JA 1J1CA 4WO5A 4ANBA 4ASZA 5CEMA 2PVMA 3G2FA 4ZSJA 2B9FA 4W4VA 4D28A 2CNQA 1SVHA 4K6ZA 4RJ6A 3BLRA 4A4XA 4ZTSA 3PWDA 5HLNA 5IZFA 4YZCA 2JFMA 3I81A 3QX4A 1K9AA 4WSQA 2R64A 3B2WA 5DGZA 3LFNA 3EFLA 2J0JA 3VBWA 2WMUA 3ORIA 5CLPA 2X7OA 5J9ZA 5KX8A 2WTKC 3ENMA 5AEPA 2FGIA 3DJ6A 3PY0A 2GNJA 3JVRA 4IX3A 2CLXA 4CRLA 4HVDA 2OJ9A 3Q2JA 1WBTA 3MFTA 4CSVA 2RFNA 1PMEA 4MNEB 4H1MA 4V05A 2WD1A 5IPJA 4RJ3A 3W1FA 2WMRA 3NYNA 3MN3A 4BCIA 1YHSA 4Z7HA 3QXOA 4EQCA 4MBIA 1YWVA 4GK3A 3BCEA 2XIZA 3KA0A 3RCJA 2C5OA 3EL7A 4M84A 4BCFA 3PG1A 2CGVA 3L8SA 4F65A 2F2UA 4M7IA 3DTCA 2XMYA 3FL4A 3FPMA 1APME 1ZY5A 3H0ZA 3PZHA 3QX2A 4FSQA 3V6SA 4AP7A 4I6BA 3DTWA 4ZJIA 4YJNA 3I5NA 3W10A 3NNWA 3QF9A 2GS6A 3B2TA 3DKCA 3CKXA 4KIOA 1GOLA 4IB5A 4TPTA 2WMWA 2Y4IC 4QP1A 3TUDA 2X39A 2XK3A 3VBVA 5ACKA 5AUWA 4CT2A 1PXOA 3KRLA 4X2GA 2WTIA 5IQGA 5EW3A 4NEUA 1XJDA 4FZ7A 4L46A 4FV5A 5DG5A 1STCE 3E5AA 5I9UA 5HBHA 4BDEA 4AFJA 2BIKB 5KMJA 2CSNA 5B2MA 3OEZA 5E7RA 4BDDA 5HIEA 4A9YA 4BIEA 4ZZNA 2BAKA 3ETAA 4I24A 3U6JA 2JAMA 2XKEA 2GFCA 4QQJA 2CCIA 3REPA 3ZCLA 4XG8A 4FV1A 4DLIA 3P23A 3F3WA 2HW7A 3IDCA 5CENA 2PZRA 2G01A 3OEFX 2W17A 4F6SA 3TDVA 3R1NA 3MBLA 1J1BA 3CP9A 1MRVA 3ZU7A 4KABA 5CS6A 5IA5A 4PPCA 5J8IA 3TNPC 5E4HA 4RC2A 4Y8DA 4YJOA 3AMYA 4CTBA 2KULA 3D2KA 4YSMA 3NR9A 5D10A 3TJDA 4QTEA 1XH7A 3EFKA 4F9CA 5AUZA 1OBGA 2WTCA 3LVPA 2P4IA 3KMUA 2YDIA 3NIEA 4GMYA 3N51A 5TOZA 3NS9A 4RZVA 2E9VA 3GOKA 4UBAA 5IQBA 1ZMUA 4MX9A 4AZSA 2R2PA 4BVUA 2ITWA 3EJ1A 3EN6A 1VYWA 2PVRA 2QOHA 4AT5A 4O22A 4IH8A 1ZXEA 5AR2A 4ASXA 4X3FB 3EQDA 4IM2A 4L43A 5T6KA 5JEBA 1V0BA 4FV2A 3VS5A 3QCYA 4NL0A 3LFEA 3ZTXA 1GAGA 4MTAA 1M2QA 4E3CA 4YPDA 4U42A 4DEDA 2X8EA 4RX8A 4ITJA 4IVAA 4EORA 4L7FA 5AP1A 4K9YA 1G5SA 2R3NA 3E92A 5DR9A 4KIKA 4ANQA 3C0HA 5LVLA 1H00A 2OGVA 4RVKA 3P4KA 4J53A 2YM7A 2B9IA 3RTPA 3QZHA 4C36A 5HD4A 3RNYA 4M8TA 4OT6A 2IN6A 4WRGA 3ZLSA 3SV0A 4C34A 2ERZE 2OWBA 4L67A 4OTGA 3ROYA 4LRMA 1PY5A 4QPSA 5AUTA 4C02A 2XIRA 4J98A 4IIRA 3FZSA 5AP0A 3OCGA 2C6EA 5CU4A 1ZRZA 3RK7A 3OUKA 2DYLA 5E8SA 4ZSEA 1ZZLA 4O84A 3C7QA 4FIFA 4YZ9A 2WMSA 2ZV2A 3KMWA 4CFMA 4UY9A 3DU8A 4WSYA 2E9NA 5D7VA 2V55A 3NW6A 4G16A 2WEIA 3UIBA 3WF6A 2C3KA 4WNPA 4KIQA 1KOBA 3HRFA 3UOHA 3HEGA 4BGQA 3FZPA 5BMSA 1YXSA 3CIKA 5LWMA 5FTGA 5CF6A 2VZ6A 3R8LA 5JSMA 4EBVA 2G1TA 3S1HA 3QUPA 3DCVA 1OB3A 5FLFA 4II5A 3ID6C 3R7YA 4XLIA 3KU2A 2P55A 3VW8A 3UJGA 5M55A 3ZH8A 4MXXA 1UU7A 2VTAA 3U4WA 1Q41A 4C37A 1URCA 4X21A 4DE4A 4FT9A 3AMBA 5DVRA 2ETRA 4FVRA 3UVPA 3QALE 3OT3A 4HCUA 1IG1A 2LGCA 3QQFA 4F0FA 3PLSA 3QU0A 3FQEA 5I9XA 4DG2E 4YU2A 2I40A 1ZYCA 2J51A 2PZYA 4L00A 4EYMA 4J7BA 1Y91A 1LP4A 1KE9A 4YLKA 4GT5A 3SAYA 4ALUA 4K2RA 3GCPA 4JG7A 3MW1A 2H96A 4D2TA 2UZUE 4CLIA 2WELA 4MCVA 3T3VA 2C68A 1Q24A 3PJCA 2UW6A 1WVWA 3HVCA 1KSWA 4GK4A 4U81A 3HMIA 3FKNA 4YUQA 2P3GX 4J1RA 4E26A 4TWCA 4DH3A 3RHKA 1JQHA 3FLSA 1QMZA 3VO3A 4BZNA 4EHGA 3GUBA 5HO6A 3OBJA 3Q4TA 4L3JA 4ZLOA 5I9WA 5M4IA 4Y95A 3FMEA 3CQWA 4EJ7A 5E9EA 2DWBA 4MXOA 4NT4A 4IVBA 2QO7A 3FYKX 3DDQA 4YHTA 5F9EA 2J0IA 4YTCA 1DI9A 3G5DA 3D7ZA 4USDA 5HGIA 3M42A 3SC1A 2BZKB 2UZVA 1FBNA 4FUXA 5BPYA 4G3FA 4HZRA 4KIPA 5KKRC 1YW2A 3WE4A 4PDOA 5C8KA 3HMOA 3SGCA 1F5QA 2JDOA 4Y46A 4ZTQA 2PTKA 3R1QA 4R1VA 5CALA 1NXKA 2OJJA 4EZ7A 2WIPA 2IZRA 4L52A 3GCUA 3ZDUA 2OO8X 4NFNA 4YURA 3O50A 3UIUA 5A6OA 5DI1A 3SXSA 4FEWA 4U45A 4YZDA 4RLKA 4AQCA 5CSXA 2G2IA 2XJ2A 1FMOE 2PSQA 4MXCA 4P7EA 1RW8A 2ZJWA 5CI7A 3NUXA 4IC8A 3K54A 5J9YA 5M4FA 4I0SA 4W8DA 1SZMA 4DYMA 4I6QA 1ATPE 4XCUA 3VS6A 4EWHA 4QTAA 2ITYA 2OF4A 4EOOA 5IDNA 5AR7A 5AR5A 5CU2A 3HZTA 3CD8A 2WNTA 3QKLA 5CZIA 1W0XC 4IB3A 3ZSIA 2GSFA 4EH6A 5DWRA 4KBKA 4JX7A 3UGCA 3Q6UA 3VUMA 4DFBA 2H34A 2C5XA 2I1MA 4P2KA 4PNIA 4AGUA 5ANGA 5M07A 5TR6A 1OKVA 1PKDA 4LRJA 5IMXA 4ZK5A 4FICA 5M09A 4AS0A 3VAPA 4AA4A 3SOCA 4TYGA 4RVTA 4M15A 3CTQA 4JQ7A 3P08A 2C3IB 3QAME 5EM7A 2R0IA 5D11A 1H25A 3TKUA 1QPCA 4RA4A 4KS7A 2QONA 5T3QA 5J5SA 1MP8A 3D4QA 4EL9A 2RFDA 1ZYSA 4AFEA 5GZAA 3PPJA 3NCGA 1YDSE 1UU3A 4ZS0A 3PRIA 4K1BA 4PUZA 5GNKA 3CXWA 3HMPA 2RGPA 3K3JA 5ACBC 3ZUUA 3HDMA 4D0XA 4ZIMA 4QMQA 3ET7A 1QPEA 1TQMA 2W1FA 3A7FA 3GNIB 3ODYX 4GT4A 4P90A 2H8HA 4IDTA 2VTMA 3BWJA 4OT5A 4UWYA 5ETCA 4FT0A 4CMOA 2I0VA 2QURA 4D2SA 2JBOA 4D55A 2ITVA 4R1YA 4I4EA 1VJYA 5AP6A 3QCSA 2X8DA 3QZGA 3OC1A 4IZ5A 2CNVA 4NYEA 2VO6A 5JMSA 3H3CA 3AT4A 3KK9A 2OG8A 4CEGA 2O3PA 2IZTA 3CBLA 2J0MB 5DEWA 2HY81 4EI4A 4F7NA 5I9VA 5HVKA 2JDSA 3V01A 3NW7A 5HNIX 3RMFA 3ITZA 2PUPA 4TYIA 3FXXA 3MPAA 4CFNA 5K4JA 4HVGA 4JRVA 4YPSA 1WZYA 1CM8A 4U0IA 4AZFA 2YCFA 4OW8A 5AM6A 5C27A 1NVRA 2R0UA 2RSVA 4RBLA 4XG7A 3HV7A 1JKTA 4UWBA 3GU8A 3ALNA 4DAWA 3LPBA 3F2AA 2UVXA 3UYSA 3NDMA 4ARKA 5DYJA 1Q3WA 3OWPA 1U54B 3GVUA 2PUIA 1JKKA 3BLHA 1H07A 4U40A 3E8NA 2FSLX 3GQIA 4UX9A 4BDJA 5BVDA 3HNGA 3MFRA 2HXLA 2YM3A 2OH0E 2WIHA 3MJ1A 3PVGA 2PK9A 4W9WA 3PSBA 2R3FA 5CI6A 4DINA 4UMPA 4DTBA 4MNEA 4LRKA 3GQLA 2CLQA 1OIUA 2XUUA 3KF4A 2IW9A 3CQEA 2XKCA 4RGJA 5CASA 5C26A 3RZFA 3RK5A 4PX6A 5HBEA 2UZNA 2UUEA 5HTCA 5GIPE 2VTJA 4O38A 3H4JA 1OL5A 4WG4A 4HGLA 3SX9A 4NJDA 4EZ3A 2C6IA 5CXZA 5AP2A 3VS3A 4E93A 4RX7A 2ZB0A 2NRUA 3DB6A 4FZ6A 2VU3A 1R0EA 4BWPA 2YIRA 3VC4A 3N4TA 3HAVA 4PRJA 4CCUA 2CDZA 2QD9A 4APCA 3S00A 4CLJA 3COKA 1U5RA 2YLFA 3EQHA 2PMOX 4JAJA 2C47A 4LQMA 5HIDA 3G6HA 3PJ8A 5GZ8A 3IW8A 4LG4A 2VGOA 1GIJA 3NYXA 5HU3A 2W4KA 3NPCA 3QQKA 3DJ5A 3ZS5A 2W4OA 5CANA 1NY3A 3RPOA 1PF8A 2ITTA 3OD6X 2V62A 4W9XA 5IU2A 5E8YA 2Q83A 2PVNA 2Z7RA 1REJA 4EUTA 3DBCA 1PXLA 3ZYAA 2JGZA 5HKMA 3FMLA 3OTUA 4JBOA 3BHYA 5HG9A 3ZRLA 3TG1A 4DGLC 2PY3A 1NVSA 4YJUA 3PLAE 3KRJA 3POZA 4UN0C 3HRCA 2JDRA 3MPMA 4WG3A 4YMJA 3OBGA 3FZOA 2W96B 3VUDA 3U9CA 4I5HA 4PL3A 3PDTA 3IOKA 3G33A 3QXPA 3E8EA 3I6WA 5FDPA 3ORTA 5CNNA 3UZPA 2VWXA 2XNNA 4XP2A 4J52A 4CRSA 4IAFA 3E3BX 5KMLA 3OUNB 4QYFA 5EQPA 4LMUA 4ENXA 4CFXA 5KKRB 3AC4A 5CSPA 2Y9QA 4WHZA 5KZIA 1SVEA 3QTQA 4FVPA 3U54A 4FUYA 3LW0A 4ZS4A 5DFPA 1U59A 3G6GA 2EB2A 2PE0A 2WQMA 1QPJA 3E64A 3ZLWA 5FGKA 5HCZA 4M67A 2VV9A 3QLFA 5EKNA 3NUNA 2IVSA 1OMWA 2JLDA 3UZTA 4FEUA 3IECA 2X4ZA 4IJPA 3EKNA 1Q8TA 2OIDA 1ERKA 1VZOA 2X1NA 1YHVA 3CKWA 3GU5A 3ORXA 3PPZA 4JAIA 4JIAA 4O6EA 4PMMA 4S31A 5F1ZA 3LFSA 3MY1A 1JVPP 5BNJA 3ORZA 2XCKA 2J50A 3MY0A 4FIJA 4O0XA 1S9JA 4HPUE 4YJPA 3TV6A 4U5JA 2W9ZB 1A48A 2HZ4A 4JG8A 5E8WA 3LMIA 4IACA 2RFSA 4R3PA 5DH3A 4IEBA 3FYJX 5J87A 1YDRE 2HENA 3O8TA 3T9TA 4R7HA 4C8BA 5L4QA 2YISA 1RE8A 4PV0A 4UYNA 5DRDA 4W4YA 5EDRA 3TZ9A 2XZSA 4KRCA 5KZ0A 4EOKA 3ZUVA 3QZFA 3BHHA 2IZSA 4ZJJA 4BZOA 4BZDA 3SOAA 4HCTA 4BDHA 2X2LA 3DK3A 3I5ZA 5ETIA 2BAJA 4FIGA 4CNHA 2I0EA 2Z60A 3GB2A 3LE6A 3OMVA 4XG6A 5AP5A 4AT3A 3N4UA 4OTFA 3KXXA 4U8ZA 4OGRA 3EFJA 2Y4PA 2OLCA 2R3QA 3VVHA 3WZKA 4JX3A 3QTRA 1J7UA 2ERKA 4XMOA 4RIXB 3SG8A 5AADA 5JRSA 3C4WA 2IVTA 2VD5A 3G9NA 3R8ZA 3O23A 3MYGA 2J9MA 2G2HA 2JDVA 1IA9A 3MVJA 3MI9A 4FNWA 3EQPA 3PVUA 5C1QB 4D1XA 5A3XA 4GFOA 4IFCA 3BU5A 5IA2A 3D5VA 3QTIA 3Q4UA 3I0QA 2Q0NA 5B2KA 5BVEA 3R2BA 3SRVB 4EH8A 3FSFA 2QOCA 3H9FA 4QD6A 3I0OA 5FQDC 1L8TA 4GFMA 5ICPA 3R28A 4DTKA 2W5AA 2QOOA 4IMYA 3HYHA 4IAIA 5CVFA 3W33A 2QOIA 4NM0A 5HO8A 4FKGA 5JFXA 2VO3A 3KGAA 4V01A 4WBOA 3ORLA 1I09A 1S9IA 3V5JA 4ANLA 3WZDA 1H01A 2O8YA 4LGGA 5G1XA 3VWAA 5GJGA 3NUUA 3SDJA 3QTWA 2X4FA 1WMKA 2C69A 2R3RA 1JKLA 2AUHA 3B8RA 5ETAA 4G1WA 3QZIA 2ITXA 3BKBA 3QBNA 3QGYA 5E8TA 4NK9A 4JVGA 4A4LA 2WXVA 4DBNA 4FL3A 2J6MA 2YCSA 3R9RA 4XBUA 4XX9A 1BL7A 4PWNA 3IW7A 4R3CA 2IW8A 3FLQA 4J71A 1Z57A 3VBQA 3U51A 2WTWA 4ASEA 5AAEA 3V5WA 3KVXA 3NYVA 4X3FC 2VAGA 2VWVA 3BYVA 3KF7A 4RWKA 3UO6A 4FKLA 4XP0A 2VWIA 4BR3A 2QOQA 5L6PA 4TTHB 5C4KA 4DEIA 3BYMA 4GSBA 5HVJA 1WBOA 4FBXA 4MK0A 4DH5A 3ZDIA 3F7WA 1E9HA 5CAUA 1YOJA 4YC3A 1PXMA 4GU9A 4YLJA 3LCSA 2UZOA 5AJQA 1IRKA 4WD5A 3ZZEA 5CTPA 5HBJA 5JT2A 4FKIA 3H10A 3LMGA 3QRKA 5EI2A 3VS7A 4C4HA 3AGMA 2EXEA 5AWMA 3MH1A 2WPAA 4FTOA 3UMXA 1YI3A 1OPKA 1BYGA 4NIFB 2UV2A 5BUJA 3DOGA 3KMMA 5AIRA 2IPXA 4JJRA 5BYZA 5A54A 2VTIA 2C1BA 5EG3A 2C30A 1SNXA 5AA9A 2W1ZA 2OJGA 2NO3A 2QCSA 2XK9A 3KC3A 3R22A 2QC6A 1G3NA 3FQSA 2BILB 4XV1A 4O0TA 3R83A 4ZY6A 2PUUA 5HE1A 2XM8A 3V04A 3Q04A 2OK1A 4O7NA 4ZTRA 1XO2B 4CG8A 3PTGA 4BI0A 4RIYB 3R9OA 1PMUA 3DA6A 2ZAZA 3EN5A 4O2PA 4GH2A 3S95A 2W05A 3E8DA 4FG7A 2VTRA 4HYSA 1WFCA 4PP9A 4YJTA 2HWPA 4F7LA 4RX5A 3C0IA 4RSSA 3S0OA 3DQWA 4DC2A 3E62A 2PUNA 2GCDA 5J9LA 3QRJA 4AZVA 1Y8YA 4HOKA 2WOTA 4BBFA 4QMPA 3BEGA 1OUKA 3UIMA 4FTKA 4HYUA 4J99A 4FTUA 3ZO1A 4QMLA 4Z9LA 3FZTA 4CKRA 3AOXA 5EFQA 4ZTHA 2XEYA 1BLXA 2W06A 2F2CB 3K2LA 2ZDTA 3ZO4A 5LVOA 3TNIA 4FTJA 2PVHA 2HZ0A 4DFLA 3NEWA 3ERKA 4KINA 4BTKA 5CT7A 4D4SA 3EN4A 1KV2A 3KXGA 4YJSA 3R71A 3K3IA 3KRRA 4QNYA 4PMTA 4PQNA 4HVHA 5CX9A 4D4YA 2HXQA 3WYXA 4CYJA 3TNQB 1R78A 1P4FA 3QCQA 2ZOQA 5L8KA 2QU5A 1FVVA 1PMNA 3CE3A 3U9NA 1XQZA 2ZVAA 3PJ1A 2XH5A 3WBLA 4E4NA 4FEVA 4DGOA 4EOSA 3CPBA 1OBDA 4DEBA 4DFUA 2GFSA 4NKSA 5AV3A 2A4LA 4O86A 1ZOHA 2RG6A 5FTOA 5L3AA 4IC7A 3HX4A 1OIQA 5IA3A 3OOMA 2XYUA 3HA6A 3TI1A 3OCBA 4IWDA 3R9NA 3G0EA 4F64A 1YI6A 3DNEA 4YP8A 5LMBA 3VNTA 1WBPA 5HTIA 5FEDA 3UPXA 4D1SA 1V1KA 2C1AA 4OTWA 4TYEA 4R78A 3JXWA 4DEAA 3TN8A 2R3KA 4WNMA 3BHTA 3OT8A 3F5GA 2VWBA 4F6WA 4IZYA 5CY3A 2IVUA 3FY0A 2VX3A 2OXDA 1JBPE 4L42A 5A4EA 2A19B 3ANRA 3BE2A 2UW3A 2X81A 2KTYA 3PE1A 4BCQA 3E8CA 5JGBA 4RFYA 1CKPA 5FP5A 4OTHA 4F09A 2RG5A 5CAPA 4S32A 1H26A 2BIYA 3O0GA 5JZNA 5HNBA 3SW7A 1CKIA 1U54A 2VTOA 4ERWA 4NU1A 4DG0E 2JKMA 4BL1A 5BVNA 4WA9A 1M7NA 3ZM4A 3MB6A 4JI9A 5EM6A 3CY2A 3DK6A 3NRMA 2BVAA 5E8VA 2XEZA 3PZEA 1MRYA 2QLUA 4DHFA 5K5NA 4O7RA 3ZC5A 4QQTA 2OZOA 4TKSA 2J5FA 4L68A 3D7TA 3CGOA 2OIBA 4G34A 1BI8A 3GC7A 5AMNA 5FXQA 5LMKC 3V3VA 5JZJA 4FIEA 3IDPA 4DTAA 3Q3BA 3DKFA 3I7BA 1SMHA 5HCXA 4BBMA 2EB3A 4BKYA 4YNEA 5T68A 2BRHA 4D5KA 5HE0A 2R5TA 3CLYA 3DZOA 3BBWA 3LOKA 3OWJA 5HNGA 3TKHA 4ZZOA 2XKFA 4CZYB 4ZTLA 4B4LA 4EK6A 4LGDA 2C6KA 3F2NA 2BPMA 4GK2A 4OTPA 4UMQA 4A9RA 4Z3VA 1IAJA 2GNIA 4L7SA 2WMAA 2R3MA 4AA0A 3L8XA 4RC3A 4D2WA 4FTQA 5BVOA 2E9PA 3HA8A 4K77A 3EL8A 1B39A 5CSHA 4QMVA 1K3AA 2E2BA 2XS0A 3II5A 3FHRA 3O2MA 3IPHA 4U44A 2HOGA 4FSRA 4IZAA 5K5XA 4EHVA 3VJNA 3ZC6A 2F4JA 3FXWA 3DY7A 5L2IA 3I1AA 4IJ9A 2XJ0A 1R0PA 3HV3A 3KULB 3QTZA 4N6YA 3LFCA 4QYGA 5IA4A 1ZY4A 3UO5A 1LUFA 4U41A 4XLVA 3V6RA 1H24A 4RX9A 5DEYA 5GZ9A 3NUAA 4LOOA 3FKLA 3QQHA 4U3ZA 4ID7A 4ALVA 4Y83A 1BMKA 2CHLA 3ZUTA 5CEQA 3P9JA 3C0GA 3FC1X 3TEIA 2F57A 2R3JA 3EQRA 3GFEA 4JBVA 2XNEA 5CVGA 3ZSHA 3OF0A 4P5ZA 1Q8YA 1FVTA 3NUYA 3DXNA 4NUSA 2EXMA 5K0KA 1R3CA 4RJ5A 2BFXA 2J5EA 4GEOA 1ZYDA 3PIZA 3MH3A 2C6OA 2WQNA 3ORNA 5HLPA 3WILA 2FSMX 4ACCA 2ACXA 1ZMWA 3RM7A 4PMPA 4F7JA 4F9BA 2JIVA 1YXUA 4ORKA 4J97A 4X2FA 1IEPA 3QFVA 4O2ZA 4L3PA 3DFCB 5EI8A 4XP3A 1WBSA 2XKDA 4FSNA 1KWPA 3AT2A 3HAMA 3K5VA 2RIOA 3GI3A 3QL8A 4F9YA 2VUWA 2XA4A 3FDNA 3OWKA 1F3MC 3MA6A 4M68A 2B9JA 2YAKA 4IAYA 4UALA 5E8XA 1SVGA 5ANEA 5EW9A 3U4UA 3RBWA 3RWPA 3A8XA 3KQ7A 3I79A 5E1SA 4YC8A 3EQFA 5C01A 2C5YA 4ZSAA 2O65A 1M2RA 2GDOA 1FOTA 2VTQA 4CYIA 3EZRA 3ZFXA 2WTDA 5M4CA 4H1JA 3GT8A 5CVHA 3FY2A 4TYHB 5LOHA 3OP5A 2BDFA
chains in the Genus database with same CATH superfamily
5HVYA 4JDIA 3LXKA 4FV9A 4QNAA 3FV8A 4TT7A 1Q62A 4J8NA 2X9FA 5CSWA 4C3RA 4FSYA 5L2TA 3BHUA 1URWA 5DA3A 4DHIB 3LJ0A 3FMDA 3TXOA 4DLJA 3MB7A 1BX6A 5HG7A 1NW1A 3HLLA 4RWJA 2R7BA 5AIKA 4X6QC 2BRGA 4IADA 4G6NA 2QO2A 5JH6A 2ZDUA 4D9UA 4FV3A 4QO9A 3CQUA 3S4QA 2Y8OA 3VRYA 3DXQA 1JLUE 5D1JA 2JBPA 4AGDA 2QHNA 2HK5A 5DR2A 5C4LA 3ZM9A 4FF8A 3VQHA 4I93A 4F9AA 4W4WA 5DIAA 3CCNA 5F95A 5EYDA 1H1QA 2PVYA 3POOA 3DAJA 4L9IA 4E5WA 3MS9A 4A7CA 3CD3A 3Q9YA 2BZJA 3FMNA 2LAVA 2UZBA 3C51A 4QMSA 5AX9A 3D9VA 3LQ3A 3HL7A 4E8AA 3O51A 1HCLA 4ANOA 4E73A 3F3ZA 4WNKA 4BJJB 1VYZA 2ZM3A 4ITHA 4EZ5A 3PXQA 1IAHA 3G90X 4Y85A 2VO0A 2WMBA 1TKIA 2YJSA 3BV3A 3QQUA 2QR8A 3F3UA 5AUXA 3R7EA 2FSTX 3RPYA 1KE6A 3LCDA 4R7IA 4FKPA 1FQ1B 4P5QA 3QD2B 4PMSA 4QOXA 4TZRA 4EH3A 4KBCA 5M57A 1ZOEA 3KY2A 5TO8A 2OZAA 3EH9A 4RJ7A 4LMNA 5DT3A 2OI4X 4D2RA 3VBXA 3N4VA 2PYWA 4XOYA 3O7LD 4MF0A 3C4CA 4QYYA 3WIKA 4V0GB 5FRIA 5HG5A 4FSZA 2XP2A 3DNDA 2OXYA 5HORA 2YLEA 3CTHA 3R1SA 5GJFA 3JR1A 3CEKA 3F9NA 3OHTA 3WF5A 4NFMA 1GZKA 3UZRA 3AC8A 4EK8A 2XAOA 4AXCA 5HCYA 3QQLA 1TFFA 2V7OA 4H3QA 3AKKA 4CKJA 3FBVA 3PP1A 4JMQA 2BROA 4C58A 2XIKA 3W16A 3A99A 4NTTA 2ITUA 5A46A 2P33A 3M1SA 3TIZA 2V0DA 3PE2A 2X2KA 4FTIA 2UVYA 4CMTA 1OUYA 5J5TA 2A27A 3WZEA 2C6LA 5ANIA 4O1OA 5C8MA 3TZMA 2QODA 4JOAA 4YJVA 5H8BA 5JN2A 4GYGA 1UWHA 3FZ1A 5EK7A 3SD0A 4EK3A 3DBEA 4ZTMA 4PDYA 1WCCA 1TQPA 3WI6A 4G3EA 3MFUA 1ND4A 3QD3A 2VWUA 1G8JA 2CJMA 4FJVA 2O0UA 2W5HA 1J3HA 5BUIA 2XARA 3A7IA 4YR8A 2A2AA 3TCPA 2B7AA 2E9UA 4OBPA 3TWJA 3AD6A 3ENHA 1H4LA 4L3LA 5IUIA 5AUYA 3IGGA 3IO7A 4MBLA 3VN9A 3UQFA 2Q0BA 5CF4A 3QHWA 1IR3A 3EYGA 1ZWSA 5A4TA 5A6NA 2CKOA 4DCAA 5CEKA 2OFVA 4HVSA 2YIXA 4MXZA 5DT0A 5AUVA 3Q5IA 1OVEA 1W82A 4QMYA 3R9DA 4BDGA 4FTRA 2H9VA 2R7IA 5EDQA 3ZLYA 4GCJA 2HELA 3LLAA 2ZV7A 4GUBA 3LM5A 2UW5A 3R6XA 1BI7A 2WTVA 4IQ6A 4UB7A 5I3RA 3SXRA 3KN5A 4U6RA 4Q2AA 5AV4A 2Y0AA 2ZMCA 3VUIA 4AACA 4MD9E 1U4DA 3Q32A 5L2SA 1GZOA 4FODA 3WOWA 5M51A 3D5XA 2CN8A 4GIHA 2YA9A 1H1SA 1OECA 2WKMA 3Q9WA 2X0GA 3C50A 3O8UA 5ANKA 4B9DA 4GT3A 4QEBA 1TQIA 5AA8A 3OXIA 3A2CA 3PXYA 4MVFA 4A06A 2WQBA 3W2OA 2GS2A 4FTTA 3LFDA 3R8PA 3BGQA 4KWPA 3PJ2A 3HUBA 3LJ1A 5EYCA 4JT3A 4E5AX 2NPQA 4C4EA 3TMOA 4QYEA 5EH0A 5CYIA 5KMKA 1YVJA 4DT9A 1PXPA 4ZMFA 5DRBA 4FV7A 4ZLYA 2VGPA 4RJ4A 4C33A 2YITA 5FM3A 2QHMA 3PUPA 5H9BA 3NFFB 1YI4A 4TN6A 5EHOA 4DGGA 2REIA 4PPAA 4FT5A 1OI9A 2YAAA 4K18A 3N9XA 1FPUA 2DS1A 3SKCA 3PXZA 2IWIA 2ETKA 3QQGA 1XR1A 2VRXA 3IDBA 4E4MA 2YIYA 4KAOA 1PW2A 4F0GA 4KKEA 4QQCA 5HESA 3Q4ZA 3CTJA 4O0RA 4JDHA 3FHIA 4XJ0A 4ACGA 4DGMA 4EC8A 3UNZA 4EH9A 4BICA 4C4IA 3R7IA 5AP3A 3BYOA 4MXYA 4E6CA 2W4JA 2W99B 3DQXA 1NVQA 2CCHA 4M13A 5BMMA 5AAFA 4AXAA 1H1WA 1WBNA 1DAWA 3RJCA 3EMGA 3OWLA 3QUEA 3E7VA 2PPQA 2JIIA 3MESA 5JFVA 3KK8A 3ML1A 5GIOE 3MY5A 4C57A 3MVMA 4O0WA 5EOLA 3F82A 2WO6A 1WVXA 1OPLA 3H9RA 3BYSA 4QP7A 4AZEA 1PYXA 3MIYA 4RWLA 1XH4A 4NW5A 2EVAA 4U7ZA 1V0OA 4BCKA 2Y6MA 4GU6A 4E4XA 1W8CA 3TDWA 2BAQA 2CN5A 5CT0A 3HP2A 4HW7A 5HZNA 1GY3A 3H30A 2ZV9A 4RA5A 3UP7A 3JY9A 5KBQA 2QLQA 2UW0A 3GC8A 2R3GA 3F6XA 4RFZA 4YLLA 5BUEA 4AN3A 4ZEGA 3IONA 5FDXA 4E7WA 5KMIA 2YWVA 2QU6A 3R8UA 2UZWE 4Q5EA 3AC3A 4D9TA 4EYJA 1UU9A 5HHWA 3BRBA 3BHVA 3HECA 4L8MA 3VULA 5LXMA 4O21A 3SHEA 4Z7GA 3BE9A 4D5HA 3ZXTA 2JC6A 3UMWA 3VONA 1CSNA 2BDWA 4J8MA 4D1ZA 5A4LA 2I0HA 4I6LA 4OLIA 3PSCA 4O83A 4KSQA 2V22A 2BZIB 4CQGA 5CU6A 4F1MA 3ZHPC 3PRFA 4AOTA 4I6HA 2GHGA 4DITA 3QA0A 3ZMMA 4IM0A 4QMOA 2YZAA 4X3FA 4O82A 3GC9A 4ERKA 4BYIA 4KIKB 5L2QA 5HLWA 4FKQA 2I7QA 1YOMA 3P7BA 4UEUA 4A9SA 1DI8A 3NUSA 3OCSA 4J95A 4WBBB 4Y73A 2GHLA 3W55A 1W83A 4FT7A 1JAMA 2FH9A 2QO9A 4L6QA 3NAXA 4PP7A 4QP4A 5EYMA 2XNMA 1YXXA 3DJ7A 5C03A 4QP3A 3P5JC 3D2IA 5A4CA 2G15A 4IAKA 3GCSA 3PVWA 3DLSA 4IAAA 4KKHA 1XH8A 3QC9A 5TF9A 5KNJA 1CMKE 3TIYA 1H0VA 2B53A 4FA2A 1OIRA 3DDPA 4F63A 3VJOA 4YBKA 4MQ2A 2Z7QA 2R4BA 4LGHA 5JGAA 5FBOA 4JRNA 4RIOA 1PXKA 5AFVA 3QRTA 3VBTA 3QYZA 3A7JA 3F3VA 1FINA 2OSCA 3TZ7A 2ITNA 5DR6A 4AU8A 1PRYA 2UW8A 4NZWB 4EOMA 5JQ8A 3OTVA 3KCKA 3WIGA 4USFA 2GNLA 2C4GA 3TNHA 4HGSA 4GKHA 3CJFA 4BTMA 5FXRA 3UNKA 4RQVA 2QG5A 5BX0A 5BYYA 5HD7A 2NRYA 3NMUF 2CPKE 3QCXA 4JNWA 5F4NA 2WMTA 3GCVA 4MQ1A 1WVYA 4XNEA 3TTIA 4QMNA 2J4ZA 4BTJA 4R3RA 3W2RA 3KRWA 1FGIA 3KEXA 4X2JA 4BGHA 1W2CA 1GNGA 4RZWA 5GINE 4NJ3A 4FX3A 3EYHA 1UKHA 4QPMA 4C35A 3O17A 1KE8A 3VF8A 1YWNA 4NCTC 2UZLA 3RAHA 3PSDA 2JITA 3QRUA 3PA4A 4O7TA 1P4OA 3FI8A 4KKGA 4QMUA 2JDTA 3TZ8A 4O7YA 5CZHA 4ALWA 2W1CA 1KV1A 2HAKA 4PL5A 2PVJA 3C4XA 3DK7A 4F9WA 4G3CA 2O64A 4O91A 4L45A 4XYFA 4ZZMA 4EHZA 3JUHA 5FG8A 1QCFA 5BYLA 1BUHA 2GMXA 2PMNX 4MWIA 1Q8ZA 2A0CX 2V7AA 3NUPA 1OITA 1MQBA 3ORMA 1J7IA 3QTUA 4FKWA 5IQFA 2XVDA 5IQEA 3QUDA 4UXLA 3VUTA 3COHA 1RJBA 3P0MA 5BVKA 3RNIA 4APPA 2GS7A 3SVVA 4CXAA 4I0TA 3QKKA 2X6DA 1JPAA 3RAKA 3D5WA 2EUFB 1YXVA 1TVOA 5LVPA 2YFXA 4GUEA 4IHPA 4LV8A 1Q8WA 4F0IA 2OBJA 2EU9A 4ACDA 3OW3A 4NTSA 5H8EA 2YCRA 1P2AA 5C9CA 3E87A 2AC5A 2YDJA 4BDAA 3DB8A 3PWYA 2R3PA 2B0QA 4FTMA 3OFMA 4PPBA 4C7TA 2F49A 4BIBA 5LWNA 3K5UA 5M44A 4C0TA 4D4RA 4G5JA 2CMWA 2ITPA 3BEAA 4JS8A 5I4NA 1Q4LA 3FI3A 4YBJA 3OOGA 2B1PA 3OVVA 4UZDA 4YSJA 1KE5A 4FGRA 3LXLA 4YO4A 5FUTA 2P2IA 4FSWA 3FMHA 3R7OA 3THBA 3UDZA 4C59A 1H08A 3O8PA 3GEQA 3V5LA 4GKIA 3QTXA 1WBWA 3CR0A 3QD4A 4O7VA 5CAVA 4FMQA 3BLQA 3MSSA 5E90A 4AGWA 3AG9A 3G51A 5CQWA 3BU3A 5D9HA 5I9ZA 1XBAA 4FKRA 1R39A 3P7AA 4KNBA 5AV1A 3EB0A 4RLLA 5HX6A 1P14A 5LQFA 5IF1A 2OH4A 2BR1A 2F7XE 2WEVA 4GRBA 4V0GA 2P2HA 1Z5MA 4E6AA 2C5VA 3VHEA 5HOAA 5C8NA 4LL0A 1HOWA 2UW7A 4I41A 3BV2A 1A06A 3MA3A 5IH5A 4B7TA 2PMLX 3A60A 3BU6A 4JLCA 4PL4A 4ZTNA 3WARA 3ZO3A 3KL8A 3VIDA 3TJCA 5HEZA 2OJIA 2PE2A 5AR3A 5LMKA 4GG7A 2IEWA 3LCKA 2QVSE 4I5CA 4RQKA 5AV2A 1WBVA 2UW9A 4PY1A 4KA3A 3FXZA 3DZQA 4CFWA 2GQRA 3BWFA 4F78A 3AMAA 4XG2A 3AC1A 4G6LA 1TZDA 1Q97A 4BDFA 4Z55A 3W8QA 3HV5A 4QMWA 2R3OA 5EM5A 3R04A 5FWKK 3PIYA 3DAEA 3PA5A 3FE3A 3VUGA 4AOIA 4FIHA 4O4FA 5H2UA 5L2WA 4WRSA 2VWWA 4OTIA 3W18A 4F6UA 3C13A 1ZAOA 2J0KA 3W0SA 2JAVA 4DH1A 5LVMA 3OCTA 1AD5A 3FQHA 5A14A 5AR4A 1QL6A 4LUDA 3QGWA 3R7VA 4YJRA 4MNFA 2WTJA 3ZLXA 5IH6A 3UTOA 3MTLA 3GFWA 2UVZA 4IANA 4XHKB 4WT6A 3IK3A 4E6DA 2HZIA 4K0YA 4QPAA 3W32A 3TACA 2VO7A 5KHWA 5K3YA 4EEVA 1SM2A 2OU7A 5D12A 4BI1A 2GNHA 1W98A 4MBJA 5IEVA 4ZLZA 1OL2A 4FKTA 2WQOA 3VRZA 4O0SA 3PIXA 5L8LA 1W84A 4WUNA 2ONLC 4W4XA 4WG5A 2O2UA 2VNYA 4BN1A 3C5IA 3OZ6A 4BCMA 5KBRA 1Q8UA 5AM7A 5IH4A 1CTPE 2YEXA 3NZ0A 4IX6A 3W2PA 2X6EA 4RVMA 4YGAA 5HG8A 2ZV8A 4I22A 4S34A 4X0MA 1OIYA 3DGKA 4QTDA 2VTSA 4O0YA 4DFYA 1OPJA 4CV8A 4A4OA 1DM2A 3WE8A 2O63A 2E9OA 3DBFA 1NA7A 4IB0A 3F61A 3P86A 2JEDA 3NYOA 3QHRA 5ETFA 4BF2A 4X7QA 4QTBA 4F08A 2H6DA 2R3HA 3D83A 2A1AB 4WIHA 4XRJA 4H39A 4XS2A 4LV5A 5AR8A 4D4VA 4FTNA 3RALA 4OAUC 5M4UA 3V8SA 5DN3A 3ANQA 3CPCA 2JKQA 3P79A 1YOLA 3EHAA 4ANMA 5AV0A 4AW0A 4BIDA 4FYNA 3CSVA 4ASDA 4FE2A 2WB8A 4YHJA 5K9IA 5EM8A 4C61A 2IZUA 5DLSA 3VHKA 3SW4A 4FKJA 3I6UA 5I9YA 4ZSLA 4YTHA 3LLTA 2YABA 2CGXA 4V04A 2PZIA 1UU8A 3JY0A 3GBZA 5JFSA 1U5QA 3T9IA 4F1OA 3BLAA 2PVFA 2BRMA 4EONA 1BKXA 1G8SA 1B38A 2XJ1A 2J7TA 3ZXZA 3KN6A 2FB8A 2XNPA 4JR3A 3I4BA 5ANJA 4I20A 4NH1A 3ZBXA 2W1EA 3AKLA 4DFZE 4I5MA 1G8AA 1PYEA 2ESMA 2VX1A 4S2ZA 3E3PA 3O71A 4TWNA 4O7ZA 2C0TA 4XBRA 3R2YA 5IISA 4ZXTA 4WOVA 2CGUA 4M3QA 2Z2WA 5I3OA 3EQIA 5JGDA 2JKOA 4KBAA 3HUCA 4U9AA 3R7GA 5HO7A 2HWOA 2WAJA 4FL1A 4PDPA 4HPTE 3EQCA 3LKMA 4QP2A 5IQHA 3O7LB 5FM2A 3QC4A 2QNJA 4RRVA 4Y72A 5EI6A 3PYYA 4M14A 4XUFA 2FUMA 4EK4A 4N0SA 4BHNA 3LFBA 3UIXA 2HW6A 3MH0A 5LCJA 3FC2A 4OR5A 3QQJA 5J7HA 3C4EA 3CY3A 2FSOX 4FK3A 3HGKA 2YACA 2VNWA 1OKWA 2GPHA 3L8VA 4PF4A 4TXCA 5CU3A 1XMMA 3OS3A 4DH8A 1OL6A 2FO0A 3KKVA 4M69B 3ELJA 5DE2A 3ODZX 4XV3A 3ZEPA 5DPVA 2XK4A 4B8MA 3ZFYA 3UO4A 5L6OA 5EQYA 3RPSA 3UOJA 5BVWA 5TE0A 4N4SA 4C4FA 1ST0A 5BV3A 2XCHA 4L53A 4O96A 1P5EA 4BTFA 1JKSA 2GNGA 3EOCA 1UWJA 4JIKA 2W0JA 1WAKA 3SQQA 3TV7A 2YM5A 5CAQA 4N57A 4ACMA 3HV6A 3UNJA 2BZHB 2XBAA 3BPRA 2YERA 3Q6WA 3RPRA 2PZ5A 4RIWB 5J1WA 3MFSA 2W1DA 3IW4A 3EFWA 4FKUA 5CF8A 4AW1A 5J7BA 3OXZA 4AW2A 2AC3A 2XYNA 3LFQA 4JDJA 3W8LA 4RVLA 3P7CA 3W2CA 4P4CA 1H27A 3Q2MA 3QWJA 5FEQA 3LQ5A 3NFGB 1NT2A 1UNGA 4BGGA 2G2FA 4DT8A 3M11A 4KRDA 4CTCA 4WNOA 3PP0A 3R21A 4DN5A 3BIZA 5IEXA 5EOBA 3F7ZA 1CDKA 4YZNA 5IEYA 3UQCA 3KREA 4EOJA 2VTLA 4RPVA 4EQUA 3RAWA 3R30A 4WUAA 2PVKA 2GQSA 1Y6BA 2XK7A 3Q9ZA 4JXFA 2UZDA 3JS2A 4D2VA 2C6TA 5AP7A 4KD1A 3IG7A 5EDPA 3LXNA 3FI4A 4R5SA 5IG1A 4DA5A 1YQJA 3BQRA 4HZSA 5GHVA 4BCHA 2X2MA 3UBDA 3Q5ZA 4EH5A 3GGFA 4L01A 4LL5A 2XM9A 4USEA 1LPUA 2WMVA 1XHAA 5KMNA 2QG7A 3RCDA 3EQBA 3LFAA 4AAAA 5E1EA 2PE1A 4MWHA 3TYKA 5CEOA 5HU9A 3T8OA 4NWMA 1PXIA 3QWKA 4FGBA 2BRBA 3MPTA 3R00A 4TYJA 2ZMDA 4E5BA 3EKKA 4RT7A 5A4QA 2ITZA 3RINA 4LV7A 3IGOA 4IX5A 4FVQA 3FJQE 3OY3A 3LJ2A 4U43A 4DCEA 3VUHA 3PUFC 3UQGA 3P5KA 3PXFA 4FNZA 5AP4A 2XB7A 4G2FA 4IFGA 4E6QA 1MUOA 1R1WA 4QMXA 4X2KA 4PNKA 5CAOA 2RF9A 4CQEA 4IXPA 4U97A 4MH7A 2CKQA 4AWIA 2IVVA 3DFAA 4F4PA 3TUCA 3LIJA 4O7LA 2J90A 5B2LA 3EQGA 4EOLA 2PHKA 5FXSA 4EBWA 5KUPA 4GG5A 4HYHA 1XMLA 4FSTA 4RIXA 4IWOA 2YN8A 4DEHA 1REKA 4DHZA 4CG9A 4FOBA 1OKZA 4EH7A 1YXTA 2GHMA 3FLYA 4HNFA 4BCOA 2XF0A 4AF3A 3VS0A 1UKIA 5M53A 4XH6A 2XNOA 4N6ZA 4YHFA 3A4OX 5LVNA 3TT0A 1T46A 4O4EA 4TWPA 3NIZA 4BY9E 3QKMA 5HI2A 3DV3A 3L9MA 1GJOA 5CEIA 3RKBA 3SRVA 3SXFA 4O81A 2NP8A 4GVAA 3OY1A 4TY1A 3COMA 5EW8A 4AZWA 4UXQA 5A9UA 5IA0A 4PDSA 2PVLA 3TUBA 1MQ4A 3R0TA 4W8EA 1H28A 5D41A 5IQDA 4QT1A 4BB4A 2R3LA 1H8FA 1UV5A 3NW5A 3PA3A 4KS8A 3VQUA 1GIIA 4L44A 3WF7A 4BC6A 2BKKA 1BL6A 3NVMB 4K11A 4XG3A 1A9UA 4OBOA 4FI1A 2R3IA 3NNXA 3SA0A 2UZTA 3LCTA 1LR4A 1B6CB 2OKRA 1XBBA 3QD0A 4YNOA 5L6WL 2BRNA 2CKPA 2B54A 4HVIA 2WTKB 3PPKA 3UE4A 2PULA 2F9GA 2IW6A 1IA8A 3E88A 3NX8A 3NGAA 5JFWA 2X0QA 2Z7SA 1YKRA 4LFIA 4QQ5A 4CFFA 3JVSA 4C2VA 3ROCA 4CCBA 2QKWB 3PFQA 4CGAA 2DUVA 3JYAA 5FBNC 4MYGA 3PVBA 5IUGA 2J2IB 4U3YA 3TNWA 4B8LA 3HMMA 3KCFA 4IWPA 3UG2A 2YHVA 4C2WA 5B0XA 4GVJA 4M66A 3UP2A 5AX3A 5M06A 3MH2A 4MD8E 3BGZA 2W1IA 4UYAA 2W7XA 4FV8A 5LCKA 3S2PA 4PTCA 3TV4A 4B6LA 5EHYA 4A9TA 3NAYA 4O27B 4CKIA 4YZBA 2IG7A 4EH4A 3BQCA 3HMNA 3PY1A 4X3JA 4FZAB 4XOZA 4F7SA 4TNDA 3LMHA 4MUQA 3F66A 5DT4A 4I94A 3LQ8A 3D15A 5CQUA 4Q9ZA 1XKKA 1JSVA 1XBCA 3DKGA 2Y4IB 5DNRA 3ZRMA 2PZPA 2ITOA 2YM4A 3U55A 4HGTA 4NIFA 2X7GA 3L1SA 4FC0A 4OUCA 3F3TA 4MXAA 2YIWA 3GOPA 4HNIA 3EIDA 4I23A 4O6LA 4FKVA 1EH4A 5KCVA 5BQ0A 4NM3A 3R8VA 4I0RA 1CKJA 4QMMA 1JOWB 1Z9XA 3OW4A 4ACHA 1GIHA 3BGPA 5AUUA 3PJ3A 1Q99A 2BFYA 2PU8A 4JBPA 4F70A 4ZOGA 1LEZA 3RHXA 3MJ2A 3D0EA 3OXTA 3QYWA 4QTCA 1OL1A 3CGFA 5HE3A 4IAZA 3C1XA 4ZP5A 3VS1A 3AC2A 4FG8A 1IASA 4YJQA 4H58A 1YHWA 4FKSA 4RIYA 5IMEA 4I6FA 1JNKA 3AD4A 3BELA 3FMJA 4BDCA 5HX8A 1PKGA 5I0BA 1O6KA 4QMTA 4BDKA 2YWPA 2F7EE 2VTHA 4C4GA 3R01A 3AKJA 1ZOGA 4E4LA 4FIIA 3V51A 4ZAUA 3AQVA 3U6HA 4B0GA 2X8IA 4ENYA 4DHJA 4IDVA 4UZHA 2HIWA 5CXHA 3SG9A 4BRXA 4BWXA 2ZYBA 4I92A 1JWHA 2ITQA 2EWAA 1ZYJA 3IW5A 2XRWA 4OTDA 1ZYLA 3V5TA 5I5ZA 1PMVA 2WQEA 3IKAA 4NM5A 4U80A 4BKZA 4FYOA 4LYNA 4WKQA 3MVHA 4C38A 4EC9A 1XH9A 3HDNA 3GU7A 3AC5A 2OF2A 4GS6A 3ALOA 5TKDA 3R73A 5JKGA 4QP6A 3QTSA 4XV2A 3RM6A 5DMZA 3KXMA 3AD5A 3COIA 2I0YA 4IW0A 4Q5HA 2C5NA 4K33A 5FP6A 4BKJA 3VF9A 2V5QA 4OBQA 5ANDA 1U46A 2SRCA 2QOFA 4UWCA 3MGYA 5E92A 3ZBFA 5LJJA 4O0VA 2QR7A 3R02A 5EHLA 3RP9A 1M14A 2BALA 4ONAA 3A7GA 2PL0A 1L3RE 1W2FA 3U87A 1XH5A 1KUTA 3D5UA 3W2SA 2VTTA 3I60A 4XG4A 3KXNA 3TM0A 4RC4A 4BWKA 4A9UA 2BDJA 2UW4A 2X9EA 3FMMA 1O6LA 3GXLA 3VW6A 1ZLTA 4GJ2A 4FG9A 3ZONA 4JQ8A 5LARA 3NWWA 2YCQA 3LHJA 3ZZWA 5M56A 3U6IA 1M2PA 1FVRA 4M0ZA 3FLWA 4OTRA 4AW5A 2C6MA 3V8WA 3G0FA 4BCNA 1MRUA 1E1VA 3FZRA 4AUAA 3Q96A 4Q9SA 4EH2A 2FYSA 4AG8A 4FZFB 1OM1A 3MVLA 1KE7A 4FL2A 4I21A 3FKOA 5L8JA 3VBYA 3BX5A 5CF5A 1PJKA 3H9OA 3RZBA 5KHXA 4GFGA 3WF8A 2VWYA 3WF9A 4HYIA 4FTLA 3E93A 3ACJA 1J91A 3BZ3A 4IBMA 4C62A 2W5BA 3ATSA 4YTIA 1O9UA 3UPZA 3GC0A 3L9PA 4IZ7A 2HCKA 4CT1A 3HKOA 3Q52A 1UNHA 2QQ7A 3FMKA 4AE9A 4EKKA 4G6OA 4EOIA 1JSUA 2C3LA 2YZLA 3SLSA 4O7SA 3P78A 3D7TB 4LI5A 5CWZA 2Z7LA 4DFXE 3QA8A 4OTQA 1T45A 5TT7A 4I5PA 4TNBA 2XK8A 5E8ZA 4FNXA 4UMTA 2B52A 4XG9A 2JIUA 4AGCA 3AGLA 2W9FB 4NCTA 4AT4A 3KRXA 4FEQA 3WZJA 3FWQA 1PXJA 2JKKA 4RMZA 5CEPA 2XNBA 4CVAA 1XWSA 4RFMA 2G9XA 5CU0A 4TL0A 5LMAA 3R7UA 3M2WA 3KXHA 4IX4A 4G17A 1AGWA 4ANNA 1M52A 4D58A 4EOQA 2X0PA 4Y5QA 2VTPA 4MHAA 3RWQA 3AXWA 2YIQA 4FEXA 2GNFA 5IQAA 3GP0A 5FEEA 4PTGA 1AQ1A 3HRBA 5GJDA 3EN7A 4X6RA 4O7WA 5KE0A 5J1VA 2OXXA 2PMIA 2NNWB 4MAOA 4M12A 4Z16A 3FLZA 3RI1A 4ZY5A 4I1ZA 3DXPA 5ANOA 4G9RA 1V0PA 4BFMA 3KFAA 3LM0A 4M69A 1RQQA 1OL7A 2ETMA 4CV9A 4E20A 4IB1A 4CFUA 3UODA 4H36A 3H0YA 4FV6A 4I3ZA 4QYHA 3V5PA 4FTCA 4CFVA 3DBDA 4FZDB 4DGNA 3UVRA 3D94A 1Q5KA 2Y6OA 2W1GA 3KULA 3C4ZA 4TW9A 5HICA 3G15A 3FAAA 3MWUA 4ITIA 5J95A 1YRPA 4GL9A 3TTJA 3UOKA 2DQ7X 2OFUA 2BTSA 3OG7A 4RIWA 2ZB1A 1W2DA 4AX8A 4CMUA 4EHEA 3IS5A 4JL9A 4YO6A 3JPVA 1LEWA 4BCPA 4CD0A 3L8PA 5IQCA 3HP5A 4G3DA 3A62A 3PXRA 4LOPA 4FSMA 4R5YA 3RVGA 2PWLA 3NNVA 4D2PA 2HYYA 2QOKA 4S30A 3VS2A 1K2PA 4AE6A 1Y57A 2BHEA 3FI2A 5JK3A 1E1XA 4AOJA 4NM7A 3ACKA 4JR7A 5DHJA 2CGWA 4LUEA 1H1RA 4XEYA 1KOAA 2OW3A 3T3UA 3F2RA 2UZEA 1ZMVA 4AN9A 3GENA 2YDKA 4M0YA 5H8GA 3DAKA 4MKCA 4F99A 2OICA 2OJFE 3ZSGA 4CZTA 2XRUA 1Y8GA 2AYPA 1VR2A 4J96A 2W1HA 3E63A 5IKWA 1OKYA 2EXCX 2WOUA 3ZEWA 3QLGA 4EOPA 5CNOA 4BCGA 1ZZ2A 3FSKA 3DLZA 3R9HA 1JSTA 3KVWA 2IF8A 2QI8A 3E7OA 3ZFMA 3D14A 2WZJA 2CKEA 2GTNA 1F0QA 2WMXA 3R1YA 4M97A 4RG0A 3EN9A 3L9NA 3DKOA 5HQ0A 2Y7JA 3MIAA 4KSPA 4AA5A 5D7AA 5K4IA 3OROA 2ZM4A 4EQMA 2VWZA 3ZO2A 2B55A 3ULIA 3NVKI 1XH6A 1DAYA 4IE9A 1M17A 3Q4CA 4JG6A 4BBEA 1PHKA 3DS6A 3NNUA 2BTRA 3TKIA 5JRQA 4KB8A 3Q53A 3DBQA 4IM3A 4S33A 4DF3A 5M08A 4G5PA 5IDPA 3NSZA