2QVSE

Crystal structure of type iia holoenzyme of camp-dependent protein kinase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
338
structure length
323
Chain Sequence
ESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title PKA type IIalpha holoenzyme reveals a combinatorial strategy for isoform diversity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase regulator
total genus 87
structure length 323
sequence length 338
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qvsE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qvsE02
4XG8A 2HW6A 3D2KA 1P2AA 3I79A 3DJ7A 4TZRA 3NAYA 1Q3DA 3IO7A 4EYJA 4GFMA 4B4LA 5AIRA 5LVMA 5CEKA 4AF3A 4UXQA 5L4QA 2VWUA 5K5NA 2ZV9A 2BFXA 4E5AX 4E6QA 4NCTA 2RF9A 5D11A 1IRKA 4MXYA 4QNYA 3PA5A 3ZOSA 4DFLA 3DNEA 3PDTA 4CG8A 4X3JA 5EDQA 2E2BA 2UZUE 4U40A 4XH6A 3P23A 4C4EA 4C4FA 3EFLA 5JN2A 1YI6A 3CD3A 5J9LA 4FKVA 5DN3A 3E92A 3QKKA 3UP7A 4F99A 2UZWE 2VU3A 5I4NA 1A9UA 4NM7A 2XB7A 5D7AA 3LOKA 4I5HA 3S0OA 4C61A 5BPYA 4X2JA 5FEDA 1JOWB 4AACA 2EUFB 3OBJA 4WNMA 4GFOA 4G2FA 1OI9A 4GT3A 3QFVA 4RIYB 1K9AA 4ZZOA 4BI1A 1LUFA 5KCVA 2WQMA 2WELA 4JDHA 3ORKA 3REPA 4CMTA 3LMHA 3D14A 2E9NA 1SM2A 3GP0A 5JKGA 2Y6MA 5DFPA 4ZMEA 4QYEA 3SXRA 4CZYB 2J0KA 1ZOGA 4RPVA 2BTRA 4EQMA 3NPCA 4TNBA 4EOOA 2WU7A 4ACGA 3DZOA 4P2KA 2OIQA 4YJQA 4XV9A 4EOMA 4G3GA 2I0HA 2Z8CA 1Y57A 3D5UA 5BQ0A 4BTKA 3COIA 5JSMA 1Q8WA 4QMYA 3FMJA 2G2FA 4PWNA 3CLYA 4QP1A 2WAJA 5KKRB 5M44A 1JQHA 3ROCA 3EQGA 3ZEPA 3RI1A 5LCKA 4DT8A 4WHZA 4O91A 1CKJA 2VZ6A 4USEA 3ZSHA 1Y6AA 1Q97A 3DTWA 3QALE 4HZRA 4AS0A 2FSTX 2ITZA 3QQJA 5CX9A 2OXYA 1ZZ2A 4ZMFA 4H1MA 4BN1A 2YLFA 3IQ7A 1ATPE 5K5XA 3QU0A 3EMGA 2FYSA 1NVQA 2X39A 2H6DA 4DFUA 3TV7A 2QLQA 5AUVA 3OWPA 2ZMDA 1S9IA 2GNIA 2BFYA 4PDOA 4KA3A 3R8MA 3C4XA 2UW7A 4E4MA 2R3IA 2GHGA 4RZWA 4PUZA 5K3YA 1SVGA 4ARKA 3IW6A 3KVWA 3O8TA 1NXKA 1GZNA 2EWAA 4FZAB 3W2QA 4YLLA 3G9NA 3EN6A 3S00A 2YLEA 3NUPA 4QMUA 5IUHA 3PJCA 4I20A 4J99A 3KRJA 4L7SA 4ZIMA 5CEQA 1UU3A 4PPAA 5BVFA 4K1BA 3ZHPC 3ZDUA 4GVJA 3NYNA 3VS7A 4HZSA 4E6AA 2P3GX 3UP2A 2WTKB 3RPRA 2XKFA 3CCNA 3KEXA 4GUBA 2XYNA 5CS6A 1R0EA 3NW6A 1OBDA 4GKHA 4S33A 3BYSA 2GTNA 2F9GA 3DJ5A 2HCKA 1R78A 4KRDA 5KMJA 5K4IA 5CQUA 4ZK5A 4BHZA 4M97A 3G6GA 5IDNA 5CSVA 3AQVA 5HBHA 3BV2A 2B54A 3BYMA 2BAKA 4IM2A 5AX3A 3LCDA 1JNKA 2P55A 4Y5HA 3ULZA 3ZUVA 5IEXA 1KE8A 1PXMA 2BIKB 2W99B 4O0WA 4K8AA 4X3FB 3UNJA 4KIKA 4FTMA 4YTCA 4GK4A 5HHWA 5K0XA 2PMNX 2CNVA 1ZRZA 4M69A 1QPJA 4BCQA 2NNWB 3MTFA 5EM7A 2BCJA 3GFWA 1FQ1B 3F6XA 2B9HA 2XZSA 3VJOA 3EQCA 4FTCA 4LOPA 2QOIA 4IZYA 3W1FA 2PZRA 2V22A 1PXOA 2PK9A 2OJ9A 2ZJWA 2I7QA 3PE2A 3KMMA 3PP1A 4NYEA 4R3PA 4BRXA 4QMTA 2QC6A 3DNDA 5AP6A 2W1CA 2XK7A 4BDHA 5GIPE 2GS7A 1REKA 3LZBA 3TWJA 2VNYA 1H0WA 2R0UA 3BYOA 3WARA 4RA5A 2OLCA 2OJFE 1YI4A 3S3IA 4OTQA 1Q3WA 4DN5A 3MIYA 4GMYA 1RW8A 2YZLA 4KABA 1YXTA 3EN4A 4R5SA 2VGOA 3D4QA 4OBQA 2WTCA 5LWMA 3UIUA 3ALNA 3CGOA 3K3JA 2W4KA 3W16A 4CCBA 3UYSA 4AZVA 4KKEA 3ZC5A 2YJRA 3G0FA 1YQJA 4IZ7A 1UVRA 4CTCA 1SNXA 3RKBA 3HMNA 4XMOA 4KKHA 2VTRA 3B2TA 2I40A 3LJ2A 5AAEA 3KKVA 4FV0A 4HGEA 3WBLA 2EB2A 5DRBA 1H0VA 3VUTA 3ODYX 3KA0A 4TPTA 3UVRA 2AYPA 5IMEA 2I0EA 4S34A 2X1NA 4E8AA 5GZ8A 4L7FA 4M8TA 4PRJA 4YZNA 3W18A 4JJRA 3QHRA 5JQ5A 4IX5A 3EL8A 1TQPA 3R7VA 3VRYA 3SKCA 1FINA 4FKLA 4JAIA 1CSNA 3F2NA 4MD8E 2WTJA 4FTJA 4W8EA 3BGPA 3EOCA 2ITTA 3HMMA 4MNEB 3WI6A 2BTSA 2IJMA 5KE0A 5CSXA 5DR6A 1YOMA 4L45A 5L6WL 4EZ5A 3UOJA 2WTIA 3AGMA 4M3QA 2XBJA 2X9EA 5JZNA 4ZLZA 3GT8A 4H3QA 2H9VA 3VF9A 2HXLA 2WNTA 3WF7A 3PP0A 5JFXA 3BV3A 4EYMA 1MQBA 1XO2B 2XIXA 2FA2A 2XKCA 2ONLA 3GBZA 1JKLA 2B55A 3JUHA 3PXZA 5BUJA 3SW7A 2GS2A 4BDGA 2GNLA 4EH5A 2JBOA 2OF4A 4IQ6A 3AC2A 2PHKA 5HO7A 5FEQA 2IW8A 3QLGA 2ESMA 2OH4A 3AT2A 3CBLA 4OTPA 1YDTE 2X4ZA 3KMUA 2RG6A 3OS3A 3VS2A 5HG7A 2OG8A 3KRXA 3MFTA 3F3WA 4IX3A 2W5HA 3P9JA 3C50A 3MPTA 3OVVA 2OH0E 3JY9A 4A06A 5EQPA 1T46A 5HD7A 1SVEA 2UW4A 3PZEA 5IG1A 1QPDA 5GHVA 3CQUA 2W1GA 3EZRA 4IAIA 2EXCX 3H9RA 3NWWA 3AT3A 3NUYA 1FVTA 3JY0A 2DQ7X 4CT2A 2GU8A 1PW2A 3TUBA 2PL0A 3NDMA 3U8WA 2B7AA 3P7BA 4XG7A 4EH9A 5FXQA 1JSUA 4EOQA 4OAUC 4RGJA 4FBXA 2YZAA 3MA3A 4QMPA 3ZFMA 4CFUA 4MWHA 3AXWA 3N4UA 1ZY5A 2ZDUA 5E90A 3SD0A 4YO6A 4S32A 5AFVA 3RWQA 1ZYJA 2O3PA 4X2GA 4FIGA 3R8VA 1IA9A 3ET7A 4FK3A 3RM6A 1YHVA 5FTOA 5J9YA 4IVAA 4RVTA 3TNWA 3UC3A 1M2PA 3Q3BA 4FIIA 5C9CA 4D4VA 1XH4A 4GJ2A 2EVAA 4HPUE 4RIYA 4P90A 1OZ1A 3LMGA 4W4YA 3F61A 3OFMA 2X2KA 4RJ8A 2FSMX 2JD5A 4IANA 4M0YA 5IQEA 4EHZA 2XIYA 3NZ0A 5E91A 3DJ6A 1CDKA 3GI3A 2C6KA 2WHBA 2R3GA 4FV3A 4H58A 3PG1A 4AXAA 4FEVA 1BUHA 5LVPA 4HYUA 2XRWA 3DQWA 5HBEA 4D1SA 5KHXA 4EHGA 3U4WA 2E9OA 3C9WA 3EQPA 4I21A 2BUJA 2IO6A 4W9WA 5A6NA 5DNRA 5LXMA 5IEVA 2J0MB 2VD5A 3O8UA 4I41A 4UB7A 2OSCA 5B2KA 3DTCA 4NWMA 5HX6A 2CSNA 3VN9A 5J95A 3CIKA 4FTOA 4YZDA 2YIWA 4KRCA 2XUUA 2Y7JA 3FZTA 2UZBA 3MVLA 4JBQA 2CGWA 3F2AA 1KE6A 2R3FA 4BDFA 3ZTXA 4UWCA 2XEYA 4EWHA 3ZFYA 3F69A 1A06A 5AIKA 3E3BX 4KS8A 1UU8A 2WPAA 3E7VA 4JQ7A 2WMBA 4ZJJA 3ULIA 4FT3A 3V6SA 2ZV8A 3TNPC 2XA4A 3VUGA 4CNHA 2HAKA 2WMTA 4YC8A 4FT5A 3FXZA 3OROA 3QUPA 2BAJA 1H25A 1GIJA 3PG3A 1A48A 3W2SA 1AGWA 1VYWA 3MH0A 4XHKB 2LAVA 3QZHA 3TTIA 2OBJA 1ZMWA 4IB3A 4ASZA 5L2TA 4Y95A 3UQCA 3BGZA 4FNXA 2W17A 4C59A 4MK0A 3UMXA 3C4EA 3Q4UA 5GZAA 2UZEA 2UZVA 3MIAA 1K3AA 1BLXA 2GCDA 4KBAA 4NIFB 4Z9LA 4FODA 4FOCA 4AWIA 3L8SA 1L8TA 2WD1A 4KAOA 4KNBA 4HVGA 1ZXEA 3AMBA 4MXZA 3C4CA 3UZRA 3QRKA 5F95A 3DS6A 5EOBA 4BDIA 4RVMA 1XH6A 3MVMA 2QU5A 2VTMA 3R04A 2GSFA 2XBAA 3QX4A 3P0MA 4YNEA 1S9JA 3SW4A 3I6UA 3ZO2A 4WNKA 4EOKA 3OY1A 3T3VA 3ZS5A 4YJPA 4X3FA 2NPQA 3ZLYA 4DEIA 5CVGA 4TT7A 3DQXA 5HNBA 4F9WA 4CGAA 1BL6A 2F2UA 3C4WA 3FAAA 5A4EA 5DR2A 2HW7A 3NNXA 3QRJA 4HCUA 4XYFA 2PMOX 3ZZWA 3JPVA 5FTQA 2W5AA 1PXPA 5L2QA 4S2ZA 2Z60A 3D9VA 4O7LA 2PVRA 2F7XE 4HJOA 3QRTA 3SLSA 3RINA 3NUAA 3MJ1A 4F0GA 4HYHA 1JAMA 5EQYA 2V0DA 1HCLA 4DH7A 1YWNA 2PMIA 4LGDA 2C3KA 4E93A 4LM5A 3WZEA 1SYKA 5CSWA 2Z7QA 5JK3A 5BMMA 5CAPA 4C7TA 4FA2A 5AAGA 3QKMA 4O2ZA 1RDQE 1F3MC 3WE8A 3DKOA 3HRCA 2I0VA 4EOLA 1STCE 5CNNA 1Q8ZA 4UYNA 4X6RA 4U45A 5AP3A 4B99A 5DIAA 2C6OA 5GIOE 4I0TA 1H1QA 3ZRKA 3HLLA 3CPBA 2H34A 2VWXA 5E8WA 3WZDA 4B8MA 1ZAOA 3A60A 4E4XA 3MN3A 1NT2A 1ZY4A 4DLIA 2P2IA 4YBKA 2GNGA 2VRXA 1W0XC 4JG7A 4MQ2A 4ZSAA 5EW3A 4IADA 2ZDTA 3G9LX 4ZLOA 4E6DA 5LVLA 5E8VA 5HBJA 3QX2A 4E5BA 2J0IA 1W82A 2UUEA 4R7HA 5HCYA 5L3AA 4L52A 2IPXA 4CRSA 4A7CA 4IAZA 4Y73A 2B4SB 4CSVA 4IB5A 3VBVA 2PWLA 4O7VA 5A54A 3MVJA 4D2VA 4MNEA 1WMKA 2PY3A 3R1SA 5CF6A 5KZ0A 3U54A 3ZMMA 3FUPA 5A9UA 2J2IB 4ONAA 4V01A 1XH9A 2YERA 2BZJA 2A1AB 3MBLA 4RWJA 4FR4A 3V5LA 4E3CA 2HYYA 3SV0A 3QLFA 3DB6A 5EHLA 2ZVAA 4KBCA 2QI8A 4FL1A 4O6LA 2C6LA 3E8CA 4IBMA 4JR7A 3NCGA 3ZYAA 4F65A 4PL5A 2GQSA 2QOQA 4APPA 5H3QA 3KMWA 4ZSGA 5EKNA 4E26A 4I3ZA 3BI6A 2PVFA 2YWPA 3Q4CA 3QF9A 1DS5A 3HRBA 2QOKA 2Y4IB 4GT5A 2R2PA 3OWLA 4C37A 2QO2A 4BYJA 3PIYA 2YFXA 3QXPA 4OT5A 3RAHA 3TT0A 1UWJA 1DI8A 1Q8YA 1WBVA 3FQHA 1UKHA 1NY3A 4LFIA 4O0YA 3A99A 3AMAA 4K6ZA 3V04A 4NM0A 4TWPA 3W2OA 1PXJA 4TYIA 3FI4A 3PSBA 4OTRA 3DV3A 4CEGA 4EEVA 1FVRA 3QD0A 3TEIA 4PL3A 3DXPA 4ZY6A 4N4SA 5IH6A 1WVXA 1PMUA 2BR1A 2HY0A 2JIVA 4P4CA 4ZY5A 5LMBA 3MFSA 3ZSIA 1NVRA 4YTIA 2WEIA 4LL5A 1YDRE 2JC6A 5D10A 5FDXA 3RM7A 3TZ7A 3Q9ZA 4CMUA 1IAHA 1JKTA 5JGDA 2OGVA 3QTXA 2CN5A 3ZO3A 3FKLA 1O6YA 4NH1A 4M14A 3VQHA 3N51A 4GSBA 5K0KA 1R3CA 1U59A 3LXNA 5TO8A 1WCCA 4UMTA 3VS3A 3HV3A 5EKOA 4AE9A 2VNWA 3NLBA 4XOYA 5L6OA 3EJ1A 4L3PA 4WKQA 3PTGA 4AW5A 3FMMA 4OW8A 3LFDA 4QPSA 2PVMA 4UBAA 1GZOA 2C5VA 4NW5A 3I7CA 4OTIA 3ORXA 5AP4A 2A27A 1J7UA 3Q9XA 5AP2A 3FSFA 4CG9A 3DBEA 4N0SA 3MH1A 3FQSA 2QOOA 3NUXA 4F6WA 4BHNA 3UIBA 4F63A 3O8PA 3VULA 4G6NA 3P1AA 2C5YA 2RIOA 3LCOA 1PXNA 4EH8A 2YN8A 2QQ7A 4JNWA 5A4QA 3AD5A 3N4VA 4GU9A 1M17A 5FLFA 4FSMA 3LFAA 4UV0A 1W98A 4R3RA 5LMKC 4HNIA 5EW9A 4D2WA 3FMDA 1QL6A 3F7WA 3BX5A 3FBVA 3ZXTA 3HDMA 4D0WA 3MPAA 4U8ZA 4GJ3A 4HW7A 1VR2A 2JFLA 3TZMA 4Z16A 4E20A 3GU6A 3MVHA 4I5PA 5IDPA 5CU6A 4GV1A 3HECA 1Q41A 3I60A 5GJGA 3ORIA 1OGUA 5CYIA 4RWKA 4YNOA 1YHWA 3WIGA 3TJDA 1O6LA 4YJVA 3TDVA 3QTWA 4IJ9A 1URWA 5I9UA 4U79A 3GCSA 2OIDA 2C69A 5EYKA 5HVYA 4HVIA 2ERKA 4WD5A 3COHA 4DFNA 3TKUA 1R0PA 3VHEA 3KB7A 5L8JA 4XBUA 4OUCA 3CJFA 4BCKA 1W83A 3Q9YA 4M68A 4FL3A 4AOTA 3B2WA 3LFFA 4FEUA 3Q2JA 3TDWA 1XH7A 2GS6A 4BWXA 4EORA 2ETMA 5A3XA 2XNMA 3QL8A 1SMHA 4AW1A 3QA8A 4TL0A 4PP7A 2CJMA 3OD6X 5EFQA 4NSTA 5A14A 4IDVA 3V8SA 4WSYA 5DT0A 5LOHA 3PA3A 4V04A 3BE2A 3HAMA 2BPMA 4JL9A 2HXQA 5FRIA 4YTHA 4R7BA 2BRHA 3A8XA 3M1SA 4KBKA 3IGOA 4QYHA 3QTZA 2JKOA 3R01A 2F57A 5J1VA 3E62A 1YVJA 5EI8A 5KMIA 4F9AA 2BKZA 3KCKA 4MVFA 3TKIA 3VBXA 2X7GA 5LVOA 4O0XA 2YM4A 4O7WA 2X8DA 4AGCA 4M13A 1Q61A 4AG8A 3DKGA 3TV4A 2J4ZA 4UMPA 1Q8UA 2XK6A 2BRMA 4BB4A 4IAYA 2IZUA 3GC8A 3ZCLA 3MGYA 5DRDA 5AA9A 4NIFA 2VTNA 2FSLX 3CY3A 5DYJA 4ZSEA 3DKFA 1J1CA 5EHYA 5CXZA 2R7BA 2B53A 5LARA 3FLNC 2BHHA 4MF0A 3DFCB 1O6KA 3GOKA 2VWIA 2IZSA 1Z9XA 3QRIA 5DGZA 2BILB 3PJ1A 3P86A 4I6FA 2VTOA 4HVHA 3TCPA 5J8IA 4O38A 4FKIA 5A4LA 4BFMA 4G16A 4IIRA 4C3FA 2G2IA 5LMAA 3PXQA 5FXSA 5B0XA 4O0UA 1JKKA 4MX9A 3BHTA 1Q4LA 2YDKA 3PRFA 4RIXB 2PULA 2OXXA 4QYGA 4UN0C 1XQZA 4J8NA 3NMUF 4IMYA 3HV5A 3ZEWA 4DEHA 3MPMA 3SXFA 5C4LA 2C68A 3R0TA 4Y83A 4B0GA 2WIHA 4ERKA 4EL9A 3ZDIA 5HE1A 4DEDA 1VYZA 2VTJA 2CMWA 2HY81 4OTFA 2C3LA 3C1XA 4PMMA 4FG8A 4ENYA 1XBBA 3A7HA 5I9YA 5ETAA 3QWKA 4C57A 4JS8A 2ITUA 4QMSA 3F5XA 4D0XA 2PSQA 3DAEA 5GJFA 2PVNA 3QAME 4FE2A 3VS1A 4DG2E 3UQFA 5FUTA 3I81A 4FKPA 3TACA 3V5JA 2R3PA 4DTAA 3MWUA 4U41A 3ZU7A 2X7OA 1OBGA 4YJUA 1ZYSA 5CZHA 2YWVA 4CFNA 4LI5A 4B7TA 1MRYA 4AFEA 3HZTA 3PY1A 2UVZA 5LQFA 4D4YA 3D5WA 3FHIA 5CNOA 4FYNA 2UW3A 2F4JA 4ZTLA 4AZFA 3F88A 3OT8A 4CKIA 3U6HA 1PHKA 2LGCA 2VWYA 2UZOA 1YXVA 3QGWA 4DHFA 5K9IA 4BBEA 4YPSA 1FOTA 4EK6A 4F1MA 5BVEA 2OK1A 2VGPA 3AT4A 5AX9A 3ZUTA 4DEEA 4RX5A 3KU2A 2YM3A 4YJNA 4OT6A 4AE6A 4YZ9A 4U44A 1OUKA 4A4LA 1B38A 4FKRA 5CXHA 4ZXTA 5HQ0A 1U46A 2HIWA 3H3CA 3FMEA 3QTSA 4Q9SA 4QTAA 1ZMUA 4UALA 3S95A 3AGLA 2VAGA 5T68A 5BVKA 5HCZA 3OG7A 3VF8A 1OIRA 3FI3A 4KINA 2C30A 4EONA 3R7EA 3HV6A 4KSPA 1QMZA 1WVYA 5CSHA 4F9CA 1APME 5ETCA 3SA0A 2XYUA 5BVWA 5IISA 3FV8A 2WOTA 5HG8A 3O50A 3OOGA 3GEQA 2BRBA 4FTRA 5M57A 3NVKI 3G5DA 1GAGA 2YM5A 5AR2A 4FKTA 5KBRA 4CKRA 3HV7A 5IA0A 4QRCA 2Z2WA 3FC2A 4E4NA 3DK3A 2RG5A 4FVRA 4I92A 1RQQA 4RJ6A 4WBOA 3BCEA 2X8IA 4J95A 4YHTA 5BMSA 3JVSA 4GYIA 4WG3A 3QQFA 5CZIA 3NVMB 3I0QA 5IUGA 4I0SA 2VN9A 3FY0A 3QCXA 5AUZA 2OI4X 4XEYA 1Q99A 4FK6A 5HGIA 3RCDA 3PIXA 5FM2A 4RFMA 3FY2A 4QP9A 1ZOEA 2GNFA 5JEBA 5CY3A 3VW6A 5I9WA 3F5GA 5D41A 2JIIA 3W10A 3F5UA 3OUNB 3LXKA 1PKDA 4HNFA 4DBXA 4YO4A 3CR0A 4AN9A 5A6OA 4U97A 3RGFA 4NM3A 2FVDA 4JX3A 3EN9A 4C4GA 3OOMA 4QMWA 3MS9A 1ZLTA 3VIDA 4FOBA 2J5FA 3Q2MA 2CKEA 2YM7A 1SVHA 4YJTA 3A4PA 3QTRA 3S2PA 3D5XA 3QGYA 1NA7A 3A7JA 3FMKA 5D12A 5DI1A 3WIKA 4DH1A 4RSSA 3W8QA 3HMPA 4JR3A 3GC7A 2NRUA 5CASA 4U3ZA 5C01A 5KX8A 3VUKA 3SOCA 4WOVA 4XP2A 4RC2A 3BWJA 5IQIA 4RJ5A 3UPXA 4EQCA 3FLWA 2IVUA 2YHVA 5ANEA 3BWFA 1DM2A 4GRBA 3MY0A 2BDWA 5BUEA 1I09A 5ACBC 4CTBA 4F4PA 5IQBA 3R21A 4AGUA 4NJ3A 5IA1A 3ZUUA 4R1VA 3EYHA 5JGAA 5E4HA 4C58A 3ROYA 4ACDA 2C3JA 4YJRA 1OMWA 2UZDA 4FV9A 4QMZA 4LOOA 2JDTA 3DA6A 3D83A 4X2KA 3ZLXA 4FNYA 4GK3A 1YXUA 4KWPA 3BQCA 4LRJA 4XG3A 4L53A 4C4JA 4CYIA 5AV0A 4ZZNA 3RNIA 4FSRA 3RAWA 2CKPA 3ORLA 3V5QA 4G1WA 4XV2A 3R7IA 4IB1A 2QG5A 3M2WA 4U0IA 2XM9A 2PVYA 1KE5A 1Q62A 5LJJA 2BAQA 4X0MA 3MDYA 5FQDC 3VS4A 4ZY4A 3EQRA 3VBYA 4D2TA 3F3UA 3L8VA 4IAAA 2A0CX 5C8KA 3QCYA 4MNFA 2F7ZE 3TN8A 2PZYA 4UWYA 4A9SA 2HZNA 4AW2A 4ZLYA 5KMKA 1ZYCA 4X21A 2YCSA 4U9AA 3TG1A 4F7SA 4IW0A 4RVKA 2Z7RA 2C6EA 3O23A 4YJOA 2R7IA 4LRMA 2YA9A 4PP9A 5ANKA 1XKKA 3UOKA 3W2CA 3C7QA 3A62A 4IWPA 4BDDA 3PLAE 2VV9A 1GZKA 4XP0A 3ORZA 4OAVB 2HZIA 1WBOA 4MTAA 4BCIA 3F3ZA 3BZ3A 2QLUA 1OIQA 1YHSA 3QD3A 4PDSA 5CEPA 2C0OA 1K2PA 1PYEA 3OWKA 2WU6A 4QP4A 2CKOA 4RMZA 2WTDA 4FKOA 2YDJA 2V55A 3HA8A 5FDPA 4PMPA 2IVSA 4EKLA 1J7IA 2WMUA 4FGRA 4XG6A 4D1XA 5AJQA 4CFMA 1J3HA 2W1EA 3Q60A 4ITJA 3ATSA 1XR1A 2FGIA 2QKRA 5DR9A 2GNJA 1WFCA 3VHKA 3GXLA 4NU1A 5CAQA 1MQ4A 2YACA 2R3LA 4K2RA 2WB8A 4GK2A 4USDA 3O7LB 3NW7A 4TYHB 5ANGA 4DITA 5HTCA 3CGFA 2XRUA 4AN2A 3MB7A 1M14A 3IK3A 3S1HA 3QZFA 4O2PA 3RTPA 1ZZLA 3ANQA 4Q5EA 2ZB0A 2J50A 3ENHA 4RIXA 3SVVA 2EXMA 4CRLA 3O51A 3R73A 3LQ8A 2UW9A 2O65A 5HTBA 4IB0A 1MRVA 2O0UA 4CFWA 1OPKA 2GPHA 3PY0A 4PMSA 1XBAA 1PF8A 3HRFA 1U4DA 3NR9A 3WF5A 3PPJA 2GTMA 3BLQA 4EOIA 3GOPA 3LXPA 1AQ1A 2BZKB 3IDPA 3A61A 2GDOA 3QRUA 4MEDA 5HG5A 3QQUA 4OR5A 4HVDA 3LVPA 4QP6A 4YZCA 4BTFA 4UYAA 3RPSA 2RSVA 2O8YA 3PVUA 4RLLA 2QODA 3QHWA 3TIZA 3GU5A 2R3HA 4OTDA 2IVVA 4NK9A 2G01A 1JVPP 2ITQA 4XV1A 3KN6A 4FTLA 4FZ6A 5IH4A 4ZS4A 1H1PA 2Y8OA 2QR7A 4IZ5A 4JXFA 4MXXA 4NW6A 2C6TA 3OBGA 5AM6A 4DFXE 5BYYA 3L9MA 3PJ3A 5EYCA 4WRSA 1YWVA 2CDZA 3C5UA 3VS0A 2O64A 1PMNA 4PDPA 4YHFA 2F2CB 4QTDA 3VS5A 2QO7A 4TN6A 4WG4A 3UIXA 3BE9A 4O83A 2PTKA 3G6HA 2OWBA 3PUPA 4Q2AA 4L42A 1M2QA 3DDPA 4FMQA 1MRUA 4AA0A 5E7RA 3KY2A 2AUHA 2XK4A 3I0OA 4P5ZA 4QT1A 3RWPA 3LFQA 3EFJA 3KXHA 2G1TA 2XCHA 5C26A 2UZNA 2WMWA 5A4CA 4A9RA 5GJDA 1H1SA 5LMKA 3LFBA 2OO8X 3DKCA 2XNGA 4I23A 4WIHA 4ACCA 3D15A 4U42A 2V7AA 4Z7HA 3I5NA 4JBPA 1YI3A 3L8XA 3BU5A 3R71A 4IAFA 3BHHA 4C3RA 2GQGA 3RP9A 4UXLA 4ZTNA 4BCHA 1URCA 3FZRA 2ITNA 1YXSA 3IW4A 4BWPA 4IX6A 4APCA 4JI9A 3GFEA 3GGFA 3CS9A 5AMNA 1H27A 3E3PA 4PQNA 4PNKA 3RNYA 4N6YA 2W9ZB 5AP0A 4BWKA 2BMCA 4AW0A 5IH5A 5CAVA 3ZXZA 5GNKA 3FLSA 4O1PA 3UDBA 2XKEA 4AZEA 2WMSA 3VW8A 2BRNA 3DBCA 4BIBA 5KMOA 1CMKE 4RJ4A 3FMHA 3WILA 1H1WA 2VTHA 3LLAA 3FPMA 4WNOA 4FX3A 3G90X 3UE4A 3OCGA 5L8LA 4CZUA 2WIPA 1Y8GA 5IZFA 4FSZA 3HNGA 4PPCA 4IVCA 4RFYA 4MKCA 4JLCA 4PPBA 4II5A 3MJ2A 2X4FA 4RWIA 5T3QA 3Q4TA 4O7SA 2H96A 3PVGA 4IDTA 5CVFA 1GIHA 4IWDA 3EZVA 4GW8A 1BI8A 4GCJA 3ETAA 4C0TA 4F09A 4NTTA 2JBPA 2OU7A 4FG7A 4FKJA 3QQLA 4C02A 3UOLA 4H05A 2C6MA 5ETFA 2Y4PA 4XBRA 3ALOA 2IZTA 2OJGA 3DAKA 3DFAA 3QQGA 3VBTA 4FV5A 5EQEA 1NW1A 2ITOA 4PDYA 5IA3A 5IQFA 4IH8A 3EQIA 4ANLA 1OPLA 5I3RA 1G5SA 4OTWA 3SHEA 2RL5A 1PY5A 4F70A 4BKYA 4ENXA 1REJA 4BGGA 4K77A 4Q9ZA 4UY9A 4GL9A 2C6DA 4TWNA 3AD4A 1QPEA 3MESA 4RJ3A 3U51A 3GVUA 5M4UA 5B2MA 4JX7A 3COKA 4G6OA 3UIMA 2CHLA 4MHAA 2V5QA 3DLZA 4QPAA 3OEZA 2HZ0A 4FSTA 3R02A 4Y5QA 4IFGA 2UVYA 4O27B 2VTPA 3G15A 3LM5A 3VVHA 3CTHA 5D1JA 5HTIA 4WO5A 3OXIA 3T8OA 2FO0A 3A7FA 4MF1A 5H8GA 3PVWA 4CD0A 3VUDA 4CT1A 3OP5A 2ZM4A 3DK6A 4IVBA 4BZOA 4QQCA 4L67A 4KKGA 3UODA 3KVXA 4RT7A 4M12A 4P5QA 3L9NA 3BRBA 3F3VA 2UZTA 3FLYA 5L8KA 4U6RA 2UW0A 3R2BA 3QQHA 2G2HA 3LCKA 4JDJA 2VX3A 3AOXA 4MBLA 4H3PA 3AMYA 3U55A 2R0IA 3EKNA 4AA4A 1YRPA 2CLQA 5J87A 4ZS0A 4EJ7A 2YIYA 2VTAA 3MYGA 3NGAA 4WSQA 4GIIA 4D9UA 4QTCA 2GMXA 3G33A 3PLSA 2XIKA 4ZTRA 4DAWA 4J97A 4DF3A 3GCQA 2X2LA 3BPRA 4PMTA 4XG2A 4O0SA 1OECA 1DAWA 3HKOA 5B2LA 3DBDA 1LEWA 3RK9A 4QP2A 4LUDA 2Y9QA 4FL2A 4KIQA 4CKJA 2ZM3A 1UWHA 3RBWA 4JIKA 4FTUA 4TWOA 4ALVA 1ND4A 2WMQA 4TW9A 3EQFA 4WG5A 2YISA 5CENA 2VTIA 3RPOA 3VS6A 4DE4A 4PY1A 2WTVA 4RQVA 1Q24A 2JKKA 2XF0A 3IOPA 5ANJA 4E7WA 4G3DA 3FXWA 2W96B 4PV0A 3NNVA 5AUYA 3MH3A 4MXAA 4IWQA 1OL5A 1KOAA 5G1XA 3ZC6A 3TM0A 1F5QA 3IGGA 4ANNA 4YURA 4FTQA 3GB2A 2O5KA 4JT3A 2VX1A 2YABA 4N6ZA 1JLUE 2ZAZA 4P7EA 4D55A 5KO1A 2WQEA 4TYHA 2EU9A 4AX8A 1KE7A 2VTTA 4W9XA 5L6PA 5E9EA 4ITHA 2X2MA 4FEWA 5C03A 4BCFA 4CQGA 2C3IB 1XHAA 3QXOA 4G9RA 3QTIA 4O0TA 5A4TA 2NP8A 4ASXA 3MV5A 3QCQA 4G31A 3BIZA 3R9OA 3AC3A 2J51A 4BVUA 3RALA 3KXXA 2GQRA 3MA6A 4J1RA 4BCOA 2OIBA 3ACJA 2R64A 2YJSA 4OBPA 4QTBA 4J71A 4ZP5A 3NNUA 4AA5A 4YU2A 3I7BA 3R9NA 3ZBXA 4AAAA 4A9TA 4RLKA 3ORPA 2R3KA 1V0BA 2VWVA 2WTWA 4XRLA 3R7OA 2CCIA 3QD2B 4HCTA 4C34A 5C8NA 1OL1A 4DGMA 3POZA 4I6QA 5M53A 3KC3A 1UKIA 3HDNA 2WGJA 4KIPA 5AUXA 3TNQB 4C8BA 3KULB 5E8XA 4DG3E 1OKYA 1Q8TA 2UW8A 2NO3A 2X81A 3BU3A 4XRJA 3ORMA 3CJGA 5HNIX 3K2LA 2XMYA 4ITIA 4AZWA 4RG0A 3FI2A 2JEDA 5EOLA 4BCJA 3PXKA 3R8PA 4G34A 2G15A 5CLPA 1PRYA 1TVOA 5HX8A 4RWLA 5CU4A 5IEYA 5DHJA 2Y0AA 2PVHA 2HELA 3KXMA 5ACKA 1U5QA 3I4BA 3E63A 3MB6A 2BZHB 2UV2A 4EWQA 5HNGA 4O7TA 4F9BA 5HE0A 3GC9A 3BGQA 4K18A 3LAUA 2XJ1A 5CEIA 3V6RA 2BIYA 4K0YA 4NUSA 3KRLA 2W1FA 4YR8A 2SRCA 5HG9A 3DXQA 4RIOA 3SOAA 5J1WA 3F2RA 3DOGA 4I5CA 3RAKA 3R8LA 2X6EA 1OITA 3HEGA 3B8RA 3BHVA 3FZPA 3LJ0A 3QCSA 2AC5A 4M84A 4Y72A 5BYZA 5F1ZA 5IPJA 3R83A 4EJNA 3O7LD 2REIA 4JAJA 3WZUA 3NRMA 1H26A 4CZTA 3QZIA 3OC1A 2ITWA 4RC3A 5HO6A 2VTLA 3PXFA 1OL6A 4TY1A 2JITA 5TR6A 3W33A 5M56A 1UNHA 2XM8A 3MSSA 4A4OA 4FSQA 1Z57A 5FM3A 2RKUA 4FT9A 4JIAA 3TKHA 5CF5A 3VO3A 3QBNA 3DBFA 2ETRA 4JRNA 1UV5A 3KFAA 4GT4A 3ZRLA 3DT1A 3L9LA 5IQAA 5C8MA 3DU8A 3ZLWA 5M09A 1OKZA 2WMXA 3D5VA 3EQBA 3CTJA 5E92A 4X2NA 1F0QA 2PVKA 3IW5A 3VBWA 3LFEA 4ANQA 5J7BA 4O7ZA 2WMVA 2PMLX 4XV3A 4JRVA 3KN5A 3EQHA 4F7LA 2WFYA 4DGOA 3ODZX 5CAUA 2CN8A 1M52A 1OL2A 4I24A 2CGXA 4PTGA 3FLZA 1Q5KA 2W4OA 4DLJA 2X9FA 3Q5IA 3NYOA 4LL0A 1SNUA 4S30A 4HOKA 5KKRC 2R3MA 4HYSA 4O7YA 3HGKA 5H8BA 3FKOA 3NCZA 3UO6A 1WVWA 3FQEA 4YC6A 5EH0A 3AC4A 3T3UA 4M66A 3TTJA 2GHMA 3Q96A 5FP6A 5DLSA 1GJOA 4ALUA 2XNOA 1PXKA 2XP2A 4FTAA 1QPCA 5GZ9A 1PMVA 4O0VA 2QOHA 2BALA 3HL7A 4LGHA 3EH9A 4FT0A 4FV8A 1RE8A 5BUIA 3CQWA 4IX4A 3KREA 4EKKA 3GENA 3UPZA 4O7RA 1ZOHA 4AP7A 4K33A 3O96A 3UQGA 3C5IA 3CSVA 4MWIA 1FMOE 4GH2A 4YPDA 3ZO1A 1NVSA 2W1HA 5F4NA 3UG2A 4HGLA 5HZNA 2DUVA 2KTYA 4O82A 4BZNA 3BELA 5J7HA 4AT3A 1WZYA 5C1QB 5LWNA 3AG9A 1PYXA 4WBBB 4CCUA 4DFZE 3GCPA 2YAAA 4IJPA 2ITYA 1YOJA 3DGKA 4OLIA 4F08A 2XEZA 5IQDA 5HLNA 1ZMVA 1WAKA 2WEVA 4L01A 3NYXA 2WTKC 2YCQA 5IQGA 3JS2A 4QYYA 2VX0A 2YCFA 3SRVB 3OF0A 4RX7A 2VO7A 2ZM1A 5EK7A 3R8ZA 4YGAA 4EZ7A 3RZBA 2J7TA 2BRGA 2UZLA 3R63A 3R00A 3TXOA 3ELJA 3I6WA 1M7QA 4WA9A 4D58A 3ZLSA 3O2MA 3QYWA 2DYLA 1J91A 3R7UA 3WZJA 4J53A 3OEFX 4BIDA 2YAKA 3SG8A 4BY9E 4MH7A 4F0IA 4YHJA 5H8EA 2XS0A 4AOJA 2B9IA 1YDSE 2C5NA 5JFSA 3FPQA 4KUJA 4ZTMA 5F94A 3E93A 2QKWB 3A2CA 2J0JA 4BKJA 1G8AA 5M55A 3OXZA 4CMOA 4EOSA 4FKUA 4GUEA 4FVQA 3FZ1A 4AU8A 2B0QA 4NTSA 4YLKA 2XNBA 2CGUA 1GY3A 4MBIA 5FBNC 5AEPA 3PSDA 3FDNA 2IW9A 4BICA 5CF8A 3R9DA 4BCGA 3UYTA 3PPKA 3CY2A 4L44A 5EM6A 4RZVA 4XJ0A 4Y8DA 3KRRA 2Y6OA 1FPUA 3HMOA 2E9VA 4H36A 4KS7A 4C36A 3EN7A 4EHVA 3GNIB 4DCEA 1ZARA 5KHWA 4PTCA 5AR4A 3LJ1A 3R7YA 4EH4A 5BVOA 3WF6A 1YKRA 2W06A 3HYHA 3E8NA 3PZHA 3U4UA 3ID6C 3PYYA 4QMOA 4EOJA 4YBJA 3L1SA 5J9ZA 4O84A 2PUUA 3RHKA 2BDJA 3VUIA 1IASA 4FYOA 5FD2A 5KZIA 3IDBA 3TNHA 4MBJA 2A19B 4IM0A 4R7IA 3FLQA 3NS9A 4EC8A 4FG9A 5CU0A 1GNGA 4FGBA 4DGGA 3DBQA 4I4FA 4AT5A 4AUAA 5HE2A 4C2VA 5HIEA 5J79A 4RJ7A 3TV6A 2DWBA 4WUAA 2WKMA 5HIBA 2WXVA 4I4EA 5CSPA 4DEAA 4LUEA 3TZ9A 3RJCA 1TQMA 5L2WA 2IW6A 4IM3A 4Z3VA 5GINE 5CVHA 3UOHA 4QPMA 3RK7A 3EN5A 4EOPA 4ZOGA 2ZMCA 4I6HA 3ZM9A 5F9EA 3UNKA 4TXCA 4JG6A 4ZJVA 4KB8A 3KULA 4FKSA 4BYIA 1LPUA 2YIXA 2BKKA 5HESA 1OUYA 3MTLA 4FSWA 3ZSGA 4E6CA 1P14A 3U6JA 3PVBA 3QC9A 1YWRA 3DY7A 4DFYA 2C4GA 2IVTA 4ACHA 4QMXA 5C4KA 1H28A 2CNQA 5IKWA 3ENMA 5K4JA 1WBNA 3VRZA 4FKWA 2J6MA 1VZOA 4FSNA 3NX8A 3QUDA 4L6QA 4DYMA 3DXNA 3U87A 2OXDA 5I0BA 4OBOA 3KXNA 4AZTA 3DPKA 3OW3A 3Q4ZA 4I22A 4BCMA 2W4JA 4QTEA 4GKIA 1KWPA 1EH4A 4Y46A 1PKGA 5FGKA 4C35A 3JXWA 1Y6BA 4XG9A 2BZIB 4J7BA 5E8YA 3WZKA 1CM8A 4I94A 1V1KA 2GFCA 1H07A 4PTEA 2QOFA 4C2WA 4LOQA 5ANIA 4V05A 4FIFA 4LRKA 4R8QA 3GU4A 3UVQA 5CT0A 5DT3A 4M7IA 4ANSA 4BR3A 4FI1A 2YEXA 3NUUA 5CAOA 5EHOA 1WBPA 3QTUA 3UMWA 2JDSA 5E8TA 1H1RA 4U5JA 2J5EA 4FF8A 5F20A 1ZYDA 2WQBA 2AC3A 1TKIA 2ACXA 2FH9A 3GCUA 3R2YA 4FTIA 4L9IA 4TTHB 5EDRA 5A46A 1H01A 4V0GB 2QOCA 4ZTSA 3IDCA 4CLIA 2PVLA 4QP8A 2B1PA 5DEWA 3GC0A 1OL7A 5CI6A 5AWMA 5HI2A 4LV8A 2OZAA 5LCJA 4FNWA 3D7TB 1JSVA 1KV1A 1OVEA 2VWZA 4CFXA 4NZWB 2W0JA 1PXIA 4ANBA 3O71A 4HVSA 3QD4A 4F64A 5AR5A 2XJ2A 3W8LA 4RQKA 4G5PA 1PJKA 3NIZA 1BKXA 4K11A 3ZFXA 2JIUA 1OKWA 3ZONA 4EUUA 3PY3A 3NW5A 2ZOQA 4OTHA 5E8UA 4O86A 3LM0A 1IA8A 3VJNA 4BBFA 1Z5MA 3D0EA 4N57A 4J8MA 5EM8A 3A7IA 2XVDA 4FIEA 5DVRA 3HP5A 4FEXA 4RFZA 5BVNA 4G17A 3EYGA 4QQJA 3C0GA 4EK8A 1T45A 1V0PA 3UZPA 3POOA 2ITXA 1YW2A 4X6QC 1GOLA 4QP7A 3CXWA 3M11A 3PXRA 4RX8A 2W1ZA 3QYZA 5CF4A 3P79A 3R9HA 3RMFA 3R9RA 2UVXA 4DTBA 3MW1A 4BCNA 4E73A 2W5BA 4FUYA 4E5WA 4WUNA 3OTUA 4IEBA 4DINA 3DK7A 5HVKA 4LQMA 2XH5A 3FYJX 1OM1A 2QOBA 3H30A 4XP3A 5IA2A 2G9XA 4YZMA 2Z7SA 4DEBA 3TL8A 5JFVA 2OICA 2QU6A 2XK8A 3OMVA 4OGRA 4ASEA 2C5XA 4XNEA 5D9HA 1FBNA 5IQCA 3FMLA 3ORTA 2E9PA 2UW6A 3Q6WA 4TWCA 1I44A 3SG9A 4FZDB 5HVJA 3V51A 4YMJA 3R8UA 5IMXA 3KF4A 3UBDA 2QO9A 2PZIA 4I6BA 1UNGA 5TOZA 4IAKA 1OKVA 2X8EA 4DGNA 2FB8A 4A9UA 5TE0A 4N70A 1YXXA 2QURA 4UX9A 1Y8YA 3CEKA 4FT7A 5FG8A 4TNDA 3JR1A 4FSYA 5AP7A 3KQ7A 5LVNA 3V01A 2PE1A 2W7XA 4ID7A 5HCXA 3NEWA 3SRVA 1WBWA 4CLJA 4PL4A 4C4HA 5BX0A 2EXEA 3SAYA 2ERZE 1X8BA 1P5EA 3ERKA 3L9PA 4DA5A 3QKLA 3W2RA 4KSQA 1AD5A 4TKSA 5DH3A 5FP5A 2V7OA 3CE3A 5M06A 4H1JA 2P33A 3V3VA 3KCFA 5M4IA 2R3NA 3AC1A 5DEYA 5JRSA 4AQCA 5CANA 4IWOA 4ZZMA 4C4IA 3LPBA 3EQDA 3GUBA 5DA3A 5J5SA 4EI4A 1MP8A 2B9JA 4NKAA 1FGKA 4F0FA 2IZRA 4H3BA 1ERKA 3LQ3A 5CQWA 2OW3A 5IUIA 4ASDA 1UU7A 4U80A 5HIDA 2X6DA 3A8WA 3OT3A 3D2IA 4GEOA 2CKQA 4DC2A 4LMNA 3WYXA 3HA6A 2W1DA 2JDOA 3CQEA 3Q6UA 4ANMA 4L68A 5T6KA 5AUWA 4UMUA 4QMVA 4CFFA 2PZPA 1MUOA 1OB3A 5CU2A 4XS2A 4F9YA 3LKMA 2GHLA 3P78A 4BL1A 5HOAA 2QNJA 2X0GA 1UNLA 4BDEA 2PVJA 4MXCA 4R3CA 3HX4A 3TNIA 3OWJA 1LEZA 3IKAA 4F1TA 5B7VA 3P08A 4B8LA 4O1OA 3N9XA 5TF9A 3LFSA 4EUTA 4FTTA 3JVRA 2IN6A 2XK9A 2PE2A 5L2SA 3ZO4A 2YCRA 5AV3A 4AT4A 5E8ZA 3WF8A 5HD4A 4QMMA 2W05A 2QCSA 3I5ZA 3K5UA 3R1NA 3R6XA 3UZTA 5HEZA 5FTGA 3P7AA 3OTVA 2RFSA 3V8WA 3BLHA 4JOAA 3LCTA 4MCVA 3MFRA 4NCTC 3F9NA 3G0EA 2VO0A 4EK4A 1W8CA 3FKNA 3RPYA 3QUEA 4ZSLA 3ZZEA 3F5PA 4O6EA 4BDAA 2W9FB 2PUPA 1OPJA 1KE9A 3V5PA 2J9MA 3DDQA 2YM6A 4FZ7A 5I9VA 3IPHA 1FMKA 2BVAA 3KRWA 3KXZA 3OHTA 5H2UA 5JMSA 3RZFA 3VUHA 2JAVA 2P0CA 5I9ZA 4FV1A 4YJSA 4CXAA 4NT4A 4EH6A 5M51A 1PXLA 5EDPA 3BBWA 2C0IA 3HAVA 1E9HA 3NYVA 3FEGA 3P7CA 2F49A 4X2FA 3IONA 2B52A 5HLPA 5AAFA 4QMQA 3FYKX 5HU3A 4A4XA 2VWWA 2H8HA 2OZOA 2RFEA 3W2PA 1OIUA 2X7FA 2J90A 2R5TA 3HP2A 4ALWA 3SQQA 2FUMA 2Q0NA 2J0LA 4LV5A 4MD7E 1QCFA 4S31A 5IA5A 4W4VA 5JH6A 3QTQA 2IWIA 2PYWA 2VO3A 3D7ZA 4AOIA 1R39A 4MAOA 3H10A 5KMNA 4NJDA 4GIHA 3NUNA 5AR3A 2Y4IC 4C3PA 1XH8A 1H4LA 5CALA 1VEBA 1U54B 2R3RA 4G3FA 3SC1A 4C38A 5E8SA 3DZQA 4DEGA 4EQUA 2C47A 3FHRA 4AFJA 5ANOA 2Q83A 4M67A 4EK3A 5M4FA 2C5OA 3LE6A 2VO6A 4L3LA 4UZHA 1BL7A 4UWBA 2ZB1A 1CKIA 4BTJA 4IC7A 4D9TA 4R78A 4JQ8A 4JBVA 3CP9A 3H0YA 3E64A 3LFNA 3ZRMA 3THBA 2C1BA 4FUXA 5ANDA 2JKMA 4EZ3A 3VC4A 3HMIA 2B9FA 1IR3A 4ERWA 4Z7GA 1FGIA 1M7NA 3BQRA 2UW5A 4EHEA 4D2RA 4XG4A 3OUKA 4D5KA 4HGTA 4WNPA 5JFWA 2XK3A 2ZV2A 1UA2A 4QMNA 3UC4A 3V5WA 3SGCA 3FXXA 1VJYA 4FEQA 5G6VA 3UO5A 4DGLC 3EB0A 5FWKK 5AUTA 4AGWA 2O63A 5HKMA 2OF2A 4U81A 4PNIA 3VBQA 4XCUA 5EYMA 2QHNA 5JGBA 4V0GA 1W7HA 2XNPA 3PFQA 3IOKA 4ZJIA 4R77A 3BKBA 3I1AA 1XWSA 3FSKA 4R6VA 3EFKA 4GG7A 1O9UA 3ITZA 4GG5A 4PF4A 3R1YA 3D7TA 3OW4A 3E8EA 4MYGA 1HOWA 4DBNA 2PUIA 4GYGA 4F7JA 2FSOX 3F82A 4BI0A 3FWQA 4QMLA 4O7NA 3GU8A 2R3JA 3ANRA 2YIRA 4BZDA 4RA4A 4GU6A 3MI9A 3OXTA 2QVSE 3BEGA 1IG1A 4NM5A 4IZAA 2QG7A 3PA4A 3RHXA 3QZGA 3EHAA 2YDIA 2I0YA 3NUSA 4FICA 4FV4A 5TT7A 3UGCA 4U43A 3TI1A 4JDKA 1FVVA 3TIYA 3R7GA 1Y91A 2GNHA 5ETIA 4ZTHA 3PRIA 3QC4A 2F7EE 3TJCA 2PZ5A 3RAIA 4BDJA 4D5HA 3LMIA 4RX9A 4G3CA 4IE9A 5D7VA 4D4SA 2OJIA 3C13A 4CVAA 1PMEA 2OFUA 4O21A 4AN3A 4ZAUA 2VUWA 2VTSA 4EBWA 4O81A 3MFUA 4L46A 4F7NA 4EC9A 4IXPA 2YIQA 3PXYA 4FKGA 5DE2A 4O96A 1XH5A 5DBXA 4BKZA 4DH3A 4M0ZA 5AV1A 2WO6A 3E88A 2R3QA 3WF9A 3F3TA 1H08A 5CTPA 1JBPE 2P2HA 3A4OX 3VUMA 3E5AA 3WOWA 4I1ZA 4AZSA 3K5VA 2A4LA 5FXRA 3LW0A 3WE4A 3LLTA 4QYFA 1U5RA 5CU3A 1H24A 2VTQA 3W55A 2I1MA 3HUCA 3Q9WA 1LP4A 4RIWB 5CT7A 5M08A 3MH2A 2XIZA 1JSTA 5E1EA 2VWBA 5TKDA 4BC6A 4NFNA 4CV9A 1W84A 1B39A 3H4JA 4HYIA 4Q5HA 5AP5A 3TUDA 3KXGA 4USFA 2YITA 3Q04A 2JGZA 4MQ1A 4ZTQA 5AV4A 5BYLA 5ITAA 3OY3A 4NEUA 5EM5A 3UNZA 4BBMA 3R28A 5IU2A 5J5TA 4IVDA 3M42A 3V8TA 2OKRA 4BGHA 4ZSJA 3E87A 2ZV7A 4ORKA 4BTMA 2RFNA 4FKQA 5CI7A 3HUBA 3FC1X 2ZYBA 3VAPA 4NFMA 4EH7A 1ZYLA 1CKPA 1WBTA 4MXOA 4FZFB 5CWZA 1KV2A 5DOSA 2WQOA 5AP1A 5H9BA 3B8QA 3BEAA 3OCTA 3ZH8A 3AD6A 3LXLA 5DPVA 3QA0A 3FJQE 1DAYA 1LR4A 3L8PA 1GIIA 3COMA 3H9FA 3CC6A 4U3YA 5I3OA 3NNWA 3PPZA 4CYJA 4ZEGA 4F1OA 4R5YA 3CKWA 3KF7A 5IA4A 5L2IA 4MD9E 3UO4A 2IG7A 2C0TA 1E1XA 5BNJA 3N4TA 4ANOA 1B6CB 3PE1A 4YUQA 2ETKA 4FV7A 4BI2A 2RFDA 3NSZA 4Y85A 4G3EA 2CLXA 4QP3A 4WT6A 4D2SA 3DB8A 3O17A 4I93A 5AR8A 2ONLC 4J52A 2DS1A 4UZDA 3C51A 3LIJA 3EFWA 4JG8A 4YC3A 3UJGA 1RJBA 2XKDA 5DG5A 3U9CA 5JZJA 3P4KA 2WZJA 2I6LA 4D2PA 5KMMA 5KMLA 4CQEA 2WMAA 4G5JA 3C0HA 4M15A 2ITVA 5AR7A 4DFBA 2KULA 3RK5A 3T9IA 4YSJA 5BVDA 3QWJA 5CEMA 2RGPA 4FSUA 4L8MA 3R1QA 3DCVA 4RC4A 4C33A 5I9XA 4XLIA 3R30A 3DAJA 4IACA 4O0RA 3V5TA 4NL0A 4LG4A 4UMQA 3NIEA 4NKSA 3SXSA 4YSMA 4BIEA 4D1ZA 4DTKA 4FV6A 4D4RA 1IAJA 4WRGA 3WYYA 4FNZA 4BGQA 4UMRA 3E7OA 5EYDA 4I0RA 3RCJA 3LFCA 4YP8A 4L3JA 5HORA 4GVAA 5JRQA 4D28A 3HV4A 4H39A 2YM8A 2WMRA 2R9SA 5AV2A 3D94A 4QQ5A 3UTOA 4LYNA 1GZ8A 3C4FA 4QD6A 4U7ZA 4Z55A 4YZBA 4RVLA 5EI6A 3EKKA 4FIHA 5M4CA 5FBOA 3F7ZA 5AADA 3PWYA 3R22A 3VNTA 5KUPA 2V62A 3O0GA 3PJ2A 3W32A 3IS5A 3GU7A 4FC0A 1G3NA 4RRVA 3G2FA 2OZAB 4W4WA 3RVGA 1J7LA 4DT9A 5HICA 5AM7A 4BCPA 4W4XA 3KL8A 4HGSA 2HENA 1UU9A 4GFGA 4QQTA 2CGVA 3P5KA 4B9DA 3ACKA 4GS6A 3FZOA 4BF2A 1JKSA 4CV8A 2CNUA 2W1IA 5FEEA 5ICPA 3A7GA 4C62A 4X7QA 5DMZA 3EL7A 3PJ8A 3RPVA 4EBVA 1HCKA 3EIDA 2Z02A 4IC8A 4QOXA 3PSCA 3OCBA 4I5MA 5HE3A 2PU8A 4B6LA 4FVPA 4CFVA 3ATTA 1XJDA 3Q53A 3FL4A 1U54A 3FMNA 3K3IA 1DI9A 4G6LA 5JQ8A 3E8DA 4A07A 4KIKB 4RBLA 3ORNA 3ZM4A 4M69B 4DH5A 4DCAA 3IECA 2QR8A 2JAMA 3UG1A 3KK8A 1V0OA 3BU6A 4JBOA 2HZ4A 4PX6A 5C27A 2PUNA 4FIJA 3HVCA 4FTNA 3VWAA 3BBTB 2EB3A 4HPTE 3GCVA 2BDFA 5KBQA 4DH8A 1P4FA 4R1YA 2P4IA 3K54A 3EWHA 4J96A 4DG0E 4JDIA 3LQ5A 1TQIA 5EW8A 5KNJA 1H00A 4BDKA 1WBSA 4IHPA 2XCKA 4IFCA 4KIOA 5DT4A 4XUFA 3AC8A 1BYGA 3Q52A 4XOZA 3BLRA 2WOUA 4F6SA 2C6IA 1OIYA 4OTGA 2WQNA 2HOGA 3H9OA 3FL5A 3VQUA 3BYUA 3G51A 4E4LA 4FV2A 2BHEA 3PWDA 3TZ8A 2JDRA 3KK9A 2CCHA 1P4OA 2QOLA 3CTQA 3H0ZA 3PIZA 3SX9A 5AA8A 5AUUA 3FE3A 4TYEA 3F66A 1R1WA 2XJ0A 3CKXA 3U9NA 5CEOA 1M2RA 3OZ6A 5HLWA 4A9YA 2HWOA 3S4QA 3KGAA 3QQKA 2JDVA 2OFVA 4JVGA 4BDBA 2E9UA 3CPCA 5E1SA 2HK5A 3IG7A 3JYAA 1JPAA 2R4BA 4TYJA 4XX9A 2NRYA 1KOBA 3II5A 3IW7A 2ITPA 3AC5A 3Q5ZA 4FTKA 2BROA 4W8DA 5I5ZA 5EG3A 4K9YA 2OJJA 2PPQA 1G8SA 3SDJA 1E1VA 2C1AA 3MY5A 3FI8A 2QONA 3BHYA 4E1ZA 4JQEA 4LGGA 4XLVA 1XBCA 2PE0A 4EK5A 4YTFA 5DWRA 4L00A 4X3FC 4AGDA 1KUTA 3MY1A 3CD8A 4KD1A 3DLSA 3Q32A 5HO8A 4HCVA 4QO9A 2XIRA 3C0IA 5JT2A 3FZSA 2JFMA 2XNNA 2GFSA 3GQLA 4TRLA 5EI2A 3LCSA 4EH2A 2XNEA 4F6UA 4BDCA 5HU9A 3U6IA 3BYVA 3IW8A 4UEUA 1CTPE 1BI7A 4ACMA 1KSWA 3LHJA 4LMUA 1IEPA 4EH3A 1J1BA 2QD9A 4YLJA 2JKQA 1ZWSA 1L3RE 2QHMA 2O2UA 5IQHA 1YOLA 2CPKE 2JLDA 2Q0BA 3T9TA 2Z7LA 3BHUA 2R3OA 1H8FA 3ZBFA 2A2AA 4L43A 4O22A 3GQIA 4RIWA 3C4ZA 3NAXA 4TYGA 3UVPA 5IF1A 1BX6A 4G9CA 5M07A 4QNAA 1SZMA 1BMKA 3TUCA 3OCSA 2HWPA 4J98A 1JWHA
chains in the Genus database with same CATH superfamily
4XG8A 2HW6A 3D2KA 1P2AA 3I79A 3DJ7A 4TZRA 3NAYA 1Q3DA 3IO7A 4EYJA 4GFMA 4B4LA 5AIRA 5LVMA 5CEKA 4AF3A 4UXQA 5L4QA 2VWUA 5K5NA 2ZV9A 2BFXA 4E5AX 4E6QA 4NCTA 2RF9A 5D11A 1IRKA 4MXYA 4QNYA 3PA5A 3ZOSA 4DFLA 3DNEA 3PDTA 4CG8A 4X3JA 5EDQA 2E2BA 2UZUE 4U40A 4XH6A 3P23A 4C4EA 4C4FA 3EFLA 5JN2A 1YI6A 3CD3A 5J9LA 4FKVA 5DN3A 3E92A 3QKKA 3UP7A 4F99A 2UZWE 2VU3A 5I4NA 1A9UA 4NM7A 2XB7A 5D7AA 3LOKA 4I5HA 3S0OA 4C61A 5BPYA 4X2JA 5FEDA 1JOWB 4AACA 2EUFB 3OBJA 4WNMA 4GFOA 4G2FA 1OI9A 4GT3A 3QFVA 4RIYB 1K9AA 4ZZOA 4BI1A 1LUFA 5KCVA 2WQMA 2WELA 4JDHA 3ORKA 3REPA 4CMTA 3LMHA 3D14A 3ML1A 2E9NA 1SM2A 3GP0A 5JKGA 2Y6MA 5DFPA 4ZMEA 4QYEA 3SXRA 4CZYB 2J0KA 1ZOGA 4RPVA 2BTRA 4EQMA 3NPCA 4TNBA 4EOOA 2WU7A 4ACGA 3DZOA 4P2KA 2OIQA 4YJQA 4XV9A 4EOMA 4G3GA 2I0HA 2Z8CA 1Y57A 3D5UA 5BQ0A 4BTKA 3COIA 5JSMA 1Q8WA 4QMYA 3FMJA 2G2FA 4PWNA 3CLYA 4QP1A 2WAJA 5KKRB 5M44A 1JQHA 3ROCA 3EQGA 3ZEPA 3RI1A 5LCKA 4DT8A 4WHZA 4O91A 1CKJA 2VZ6A 4USEA 3ZSHA 1Y6AA 1Q97A 3DTWA 3QALE 4HZRA 4AS0A 2FSTX 2ITZA 3QQJA 5CX9A 2OXYA 1ZZ2A 4ZMFA 4H1MA 4BN1A 2YLFA 3IQ7A 1ATPE 5K5XA 3QU0A 3EMGA 2FYSA 1NVQA 2X39A 2H6DA 4DFUA 3TV7A 2QLQA 5AUVA 4AAYA 3OWPA 2ZMDA 1S9IA 2GNIA 2ZFYA 2BFYA 4PDOA 4KA3A 3R8MA 3C4XA 2UW7A 4E4MA 2R3IA 2GHGA 4RZWA 4PUZA 5K3YA 1SVGA 4ARKA 3IW6A 3KVWA 3O8TA 1NXKA 1GZNA 2EWAA 4FZAB 3W2QA 4YLLA 3G9NA 3EN6A 3S00A 2YLEA 3NUPA 4QMUA 5IUHA 3PJCA 4I20A 4J99A 3KRJA 4L7SA 4ZIMA 5CEQA 1UU3A 4PPAA 5BVFA 4K1BA 3ZHPC 3ZDUA 4GVJA 3NYNA 3VS7A 4HZSA 4E6AA 2P3GX 3UP2A 2WTKB 3RPRA 2XKFA 3CCNA 3KEXA 4GUBA 2XYNA 5CS6A 1R0EA 3NW6A 1OBDA 4GKHA 4S33A 3BYSA 2GTNA 2F9GA 3DJ5A 2HCKA 1R78A 4KRDA 5KMJA 5K4IA 5CQUA 4ZK5A 4BHZA 4M97A 3G6GA 5IDNA 5CSVA 3AQVA 5HBHA 3BV2A 2B54A 3BYMA 2BAKA 4IM2A 5AX3A 3LCDA 1JNKA 2P55A 4Y5HA 3ULZA 3ZUVA 5IEXA 1KE8A 1PXMA 2BIKB 2W99B 4O0WA 4K8AA 4X3FB 3UNJA 4KIKA 4FTMA 4YTCA 4GK4A 5HHWA 5K0XA 2PMNX 2CNVA 1ZRZA 4M69A 1QPJA 4BCQA 2NNWB 3MTFA 5EM7A 2BCJA 3GFWA 1FQ1B 3F6XA 2B9HA 2XZSA 3VJOA 3EQCA 4FTCA 4LOPA 2QOIA 4IZYA 3W1FA 2PZRA 2V22A 1PXOA 2PK9A 2OJ9A 2ZJWA 2I7QA 3PE2A 3KMMA 3PP1A 4NYEA 4R3PA 4BRXA 4QMTA 2QC6A 3DNDA 5AP6A 2W1CA 2XK7A 4BDHA 5GIPE 2GS7A 1REKA 3LZBA 3TWJA 2VNYA 1H0WA 2R0UA 3BYOA 3WARA 4RA5A 2OLCA 2OJFE 1YI4A 3S3IA 4OTQA 1Q3WA 4DN5A 3MIYA 4GMYA 1RW8A 2YZLA 4KABA 1YXTA 3EN4A 4R5SA 2VGOA 3D4QA 4OBQA 2WTCA 5LWMA 3UIUA 3ALNA 3CGOA 3K3JA 2W4KA 3W16A 4CCBA 3UYSA 4AZVA 4KKEA 3ZC5A 2YJRA 3G0FA 1YQJA 4IZ7A 1UVRA 4CTCA 1SNXA 3RKBA 3HMNA 4XMOA 4KKHA 2VTRA 3B2TA 2I40A 3LJ2A 5AAEA 3KKVA 4FV0A 4HGEA 3WBLA 2EB2A 5DRBA 1H0VA 3VUTA 3ODYX 3KA0A 4TPTA 1VLRA 3UVRA 2AYPA 5IMEA 2I0EA 4S34A 2X1NA 4E8AA 5GZ8A 4L7FA 4M8TA 4PRJA 4YZNA 3W18A 4JJRA 3QHRA 5JQ5A 4IX5A 3EL8A 1TQPA 3R7VA 3VRYA 3SKCA 1FINA 4FKLA 4JAIA 1CSNA 3F2NA 4MD8E 2WTJA 4FTJA 4MUQA 4W8EA 3BGPA 3EOCA 2ITTA 3HMMA 4MNEB 3WI6A 2BTSA 2IJMA 5KE0A 5CSXA 5DR6A 1YOMA 4L45A 5L6WL 4EZ5A 3UOJA 2WTIA 3AGMA 4M3QA 2XBJA 2X9EA 5JZNA 4ZLZA 3GT8A 4H3QA 2H9VA 3VF9A 2HXLA 2WNTA 3WF7A 3PP0A 5JFXA 3BV3A 4EYMA 1MQBA 1XO2B 2XIXA 2FA2A 2XKCA 2ONLA 3GBZA 1JKLA 2B55A 3JUHA 3PXZA 5BUJA 3SW7A 3PUFC 2GS2A 4BDGA 2GNLA 4EH5A 2X0OA 2JBOA 2OF4A 4IQ6A 3AC2A 2PHKA 5HO7A 5FEQA 2IW8A 3QLGA 2ESMA 2OH4A 3AT2A 3CBLA 4OTPA 1YDTE 2X4ZA 3KMUA 2RG6A 3OS3A 3VS2A 5HG7A 2OG8A 3KRXA 3MFTA 3F3WA 4IX3A 2W5HA 3P9JA 3C50A 3MPTA 4O4BB 3OVVA 2OH0E 3JY9A 4A06A 5EQPA 1T46A 5HD7A 1SVEA 2UW4A 3PZEA 5IG1A 1QPDA 5GHVA 3CQUA 2W1GA 3EZRA 4IAIA 2EXCX 3H9RA 3NWWA 3AT3A 3NUYA 1FVTA 3JY0A 2DQ7X 4CT2A 2GU8A 1PW2A 3TUBA 2PL0A 3NDMA 3U8WA 2B7AA 3P7BA 4XG7A 4EH9A 5FXQA 1JSUA 4EOQA 4OAUC 4RGJA 4FBXA 2YZAA 3MA3A 4QMPA 3ZFMA 4CFUA 4MWHA 3AXWA 3N4UA 1ZY5A 2ZDUA 5E90A 3SD0A 4YO6A 4S32A 5AFVA 3RWQA 1ZYJA 2O3PA 4X2GA 4FIGA 3R8VA 1IA9A 3ET7A 4FK3A 3RM6A 1ST4A 1YHVA 5FTOA 5J9YA 4IVAA 4RVTA 3TNWA 3UC3A 5BV3A 1M2PA 3Q3BA 4FIIA 5C9CA 4D4VA 1XH4A 4GJ2A 2EVAA 4HPUE 4RIYA 4P90A 1OZ1A 3LMGA 4W4YA 3F61A 3OFMA 2X2KA 4RJ8A 2FSMX 2JD5A 4IANA 4M0YA 5IQEA 4EHZA 2XIYA 3NZ0A 5E91A 3DJ6A 1CDKA 3GI3A 2C6KA 2WHBA 2R3GA 4FV3A 4H58A 3PG1A 4AXAA 4FEVA 1BUHA 4AXFA 5LVPA 4HYUA 2XRWA 3DQWA 5HBEA 4D1SA 5KHXA 4EHGA 3U4WA 2E9OA 3C9WA 3EQPA 4I21A 2BUJA 2IO6A 4W9WA 5A6NA 5DNRA 5LXMA 5IEVA 2J0MB 2VD5A 3O8UA 4I41A 4UB7A 2OSCA 5B2KA 3DTCA 4NWMA 5HX6A 2CSNA 3VN9A 5J95A 3CIKA 4FTOA 4YZDA 2YIWA 4KRCA 2XUUA 2Y7JA 3FZTA 2UZBA 3MVLA 4JBQA 2CGWA 3F2AA 1KE6A 2R3FA 4BDFA 3ZTXA 4UWCA 2XEYA 4EWHA 3ZFYA 3F69A 1A06A 5AIKA 3E3BX 4KS8A 1UU8A 2WPAA 3E7VA 4JQ7A 2WMBA 4ZJJA 3ULIA 4FT3A 3V6SA 2ZV8A 3TNPC 2XA4A 3VUGA 4CNHA 2HAKA 2WMTA 4YC8A 4FT5A 3FXZA 3OROA 3QUPA 2BAJA 1H25A 1GIJA 3PG3A 1A48A 3W2SA 1AGWA 1VYWA 3MH0A 4XHKB 2LAVA 3QZHA 3TTIA 2OBJA 1ZMWA 4IB3A 4ASZA 5L2TA 4Y95A 3UQCA 3BGZA 4FNXA 2W17A 4C59A 4MK0A 3UMXA 3C4EA 3Q4UA 5GZAA 2UZEA 2UZVA 3MIAA 1K3AA 1BLXA 2GCDA 4KBAA 4NIFB 4Z9LA 4FODA 4FOCA 4AWIA 3L8SA 1L8TA 2WD1A 4KAOA 4KNBA 4HVGA 1ZXEA 3AMBA 4MXZA 3C4CA 3UZRA 3QRKA 5F95A 3DS6A 5EOBA 4BDIA 4RVMA 1XH6A 3MVMA 2QU5A 2VTMA 3R04A 2GSFA 2XBAA 3QX4A 3P0MA 4YNEA 1S9JA 3SW4A 3I6UA 3ZO2A 4WNKA 4EOKA 3OY1A 3T3VA 3ZS5A 4YJPA 4X3FA 2NPQA 3ZLYA 4DEIA 5CVGA 4TT7A 3DQXA 5HNBA 4F9WA 4CGAA 1BL6A 2F2UA 3C4WA 3FAAA 5A4EA 5DR2A 2HW7A 3NNXA 3QRJA 4HCUA 4XYFA 2PMOX 3ZZWA 2XALA 3JPVA 5FTQA 2W5AA 1PXPA 5L2QA 4S2ZA 2Z60A 3AKKA 3D9VA 4O7LA 2PVRA 2F7XE 4HJOA 3QRTA 3SLSA 3RINA 3NUAA 3MJ1A 4QDVA 4F0GA 4HYHA 1JAMA 5EQYA 2V0DA 1HCLA 2A98A 1YWNA 2PMIA 4LGDA 4DH7A 2C3KA 4E93A 4LM5A 3WZEA 1SYKA 5CSWA 2Z7QA 5JK3A 5BMMA 5CAPA 4C7TA 4FA2A 5AAGA 3QKMA 4O2ZA 1RDQE 1F3MC 3WE8A 3DKOA 3HRCA 2I0VA 4EOLA 1STCE 5CNNA 1Q8ZA 4UYNA 4X6RA 2IF8A 4U45A 5AP3A 4B99A 5DIAA 2C6OA 5GIOE 4I0TA 1H1QA 3ZRKA 3HLLA 3CPBA 2H34A 2VWXA 5E8WA 3WZDA 4B8MA 1ZAOA 3A60A 4E4XA 3MN3A 1NT2A 1ZY4A 4DLIA 2P2IA 4YBKA 2GNGA 2VRXA 1W0XC 4JG7A 4MQ2A 4ZSAA 5EW3A 4IADA 2ZDTA 3G9LX 4ZLOA 4E6DA 5LVLA 5E8VA 5HBJA 3QX2A 4E5BA 2J0IA 1W82A 2UUEA 4R7HA 5HCYA 5L3AA 4L52A 2IPXA 3KIOC 4CRSA 4A7CA 4IAZA 4Y73A 2B4SB 4CSVA 4IB5A 3VBVA 2PWLA 4O7VA 5A54A 3MVJA 4D2VA 4MNEA 1WMKA 2PY3A 3R1SA 5CF6A 5KZ0A 3U54A 3ZMMA 3FUPA 5A9UA 2J2IB 4ONAA 4V01A 1XH9A 2YERA 2BZJA 2A1AB 3MBLA 4RWJA 4FR4A 3V5LA 4E3CA 2HYYA 3SV0A 3QLFA 3DB6A 5EHLA 2ZVAA 4KBCA 2QI8A 4FL1A 4O6LA 2C6LA 3E8CA 4IBMA 4JR7A 3NCGA 3ZYAA 4F65A 4PL5A 2GQSA 2QOQA 4APPA 5H3QA 3KMWA 4ZSGA 5EKNA 4E26A 4I3ZA 3BI6A 2PVFA 2YWPA 3Q4CA 3QF9A 1DS5A 3HRBA 2QOKA 2Y4IB 4GT5A 2R2PA 3OWLA 4C37A 2QO2A 4BYJA 3PIYA 2YFXA 3QXPA 4OT5A 3RAHA 3TT0A 1UWJA 1DI8A 1Q8YA 1WBVA 3FQHA 1UKHA 1NY3A 4LFIA 4O0YA 3A99A 3AMAA 4K6ZA 3V04A 4NM0A 4TWPA 3W0SA 3W2OA 1PXJA 4TYIA 3FI4A 3PSBA 4OTRA 3DV3A 4CEGA 4EEVA 1FVRA 3QD0A 3TEIA 4PL3A 3DXPA 4ZY6A 4N4SA 5IH6A 1WVXA 1PMUA 2BR1A 2HY0A 2JIVA 4P4CA 4ZY5A 5LMBA 3MFSA 3ZSIA 1NVRA 4YTIA 2WEIA 4LL5A 1YDRE 2JC6A 5D10A 5FDXA 3RM7A 3TZ7A 3Q9ZA 4CMUA 1IAHA 1JKTA 5JGDA 2OGVA 3QTXA 2CN5A 3ZO3A 3FKLA 1O6YA 4NH1A 4M14A 3VQHA 3N51A 4GSBA 5K0KA 1R3CA 1U59A 3LXNA 5TO8A 1WCCA 4UMTA 3VS3A 3HV3A 5EKOA 4AE9A 2VNWA 3NLBA 4XOYA 5L6OA 3EJ1A 4L3PA 4WKQA 3PTGA 4AW5A 3FMMA 4OW8A 3LFDA 4QPSA 2PVMA 4UBAA 1GZOA 2C5VA 4NW5A 3I7CA 4OTIA 3ORXA 5AP4A 2A27A 1J7UA 3Q9XA 5AP2A 3FSFA 4CG9A 3DBEA 4N0SA 3MH1A 3FQSA 2QOOA 3NUXA 4F6WA 4BHNA 3UIBA 4F63A 3W0PA 3O8PA 3VULA 4G6NA 3P1AA 2C5YA 2RIOA 3LCOA 1PXNA 4EH8A 2YN8A 2QQ7A 4JNWA 5A4QA 3AD5A 3N4VA 4GU9A 1M17A 5FLFA 4FSMA 3LFAA 4UV0A 1W98A 4R3RA 5LMKC 4HNIA 5EW9A 4D2WA 3FMDA 1QL6A 3F7WA 3BX5A 3FBVA 3ZXTA 3HDMA 4D0WA 3MPAA 4U8ZA 4GJ3A 4HW7A 1VR2A 2JFLA 3TZMA 4Z16A 4E20A 3GU6A 3MVHA 4I5PA 5IDPA 5CU6A 4GV1A 3HECA 1Q41A 3I60A 5GJGA 3ORIA 1OGUA 5CYIA 4RWKA 4YNOA 4DDIA 1YHWA 3WIGA 3TJDA 1O6LA 4YJVA 3TDVA 3QTWA 4IJ9A 1URWA 5I9UA 4U79A 3GCSA 2OIDA 2C69A 5EYKA 5HVYA 2XAMA 4HVIA 2ERKA 4WD5A 3COHA 4DFNA 3TKUA 1R0PA 3VHEA 3KB7A 5L8JA 4XBUA 4OUCA 3CJFA 4BCKA 1W83A 3Q9YA 4M68A 4FL3A 4AOTA 3B2WA 3LFFA 4FEUA 3Q2JA 3TDWA 1XH7A 2GS6A 4BWXA 4EORA 2ETMA 5A3XA 2XNMA 3QL8A 1SMHA 4AW1A 3QA8A 4TL0A 4PP7A 2CJMA 3OD6X 5EFQA 4NSTA 5A14A 4IDVA 3V8SA 4WSYA 5DT0A 5LOHA 3PA3A 4V04A 3BE2A 3HAMA 2BPMA 4JL9A 2HXQA 5FRIA 4YTHA 4R7BA 2BRHA 3A8XA 3M1SA 4KBKA 3IGOA 4QYHA 3QTZA 2JKOA 3R01A 2F57A 5J1VA 3E62A 1YVJA 5EI8A 5KMIA 4F9AA 2BKZA 3KCKA 4MVFA 3TKIA 3VBXA 2X7GA 5LVOA 4O0XA 2YM4A 4O7WA 2X8DA 4AGCA 4M13A 1Q61A 4AG8A 3DKGA 3TV4A 2J4ZA 4UMPA 1Q8UA 2XK6A 2BRMA 4BB4A 4IAYA 2IZUA 3GC8A 3ZCLA 3MGYA 5DRDA 5AA9A 4NIFA 2VTNA 2FSLX 3CY3A 5DYJA 4ZSEA 3DKFA 1J1CA 5EHYA 5CXZA 2R7BA 2B53A 5LARA 3FLNC 2BHHA 4MF0A 3DFCB 1O6KA 3GOKA 4QEBA 2VWIA 2IZSA 1Z9XA 3QRIA 5DGZA 2BILB 3PJ1A 3P86A 4I6FA 2VTOA 4HVHA 3TCPA 5J8IA 4O38A 4FKIA 5A4LA 4BFMA 4G16A 4IIRA 4C3FA 2G2IA 5LMAA 3PXQA 5FXSA 4AXEA 5B0XA 4O0UA 1JKKA 4MX9A 3BHTA 1Q4LA 2YDKA 3PRFA 4RIXB 2PULA 2OXXA 4QYGA 4UN0C 1XQZA 4J8NA 3NMUF 4IMYA 3HV5A 3ZEWA 4DEHA 3MPMA 3SXFA 5C4LA 2C68A 3R0TA 4Y83A 4B0GA 2WIHA 4ERKA 4EL9A 3ZDIA 5HE1A 4DEDA 1VYZA 2VTJA 3BL7A 2CMWA 2HY81 4OTFA 2C3LA 3C1XA 4PMMA 4FG8A 4ENYA 1XBBA 3A7HA 5I9YA 5ETAA 3QWKA 4C57A 4JS8A 2ITUA 4QMSA 3F5XA 4D0XA 2PSQA 3DAEA 5GJFA 2PVNA 3QAME 4FE2A 3VS1A 4DG2E 3UQFA 5FUTA 3I81A 4FKPA 3TACA 3V5JA 2R3PA 4DTAA 3MWUA 4U41A 3ZU7A 2X7OA 1OBGA 4YJUA 1ZYSA 5CZHA 2YWVA 4CFNA 4LI5A 4B7TA 1MRYA 4AFEA 3HZTA 3PY1A 2UVZA 5LQFA 4D4YA 3D5WA 3FHIA 5CNOA 4FYNA 2UW3A 2F4JA 4ZTLA 4AZFA 3F88A 3OT8A 4CKIA 3U6HA 1PHKA 3W0OA 2LGCA 2VWYA 2UZOA 1YXVA 3QGWA 4DHFA 5K9IA 4BBEA 4YPSA 1FOTA 4EK6A 4F1MA 5BVEA 2OK1A 2VGPA 3AT4A 5AX9A 3ZUTA 4DEEA 4RX5A 3KU2A 2YM3A 4YJNA 4OT6A 4AE6A 4YZ9A 4U44A 1OUKA 4A4LA 1B38A 4FKRA 5CXHA 4ZXTA 5HQ0A 1U46A 2HIWA 3H3CA 3FMEA 3QTSA 4Q9SA 4QTAA 1ZMUA 4UALA 3S95A 3AGLA 2VAGA 5T68A 5BVKA 5HCZA 3OG7A 3VF8A 1OIRA 3FI3A 4KINA 2C30A 4EONA 3R7EA 3HV6A 4KSPA 1QMZA 1WVYA 5CSHA 4F9CA 1APME 5ETCA 3SA0A 3TYKA 2XYUA 5BVWA 5IISA 1XMMA 3FV8A 2WOTA 5HG8A 3W0QA 3O50A 3OOGA 3GEQA 2BRBA 4FTRA 5M57A 3NVKI 3G5DA 1GAGA 4O4DA 2YM5A 5AR2A 4FKTA 5KBRA 4CKRA 3HV7A 5IA0A 4QRCA 2Z2WA 3FC2A 4E4NA 3DK3A 2RG5A 4FVRA 4I92A 1RQQA 4RJ6A 4WBOA 3BCEA 2X8IA 4J95A 4YHTA 5BMSA 3JVSA 4GYIA 4WG3A 3QQFA 5CZIA 3NVMB 3I0QA 5IUGA 4I0SA 2VN9A 3FY0A 3QCXA 4AQKA 5AUZA 2OI4X 4XEYA 1Q99A 4FK6A 3AKJA 5HGIA 4O4EA 3PIXA 5FM2A 3RCDA 4RFMA 3FY2A 4QP9A 1ZOEA 2GNFA 5JEBA 5CY3A 3VW6A 5I9WA 3F5GA 5D41A 2JIIA 3W10A 3F5UA 2X0PA 3OUNB 3LXKA 1PKDA 4HNFA 4DBXA 4YO4A 3CR0A 4AN9A 5A6OA 4U97A 3RGFA 4NM3A 2FVDA 4JX3A 3EN9A 4C4GA 3OOMA 4QMWA 3MS9A 1ZLTA 3VIDA 4FOBA 2J5FA 3Q2MA 2CKEA 2YM7A 1SVHA 4YJTA 3A4PA 3QTRA 1ST0A 3S2PA 3D5XA 3QGYA 1NA7A 3A7JA 3FMKA 5D12A 5DI1A 3WIKA 4DH1A 4FJVA 4RSSA 3W8QA 3HMPA 4JR3A 3GC7A 2NRUA 5CASA 4U3ZA 5C01A 5KX8A 3VUKA 3SOCA 4WOVA 4XP2A 4RC2A 3BWJA 5IQIA 4RJ5A 3UPXA 4EQCA 3FLWA 2IVUA 2YHVA 5ANEA 3BWFA 1DM2A 4GRBA 3MY0A 2BDWA 5BUEA 1I09A 5ACBC 4CTBA 4F4PA 5IQBA 3R21A 4AGUA 4NJ3A 5IA1A 3ZUUA 4R1VA 3EYHA 5JGAA 5E4HA 4C58A 3ROYA 4ACDA 2C3JA 4YJRA 1OMWA 2UZDA 4FV9A 4QMZA 4LOOA 2JDTA 3DA6A 3D83A 4X2KA 3ZLXA 4FNYA 4GK3A 1YXUA 4KWPA 3BQCA 4LRJA 4XG3A 4L53A 4C4JA 4CYIA 5AV0A 4ZZNA 3RNIA 4FSRA 3RAWA 2CKPA 3ORLA 3V5QA 4G1WA 4XV2A 3R7IA 4IB1A 2QG5A 3M2WA 4U0IA 2XM9A 2PVYA 1KE5A 1Q62A 5LJJA 2BAQA 4X0MA 3MDYA 5FQDC 3VS4A 2XAOA 4ZY4A 3EQRA 3VBYA 4D2TA 3F3UA 3L8VA 4IAAA 2A0CX 5C8KA 3QCYA 4MNFA 2F7ZE 3TN8A 2PZYA 4UWYA 4A9SA 2HZNA 4AW2A 4ZLYA 5KMKA 1ZYCA 4X21A 2YCSA 4U9AA 3TG1A 4F7SA 4IW0A 4RVKA 2Z7RA 2C6EA 3O23A 4YJOA 2R7IA 4LRMA 2YA9A 4PP9A 5ANKA 1XKKA 3UOKA 3W2CA 3C7QA 3A62A 4IWPA 4BDDA 1TZDA 3PLAE 2VV9A 1GZKA 4XP0A 3ORZA 4OAVB 2HZIA 1WBOA 4MTAA 4BCIA 3F3ZA 3BZ3A 2QLUA 1OIQA 1YHSA 3QD3A 4PDSA 5CEPA 2C0OA 1K2PA 1PYEA 3OWKA 2WU6A 4QP4A 2CKOA 4RMZA 2WTDA 4FKOA 2YDJA 2V55A 3HA8A 5FDPA 4PMPA 2IVSA 4EKLA 1J7IA 2WMUA 4FGRA 4XG6A 4AXDA 4D1XA 5AJQA 4CFMA 1J3HA 2W1EA 3Q60A 4ITJA 3ATSA 1XR1A 2FGIA 2QKRA 5DR9A 2GNJA 1WFCA 3VHKA 3GXLA 4NU1A 5CAQA 1MQ4A 2YACA 2R3LA 4K2RA 2WB8A 4GK2A 4USDA 3O7LB 3NW7A 4TYHB 5ANGA 4DITA 5HTCA 3CGFA 2XRUA 4AN2A 3MB7A 1M14A 3IK3A 3S1HA 3QZFA 4O2PA 3RTPA 1ZZLA 3ANQA 4Q5EA 2ZB0A 2J50A 3ENHA 4RIXA 3SVVA 2EXMA 4CRLA 3O51A 3R73A 3LQ8A 2UW9A 2O65A 5HTBA 4IB0A 1MRVA 2O0UA 4CFWA 1OPKA 2GPHA 3PY0A 4PMSA 1XBAA 1PF8A 3HRFA 1U4DA 3NR9A 3WF5A 3PPJA 2GTMA 3BLQA 4EOIA 3GOPA 3LXPA 1AQ1A 2BZKB 3IDPA 3A61A 2GDOA 3QRUA 4MEDA 5HG5A 3QQUA 4OR5A 4HVDA 3LVPA 4QP6A 4YZCA 4BTFA 4UYAA 3RPSA 2RSVA 2O8YA 3PVUA 4RLLA 2QODA 3QHWA 3TIZA 3GU5A 2R3HA 4OTDA 2IVVA 4NK9A 2G01A 1JVPP 2ITQA 4XV1A 3KN6A 4FTLA 4FZ6A 5IH4A 4ZS4A 1H1PA 2Y8OA 2QR7A 4IZ5A 4JXFA 4MXXA 4NW6A 2C6TA 3OBGA 5AM6A 4DFXE 5BYYA 3L9MA 3PJ3A 5EYCA 4WRSA 1YWVA 2CDZA 3C5UA 3VS0A 2O64A 1PMNA 4PDPA 4YHFA 2F2CB 4QTDA 3VS5A 2QO7A 4TN6A 4WG4A 3UIXA 3BE9A 4O83A 2PTKA 3G6HA 2OWBA 3PUPA 4Q2AA 4L42A 1M2QA 3DDPA 4FMQA 1MRUA 4AA0A 5E7RA 3KY2A 2AUHA 2XK4A 3I0OA 4P5ZA 4QT1A 3RWPA 3LFQA 3EFJA 3KXHA 2G1TA 2XCHA 5C26A 2UZNA 2WMWA 5A4CA 4A9RA 5GJDA 1H1SA 5LMKA 3LFBA 2OO8X 3DKCA 2XNGA 4I23A 4WIHA 4ACCA 2AQXA 3D15A 4U42A 2V7AA 4Z7HA 3I5NA 4JBPA 1YI3A 3L8XA 3BU5A 3R71A 4IAFA 3BHHA 4C3RA 2GQGA 3RP9A 4UXLA 4ZTNA 4BCHA 1URCA 3FZRA 2ITNA 1YXSA 3IW4A 4BWPA 4IX6A 4APCA 4JI9A 3GFEA 3GGFA 3CS9A 5AMNA 1H27A 3E3PA 4PQNA 4PNKA 3O5AA 3RNYA 4N6YA 3W0RA 2W9ZB 5AP0A 4BWKA 2BMCA 4AW0A 5IH5A 5CAVA 3ZXZA 5GNKA 3FLSA 4O1PA 3UDBA 2XKEA 4AZEA 2WMSA 3NFGB 3VW8A 2BRNA 3DBCA 4BIBA 5KMOA 1CMKE 4RJ4A 4QDEA 3FMHA 3WILA 1H1WA 2VTHA 3LLAA 3FPMA 4WNOA 4FX3A 3G90X 3UE4A 3OCGA 5L8LA 4CZUA 2WIPA 1Y8GA 5IZFA 4FSZA 3HNGA 4PPCA 4IVCA 4RFYA 4MKCA 4JLCA 4PPBA 4II5A 3MJ2A 2X4FA 4RWIA 5T3QA 3Q4TA 4O7SA 2H96A 3PVGA 4IDTA 5CVFA 1GIHA 4IWDA 3EZVA 4GW8A 1BI8A 4GCJA 3ETAA 4C0TA 4F09A 4NTTA 2JBPA 2OU7A 4FG7A 4FKJA 3QQLA 4C02A 3UOLA 4H05A 2C6MA 5ETFA 2Y4PA 4XBRA 3ALOA 2IZTA 2OJGA 3DAKA 3DFAA 3QQGA 3VBTA 4FV5A 5EQEA 1NW1A 2ITOA 4PDYA 5IA3A 5IQFA 4IH8A 3EQIA 4ANLA 1OPLA 5I3RA