2QVSE

Crystal structure of type iia holoenzyme of camp-dependent protein kinase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
338
structure length
323
Chain Sequence
ESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase regulator
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title PKA type IIalpha holoenzyme reveals a combinatorial strategy for isoform diversity.
pubmed doi rcsb
source organism Mus musculus
total genus 87
structure length 323
sequence length 338
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qvsE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qvsE02
4LMNA 4O27B 4PMSA 3NW6A 3BV2A 3OROA 5ANKA 1OIUA 3W8QA 1TVOA 4MD7E 2HWPA 4OTQA 5LWNA 2XK7A 4TXCA 5AP2A 3OHTA 5HG7A 1H08A 4FZAB 4M69A 3NUYA 3QQKA 4CD0A 3E3BX 3SGCA 2AUHA 3LXNA 2R3IA 2VTNA 4RVLA 3VBYA 3LZBA 4Y83A 5IUHA 2JDRA 1U59A 3IGGA 3G9NA 5CSHA 3ZRLA 2HENA 2ITNA 1PRYA 4K11A 4Z55A 3D94A 3CQEA 3BELA 2X8EA 3DS6A 4YZCA 3VUHA 2WMRA 4EOQA 3FZRA 5A46A 2C3IB 4IAZA 4O82A 1LEZA 2BROA 2ZM1A 4FV6A 4FTMA 4DGOA 5M57A 4OTPA 2OJJA 3QBNA 3ZRMA 4BI0A 3SLSA 3K3JA 3F61A 4AAAA 4ZAUA 2QOHA 2UZOA 4PDYA 3DV3A 4L8MA 4C36A 2OGVA 3PJ3A 5LARA 4CGAA 3K3IA 2LAVA 4CV8A 2R7BA 2PMIA 3FMDA 3MY0A 4R5YA 4Y73A 3E8CA 3LFSA 5KMKA 2JLDA 3S2PA 3WZKA 1CSNA 2ZB0A 3C0GA 2QC6A 4KS8A 3TDVA 3HUCA 2C4GA 1PXLA 4I94A 4OW8A 2JEDA 3BGQA 4WO5A 5JGAA 1W8CA 1CDKA 2WTCA 5HGIA 5BQ0A 4M84A 4MNEA 3FMJA 3KMMA 4FKRA 1XJDA 1YHWA 3NMUF 2Y4PA 5CAPA 3FQHA 3R71A 2P2HA 3NYVA 3DLZA 4DG0E 1IRKA 4NKAA 4WIHA 3GI3A 2WZJA 4GFGA 3U4WA 2WAJA 5EOBA 2IVVA 5HBJA 4DEDA 4AF3A 4DEGA 3UGCA 4E6QA 4S34A 4O84A 2G01A 2JDVA 2YDKA 3FMNA 3HV5A 3OXIA 3SHEA 4EOMA 2OSCA 3QX4A 4G16A 5FLFA 4LL5A 3R01A 3A8XA 4PMPA 4PRJA 3D4QA 3KGAA 4GKHA 2WTKC 3ZUUA 1YRPA 4C0TA 1REJA 5KX8A 2EB2A 2XB7A 2VWIA 1IAHA 4ANSA 2NPQA 3MY5A 3OT8A 3LCDA 4FSYA 3P1AA 4LRMA 3ZO3A 3LCKA 4EH4A 4XHKB 2R5TA 3VJNA 4U40A 2XJ0A 3ORKA 4C38A 4Y5QA 5DLSA 5CEPA 5FDXA 5DFPA 3FKLA 2YM8A 3F69A 2JFMA 2VWZA 3GOKA 3R7GA 4RQVA 5HO6A 1H8FA 2PVHA 3GB2A 4WG3A 3ZZEA 4B8LA 4DH3A 4L00A 3LJ0A 4KAOA 3SOAA 1KSWA 2YAKA 3D5WA 1RE8A 4BF2A 3KVXA 4QP9A 1MRUA 2WTWA 2GS7A 5LCKA 3ZFMA 4FKSA 4BIBA 3QD3A 4AS0A 4TPTA 4AT5A 3V5QA 2DWBA 5ETFA 1JSTA 5D7AA 5TOZA 5EOLA 2XIKA 4FTOA 3SD0A 1JAMA 4NWMA 4BDHA 4WSQA 3ZLSA 4BDJA 5CASA 5HO7A 4MKCA 4DFYA 4DG2E 5JH6A 5KMLA 5IQHA 3C5UA 5KMOA 5C8NA 1YXXA 4ANNA 5CANA 3KREA 3TI1A 4PUZA 2QU5A 5HZNA 3B8RA 3ERKA 4PPCA 1URCA 4RWKA 2R3RA 5EKNA 5HU3A 4K33A 5DT4A 3F7ZA 2RF9A 1LEWA 4YNOA 2ZOQA 4FGBA 3PLAE 3UNKA 2YA9A 2B9FA 4GT3A 1ZLTA 2F57A 4IAFA 4QPMA 4RIOA 4K1BA 4G3DA 2GNHA 4U6RA 3RCJA 4DC2A 4DTKA 3SW7A 4EHZA 4UYNA 1WZYA 3BEGA 3OCGA 4ID7A 5IEYA 5M56A 1Q4LA 4DEEA 3R0TA 4TW9A 5CVGA 4EOIA 1PKDA 4QMTA 3UVQA 4F70A 1KE5A 3MVMA 2RG5A 3ZM9A 5IQFA 4FE2A 3WYXA 4XYFA 3EFKA 3R02A 3CJFA 4JQ8A 4ZSJA 5BPYA 4ITJA 3TNWA 3ZUVA 5J87A 2WU7A 4NIFB 4BDIA 2O5KA 2R2PA 3FKNA 4P7EA 3TV4A 3Q4CA 3PVUA 4E1ZA 4DITA 5BYZA 3HGKA 4C58A 4FSNA 3OCTA 3R7OA 2VO6A 4IAYA 5IEVA 2SRCA 3E5AA 2Y6MA 3FZPA 3LXLA 3QTUA 3CY2A 1BI8A 3FSFA 4G9RA 4UY9A 4XNEA 4FSZA 5LMAA 4QMXA 4OBPA 5EQYA 4OLIA 4L6QA 4E6DA 3SX9A 2FUMA 3VBTA 4ZLYA 5BUJA 4O2PA 4AGDA 4IX6A 2KTYA 4FX3A 5K9IA 5F95A 2XH5A 5E1SA 5AP6A 2DQ7X 3VS3A 5KBRA 3R7UA 4LRKA 3D7ZA 3OF0A 4JXFA 5FEDA 4FOCA 2IVUA 3C4EA 2WMTA 3C7QA 4IB5A 5DI1A 4UX9A 3KC3A 2OIDA 2YDIA 3PSBA 3WF8A 5EM8A 3RP9A 3A7GA 2GPHA 4TYHA 3U51A 3BHYA 1B39A 3BHHA 4ZTRA 4RPVA 4QYFA 2BRNA 3VF9A 4F0FA 1V0BA 4LG4A 3ZYAA 4I1ZA 3LPBA 3R21A 4H39A 4I5HA 4E5WA 1PYXA 3GQLA 3KCFA 4BDDA 5AUTA 5CF5A 2CPKE 5IUIA 4UEUA 4GFMA 1WBOA 5DR6A 4FIJA 2BIYA 4QNAA 3QFVA 2OFVA 4E6AA 2ITZA 1J7LA 4IVDA 4BN1A 4FL2A 1Q62A 4FV7A 4FUXA 5AUXA 2O2UA 3FC1X 4QTEA 3U8WA 3OEZA 4EJ7A 5EDPA 5K5NA 5ANIA 3QZFA 2YABA 4MEDA 3RKBA 3PY1A 4DTAA 1Q8YA 3E7OA 4RIYA 3U6HA 2E2BA 4XG4A 2JC6A 3EYHA 3WBLA 5HLNA 4FEQA 4KS7A 4D1SA 3FKOA 2P55A 1Q8WA 4B7TA 4F7NA 2DYLA 4GIHA 3I81A 3SXSA 3AD6A 4AZEA 3OW3A 5FEQA 1PMEA 2V7OA 3FPMA 3PA4A 4FZFB 1XH5A 3PE1A 4CKIA 4QP2A 4RGJA 3TWJA 3QTSA 1XBCA 5FM2A 5HTIA 2PYWA 5B0XA 2OJFE 5L8LA 4DCAA 4RQKA 4L68A 3FL4A 1I09A 4CT1A 4EOLA 2OFUA 4QMWA 5FTGA 2WOUA 4N6YA 4DLIA 4JAIA 3H10A 5IKWA 4HVIA 4CVAA 2CKQA 1J1BA 3FZSA 5DHJA 3MW1A 2X39A 2HXLA 3QC9A 5DRBA 2HY81 1CKJA 4BCQA 3RK9A 4FBXA 2JGZA 3MH1A 4NW5A 2CHLA 1XBAA 5EQEA 4XMOA 4B6LA 2YCSA 3HA8A 4DBNA 3VS1A 3Q5IA 3F5PA 3EOCA 3MVHA 3PYYA 4YJQA 3UO5A 3Q4TA 3VUDA 3VHEA 2QG7A 3G6GA 2W4OA 2YM7A 3LAUA 4RSSA 2C1BA 2NP8A 5CYIA 4O7LA 1DI9A 5CF4A 1PXOA 1CKPA 4IX4A 4Z7GA 4FOBA 1SM2A 2XYNA 4L44A 3FLSA 2R3PA 5L8KA 1FBNA 4MX9A 5A6NA 1TKIA 2I1MA 3QTWA 4BDBA 3RAWA 3QUEA 5AV4A 2J50A 1FMKA 3SKCA 4Y8DA 5CZHA 2QO2A 3MTFA 2I0VA 4AZSA 3MIYA 4X2NA 3FI8A 2C0TA 4A07A 2W05A 4G3FA 1Q41A 2OXYA 2PMNX 2Z8CA 4FL3A 1KV2A 3D5UA 4DLJA 4IB1A 4RWIA 4Y72A 2XP2A 3PWDA 1JVPP 4FIEA 4JR3A 4I23A 4QMZA 5AR8A 4ZJVA 4LFIA 3T3UA 2XS0A 3FL5A 4EHEA 3QHWA 3IS5A 3P9JA 2C3KA 5BUEA 3GT8A 3QCQA 3FZTA 2JKQA 2CLQA 2EXMA 2JAMA 2W5AA 1BMKA 2JD5A 3KFAA 5EI6A 2VTRA 4AN9A 4ANBA 3OWPA 2F9GA 4CZTA 3GC8A 1QPJA 5EG3A 3TJCA 3ULIA 4A4XA 3ZC6A 4F9BA 4LGDA 5HOAA 2DS1A 4J98A 3MB6A 4F0IA 2C5NA 3COIA 3W2PA 4E4LA 5KKRB 5BVKA 2YIRA 1JOWB 2E9PA 3GBZA 4WBOA 4AQCA 5ANJA 4EZ5A 3L9MA 3GFWA 4AGCA 1WVXA 3TKIA 4YGAA 4FT7A 5CU0A 5HQ0A 2V22A 4ARKA 2WTVA 3OCSA 4DGNA 3MJ1A 4RIWB 4L53A 1H07A 4X21A 3IQ7A 3R8LA 5K4JA 4KIOA 4EHGA 3AC8A 3CJGA 3QQGA 3FDNA 2ZM3A 4YHJA 2R3GA 4OT6A 4KABA 1QPDA 2ETMA 4B0GA 1XWSA 3AC4A 3ALOA 4QT1A 2EXCX 3CBLA 3Q6WA 4GEOA 4EQCA 3DNDA 3Q96A 5JZJA 3NUNA 3FBVA 3FZ1A 3QQLA 1GY3A 3BBTB 4L9IA 3MV5A 3NNUA 5G1XA 2G2IA 3UOJA 1B38A 1OZ1A 3ZO2A 4FV1A 5CU2A 3HA6A 4EONA 4C59A 2CKPA 4PPBA 3TTIA 3DAJA 3IDCA 5GZ8A 4PDOA 1F5QA 5L2SA 3F88A 4V0GA 1JKKA 2EUFB 5IQBA 4ZSEA 4E8AA 1OPKA 3FQSA 1YXUA 4IADA 5AV0A 3H9RA 3PRIA 4FKLA 2V7AA 3I5NA 4UV0A 4DH1A 4F1TA 4K77A 3IOPA 4QMSA 4RX5A 2O64A 2I0HA 2QOFA 5C27A 3KB7A 3FYJX 5KMNA 1LR4A 3CPBA 1YXTA 3VS0A 3ZSHA 1VEBA 1GIHA 4EH3A 3PJ8A 3DKFA 3R04A 1OUKA 3MN3A 4W9WA 1L8TA 3TEIA 4H1MA 4MTAA 2IZRA 2ERZE 2XRUA 2QG5A 3ODZX 4RFMA 5L4QA 5IQDA 4JBQA 4M68A 5AP0A 3C0HA 5IPJA 5CEIA 2UW3A 3TNHA 1HCLA 4GV1A 4JDIA 2B54A 3OOGA 4Q2AA 3HRCA 5EHOA 3ZH8A 1PMVA 3UO6A 4FF8A 5JFSA 4FTCA 1ZZ2A 2H96A 3R8PA 3HX4A 1XBBA 4I6HA 4I5PA 2Q0BA 4AN2A 5EKOA 2VWWA 2WMAA 4ZZOA 2E9OA 4RFYA 3VULA 3GC9A 3PA5A 4KKGA 2HZ4A 4C2VA 4IB0A 2YM5A 1BYGA 3OBJA 3OG7A 5M4CA 4C33A 2G2HA 4BKJA 4QP1A 4F65A 3VRZA 2E9NA 5C9CA 1HCKA 3HZTA 2IW9A 1ZMWA 3IK3A 5E90A 2X7FA 4EYMA 3NW7A 4L67A 4AWIA 3T8OA 5L6OA 5DOSA 4OTIA 3EHAA 5ACKA 4WG4A 4IAAA 4D55A 1Q8TA 5KBQA 2GFCA 4FEXA 3HMPA 1ZYLA 3LJ1A 4EEVA 3GENA 3JVSA 3D15A 5CNOA 3KQ7A 2W17A 1E1XA 5EW8A 4BCFA 3VIDA 1ZXEA 3ZBFA 2Y0AA 3IW7A 3L8VA 4IDTA 4A9RA 4M69B 2OXXA 3HP5A 5IQAA 2W5HA 2QVSE 3BU5A 3MYGA 4PF4A 4BI2A 3DZQA 4RIXB 2YWVA 3IW4A 4CQEA 3L9NA 2PVLA 4PTEA 5L6PA 2PVKA 1GIIA 4G34A 4K0YA 2YM3A 1PMNA 3EZRA 4QTAA 4GK3A 3RVGA 3P79A 4IWQA 3EZVA 4E73A 3M1SA 4CSVA 3D5XA 5GHVA 4FG8A 2B9IA 5GJFA 3RPRA 5KMIA 3OTVA 3Q4UA 4QP6A 4PY1A 2JFLA 5FXRA 4D2VA 4IWPA 3PPJA 1YHSA 3MY1A 1BX6A 4L7SA 1J1CA 4GMYA 4QPAA 2VTHA 4FTJA 4FT9A 4RJ4A 1CKIA 4X6RA 1H00A 5BYYA 5JFWA 2R9SA 4ZSLA 3T3VA 2ONLC 3CCNA 3QRUA 3LFAA 4XG2A 5TE0A 3PZEA 2ZMCA 4I20A 2BDFA 2GU8A 2R64A 5AIRA 2I40A 2YJSA 3N9XA 2OICA 4AW0A 4F6WA 3Q52A 2XK9A 2F49A 4FUYA 3F5GA 3UZPA 4AA4A 4K18A 3P7AA 1OPLA 4U45A 4B4LA 3OFMA 2HW6A 4NSTA 3GUBA 4PPAA 4C4FA 4DT8A 3ACJA 4FVQA 3V8TA 4IAKA 2Y4IB 3C5IA 3DTCA 4YSJA 2ETKA 3E64A 4JQEA 3QLGA 5CXHA 4FTAA 4Y95A 4AGUA 3GCUA 4IZ7A 4YZMA 2EWAA 3NNVA 3EN5A 4IANA 3TKUA 3TKHA 1FPUA 3QUPA 3PUPA 1W83A 2VWBA 5M55A 3PLSA 4U0IA 4EZ3A 5I5ZA 3IW5A 3HMOA 2CJMA 3QKMA 5IA4A 2F2UA 2HZIA 1SNUA 2UZVA 5DWRA 3ZMMA 2VAGA 3R28A 5E8SA 3QZIA 3GGFA 4GFOA 3IONA 4CTBA 1GJOA 1BL7A 2FO0A 2R3JA 3UOKA 3V51A 3DCVA 4YPSA 1H24A 2XZSA 4XJ0A 3V8WA 1TQPA 4GCJA 4UN0C 3BU3A 4P4CA 1YDTE 2RSVA 4FNZA 5IQGA 3GC0A 3RTPA 2H34A 4DG3E 4MVFA 2BKZA 4QQCA 1SZMA 1EH4A 4BTMA 4YLJA 2OG8A 1QMZA 3BYSA 2QKWB 3PA3A 3A8WA 3SDJA 4L3JA 4U3ZA 4YTIA 5HCZA 1GZ8A 1H1QA 5J95A 3RI1A 3V3VA 1H1RA 4C34A 2W1CA 2JDOA 3D9VA 4X6QC 1WBTA 3W32A 1R1WA 4G6NA 3DY7A 1SVHA 4HYUA 3BYMA 4LGGA 2CKOA 4NL0A 2XJ2A 3II5A 3E93A 4FYNA 2QQ7A 5EH0A 4W4VA 3F9NA 4UZHA 2RKUA 5L3AA 5M4UA 3PJ2A 4LUDA 2CMWA 3QALE 1U54B 5E1EA 5EW3A 3VRYA 3LLAA 3U55A 2PUNA 2UW8A 4QMPA 4EZ7A 5I3RA 1W84A 4OGRA 3EN7A 2BZJA 2C69A 2XNEA 4G3GA 3WIKA 3FLNC 1TQIA 2C3JA 4ZJJA 3EQPA 2QOOA 2VTQA 2OZAA 2QD9A 3CXWA 4XBUA 4IC8A 2UVYA 3H9FA 5EK7A 4WKQA 3O7LD 3LMGA 3ROCA 5E8UA 4JOAA 2WEVA 1U4DA 4TN6A 1W98A 3ZFXA 4F08A 1X8BA 4O86A 2H6DA 2UW6A 4NTTA 4O0VA 3KU2A 2OK1A 1NA7A 3E7VA 4O22A 3MH2A 3R8MA 2QR8A 4TNBA 3ZHPC 4J96A 4S31A 3CTJA 3KRJA 4E4NA 3A62A 2GFSA 2PZIA 1QL6A 4C3FA 2QLUA 4I4FA 4WRSA 4TYIA 3QGYA 5FG8A 5JQ8A 2GS6A 3OD6X 2VTPA 2OLCA 3V5JA 4PDSA 4I5MA 4WUNA 3GU4A 1A06A 4F7JA 2RG6A 3P4KA 4OTFA 1KUTA 1E9HA 3VUIA 4QP4A 4X3FA 3RM7A 4GUEA 5BMSA 4OAVB 3ZEPA 3KKVA 5EM6A 2Z7SA 4D5HA 2O63A 1FOTA 2Q0NA 1ZYSA 2ZAZA 5IA2A 4FEUA 2YIWA 4E4XA 3HEGA 3W18A 1J91A 4NUSA 4BI1A 5AIKA 4EHVA 1Z57A 3CGOA 2XNBA 4Q9SA 5EI2A 2VTAA 4TTHB 3BGZA 1H0VA 1PMUA 4O6LA 2WQMA 4S2ZA 2WQBA 4TRLA 5E7RA 2BTRA 3QTQA 4ASEA 1Y57A 3FMEA 2FSOX 4FZ6A 3PXKA 4I21A 3L8SA 5CLPA 2XRWA 2JAVA 2C6IA 5FD2A 2GNGA 3DGKA 5BVDA 1OL5A 4BCKA 1GZOA 4BDCA 3O23A 4C8BA 4Z7HA 2UZUE 2VNYA 1ZOEA 3VS5A 1WBVA 4M67A 4O0YA 1G8AA 5HX6A 3SG8A 4CRLA 5D9HA 2QODA 2BHEA 4DEBA 1WMKA 3H4JA 4EK3A 2UZDA 1UV5A 3UPZA 5ANGA 3FYKX 4GG7A 4TYHB 4XOZA 2YN8A 4GJ2A 2W1GA 2Y4IC 3V01A 2PK9A 4XV2A 2VTLA 5HNIX 2YWPA 3NLBA 4AP7A 3E88A 4MBLA 3DFCB 4RG0A 4RLLA 3FUPA 4IB3A 5AP7A 4HCUA 4ASXA 4XLIA 4FTLA 4G31A 3DQXA 3KA0A 3R63A 4RRVA 5K3YA 3UE4A 3CLYA 3U6IA 2PULA 2JDTA 4FT3A 3PP0A 5HBEA 4FSQA 3V8SA 5HTCA 1H1PA 3WE8A 4FG7A 2UW9A 4U9AA 4XV9A 2CGXA 4IM2A 3P0MA 5AJQA 2E9UA 4V05A 2UV2A 2G2FA 3UC4A 4RIYB 4LM5A 5DA3A 3UC3A 3SRVA 3TNIA 4RJ7A 3TUCA 3FY2A 4RVKA 2O0UA 3R22A 1U5QA 4HZSA 4KINA 1Q8UA 1M2RA 4NKSA 3BQCA 2X8DA 4GU9A 3F6XA 3O2MA 3W10A 2C6LA 3TNPC 1RW8A 3WIGA 3BQRA 1QPEA 1YW2A 1P4OA 3BLHA 4MBJA 4LMUA 5J8IA 4OTGA 3VBVA 4CEGA 5D10A 4ZTMA 5AEPA 5J79A 3GVUA 4FNWA 4O6EA 5LVOA 2J0IA 2R4BA 3THBA 3KRRA 5CF8A 2IPXA 3E63A 3KRXA 3UPXA 3VQUA 3UMWA 5HLWA 4ZSGA 3FE3A 2XBJA 2EVAA 5AA9A 5BVNA 2ITQA 3CP9A 4FTUA 2PVFA 4XV1A 5KE0A 3ET7A 3FLQA 2PU8A 2B52A 2P4IA 3R9DA 5ITAA 3TL8A 2BIKB 2OBJA 1K2PA 4KUJA 1Q24A 3S00A 4JS8A 4UXLA 4XG6A 2ZMDA 3DKOA 4ACMA 3EL7A 4HW7A 1JNKA 2O65A 3D7TA 3U4UA 3ZM4A 5CQWA 3QTRA 5AP4A 4EKLA 3DXNA 2R3OA 3U9NA 4TL0A 2PHKA 3FSKA 3R00A 4P5ZA 4P90A 4WD5A 3EIDA 2XK6A 5JEBA 4DF3A 3UJGA 4D2TA 5AV3A 3R7VA 1O6LA 3Q9WA 5ANDA 3UMXA 4ANLA 4EC9A 5CAOA 4USFA 5I9WA 3COMA 1YDRE 4FKOA 4WBBB 4GT5A 2HXQA 2XK8A 3BX5A 3OY1A 1WAKA 4JVGA 2WTJA 3KXNA 4KSPA 4OTDA 4MF0A 5TT7A 3R7IA 2I6LA 3O17A 2W5BA 3R9OA 4EH6A 4BCGA 4O0RA 4FV9A 1Z9XA 3W55A 4K6ZA 3WF6A 1R39A 1VZOA 2WMXA 4IVBA 4KIQA 2WB8A 4X2KA 4YC3A 3R7YA 4DGLC 4RJ3A 3AXWA 4H1JA 3HL7A 2JITA 1Q8ZA 3BHTA 2HIWA 4RZWA 3WILA 4BKZA 3NAXA 2RL5A 3F2AA 4KD1A 3VBXA 4UMUA 4X7QA 4HVHA 5HD4A 4QMMA 4JDJA 5E92A 3PDTA 3LM0A 5H8BA 5M08A 4NM7A 1IG1A 4IJ9A 3LJ2A 3WF9A 2XBAA 2NRUA 5DIAA 3KCKA 2VN9A 3I60A 3C4ZA 4DAWA 4N57A 4HOKA 2GNFA 4D2SA 2GQGA 3IDBA 4YJNA 1UVRA 5H8GA 2CKEA 5CXZA 4DHFA 3EQDA 1NT2A 3W2CA 4JX7A 2BZHB 3Q6UA 4N70A 4ERKA 2UZEA 1NXKA 4ZXTA 1GZNA 2OJGA 4N6ZA 2QO7A 1ZWSA 5M44A 3IECA 4LQMA 4C61A 2W0JA 3F3ZA 1B6CB 2C6EA 2VTOA 2QLQA 2YLFA 4HGSA 3TTJA 2XK3A 3PIXA 4U7ZA 4PV0A 5LWMA 3VUTA 3WZJA 3ZZWA 4RJ8A 2IVSA 2VWXA 3JYAA 1IASA 3PG1A 3BRBA 3HV6A 4A9YA 4CTCA 3AT4A 3I6UA 3BPRA 3JS2A 3UBDA 4ZS0A 3PWYA 1ZAOA 5FRIA 4ORKA 3BU6A 5LMKA 3L1SA 2P3GX 3CQWA 4H3BA 5D7VA 1WBNA 4V01A 3SV0A 2B7AA 4XLVA 4BDFA 5K4IA 3AMAA 4XP3A 1H01A 4IEBA 4WOVA 3CC6A 4OTWA 3ZLXA 2G15A 2O8YA 3AC5A 4IMYA 4RWJA 4S32A 4C4HA 4YC6A 5CEQA 2HYYA 5DR2A 3MJ2A 3HNGA 4FKGA 4I6FA 2YZLA 1OM1A 3C4CA 3R9RA 3R9NA 4W4WA 5KMJA 2RFSA 3NWWA 2FYSA 3ZRKA 5EHYA 5AADA 4V0GB 1UU9A 2XIXA 1YWVA 4ZTQA 5FWKK 2X6DA 3PSDA 4ZZMA 1Q61A 4A06A 2CN8A 4IQ6A 5EM5A 4NK9A 4C35A 4MNFA 3WE4A 1G3NA 3CE3A 4EQMA 4ZOGA 4C4IA 5KMMA 2PZRA 4HCTA 4JR7A 5IH5A 4YJPA 2ITTA 4HZRA 4JJRA 5BX0A 4FEWA 4F7LA 3VAPA 4TKSA 1QCFA 4DCEA 4CV9A 4NM0A 2GHLA 2WU6A 5BVFA 5CVFA 5D41A 3QYZA 3DB8A 1OL7A 2WTDA 4LV8A 5EDRA 4WSYA 5AWMA 4QMQA 5ANOA 5E8XA 5A4EA 3UQCA 3HDNA 4JQ7A 3D14A 3TZ9A 2VWUA 3GEQA 1YWNA 4ZY5A 4EUTA 5DG5A 4O7RA 1OIYA 3I1AA 5AV1A 3C4WA 3F82A 5CTPA 3FXXA 3TACA 3SAYA 5C1QB 3K5UA 5IG1A 1OBGA 3MPMA 3LOKA 4E93A 5CALA 2Z7LA 4M97A 2A19B 2CGUA 3MTLA 3BYUA 2JIUA 1ZOGA 3PXFA 5CSVA 4ACGA 4DH8A 2XM8A 1KOAA 1YHVA 1BKXA 4UMPA 3WZDA 4NFNA 2PUUA 4Q5EA 5HX8A 4CYJA 4TWPA 3FQEA 3VVHA 3COKA 2C5YA 2P2IA 2BAKA 2IW6A 2NO3A 3IKAA 3MS9A 3QTIA 5B2LA 5EW9A 4AGWA 3GCPA 2RGPA 3ZOSA 2QOIA 3C4FA 3PXYA 4CKRA 4FIHA 2UW4A 5HVJA 2XIYA 4HJOA 3RPOA 4G9CA 4FGRA 3Q04A 5EHLA 3GU8A 4LOQA 5HIEA 4TZRA 3C50A 3FAAA 4W8EA 2XKEA 2J90A 3I5ZA 3DKGA 3QKLA 3R2YA 3ZDUA 2IWIA 3AC2A 4X2JA 5CWZA 5T68A 4ZZNA 3ITZA 3BKBA 4Q9ZA 5LCJA 1U5RA 2YIQA 2GQSA 4IFGA 1DM2A 3KY2A 3R1NA 2OZOA 4FA2A 4L46A 3VS7A 5J9ZA 1Q3WA 4CCUA 3NS9A 3PIYA 5HE2A 2J2IB 5IA5A 3E62A 4EBVA 1YI6A 5H9BA 3PG3A 3EH9A 5CSPA 3GQIA 3NUPA 5HKMA 3DU8A 2I0EA 1Q5KA 2F7XE 2XKFA 1CMKE 3SOCA 3E8DA 3S3IA 4YBJA 1ZYDA 4FK6A 4HGEA 4BR3A 3DJ7A 4BDGA 4D0WA 1YDSE 1PXNA 3BBWA 3UQGA 1PYEA 3GC7A 5FGKA 2IO6A 3A4OX 1IR3A 2WIHA 3KN5A 2R7IA 5JT2A 3DKCA 4EH2A 3LFEA 5AR3A 3IW6A 3POZA 2VV9A 2JKKA 4L45A 4IM3A 3S95A 3R73A 3D2IA 4NW6A 3VC4A 5BVEA 2C5OA 4CFMA 1WVWA 3K2LA 3LKMA 4BZNA 3UNZA 4ZLOA 3EL8A 4AZWA 2W1DA 2PZ5A 2C6TA 3V04A 3TM0A 3CD3A 1OMWA 2C5VA 4U44A 2FSLX 2WFYA 1UNGA 5AR5A 4YSMA 2GCDA 4TWCA 4O7SA 4E26A 1YI4A 4JDHA 1FQ1B 3EQFA 4RFZA 4D4SA 4IAIA 4Y46A 1OBDA 4G17A 5C8KA 3GU7A 1XH6A 1Y6BA 5AM6A 3FEGA 3AC1A 4WNMA 4UWYA 2W7XA 4YU2A 4YJVA 3QD2B 3VS2A 3JY9A 3FMHA 2YACA 4RBLA 2PMOX 5EFQA 3Q4ZA 3QYWA 5JGDA 2CNVA 1UNHA 1OB3A 2R0IA 1SMHA 3HKOA 4PNKA 2VWYA 4ZTNA 3QXOA 4C62A 3ZUTA 4A7CA 5FXSA 2EU9A 3DLSA 2W4KA 2JIVA 5HU9A 4L3PA 5HI2A 2VTMA 2JBOA 3FV8A 4GW8A 4FSWA 4QTCA 2ITOA 4CYIA 2JKMA 3FI3A 5LOHA 3NR9A 2W1FA 4FZ7A 3W2OA 1R0EA 1NVQA 2XCHA 4FODA 4BDAA 3CSVA 4C2WA 5KZIA 1OIQA 1VJYA 4FV4A 1M2QA 5CU3A 1OKZA 4D1ZA 2BFXA 5EYDA 3F3TA 3W2RA 4YZDA 3A7FA 4YJUA 4ANQA 3AGMA 2ZB1A 4QQJA 3GCVA 1KE9A 3OVVA 4G5JA 2QHNA 2Z2WA 4OTRA 3HVCA 1XH7A 3LCSA 4FKUA 3C0IA 4AX8A 5DEWA 4XX9A 1H4LA 1Y8YA 3FY0A 4FVRA 4WUAA 3RALA 2X81A 5DR9A 1OVEA 2YDJA 4EBWA 1VR2A 3BE2A 3FMLA 2XNGA 3O50A 4KIKB 4E7WA 3NYNA 4XBRA 3AMBA 3WYYA 2V62A 4LOPA 5J5SA 4EC8A 5A14A 3KXMA 4DFLA 2PVJA 3RWQA 3IG7A 5E8TA 3NUXA 4C02A 4R77A 3R1YA 1I44A 3O8TA 4CRSA 4F6SA 2VX0A 3POOA 3P86A 4M13A 4L01A 2VTJA 4R1YA 3ANRA 1A9UA 4FNXA 5C03A 3V5TA 1XH8A 2IZSA 2VX3A 4I5CA 4C3PA 4DGGA 4H05A 2JKOA 3CY3A 3DTWA 5J1WA 1GNGA 3GU6A 4FIGA 4IE9A 4YPDA 4EOJA 3QUDA 3N4TA 2P33A 2GS2A 4XCUA 4X3FB 3O8PA 1ZZLA 5E8VA 4F9YA 4TYJA 2X0GA 3PJCA 4IX5A 4BYJA 3WARA 2V5QA 5L2TA 5IMEA 3AGLA 4LUEA 4BGQA 3KVWA 3LM5A 2NNWB 4J8MA 3QWKA 2Z02A 4C3RA 2R3MA 3O96A 2YHVA 1UA2A 1PJKA 1JWHA 1IA8A 2XF0A 3H0YA 5HLPA 3I79A 2UVXA 3IW8A 4D4VA 3UP2A 5IDNA 5AR2A 2WMBA 3RNIA 3ORXA 3ROYA 5AR7A 2YAAA 4RJ5A 2BDJA 3RINA 2VGPA 5E91A 4UALA 5CI6A 2BKKA 4H3QA 4PTCA 3TNQB 3KXZA 2XEZA 2J6MA 4FTNA 2HZ0A 3OZ6A 5CEMA 2UZNA 4F9AA 3FI2A 4DE4A 2IZUA 3LHJA 2J0LA 3ODYX 5BYLA 3PY3A 2F7ZE 1OL6A 2VO0A 2ZV8A 4A9TA 2PVMA 2WELA 4YJTA 3BLRA 5CEKA 1JKSA 5KZ0A 1NY3A 4F63A 1H28A 1FVTA 4GK4A 3QQJA 2OF4A 2C6MA 5ANEA 3DQWA 2GNIA 4OR5A 3LW0A 4GKIA 4II5A 1YWRA 4RC2A 3W2QA 4HYHA 2GDOA 1H25A 5KO1A 4APCA 2FVDA 4PMMA 3ATTA 2C3LA 4GYGA 4CG8A 5LVLA 2XYUA 4D5KA 2QONA 3VBQA 1OITA 5DT3A 4CZYB 4S33A 3R6XA 5HIDA 2W1ZA 5J1VA 1PKGA 4BY9E 4BYIA 3F7WA 3RPVA 1OUYA 3G9LX 4PQNA 2HK5A 3IO7A 4DFZE 2WMUA 3P78A 4ENYA 2CCIA 5AMNA 4D2PA 3FWQA 4IBMA 5M4FA 4ZTLA 5L6WL 5KUPA 2JIIA 2B9HA 2UW0A 5GNKA 2W96B 3IOKA 4RZVA 3NCZA 2X9FA 4U8ZA 5DT0A 2VO7A 4FKIA 4G3EA 2WNTA 4GVAA 1LUFA 2UZBA 4AOJA 5IU2A 4OUCA 4O7YA 1ZYCA 1RJBA 2P0CA 1O9UA 3UVPA 3NVKI 3AMYA 4AUAA 4FV3A 3UYSA 2XMYA 2QR7A 3MA3A 3G15A 2YISA 1UU7A 4UYAA 5IUGA 4TWNA 4GIIA 5BNJA 3QLFA 4CG9A 1H0WA 2W06A 3EKNA 3FHIA 5CX9A 1A48A 4IFCA 4FMQA 4KRDA 3OP5A 3BWJA 4MK0A 4EK6A 2FSMX 4FG9A 3PRFA 4IZYA 4FK3A 5AAGA 4YZ9A 4MNEB 2PUPA 5T6KA 3RPYA 5JZNA 2R3HA 4DEHA 4XH6A 3K5VA 3JVRA 3D7TB 5FTOA 4U79A 3V6RA 3W2SA 1FVVA 5GJDA 4QPSA 1ZY5A 3KK8A 4ALVA 1M14A 2OH4A 1H1SA 4J71A 1T45A 3UO4A 5A4CA 1IAJA 3GP0A 5AP3A 2EB3A 3KRLA 5HVYA 4U3YA 1IEPA 1PXIA 3KK9A 4Q5HA 4AOTA 4BIDA 5HVKA 2QNJA 3LMHA 3UIXA 3A2CA 3UOLA 4HYIA 3FLZA 4EK8A 5GZAA 1P2AA 3LXKA 2FH9A 2WHBA 3K54A 3O8UA 4M7IA 4BCMA 4EOSA 1XH9A 2NRYA 2WOTA 1YXVA 2XM9A 4W4XA 3UG2A 3P7CA 4EL9A 4GUBA 2QOCA 5M09A 3MH0A 3ZS5A 5GIPE 1H26A 3OY3A 3DOGA 5K5XA 4LYNA 1TQMA 4CCBA 3DK3A 5TF9A 5K0XA 4RVTA 4YJRA 4EUUA 3W33A 4J8NA 4XEYA 2FSTX 2G9XA 2Y6OA 4X3FC 4CMOA 5E8WA 1KWPA 1Q97A 4ALWA 1OGUA 2B1PA 2W4JA 2PVNA 4YZBA 4KSQA 3D2KA 3TIZA 3TV7A 3DA6A 4QTDA 4DH7A 4NTSA 3BYOA 3G6HA 3ORLA 4EI4A 2ZV7A 4ASZA 4K2RA 4BVUA 3FMKA 1JLUE 3R83A 4PP7A 1K3AA 2UZWE 3TZ7A 5CZIA 4QOXA 2F4JA 4CKJA 4EYJA 3JY0A 1R3CA 5J9YA 2O3PA 4FKWA 4R3PA 4ASDA 4MD9E 1MUOA 1UU3A 4XP2A 3ZLWA 3O0GA 2XIRA 1WBWA 4D4RA 2XUUA 2OJIA 4M15A 4FEVA 1JSUA 3DDQA 2OI4X 3NIZA 4IX3A 4I93A 3WZEA 1GOLA 3ELJA 2UW7A 3R1SA 2J0MB 2VUWA 3EFWA 3CTQA 2Y9QA 5F4NA 5ETIA 1OKYA 3EB0A 1JQHA 4F1OA 5BVOA 3H9OA 3C9WA 2R3FA 3Q53A 4PDPA 2I0YA 3QU0A 2RIOA 3MPAA 3F5XA 3Q2MA 5LJJA 5FBNC 4QQ5A 5F9EA 4USEA 2GHMA 3LLTA 2A4LA 5C8MA 4DTBA 5GIOE 4EQUA 1F0QA 3G2FA 3RAKA 1YI3A 3FZOA 4GYIA 1SVEA 1G5SA 4FL1A 2PE2A 2A2AA 5HORA 2R3LA 3OXTA 3QXPA 2UVZA 5AUYA 2XA4A 3TZ8A 5I4NA 4MWIA 4RWLA 1WFCA 4BCJA 4EH9A 2A1AB 2OO8X 3C51A 3C4XA 1YOLA 3BI6A 3MB7A 3P08A 5I9UA 5L2WA 3QCSA 3BGPA 4O7WA 2IJMA 4CQGA 4F99A 3A7HA 1FMOE 3UZTA 1YKRA 3NDMA 5DGZA 4E5BA 3ZDIA 2GNLA 2BALA 3VBWA 2BRBA 4MXOA 2X7OA 4QYYA 5KCVA 3TUBA 4ZEGA 3TJDA 4MF1A 5A3XA 1XR1A 5AAFA 4WA9A 5EDQA 4I4EA 3NCGA 2YCRA 2YIXA 1ZYJA 4TNDA 3VNTA 3VUKA 4BWKA 1REKA 4JLCA 5B2MA 4IJPA 5TKDA 4BBMA 1Q99A 5CSWA 5FP5A 4J97A 2W99B 3KXGA 2FA2A 3HDMA 3MESA 2WMWA 1JKLA 3PVBA 4KNBA 4O21A 3RK5A 4C37A 1W7HA 4LL0A 4IC7A 4AZTA 4FIFA 4YMJA 3ZC5A 5IH6A 5L2QA 2ESMA 5LXMA 4BCHA 3WI6A 4JG8A 4XG3A 4QMNA 5IQCA 5H3QA 3UIUA 3NSZA 3QRIA 3KULA 4BCIA 3DB6A 5EYKA 4BICA 1YXSA 3O71A 4TY1A 3ZO4A 3NYOA 3RAIA 5HG9A 2J0JA 2YCFA 4MXYA 5M51A 4FYOA 5AUUA 4NH1A 4GVJA 3ZSGA 4JBVA 4DEAA 4JI9A 4TWOA 5IMXA 2PWLA 4ZJIA 2X2LA 1OECA 3NVMB 3H0ZA 4PL4A 4FICA 4YLKA 2YERA 2ITYA 4YJOA 5C4KA 4XS2A 4HNIA 1MRYA 3DAEA 3OCBA 4J95A 4MQ2A 4ANOA 4EOKA 4D28A 3QQUA 3LE6A 4JAJA 1ZY4A 1STCE 4JNWA 5A6OA 2C68A 3WF7A 5DYJA 4RIXA 1MRVA 1V0OA 4MXXA 4U97A 2WKMA 3F2NA 4UMTA 3VW6A 1DS5A 5JGBA 2ZJWA 2WQEA 4ACCA 4O0UA 3LFCA 4HNFA 3DT1A 2X9EA 4L7FA 4AW5A 4QYHA 3FJQE 3RHKA 4PWNA 3OUKA 3BWFA 5HNBA 1J3HA 2REIA 3BCEA 4G2FA 4M12A 3I4BA 4G3CA 4JBPA 3ZU7A 4BZDA 2UZTA 3F3VA 1CM8A 3ACKA 4AA0A 2QOBA 4E3CA 4NCTA 4C7TA 1FGIA 2VTSA 4G6LA 2H9VA 2H8HA 3DPKA 4WNKA 1XHAA 3ZXZA 4F9WA 1PXKA 3A60A 4KBAA 3TXOA 4CZUA 3G90X 1LPUA 2OU7A 3F3UA 4YZNA 1M7QA 3WZUA 3EQCA 4K9YA 3AD5A 5I3OA 2J5FA 3RM6A 4KBCA 5CENA 3BE9A 2ERKA 5E9EA 4H36A 4APPA 4HPUE 2IZTA 3EQGA 4YUQA 5CU6A 4R8QA 1PW2A 3EN6A 1QPCA 4R6VA 1AQ1A 3KMUA 2ZM4A 3E3PA 5DN3A 2EXEA 4I3ZA 3T9TA 4KB8A 3VW8A 1AGWA 5DH3A 2XEYA 4Y5HA 5M53A 4FV8A 2X4ZA 2AYPA 3DBDA 4L52A 1FGKA 4D2WA 2VTIA 2BR1A 5JFXA 3HYHA 1Y8GA 3TG1A 4FV0A 3L9PA 1ZRZA 3PPKA 3I6WA 3RMFA 4CMTA 4TYEA 5LMKC 2B9JA 2J0KA 2XKDA 5A54A 4PL3A 5BUIA 5J7BA 1KV1A 5CS6A 1NW1A 1GZKA 1OPJA 5ETCA 4IVCA 4V04A 3RBWA 2HOGA 2QI8A 4X2FA 3C1XA 4O7TA 2BDWA 4NJDA 5F20A 4JRVA 3MSSA 1UKHA 3G0FA 3BHUA 4BTJA 2R3NA 4U81A 4M66A 2BHHA 1MP8A 4CLIA 2ACXA 4IWDA 4EH8A 3EQRA 1P4FA 3NIEA 1PXJA 2R3KA 3CPCA 4QMUA 4XOYA 5IA3A 3AQVA 3R2BA 5HE1A 3EKKA 2CN5A 3BIZA 4LGHA 5JK3A 4O1PA 3FXWA 3Q9YA 5DRDA 2FB8A 4B99A 4QP3A 1MQBA 4WHZA 4AFEA 4DFBA 1SNXA 5LMBA 3QQFA 3VWAA 2VD5A 4TT7A 4BBFA 2IW8A 4E20A 2PE1A 5EM7A 4C4EA 1GIJA 3RK7A 2QKRA 5AUVA 4DFUA 2YFXA 4FTIA 4C4GA 4YTCA 4J52A 5AA8A 2LGCA 1SVGA 1MQ4A 3PZHA 5FXQA 4DH5A 4EWQA 1IA9A 4PNIA 1O6YA 5A9UA 5HIBA 2X1NA 3KF7A 4FTQA 4IH8A 4QYEA 1K9AA 3HRFA 1U54A 1ZOHA 4W4YA 4FSUA 5GZ9A 4ZY6A 5CT0A 5CVHA 1S9IA 2HZNA 1XQZA 3CR0A 3EQBA 3E8EA 3LIJA 3B8QA 4F7SA 5LVPA 4BRXA 1UWJA 2RFNA 2YJRA 1P5EA 1BI7A 3EYGA 4KA3A 4PX6A 3UOHA 3QD4A 4O38A 3AOXA 2WQNA 3KXHA 1ATPE 1BL6A 4DBXA 3JXWA 3DDPA 3QRJA 3DJ6A 5FBOA 2XNMA 2IG7A 4UXQA 4YNEA 3LVPA 2BTSA 1DAWA 2W1IA 3W1FA 2CGWA 2Z7QA 2PVYA 4QP7A 5BVWA 3DXQA 2Z60A 3AT3A 1WBSA 5F94A 4IDVA 4CFNA 3ORIA 3BYVA 1WCCA 2VNWA 4WT6A 4LRJA 4XRJA 3UVRA 4BKYA 4CFUA 3PY0A 4MBIA 4D9TA 4RX9A 5HCXA 2ZYBA 4O83A 5DEYA 1JKTA 5HTBA 3D83A 4IIRA 4NEUA 3SQQA 3GFEA 1YQJA 2BFYA 4J53A 4BTFA 1RDQE 5J5TA 2PTKA 2WEIA 5EI8A 3BZ3A 4DGMA 5L2IA 3SA0A 4UBAA 4I92A 4RX8A 4FKVA 4TYGA 4Z3VA 1V1KA 3N4UA 5AAEA 1UKIA 4M8TA 4W9XA 4AOIA 1ND4A 2WTIA 3GU5A 4FKTA 4HVGA 4BB4A 1S9JA 4ERWA 4CFWA 3G0EA 3OS3A 4GT4A 4L3LA 1XKKA 2J51A 4O0TA 5JMSA 3QF9A 3S4QA 4CMUA 3NW5A 5KHWA 2R3QA 3QQHA 1YVJA 5CU4A 3Q32A 3QCYA 5GINE 1ZARA 2XKCA 4FNYA 4G1WA 4FTRA 4EOPA 3RGFA 3UIBA 4BC6A 5JN2A 4JX3A 4JG7A 4OBOA 3V5LA 5AX3A 2YITA 5FEEA 3EQHA 5HICA 3LCOA 3AG9A 3ZLYA 4YR8A 3V5PA 2C0OA 4IZAA 3KF4A 4IWOA 2X2KA 4AZFA 1YOMA 1UNLA 1OKVA 5FTQA 4B9DA 4O2ZA 4FZDB 4AA5A 3MDYA 3BLQA 5H8EA 3I0OA 4HGLA 2ZDTA 1APME 3LQ5A 3Q60A 4D4YA 4ITHA 1NVRA 3EQIA 4FC0A 5IZFA 4MCVA 3NYXA 2FGIA 5IA0A 4F64A 1M7NA 4WNOA 2BMCA 3SXFA 4P2KA 4WNPA 5CAVA 5HESA 4I0TA 2PUIA 2HCKA 3NNWA 1KE7A 3IPHA 4YLLA 5C26A 5AR4A 4HPTE 3PP1A 4QMYA 4FSTA 1PXPA 3HMNA 3NRMA 4R3CA 4YC8A 3VO3A 3ZONA 3U6JA 3COHA 3L8PA 3VUGA 2BUJA 3ZCLA 4ZMEA 2J5EA 4RX7A 4OAUC 3Q3BA 4RVMA 3RJCA 1WVYA 4I22A 5CNNA 4BWXA 5CAUA 1JSVA 2QURA 4FVPA 3OC1A 3PVGA 5HO8A 3BEAA 3VN9A 3P7BA 4UMRA 4MWHA 3QKKA 4WG5A 2X8IA 3AD4A 4L42A 5HNGA 2WMQA 4C4JA 2BRGA 3BHVA 3OWKA 2OWBA 3QC4A 3QA8A 5DE2A 3UNJA 3KEXA 4JBOA 4U5JA 3TUDA 2C0IA 2BAJA 3MFRA 5FUTA 3OWJA 4ZP5A 4IVAA 2PSQA 3CD8A 1Q3DA 3EWHA 4O96A 4BIEA 4F0GA 3R9HA 5HG8A 4AZVA 2E9VA 4F6UA 4FKJA 4MH7A 3HV3A 3O51A 3OUNB 3PTGA 4U80A 4C57A 3A4PA 5ETAA 2A0CX 3KMWA 3QRKA 5FP6A 4BWPA 2VX1A 3NGAA 3NAYA 3PJ1A 4E5AX 3RZFA 2WPAA 3EJ1A 4XRLA 4OBQA 2X7GA 3ID6C 4R7BA 1PHKA 2BZKB 1R0PA 3CEKA 3NX8A 4GRBA 2XJ1A 3NUAA 3L9LA 3HLLA 5IQEA 4DEIA 2WMSA 3GCSA 3LQ8A 4CT2A 3ULZA 4AW2A 4O7ZA 3ZBXA 1E1VA 5BMMA 4G5PA 2OKRA 1Y6AA 4YHFA 4U41A 3MFSA 4BGGA 4QMVA 2DUVA 3JPVA 2ZVAA 4GJ3A 1PF8A 3EN9A 3E87A 4UMQA 2XNOA 3F3WA 3MI9A 4I6BA 2CLXA 4ACDA 3E8NA 5TO8A 4F9CA 3DFAA 3QAME 4P5QA 5D12A 3SVVA 4NM3A 4PP9A 3DK7A 2QHMA 3ZO1A 3S1HA 4GU6A 2UZLA 4EK5A 4FKQA 4KWPA 4DT9A 3N4VA 2ETRA 4AFJA 1UWHA 5E8YA 1CTPE 4BDEA 5FDPA 4YURA 3B2WA 3EMGA 1VYZA 3DAKA 3Q2JA 3R1QA 2G1TA 3P5KA 4J7BA 5HCYA 1H27A 2A27A 2JDSA 5CQUA 5CY3A 3A7IA 4IZ5A 4BFMA 3KXXA 4ENXA 2CNUA 1OL1A 1O6KA 5JRSA 3SG9A 3OT3A 4D2RA 3PXZA 4N4SA 3KRWA 4IW0A 4O0WA 1FINA 4KKHA 4QMLA 3ORPA 4YBKA 4YO6A 1SYKA 4H3PA 3N51A 2XCKA 5M06A 5IEXA 4EH5A 2BVAA 5A4LA 3CQUA 2KULA 2XIZA 2YM6A 3MWUA 4EWHA 1G8SA 3M42A 4EJNA 4O1OA 5B7VA 2XVDA 3NZ0A 5JRQA 5M4IA 4R7IA 4RMZA 2YIYA 4IHPA 2CGVA 2WIPA 4GH2A 3VQHA 2WQOA 4ZSAA 3CKXA 3QGWA 3HAMA 4QTBA 3EN4A 3ETAA 5IDPA 4QO9A 2BILB 4ANMA 1NVSA 2ITXA 2AC3A 2HW7A 3PXRA 1JBPE 4JL9A 5AUWA 3TT0A 2BZIB 4MYGA 3BV3A 1LP4A 3R30A 4R7HA 1L3RE 3VUMA 2OZAB 5I9VA 4JT3A 4HVSA 4MHAA 4ZIMA 3HP2A 3FI4A 1DAYA 3PFQA 4LOOA 4RA5A 3FHRA 2XK4A 5DBXA 2W9FB 3G5DA 4LI5A 4NM5A 3IGOA 4QYGA 4QNYA 3MBLA 2VO3A 3FC2A 3R8UA 4RA4A 3DBCA 3Q5ZA 4HCVA 2BRHA 4S30A 4X2GA 1KE6A 2CCHA 1ZMUA 5I9ZA 5ACBC 5A4TA 4DYMA 4WRGA 5EYCA 4EH7A 4L43A 4GS6A 2PZPA 3D0EA 3U9CA 3QTXA 3H3CA 2Q83A 4J1RA 4NIFA 2OJ9A 4IACA 3IDPA 3FPQA 4GSBA 2J7TA 3SC1A 3TDWA 3T9IA 3EFLA 4BL1A 4DINA 5J7HA 3CIKA 4U42A 3OBGA 2QO9A 5IISA 2C5XA 3OMVA 3LCTA 4B8MA 4JIKA 3QA0A 2ZV2A 2PVRA 4BBEA 5I9XA 2OIBA 2VU3A 2Y7JA 4ZS4A 4ITIA 3QCXA 4G6OA 5FQDC 1YOJA 4RC3A 2C6OA 4YP8A 5ICPA 3QZGA 4RJ6A 3JUHA 4W8DA 4EOOA 5I0BA 3QL8A 3AT2A 2J4ZA 5JFVA 3LXPA 3QX2A 3HMMA 3MGYA 4N0SA 5C01A 3REPA 2C6DA 3DBEA 3HRBA 1FVRA 3ORTA 4QMOA 4F4PA 1RQQA 5H2UA 2XNNA 3PPZA 4A4OA 4PTGA 3ZFYA 3M2WA 3W16A 4HYSA 4IM0A 1ZMVA 4YJSA 3GXLA 4ZTHA 2GNJA 2B4SB 5E8ZA 2GTMA 2QOQA 5G6VA 3UIMA 5AFVA 4F09A 1URWA 2BAQA 3FXZA 3EFJA 3PXQA 4YHTA 3KULB 2JBPA 3SXRA 1M17A 1AD5A 4CFXA 4MAOA 3ZXTA 4CFFA 4NU1A 4FIIA 4PMTA 3UDBA 4ZK5A 3OXZA 1JPAA 4JG6A 4EKKA 4O0XA 4O81A 3CS9A 4OT5A 4KIPA 3QD0A 5AP1A 2VWVA 4QD6A 1KE8A 2Z7RA 3A7JA 5DVRA 3RNYA 2WD1A 3PSCA 3DZOA 3ANQA 4FTTA 4FTKA 4XG7A 2B55A 1BLXA 3VF8A 1P14A 1R78A 3CKWA 5CSXA 2ZV9A 3LFFA 4ACHA 4GL9A 4HVDA 4D9UA 1M52A 2PE0A 3HECA 3SRVB 2ITPA 4NYEA 5CAQA 4BCOA 5AX9A 4D58A 2WMVA 2Y8OA 3RPSA 3NNXA 4BZOA 4FT5A 2X2MA 3QTZA 4CXAA 5KNJA 4ZTSA 2UUEA 3LQ3A 5E4HA 2X4FA 4XV3A 1Z5MA 3NUUA 2OW3A 3NPCA 4BHNA 1W82A 2VRXA 3UZRA 2YZAA 4ZY4A 3ORZA 4RC4A 3G51A 4U43A 3U87A 3UQFA 2C6KA 5L8JA 3DK6A 4X3JA 4AN3A 4D1XA 3C13A 4BCPA 2AC5A 5HD7A 3NUSA 4MXZA 4AG8A 3MA6A 4X0MA 3R8ZA 5EQPA 4Z9LA 2W1EA 5AM7A 4O7VA 4O0SA 4DFNA 3LMIA 5KKRC 4R1VA 2C1AA 4FR4A 4RLKA 3LFDA 3RHXA 5JKGA 3DNEA 5LVMA 3FMMA 3H30A 4A9UA 4AW1A 4BGHA 3LFQA 3MFUA 3PE2A 5B2KA 5KHXA 3JR1A 3MPTA 5HBHA 3TCPA 4GK2A 4USDA 3TN8A 2QOLA 2GQRA 3I0QA 4Y85A 5DNRA 4FSMA 3GOPA 1J7UA 4ALUA 4K8AA 3OEFX 2GTNA 2IN6A 2WO6A 1J7IA 3MFTA 2PY3A 3CGFA 2XNPA 4ZLZA 4I41A 3TZMA 4NZWB 3QRTA 2HY0A 2PZYA 1M2PA 3Q9XA 5CI7A 3MH3A 1U46A 4YO4A 5AV2A 4M0YA 5TR6A 4A9SA 4AT3A 2R0UA 3G33A 4UWBA 3RCDA 2RFEA 2B0QA 2ITWA 4XUFA 1T46A 2WGJA 3W8LA 4AT4A 3CTHA 1WBPA 4YTFA 2YLEA 3ZEWA 2YM4A 4FSRA 1XH4A 5HG5A 3NEWA 5HEZA 3V5WA 2I7QA 4M14A 1GAGA 3A61A 5HHWA 1W0XC 2B53A 3ALNA 3UTOA 3PVWA 5IH4A 3ORNA 4DN5A 1F3MC 2W9ZB 3ENHA 3UODA 5F1ZA 2W1HA 3AC3A 2QOKA 2X6EA 3D5VA 4MQ1A 3OW4A 2YCQA 3HMIA 3ATSA 1H1WA 1OI9A 4CFVA 1VYWA 2OH0E 3WOWA 1BUHA 4BTKA 5IF1A 2HWOA 3KN6A 3OTUA 4XG9A 4O7NA 5LQFA 4R5SA 4NJ3A 4AU8A 3LFNA 2VGOA 3QWJA 2ONLA 5FM3A 1ERKA 4I24A 5DPVA 3GCQA 5HE0A 1PXMA 3RZBA 4D0XA 4MD8E 4RIWA 4EK4A 2BCJA 3ZTXA 3TIYA 2C30A 3Q9ZA 4FV2A 4I0RA 2VZ6A 4E4MA 2CNQA 4HGTA 5C4LA 5D1JA 3E92A 2HAKA 3U54A 4FT0A 3RAHA 2YEXA 5AP5A 5EYMA 4KBKA 4AE6A 3V6SA 4E6CA 4MXCA 4AACA 4AE9A 4UWCA 3MVLA 5A4QA 3HUBA 5CEOA 3ENMA 1DI8A 2PMLX 2V55A 4KRCA 3F66A 3DBFA 4H58A 4OTHA 5CT7A 3UG1A 3WF5A 4A4LA 5I9YA 4FKPA 2BRMA 5K0KA 3B2TA 4NFMA 4DFXE 3DBQA 3SW4A 4CLJA 1UU8A 3VJOA 4F1MA 4I0SA 3UP7A 4AXAA 2PL0A 3VS4A 3TV6A 5M07A 4KIKA 3MVJA 2WXVA 3DXPA 2J9MA 4XG8A 4CNHA 4FV5A 4GG5A 2VTTA 3L8XA 3MIAA 3R7EA 3R8VA 4BDKA 2UW5A 4JDKA 4M0ZA 5LVNA 4JRNA 2WTKB 3FLWA 2GHGA 4NT4A 3DJ5A 3LFBA 4R3RA 5GJGA 3QHRA 5J9LA 3S0OA 5T3QA 3ORMA 3OWLA 4Z16A 4O91A 5DMZA 2ITUA 4QQTA 4R78A 3OOMA 3QZHA 2F7EE 4EORA 3F5UA 3F2RA 2RFDA 4ONAA 2IVTA 4QRCA 4YTHA 3HV7A 4I6QA 2ITVA 4BHZA 4UZDA 1OIRA 5CF6A 2QU6A 4IXPA 3HV4A 5HE3A 2ZDUA 4PL5A 1OKWA 1Y91A 2CSNA 3I7BA 4QP8A 3M11A 4LV5A 2BPMA 1XO2B 5IQIA 2CDZA 5IA1A 2GSFA 4BCNA 1KOBA 3P23A 4MXAA 2PPQA 3PIZA 3UYTA 4XP0A 5D11A 5AUZA 2HELA 3I7CA 2V0DA 3HAVA 4NCTC 3RWPA 4RT7A 1PY5A 3ZSIA 1HOWA 3KL8A 3O7LB 5JQ5A 4ZMFA 3A99A 2QCSA 3FLYA 2F2CB 4FI1A 2C47A 2GMXA 4DA5A 2OXDA 4UB7A 3VHKA 3VS6A 2OIQA 1V0PA 4KKEA 1OL2A 2OF2A 4M3QA 4J99A 5JSMA 3GNIB 4JIAA
chains in the Genus database with same CATH superfamily
4LMNA 4O27B 4PMSA 2XALA 3NW6A 3BV2A 3OROA 5ANKA 1OIUA 3W8QA 1TVOA 4MD7E 2HWPA 4OTQA 5LWNA 2XK7A 4TXCA 4O4BB 3OHTA 5AP2A 1H08A 5HG7A 4FZAB 4M69A 3NUYA 3QQKA 4CD0A 3E3BX 3SGCA 2AUHA 3LXNA 2R3IA 2VTNA 4RVLA 3VBYA 3LZBA 4Y83A 5IUHA 2JDRA 1U59A 3IGGA 3G9NA 5CSHA 3ZRLA 2HENA 2ITNA 1PRYA 4K11A 4Z55A 3D94A 3CQEA 3BELA 2X8EA 3DS6A 4YZCA 3VUHA 2WMRA 4EOQA 3FZRA 5A46A 2C3IB 4IAZA 4O82A 1LEZA 2BROA 2ZM1A 4FV6A 3UDSA 4FTMA 4DGOA 5M57A 4OTPA 2OJJA 3QBNA 3ZRMA 4BI0A 3SLSA 3K3JA 3F61A 4AAAA 4ZAUA 2QOHA 2UZOA 4PDYA 3DV3A 4L8MA 4C36A 2OGVA 3PJ3A 5LARA 4CGAA 3K3IA 2LAVA 4DDGA 4CV8A 2R7BA 2PMIA 3FMDA 3MY0A 4R5YA 4Y73A 3E8CA 3LFSA 5KMKA 2JLDA 3S2PA 3WZKA 1CSNA 2ZB0A 3C0GA 2QC6A 4KS8A 3TDVA 3HUCA 2C4GA 1PXLA 4I94A 4OW8A 4DHIB 2JEDA 3BGQA 4WO5A 5JGAA 1W8CA 1CDKA 2WTCA 5HGIA 5BQ0A 4M84A 4MNEA 3FMJA 3KMMA 4FKRA 1XJDA 1YHWA 3NMUF 2Y4PA 5CAPA 3FQHA 3R71A 2P2HA 3NYVA 3DLZA 4DG0E 1IRKA 4NKAA 4WIHA 3GI3A 2WZJA 4GFGA 3U4WA 2WAJA 5EOBA 2IVVA 5HBJA 4DEDA 4AF3A 4DEGA 3UGCA 4E6QA 4S34A 4O84A 2G01A 2JDVA 2YDKA 3FMNA 3HV5A 3OXIA 3SHEA 4EOMA 2OSCA 3QX4A 4G16A 5FLFA 4LL5A 3R01A 3A8XA 4PMPA 4PRJA 3D4QA 3KGAA 4GKHA 2WTKC 3ZUUA 1YRPA 4C0TA 1REJA 5KX8A 2EB2A 2XB7A 2VWIA 1IAHA 2ZFYA 4ANSA 2NPQA 3MY5A 3OT8A 3LCDA 4FSYA 3P1AA 4LRMA 3ZO3A 3LCKA 4EH4A 4XHKB 2R5TA 3VJNA 4U40A 2XJ0A 3ORKA 4C38A 4Y5QA 5DLSA 5CEPA 5FDXA 5DFPA 3FKLA 2YM8A 3F69A 2JFMA 2VWZA 3GOKA 3R7GA 4RQVA 5HO6A 1H8FA 2PVHA 3GB2A 4WG3A 3ZZEA 4B8LA 4DH3A 4L00A 3LJ0A 4KAOA 3SOAA 1KSWA 2YAKA 3D5WA 1RE8A 4BF2A 3KVXA 4QP9A 1MRUA 2WTWA 2GS7A 5LCKA 3ZFMA 4FKSA 4BIBA 3QD3A 4AS0A 1W2CA 4TPTA 4AT5A 3V5QA 2DWBA 5ETFA 1JSTA 5D7AA 5TOZA 5EOLA 2XIKA 4FTOA 4DDIA 3SD0A 1JAMA 4NWMA 4BDHA 4WSQA 3ZLSA 4BDJA 5CASA 5HO7A 4MKCA 4DFYA 4DG2E 5JH6A 5KMLA 5IQHA 3C5UA 5KMOA 5C8NA 3P5JC 1YXXA 4ANNA 5CANA 3KREA 3TI1A 4PUZA 2QU5A 5HZNA 3B8RA 3ERKA 4PPCA 1URCA 4RWKA 2R3RA 5EKNA 5HU3A 4K33A 5DT4A 3F7ZA 2RF9A 1LEWA 4YNOA 2ZOQA 4FGBA 3PLAE 3UNKA 2YA9A 2B9FA 4GT3A 1ZLTA 2F57A 4IAFA 4QPMA 4RIOA 4K1BA 4G3DA 2GNHA 4U6RA 3RCJA 4DC2A 4DTKA 3SW7A 4EHZA 4UYNA 1WZYA 3BEGA 3OCGA 4ID7A 5IEYA 5M56A 1Q4LA 4DEEA 3R0TA 4TW9A 5CVGA 4EOIA 1PKDA 4QMTA 3UVQA 4F70A 1KE5A 3MVMA 2RG5A 3ZM9A 5IQFA 4FE2A 3WYXA 4XYFA 3EFKA 3R02A 3CJFA 4JQ8A 4ZSJA 5BPYA 4ITJA 3TNWA 3ZUVA 5J87A 2WU7A 4NIFB 4BDIA 2O5KA 2R2PA 3FKNA 4P7EA 3TV4A 3Q4CA 3PVUA 4E1ZA 4DITA 5BYZA 3HGKA 4C58A 4FSNA 3OCTA 3R7OA 2VO6A 4IAYA 5IEVA 2SRCA 3E5AA 2Y6MA 3FZPA 3LXLA 3QTUA 3CY2A 1BI8A 3FSFA 4G9RA 4UY9A 4XNEA 4FSZA 5LMAA 4QMXA 4OBPA 5EQYA 4OLIA 4L6QA 4E6DA 3SX9A 2FUMA 3VBTA 4ZLYA 5BUJA 4O2PA 4AGDA 4IX6A 2KTYA 4FX3A 5K9IA 5F95A 2XH5A 5E1SA 5AP6A 2DQ7X 3VS3A 5KBRA 3R7UA 4LRKA 3D7ZA 3OF0A 4JXFA 5FEDA 4FOCA 2IVUA 3C4EA 2WMTA 3C7QA 4IB5A 5DI1A 4UX9A 3KC3A 2OIDA 2YDIA 3PSBA 3WF8A 5EM8A 1TFFA 1TZDA 3A7GA 3RP9A 2GPHA 4TYHA 3U51A 3BHYA 1B39A 3BHHA 4ZTRA 4RPVA 4QYFA 2BRNA 3VF9A 4F0FA 1V0BA 4LG4A 3ZYAA 4I1ZA 3LPBA 3R21A 4H39A 4I5HA 4E5WA 1PYXA 3GQLA 3KCFA 4BDDA 5AUTA 5CF5A 2CPKE 5IUIA 4UEUA 4GFMA 1WBOA 5DR6A 4FIJA 2BIYA 4QNAA 3QFVA 2OFVA 4E6AA 2ITZA 1J7LA 4IVDA 4BN1A 4FL2A 1Q62A 4FV7A 4FUXA 5AUXA 2O2UA 3FC1X 4QTEA 3U8WA 3OEZA 4EJ7A 5EDPA 5K5NA 5ANIA 3QZFA 2YABA 4MEDA 3RKBA 3PY1A 4DTAA 1Q8YA 3E7OA 4RIYA 3U6HA 2E2BA 4XG4A 2JC6A 3EYHA 3WBLA 5HLNA 4FEQA 4KS7A 4D1SA 3FKOA 2P55A 1Q8WA 4B7TA 4F7NA 2DYLA 4GIHA 3I81A 3SXSA 3AD6A 4AZEA 3OW3A 5FEQA 1PMEA 2V7OA 3FPMA 3PA4A 4FZFB 1XH5A 3PE1A 4CKIA 4QP2A 4RGJA 3TWJA 3QTSA 1XBCA 5FM2A 5HTIA 2PYWA 5B0XA 2OJFE 5L8LA 4DCAA 4RQKA 4L68A 3FL4A 1I09A 4CT1A 4EOLA 2OFUA 4QMWA 5FTGA 2WOUA 4N6YA 4DLIA 4JAIA 3H10A 5IKWA 4HVIA 4CVAA 2CKQA 1J1BA 3FZSA 5DHJA 3MW1A 2X39A 2HXLA 3QC9A 5DRBA 2HY81 1CKJA 4BCQA 3RK9A 4FBXA 2JGZA 3MH1A 4NW5A 2CHLA 1XBAA 5EQEA 4XMOA 4B6LA 2YCSA 3HA8A 4DBNA 3VS1A 3Q5IA 3F5PA 1XMMA 3EOCA 3MVHA 3PYYA 4YJQA 3UO5A 3Q4TA 3VUDA 3VHEA 2QG7A 3G6GA 2W4OA 2YM7A 3LAUA 4RSSA 2C1BA 2NP8A 5CYIA 4O7LA 1DI9A 5CF4A 1PXOA 1CKPA 4IX4A 4Z7GA 4FOBA 1SM2A 2XYNA 4L44A 3FLSA 2R3PA 5L8KA 1FBNA 4MX9A 5A6NA 1TKIA 2I1MA 3QTWA 4BDBA 3RAWA 3QUEA 5AV4A 2J50A 1FMKA 3SKCA 4Y8DA 5CZHA 2QO2A 3MTFA 2I0VA 4AZSA 3MIYA 4X2NA 3FI8A 2C0TA 4A07A 2W05A 4G3FA 1Q41A 2OXYA 2PMNX 2Z8CA 4FL3A 1KV2A 3D5UA 4DLJA 4IB1A 4RWIA 4Y72A 2XP2A 3PWDA 1JVPP 4FIEA 4JR3A 4I23A 4QMZA 5AR8A 4ZJVA 4LFIA 3T3UA 2XS0A 3FL5A 4EHEA 3QHWA 3IS5A 3P9JA 2C3KA 5BUEA 3GT8A 3QCQA 3FZTA 2JKQA 2CLQA 2EXMA 2JAMA 2W5AA 1BMKA 2JD5A 3KFAA 5EI6A 2VTRA 4AN9A 4ANBA 3AKKA 3OWPA 2F9GA 4CZTA 3GC8A 1QPJA 5EG3A 3TJCA 3ULIA 4A4XA 3ZC6A 4F9BA 4LGDA 5HOAA 2DS1A 4J98A 3MB6A 4F0IA 2C5NA 3COIA 3W2PA 4E4LA 5KKRB 5BVKA 2YIRA 1JOWB 2E9PA 3GBZA 4WBOA 4AQCA 5ANJA 4EZ5A 1ST4A 3L9MA 3GFWA 4AGCA 1WVXA 3TKIA 4YGAA 4FT7A 5CU0A 5HQ0A 2V22A 4ARKA 2WTVA 3OCSA 4DGNA 3MJ1A 4RIWB 4L53A 1H07A 4X21A 3IQ7A 3R8LA 5K4JA 4KIOA 4EHGA 3AC8A 3CJGA 3QQGA 3FDNA 2ZM3A 4YHJA 2R3GA 4OT6A 4KABA 1QPDA 2ETMA 4B0GA 1XWSA 4MUQA 3AC4A 3ALOA 4QT1A 2EXCX 3CBLA 3Q6WA 4GEOA 4EQCA 3DNDA 3Q96A 5JZJA 3NUNA 3FBVA 3FZ1A 3QQLA 1GY3A 3BBTB 4L9IA 3MV5A 3NNUA 5G1XA 2G2IA 3UOJA 1B38A 1OZ1A 3ZO2A 4FV1A 5CU2A 3HA6A 4EONA 4C59A 2CKPA 4PPBA 3TTIA 3DAJA 3IDCA 5GZ8A 4PDOA 1F5QA 5L2SA 3F88A 4V0GA 1JKKA 2EUFB 5IQBA 4ZSEA 4E8AA 1OPKA 3FQSA 1YXUA 4IADA 5AV0A 3H9RA 3PRIA 4FKLA 2V7AA 3I5NA 4UV0A 4DH1A 4F1TA 4K77A 3IOPA 4QMSA 4RX5A 2O64A 2I0HA 2QOFA 5C27A 3KB7A 3FYJX 5KMNA 1LR4A 3CPBA 1YXTA 3VS0A 3ZSHA 1VEBA 1GIHA 4EH3A 3PJ8A 3DKFA 3R04A 1OUKA 3MN3A 4W9WA 1L8TA 3TEIA 3PUFC 4H1MA 4MTAA 2IZRA 2ERZE 2XRUA 2QG5A 3ODZX 4RFMA 5L4QA 5IQDA 4JBQA 4M68A 5AP0A 3C0HA 2NYAA 5IPJA 5CEIA 2UW3A 3TNHA 1HCLA 4GV1A 4JDIA 2B54A 3OOGA 4Q2AA 3HRCA 5EHOA 3ZH8A 1PMVA 3UO6A 4FF8A 5JFSA 4FTCA 1ZZ2A 2H96A 3R8PA 3HX4A 1XBBA 4I6HA 4I5PA 2Q0BA 4AN2A 5EKOA 2VWWA 2WMAA 4ZZOA 2E9OA 4RFYA 3VULA 3GC9A 3PA5A 4KKGA 2HZ4A 4C2VA 4IB0A 2YM5A 1BYGA 3OBJA 3OG7A 5M4CA 4C33A 2G2HA 4BKJA 4QP1A 4F65A 3VRZA 2E9NA 5C9CA 1HCKA 3HZTA 2IW9A 1ZMWA 3IK3A 5E90A 2X7FA 4EYMA 3NW7A 4L67A 4AWIA 3T8OA 5L6OA 5DOSA 4OTIA 3EHAA 5ACKA 4WG4A 4IAAA 4D55A 1Q8TA 5KBQA 2GFCA 4FEXA 3HMPA 1ZYLA 3LJ1A 4EEVA 3GENA 3JVSA 3D15A 5CNOA 3KQ7A 2W17A 1E1XA 5EW8A 4BCFA 3VIDA 1ZXEA 3ZBFA 2Y0AA 3IW7A 3L8VA 4IDTA 4A9RA 4M69B 2OXXA 3HP5A 5IQAA 2W5HA 2QVSE 3BU5A 3MYGA 4PF4A 4BI2A 3DZQA 4RIXB 2YWVA 3IW4A 4CQEA 3L9NA 2PVLA 4PTEA 5L6PA 2PVKA 1GIIA 4G34A 4K0YA 2YM3A 1PMNA 3EZRA 4QTAA 4GK3A 3RVGA 3P79A 4IWQA 3EZVA 4E73A 3M1SA 4CSVA 3D5XA 5GHVA 4FG8A 2B9IA 5GJFA 3RPRA 5KMIA 3OTVA 3Q4UA 4QP6A 4PY1A 2JFLA 5FXRA 4D2VA 4IWPA 3PPJA 1YHSA 3MY1A 1BX6A 4L7SA 1J1CA 4GMYA 4QPAA 2VTHA 4FTJA 4FT9A 4RJ4A 1CKIA 4X6RA 1H00A 5BYYA 5JFWA 2R9SA 4ZSLA 3T3VA 2ONLC 3CCNA 3QRUA 3LFAA 4XG2A 5TE0A 3PZEA 2ZMCA 4I20A 2BDFA 2GU8A 2R64A 5AIRA 2I40A 2YJSA 3N9XA 2OICA 4AW0A 4F6WA 3Q52A 2XK9A 2F49A 4FUYA 3F5GA 3UZPA 4AA4A 4K18A 3P7AA 1OPLA 4U45A 4B4LA 3OFMA 2HW6A 4NSTA 3GUBA 4PPAA 3UDZA 4C4FA 4DT8A 3ACJA 4FVQA 3V8TA 4IAKA 2Y4IB 3C5IA 3DTCA 4YSJA 2ETKA 3E64A 4JQEA 3QLGA 5CXHA 4FTAA 4Y95A 4AGUA 3GCUA 4IZ7A 4YZMA 2EWAA 3NNVA 3EN5A 4IANA 3TKUA 3TKHA 1FPUA 3QUPA 3PUPA 1W83A 2VWBA 5M55A 3PLSA 4U0IA 4EZ3A 5I5ZA 3IW5A 3HMOA 3VONA 2CJMA 3QKMA 5IA4A 2F2UA 2HZIA 1SNUA 2UZVA 5DWRA 3ZMMA 2VAGA 3R28A 5E8SA 3QZIA 3GGFA 4GFOA 3IONA 4CTBA 1GJOA 1BL7A 2FO0A 2R3JA 3UOKA 3V51A 3DCVA 4YPSA 1H24A 2XZSA 4XJ0A 3V8WA 1TQPA 4GCJA 4UN0C 3BU3A 4P4CA 1YDTE 2RSVA 4FNZA 5IQGA 3GC0A 3RTPA 2H34A 4DG3E 4MVFA 2BKZA 4QQCA 1SZMA 1EH4A 4BTMA 4O4DA 4YLJA 2OG8A 1QMZA 3BYSA 2QKWB 3PA3A 3A8WA 3SDJA 4L3JA 4U3ZA 4YTIA 5HCZA 1GZ8A 1H1QA 5J95A 3RI1A 3V3VA 1H1RA 4C34A 2W1CA 2JDOA 3D9VA 4X6QC 1WBTA 3W32A 1R1WA 4AXCA 4DHZA 4G6NA 3DY7A 1SVHA 4HYUA 3BYMA 4LGGA 2CKOA 4NL0A 2XJ2A 3II5A 3E93A 4FYNA 2QQ7A 5EH0A 4DHJA 4W4VA 3F9NA 4UZHA 2RKUA 5L3AA 5M4UA 3PJ2A 4LUDA 2CMWA 3QALE 1U54B 5E1EA 5EW3A 3VRYA 3LLAA 3U55A 2PUNA 2UW8A 4QMPA 4EZ7A 5I3RA 1W84A 4OGRA 3EN7A 2BZJA 2C69A 2XNEA 4G3GA 3WIKA 3FLNC 1TQIA 2C3JA 4ZJJA 3EQPA 2QOOA 2VTQA 2OZAA 2QD9A 3CXWA 4XBUA 4IC8A 2UVYA 3H9FA 5EK7A 4WKQA 3O7LD 3LMGA 3ROCA 5E8UA 4JOAA 2WEVA 1U4DA 4TN6A 1W98A 3ZFXA 4F08A 1X8BA 4O86A 2H6DA 2UW6A 3AKLA 4NTTA 4O0VA 3KU2A 2OK1A 1NA7A 3E7VA 4O22A 3MH2A 3R8MA 2QR8A 4TNBA 3ZHPC 4J96A 4S31A 3CTJA 3KRJA 4E4NA 3A62A 2GFSA 2PZIA 1QL6A 4C3FA 2QLUA 4I4FA 4WRSA 4TYIA 3QGYA 5FG8A 5JQ8A 2GS6A 3OD6X 2VTPA 2OLCA 3V5JA 4PDSA 4I5MA 4WUNA 3GU4A 1A06A 4F7JA 2RG6A 3P4KA 4OTFA 1KUTA 1E9HA 3VUIA 4QP4A 4X3FA 3RM7A 4GUEA 5BMSA 4OAVB 3ZEPA 3KKVA 5EM6A 2Z7SA 4D5HA 2O63A 1FOTA 2Q0NA 1ZYSA 2ZAZA 5IA2A 4FEUA 2YIWA 4E4XA 3HEGA 3W18A 1J91A 4NUSA 4BI1A 5AIKA 4EHVA 1Z57A 3CGOA 2XNBA 4Q9SA 5EI2A 2VTAA 4TTHB 3BGZA 1H0VA 1PMUA 4O6LA 2WQMA 4S2ZA 2WQBA 4TRLA 5E7RA 2BTRA 3QTQA 4ASEA 1Y57A 3FMEA 2FSOX 4FZ6A 3PXKA 4I21A 3L8SA 5CLPA 2XRWA 2JAVA 2C6IA 5FD2A 2GNGA 3DGKA 5BVDA 1OL5A 4BCKA 1GZOA 4BDCA 3O23A 4C8BA 4Z7HA 2UZUE 2VNYA 1ZOEA 3VS5A 1WBVA 4M67A 4O0YA 1G8AA 5HX6A 3SG8A 4CRLA 5D9HA 2QODA 2BHEA 4DEBA 1WMKA 3H4JA 4EK3A 2UZDA 1UV5A 3UPZA 5ANGA 3FYKX 4GG7A 4TYHB 4XOZA 2YN8A 4GJ2A 2W1GA 2Y4IC 3V01A 2PK9A 4XV2A 2VTLA 5HNIX 2YWPA 3NLBA 4AP7A 3E88A 4MBLA 3DFCB 4RG0A 4RLLA 3FUPA 4IB3A 5AP7A 4HCUA 4ASXA 4XLIA 4FTLA 4G31A 4O4EA 3DQXA 3KA0A 3R63A 4RRVA 5K3YA 3UE4A 3CLYA 3U6IA 2PULA 2JDTA 4FT3A 3PP0A 5HBEA 4FSQA 3V8SA 5HTCA 1H1PA 3WE8A 4FG7A 2UW9A 4U9AA 4XV9A 2CGXA 4IM2A 3P0MA 5AJQA 2E9UA 4V05A 2UV2A 2G2FA 3UC4A 4RIYB 4LM5A 4BJJB 5DA3A 3UC3A 3SRVA 3TNIA 4RJ7A 3TUCA 3FY2A 4RVKA 2O0UA 3R22A 1U5QA 4HZSA 4KINA 1Q8UA 1M2RA 4NKSA 3BQCA 2X8DA 4GU9A 3F6XA 3O2MA 3W10A 2C6LA 3TNPC 1RW8A 3WIGA 3BQRA 1QPEA 1YW2A 1P4OA 3BLHA 4MBJA 4LMUA 5J8IA 4OTGA 3VBVA 4CEGA 5D10A 4ZTMA 5AEPA 5J79A 3GVUA 4FNWA 4O6EA 5LVOA 2J0IA 2R4BA 3THBA 3KRRA 5CF8A 2IPXA 3E63A 3KRXA 3UPXA 3VQUA 3UMWA 5HLWA 4ZSGA 3FE3A 2XBJA 2EVAA 5AA9A 5BVNA 2ITQA 3CP9A 4FTUA 2PVFA 4XV1A 4QEBA 5KE0A 3ET7A 3FLQA 2PU8A 2B52A 2P4IA 3R9DA 5ITAA 3TL8A 2BIKB 2OBJA 1K2PA 4KUJA 3PFYA 1Q24A 3S00A 4JS8A 4UXLA 4XG6A 2ZMDA 3DKOA 4ACMA 3EL7A 4HW7A 1JNKA 2O65A 3D7TA 3U4UA 3ZM4A 5CQWA 3QTRA 5AP4A 4EKLA 3DXNA 2R3OA 3U9NA 4TL0A 2PHKA 3FSKA 3R00A 4P5ZA 4P90A 1W2FA 3EIDA 2XK6A 4WD5A 5JEBA 3UJGA 4D2TA 5AV3A 3R7VA 1O6LA 3Q9WA 5ANDA 3UMXA 4ANLA 4EC9A 5CAOA 4USFA 5I9WA 3COMA 1YDRE 4FKOA 4WBBB 4GT5A 2HXQA 2XK8A 3BX5A 3OY1A 1WAKA 4JVGA 2WTJA 3KXNA 4KSPA 4OTDA 4MF0A 5TT7A 3R7IA 2I6LA 3O17A 2W5BA 3R9OA 4EH6A 4BCGA 4O0RA 4FV9A 1Z9XA 3W55A 4K6ZA 3WF6A 1R39A 1VZOA 2WMXA 4IVBA 4KIQA 2WB8A 4X2KA 4YC3A 3R7YA 4DGLC 4RJ3A 3AXWA 4H1JA 3HL7A 2JITA 1Q8ZA 3BHTA 2HIWA 4RZWA 3WILA 4BKZA 3NAXA 2RL5A 3F2AA 4KD1A 3VBXA 4UMUA 4X7QA 4HVHA 5HD4A 4QMMA 4JDJA 5E92A 3PDTA 3LM0A 5H8BA 5M08A 4NM7A 1IG1A 4IJ9A 3LJ2A 3WF9A 2XBAA 2NRUA 5DIAA 3KCKA 2VN9A 3I60A 3C4ZA 4DAWA 4N57A 4HOKA 2GNFA 4D2SA 2GQGA 3IDBA 4YJNA 1UVRA 5H8GA 2CKEA 5CXZA 4DHFA 3EQDA 1NT2A 3W2CA 4JX7A 2BZHB 3Q6UA 4N70A 4ERKA 2UZEA 1NXKA 4ZXTA 1GZNA 2OJGA 4N6ZA 2QO7A 1ZWSA 5M44A 3IECA 4LQMA 4C61A 2W0JA 3F3ZA 1B6CB 2C6EA 2VTOA 2QLQA 2YLFA 4HGSA 3TTJA 2XK3A 3PIXA 4U7ZA 4PV0A 5LWMA 3VUTA 3WZJA 3ZZWA 4RJ8A 2IVSA 2VWXA 3JYAA 1IASA 3PG1A 3BRBA 3HV6A 4A9YA 4CTCA 3AT4A 3I6UA 3BPRA 3JS2A 3UBDA 4ZS0A 3PWYA 1ZAOA 5FRIA 4ORKA 3BU6A 5LMKA 3L1SA 2P3GX 3CQWA 4H3BA 5D7VA 1WBNA 4V01A 3SV0A 2B7AA 4XLVA 4BDFA 5K4IA 3AMAA 4XP3A 1H01A 4IEBA 4WOVA 3CC6A 4OTWA 3ZLXA 2G15A 2O8YA 3AC5A 4IMYA 4RWJA 4S32A 4C4HA 4YC6A 5CEQA 2HYYA 5DR2A 3MJ2A 3HNGA 4FKGA 4I6FA 2YZLA 1OM1A 3C4CA 3R9RA 3R9NA 4W4WA 5KMJA 2RFSA 3NWWA 2FYSA 3ZRKA 5EHYA 5AADA 4V0GB 1UU9A 2XIXA 1YWVA 4ZTQA 5FWKK 2X6DA 3PSDA 4FRFA 1Q61A 4A06A 3O5AA 2CN8A 4IQ6A 5EM5A 4NK9A 4C35A 4MNFA 3WE4A 1G3NA 3CE3A 4EQMA 4ZOGA 4C4IA 5KMMA 2PZRA 4HCTA 4JR7A 5IH5A 4YJPA 2ITTA 3W0PA 4HZRA 4JJRA 5BX0A 4FEWA 4F7LA 3VAPA 4TKSA 1QCFA 4DCEA 4CV9A 4NM0A 2GHLA 2WU6A 5BVFA 5CVFA 5D41A 3QYZA 3DB8A 1OL7A 2WTDA 4LV8A 5EDRA 4WSYA 5AWMA 4QMQA 5ANOA 5E8XA 5A4EA 3UQCA 2AQXA 3HDNA 4JQ7A 3D14A 3TZ9A 2VWUA 3GEQA 1YWNA 4ZY5A 4EUTA 5DG5A 4O7RA 4AAYA 1OIYA 3I1AA 5AV1A 3C4WA 3F82A 5CTPA 3FXXA 3TACA 3SAYA 5C1QB 3K5UA 5IG1A 1OBGA 3MPMA 3LOKA 4E93A 5CALA 2Z7LA 4M97A 2A19B 2CGUA 3MTLA 3BYUA 2JIUA 1ZOGA 3PXFA 5CSVA 4ACGA 4DH8A 2XM8A 1KOAA 1YHVA 1BKXA 4UMPA 3WZDA 4NFNA 2PUUA 4Q5EA 5HX8A 4CYJA 4TWPA 3FQEA 3VVHA 3COKA 2C5YA 2P2IA 2BAKA 2IW6A 2NO3A 3IKAA 3MS9A 3QTIA 5B2LA 5EW9A 4AGWA 3GCPA 2RGPA 3ZOSA 2QOIA 3C4FA 3PXYA 4CKRA 4FIHA 2UW4A 5HVJA 2XIYA 4HJOA 3RPOA 4G9CA 4FGRA 3Q04A 5EHLA 3GU8A 4LOQA 5HIEA 4TZRA 3C50A 3FAAA 4W8EA 2XKEA 2J90A 3I5ZA 3DKGA 3QKLA 3R2YA 3ZDUA 2IWIA 3AC2A 4X2JA 5BV3A 5CWZA 5T68A 4ZZNA 3ITZA 3BKBA 4Q9ZA 5LCJA 1U5RA 2YIQA 2GQSA 4IFGA 1DM2A 3KY2A 3R1NA 2OZOA 4FA2A 4L46A 3VS7A 5J9ZA 1Q3WA 4CCUA 3NS9A 3PIYA 5HE2A 2J2IB 5IA5A 3E62A 4EBVA 1YI6A 5H9BA 3PG3A 3EH9A 5CSPA 3GQIA 3NUPA 5HKMA 3DU8A 2I0EA 1Q5KA 2F7XE 2XKFA 1CMKE 3SOCA 3E8DA 3S3IA 4YBJA 1ZYDA 4FK6A 4HGEA 4BR3A 3DJ7A 4BDGA 4D0WA 1YDSE 1PXNA 3BBWA 3UQGA 1PYEA 3GC7A 5FGKA 2IO6A 3A4OX 1IR3A 2WIHA 3KN5A 2R7IA 5JT2A 3DKCA 4EH2A 3LFEA 5AR3A 3IW6A 3POZA 2VV9A 2JKKA 4L45A 4IM3A 3S95A 4AXDA 3R73A 3D2IA 4NW6A 3VC4A 5BVEA 2C5OA 4CFMA 1WVWA 3K2LA 3LKMA 4BZNA 3UNZA 4ZLOA 3EL8A 4AZWA 2W1DA 2PZ5A 2C6TA 3V04A 3TM0A 3CD3A 1OMWA 2C5VA 4U44A 2FSLX 2WFYA 1UNGA 5AR5A 4YSMA 2GCDA 4TWCA 4O7SA 4E26A 1YI4A 4JDHA 1FQ1B 3EQFA 4RFZA 4D4SA 4IAIA 4Y46A 1OBDA 4G17A 5C8KA 3GU7A 1XH6A 1Y6BA 5AM6A 3FEGA 3AC1A 4WNMA 4UWYA 2W7XA 4YU2A 4YJVA 3QD2B 3VS2A 3JY9A 3FMHA 2YACA 4RBLA 2PMOX 5EFQA 3Q4ZA 3QYWA 5JGDA 2CNVA 1UNHA 1OB3A 2R0IA 1SMHA 3HKOA 4PNKA 2VWYA 4ZTNA 3QXOA 4C62A 3ZUTA 4A7CA 5FXSA 2EU9A 3DLSA 2W4KA 2JIVA 5HU9A 4L3PA 5HI2A 2VTMA 2JBOA 3FV8A 4GW8A 4FSWA 4QTCA 2ITOA 4CYIA 2JKMA 3FI3A 5LOHA 3NR9A 2W1FA 4FZ7A 3W2OA 1R0EA 1NVQA 2XCHA 4FODA 4BDAA 3CSVA 3W0RA 4C2WA 5KZIA 1OIQA 1VJYA 4FV4A