4A06A

Human pdk1 kinase domain in complex with allosteric activator ps114 bound to the pif-pocket
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
283
structure length
282
Chain Sequence
KKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
publication title Allosteric Regulation of Protein Kinase Pkczeta by the N-Terminal C1 Domain and Small Compounds to the Pif-Pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 282
sequence length 283
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4a06A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4a06A01
4E4LA 4GFOA 2PMOX 4EK5A 4XG8A 3GU6A 4FT0A 4RLLA 3K3JA 3FZTA 3W16A 4OAVB 3MESA 4AP7A 5AWMA 1WBOA 4EK4A 3GCUA 2W17A 4QMMA 4TRLA 2A2AA 2PZRA 2O63A 4QNYA 2PY3A 3ID6C 4UXQA 3C4FA 1H1WA 2YFXA 4BDIA 4JL9A 2ONLC 3RPYA 4B8MA 4CRLA 4CXAA 2UW4A 2RSVA 3CIKA 2JDOA 4YZBA 3VBYA 4YSJA 5KMJA 5I3OA 3F7WA 1UWHA 3ORIA 2X6EA 4FV5A 4U0IA 5DVRA 3Q52A 3C4ZA 4AGWA 5K4JA 4YSMA 4DTBA 2GFCA 3R83A 2CGWA 2YCQA 2PZ5A 3EFLA 1JNKA 4CMTA 5HBHA 4FF8A 3FMDA 4KINA 3T3UA 4L45A 2V5QA 4KIKA 5HTCA 3VRYA 2C69A 4JAIA 1NY3A 4QMNA 4FG7A 5GIOE 4FEQA 3F69A 3DK6A 3FLWA 4J7BA 4BDEA 2XBAA 3HRBA 3V6SA 1M2QA 3DJ5A 2FSOX 2A27A 3NYXA 1YWRA 5DT3A 3QFVA 4B6LA 4F7SA 2A1AB 2YERA 4X2NA 4DH8A 2JAVA 2RIOA 5M56A 2IG7A 2VGOA 1O6YA 1KV2A 1PMEA 4JR7A 2X81A 4CEGA 2C0OA 2J0MB 2HXLA 4O83A 4DG2E 4U41A 5CNNA 2BTRA 5CVFA 2VWYA 2UZDA 3RKBA 2BKKA 4O7LA 2ITQA 3COIA 1XQZA 3OVVA 4F9YA 1JKTA 2P55A 3MJ2A 5GZ9A 2X9FA 4MD9E 2DQ7X 2VWZA 4F9WA 1JSTA 2EVAA 4D1XA 4FGBA 3Q4ZA 3UOHA 3UVQA 1UU9A 4FKOA 4FZFB 5AUUA 5HU9A 2DS1A 4QTAA 4EYJA 5E8XA 2IVVA 4EQMA 5E90A 3WF7A 3LMGA 4BZDA 2VNWA 3A7FA 3QTRA 4K8AA 2JDSA 2IN6A 5ANDA 4DEAA 4GS6A 4LV5A 4IC7A 3R7EA 3DKFA 3VBWA 4OTPA 1EH4A 2WD1A 3TZMA 3IW7A 4BTFA 2ACXA 4ITHA 1KE9A 2VUWA 4DGOA 2JFLA 2PPQA 4DBXA 4BIEA 4D2VA 2YWPA 4PP9A 2YJRA 3QCXA 4LV8A 4RBLA 3C4WA 4X21A 3BU3A 3KVWA 3DQWA 3MVLA 1HCKA 4FTJA 4GVJA 4BKJA 3P86A 1XH9A 3DZOA 1Q97A 2BZIB 1WZYA 5IQCA 5HCXA 5JFVA 3PXZA 4AOIA 4ARKA 3BZ3A 4EKLA 5TKDA 4AZWA 4EZ5A 3ZFYA 1BI8A 3DV3A 4DGGA 2C5OA 3O96A 3GNIB 4E6AA 1M7QA 4L3LA 3FZOA 4W8EA 2OW3A 1FMKA 2A0CX 2GMXA 4DFXE 3NEWA 3DKCA 1CKIA 3F9NA 4KB8A 4OBQA 4PV0A 5CU6A 5GJFA 3RZFA 3S3IA 3HMNA 2YM8A 4WBOA 5I9ZA 3A2CA 4C34A 2AYPA 4J8NA 2GU8A 3EFJA 2VWXA 2CNVA 3EN9A 2BTSA 3ZC6A 2EXCX 2W4JA 5HG8A 2PWLA 5D1JA 2Z7RA 5HNBA 5HO8A 4FG9A 2QG7A 4NSTA 4FZDB 4F9AA 4MHAA 2B54A 4E7WA 2RL5A 4FKGA 1NVSA 2F2UA 5FTGA 2OJ9A 2BUJA 4BRXA 1H1RA 3A7GA 1PMNA 4YBKA 3TJDA 3RZBA 3IDPA 2QOQA 5CTPA 1H25A 2YDIA 2QODA 2VWUA 3CTHA 3WF8A 4EOIA 2JC6A 1OECA 4LOPA 1Q3DA 4G6LA 4M97A 5FP6A 4Z3VA 4BCIA 1WVWA 3BLQA 5HTIA 3KREA 1U54B 1KE8A 4OTRA 5DEYA 5H2UA 4YJVA 5F9EA 1FGKA 1V1KA 1YHSA 3F3VA 1H26A 5AP1A 5I9WA 5KKRB 2HK5A 3D83A 2C5NA 4EJNA 3R22A 2Z8CA 5T68A 3OTUA 4G5JA 3G6GA 3IOPA 2WGJA 1W0XC 4NT4A 4YTFA 5CF6A 3O71A 4I21A 5AIRA 4FTNA 3QUDA 1RE8A 3GFWA 1M14A 3DY7A 3LOKA 2QOHA 3I0QA 3F2NA 2WMAA 1ZMUA 3LXKA 3NUXA 5FEEA 2XYNA 5HESA 4V01A 3VBQA 4F9CA 3GT8A 5CX9A 2ITOA 4CLIA 1VYWA 1W7HA 1TQIA 2E2BA 3NWWA 4GMYA 3ZZWA 4C4FA 4AUAA 1H4LA 2YM4A 3KXXA 4ZTSA 4FT7A 3E63A 5HVKA 3VS4A 3QC9A 3DQXA 2XNOA 3F66A 4J8MA 2GSFA 4FSMA 4N0SA 2CKQA 5JFSA 2HWOA 2F4JA 5AR8A 4BCMA 3MFTA 3AMAA 1O6KA 3LXNA 2QONA 3AT4A 5FG8A 1TQPA 2ITYA 3COMA 1AQ1A 1VR2A 4RT7A 4XS2A 5ETFA 5ETCA 2PMLX 4F9BA 3IG7A 2X7FA 3G0FA 4X7QA 3R9RA 3U6JA 3NUNA 3TCPA 5K5NA 4S30A 4R7HA 1FPUA 1OPKA 3P5KA 5DGZA 3PA5A 5H3QA 2XKDA 5IUIA 4B9DA 3R7UA 4CFWA 3LMHA 4YJQA 4CFUA 3A4PA 4QP4A 3CJGA 5HD4A 1KWPA 1GZNA 1WVYA 2ETMA 4XG6A 2Z60A 4YPSA 3C4CA 4YJSA 5EH0A 3ZSGA 3OWKA 4QP3A 5E91A 5HBEA 5HEZA 2OFUA 3DNDA 2O0UA 1GAGA 4BL1A 3ZO4A 4CRSA 3FJQE 2I0VA 4O0UA 5JGBA 3FMHA 1JVPP 4YNEA 5CY3A 3RHKA 4D0WA 3PXYA 3KN5A 2Y4IB 4M8TA 2C5YA 2DWBA 4BDFA 4W4YA 4YZCA 4BWPA 5LWMA 4YO4A 1XBBA 4M66A 3S0OA 3VUMA 4JDKA 1OGUA 1UU7A 3HZTA 5CXZA 2BIYA 4FIEA 5HG5A 5JSMA 4LL5A 5JQ5A 2Y6MA 4HNIA 3U9CA 4RGJA 4ZSGA 4P7EA 4O0YA 5HIBA 4O27B 1OPJA 4KBKA 4I5CA 3TWJA 3KXHA 4ZMFA 1ZMWA 5HLPA 4Y85A 3U6HA 2ZAZA 3ACKA 3H9RA 2QCSA 3M1SA 4DFYA 3QD2B 3GQLA 1QPJA 2B52A 3IW4A 1H01A 3BV2A 4J52A 4O2PA 4QTEA 3NYOA 3HP2A 4A9YA 3JR1A 3MB6A 4TT7A 3RMFA 1V0PA 2UZUE 3VHEA 4D2PA 4YMJA 4GJ3A 4I93A 3NAXA 5CAUA 4U44A 5FRIA 4HW7A 4BN1A 4WNMA 4YPDA 3MS9A 3IQ7A 3A7HA 3QTUA 3QAME 4JI9A 4FTIA 3R8LA 5T6KA 4CKIA 1QPDA 3HMIA 3HDNA 4NUSA 4RX5A 4O0SA 2V7OA 1V0OA 3LE6A 4FTMA 3UZPA 4TYEA 3N4VA 5TT7A 3UG1A 2CLQA 3PG3A 3FMJA 3OBJA 3L8SA 1H0VA 3PRIA 4JIAA 2B0QA 3HRFA 4LG4A 1P5EA 3GI3A 2QOOA 3V8TA 5FBNC 4BDKA 2OI4X 4C2VA 3RAKA 2AC3A 4CT1A 1IAJA 5F4NA 1UVRA 2ITWA 4H3PA 1CM8A 3MTFA 2FVDA 5G6VA 3TNQB 4CMUA 3D2IA 3JUHA 3WZEA 4QT1A 2BR1A 2GTNA 4MD7E 2QO7A 4FUYA 4QPAA 2WIPA 3BU5A 4G16A 5CU0A 4QYGA 2NRUA 3DDPA 4IAYA 5I4NA 3QKMA 1M2RA 3ORNA 4GT3A 5CNOA 1M52A 2WEVA 3ENMA 4W4VA 5AX3A 3A8WA 4YGAA 4C38A 5IMEA 3NUAA 5K3YA 2J6MA 4ITIA 3ZFMA 5CT7A 2HCKA 2GFSA 4P90A 4BGHA 4CSVA 2VTAA 4HVGA 2SRCA 3TDWA 4BCOA 3KXNA 2BROA 2W5AA 2QLUA 4Q5HA 4F65A 4RPVA 4H58A 1BL7A 1APME 1IA8A 2CPKE 3LLTA 5CF5A 3F3WA 4L3JA 3PIXA 2WOUA 1RQQA 1Z57A 3ACJA 5IQFA 3Q60A 4FR4A 5M4IA 4D2RA 3QKKA 3RJCA 3VF9A 5A6NA 4CLJA 5IUGA 5T3QA 4H1JA 3N51A 1ZYDA 1RJBA 4FSWA 4U79A 3HNGA 1U5RA 2P0CA 1TQMA 2YIXA 2R3KA 4YTHA 2XJ2A 1SZMA 1JKLA 3C5UA 4YHJA 3S1HA 1IA9A 3C1XA 4FKUA 2F7ZE 3QX4A 3AXWA 3TUBA 4TW9A 1PKDA 2X39A 4WO5A 4ZJJA 4B7TA 4R7BA 1M7NA 5HIDA 5IQDA 4BCNA 2WU6A 3QU0A 3ETAA 1DM2A 3LCTA 4O7VA 3W8LA 5JQ8A 1ZZ2A 4G34A 4NJ3A 5L8JA 4AG8A 4KIOA 4RIWA 1OL2A 4D55A 5F20A 4E8AA 2J51A 2J0KA 4ITJA 3KF4A 4F6UA 2JIVA 3QUPA 4CV8A 3HECA 3MVMA 4MWIA 3V01A 4WUAA 4LUDA 3PRFA 3AOXA 2PE1A 3MI9A 4FSQA 2GCDA 4RWLA 1GY3A 4PNKA 2PHKA 5KKRC 4IB3A 5JGDA 1GIJA 2P2HA 3FPMA 2DYLA 4IAKA 3NCGA 4J1RA 4A9UA 1G3NA 1Q5KA 2ZM1A 3C50A 2R3OA 3GU4A 3VO3A 4CFNA 3H10A 4ENXA 1GZKA 4EH4A 4L68A 5CASA 2PVNA 2WQMA 2OK1A 3R04A 4D28A 2ITVA 4E20A 2C6EA 4CKJA 3N4TA 3OY1A 3OD6X 3VULA 3K3IA 4BB4A 5IA4A 5IQAA 4AA4A 3VF8A 2X7OA 3K54A 4BZNA 4KA3A 2UW0A 5FLFA 3LPBA 3RWPA 5AUVA 3TG1A 4YZDA 1OITA 3AC1A 3PYYA 4CT2A 5M44A 3CY3A 2OO8X 3EN6A 2HIWA 2R9SA 2REIA 4PDPA 2JIUA 4E5AX 5IKWA 3QTIA 4DA5A 1OB3A 2PVRA 1F5QA 4RWIA 4EOLA 3UJGA 4CFVA 3E3PA 3DBQA 2O2UA 3IPHA 2YDJA 3RCJA 2ESMA 2ZV2A 4F08A 3VHKA 4K6ZA 3CKWA 3R02A 4DBNA 4OTGA 1X8BA 2FUMA 2BRGA 3LQ3A 2FB8A 4IZYA 3QYWA 3NNWA 5H8BA 3HVCA 3VRZA 4BCQA 4ZSAA 2IZUA 1SM2A 3EYHA 2CMWA 2W4KA 3SOCA 3VW6A 4BCFA 5J1VA 4EKKA 5CAOA 1UV5A 5CZIA 5AV3A 5CLPA 4IXPA 3EQFA 4RJ5A 5IMXA 2UW6A 3H0ZA 3JY9A 4AT5A 4PTGA 2W5BA 4S32A 4F70A 2XK6A 5AP2A 2YM5A 4MYGA 3LFEA 4WG3A 3FV8A 4O7NA 3Q6UA 5EW8A 4F63A 5CF4A 4EHZA 5CSPA 2I0YA 3CXWA 2QVSE 4FSZA 4C59A 3PTGA 2F57A 2NO3A 2W9ZB 4FV1A 5HE3A 2CCIA 4FIJA 5JZNA 4CFFA 3PDTA 4KIQA 3SG9A 1DAYA 3R7GA 4NW5A 4QQ5A 5AFVA 1ZZLA 2R3MA 2Z7QA 2UVXA 4GIIA 1Q8WA 3LXLA 5JFXA 5A4TA 4GYIA 4GT4A 4PF4A 4IM3A 4R1VA 3VVHA 4X0MA 5FM3A 4EOMA 4IM0A 4IX5A 2R0IA 2J0IA 2XVDA 3BHYA 3Q96A 5GJGA 4CYIA 4FT5A 2C6TA 4N6YA 1YXXA 2EB2A 3QRTA 4FOBA 3VIDA 3R01A 2R4BA 4AW2A 1Y91A 1YI3A 4FKLA 4PMPA 2VTOA 4F7LA 3T8OA 4HCVA 4KUJA 3MGYA 3F3TA 3OFMA 1PXJA 2UZBA 2GNHA 5ANEA 2BZHB 4A4OA 3QZHA 4C4IA 3ZUUA 4FIHA 4CTCA 3U54A 4PL4A 3II5A 2NP8A 3HMPA 2OG8A 3UYTA 5A54A 5L6PA 4FVQA 4OTHA 5JEBA 2YN8A 3D5WA 2OKRA 3AC4A 3CGFA 3RCDA 3V8SA 4AT4A 1WBVA 4KABA 2LGCA 4ZY5A 5HD7A 2GHGA 2W96B 3DFCB 5GJDA 4F6SA 2XZSA 3KK9A 4AE6A 2WMRA 2CNUA 2OXDA 3LFSA 3PJ8A 1LP4A 4ANLA 4RRVA 5AV1A 4KSQA 4MEDA 3SLSA 2IVTA 5JKGA 3K2LA 4BY9E 4WRGA 5BVWA 3SDJA 2BFYA 3JYAA 3NUUA 4K77A 2R3LA 5EHLA 2IJMA 5IQBA 3OCTA 4W4XA 5IQIA 1Q24A 3MBLA 3FMEA 3SRVB 3QD0A 1Q4LA 3ORXA 4FT9A 2GNLA 4RJ6A 5DIAA 3VUIA 4CG8A 2C1BA 3BYUA 3BYMA 1ZRZA 4PY1A 4HGLA 4XHKB 4I94A 5ANGA 3TZ7A 5HNGA 4FTRA 5E8WA 3GOPA 4RQKA 4G2FA 3GU7A 4PPAA 2HXQA 5CAPA 2GPHA 2YITA 4E4MA 2QG5A 4PMMA 3EJ1A 4FICA 1IAHA 4FIFA 3MVHA 5LWNA 3CLYA 3JXWA 4EUTA 3UNKA 5EHYA 1ZYSA 3QBNA 3FMNA 4E5BA 5BYZA 5FXSA 1K3AA 2XK7A 5L6OA 5GHVA 3DXPA 1JKKA 5EG3A 4O7RA 4QD6A 5FGKA 4FEWA 3FI3A 4I41A 3MH1A 3WZKA 1XH8A 2G15A 3FMKA 4M84A 2YCRA 4F1OA 2XKFA 4WG5A 1LR4A 1Q99A 4RJ3A 3UIXA 4QP9A 3O23A 3WI6A 3I1AA 3CY2A 3SRVA 2H96A 2WTWA 4O0XA 5HORA 4YC3A 3Q9WA 4TYHB 4DAWA 1ZOEA 4XMOA 5CAQA 3RNYA 3IGOA 2R7BA 4TYIA 2WTCA 1G8AA 3JS2A 2VO7A 2X9EA 5LMAA 1UA2A 3TIZA 3QA8A 3NLBA 4USEA 1URWA 5EQEA 3OC1A 2JAMA 3BGZA 3QX2A 3E7OA 1UNLA 4RIOA 3RALA 2C6LA 3PZEA 4YUQA 1LPUA 3I60A 3NNVA 4NU1A 2PVJA 4FTQA 3D7ZA 4K1BA 1UKIA 5AIKA 5JMSA 3ATSA 2GNFA 4V05A 3RK7A 1XH6A 3TKHA 3R1YA 4DCEA 3C4EA 5IZFA 2QLQA 4IACA 2BPMA 3VUKA 5DEWA 3FL5A 5AAGA 3QCQA 2R2PA 5KBRA 5HGIA 4MQ1A 4YURA 3TEIA 2AUHA 4YHTA 4XV1A 5FEDA 4GFGA 3ZC5A 4RJ8A 1FGIA 1ERKA 3OP5A 4QNAA 4KKGA 4UMPA 2R3IA 4TYHA 3WIKA 3ALOA 5IQGA 1XHAA 5BPYA 3KXMA 3OEZA 5AR3A 5DT4A 3DK3A 5C4KA 5A4CA 1OL1A 4RX9A 5DRBA 4J95A 5JGAA 2WTJA 4OBOA 4E93A 1OKVA 4MAOA 3D5VA 3HV7A 2C6MA 5HLWA 2GTMA 3LFBA 4C35A 3PPJA 4G6OA 2PYWA 5EYCA 4FKRA 3QRIA 4IAZA 2W4OA 3Q3BA 5D7AA 3KULB 4BDHA 2BRBA 4NCTA 1PMVA 4QPSA 2CN5A 4YLKA 4R77A 3CPBA 2FO0A 3SXFA 5AUYA 2ZDUA 2HZIA 5LJJA 5E1EA 4QMSA 4C4HA 4DGNA 2OF2A 4DLJA 2OXYA 4DITA 4FK6A 4G9RA 4IAAA 3FY2A 3AT2A 4XP3A 4JLCA 5CSVA 3O8TA 3R63A 2CKPA 2W99B 3ZONA 4A07A 4G17A 3HA6A 4EOSA 4YTCA 5C1QB 2JLDA 5F1ZA 5AEPA 1E9HA 5EDRA 2UZEA 2VTJA 3BKBA 3HLLA 2YJSA 2C0TA 4UV0A 4Y83A 5CEIA 4XG9A 1B39A 1OKYA 3PPKA 4QRCA 4IJPA 2PL0A 3LJ1A 3OMVA 5CVGA 1U59A 2HY81 3Q5IA 4JS8A 3UO6A 4L9IA 2V0DA 4GFMA 5KHXA 2XF0A 3FZRA 2WQNA 3OF0A 4ZZMA 4C2WA 4TNBA 1QPEA 3KXZA 2BAKA 4XJ0A 4PX6A 3KULA 4D1SA 1ZYJA 3G33A 4FC0A 1YQJA 2W1DA 3QQGA 4M7IA 3LMIA 4HYIA 5IPJA 1CKPA 1Z5MA 3MIAA 2GQGA 3IW6A 3I6UA 3V5TA 3AMBA 3EQBA 3PJ1A 4CQGA 1WFCA 2EXMA 3O50A 3R8PA 3QTXA 1FBNA 4J71A 3BHTA 3TZ8A 4KAOA 3F88A 3DBEA 4PMTA 3Q4TA 2O3PA 4FKTA 3FLSA 2X8DA 4JBOA 3FXZA 2BRNA 4ZSJA 4DFBA 3ORZA 4Z16A 4XV9A 5E8ZA 4O7TA 3DJ6A 2H34A 3VUTA 4QYHA 3VNTA 4GSBA 4Y5QA 2VAGA 3RPOA 4N6ZA 3ERKA 3OXTA 4WOVA 3HMMA 3MYGA 4HJOA 1BUHA 4IZ7A 4YZMA 5HVJA 3TN8A 5DOSA 3CTQA 4QMZA 4U6RA 2BAJA 2V22A 3BCEA 3UO4A 3UP2A 4R3PA 1REJA 3W10A 3NSZA 5J7HA 2Q83A 1OMWA 3FKLA 2CHLA 3TNIA 2GNGA 3VC4A 5LQFA 3ZUVA 4FV0A 3ZO1A 5H8EA 4MNFA 4MXYA 3FZPA 4G3GA 3S00A 5CEMA 4JDHA 2W1HA 1Q41A 3TM0A 1R78A 4EC8A 2PVMA 1ZOHA 2PMIA 3ORMA 5BVKA 2G2HA 5DI1A 2G9XA 3OW3A 2XYUA 2VGPA 3RVGA 2RG5A 1ZWSA 4W9WA 4K33A 2OF4A 4USDA 4HZSA 4OTFA 3WZDA 2OSCA 2BHEA 1U5QA 4D4YA 5IEYA 1GIHA 4L44A 5JRQA 2H9VA 3UOJA 3FZSA 1OL5A 5B7VA 4H05A 3KA0A 3QUEA 4RVTA 3KRRA 4WD5A 2VV9A 4QQCA 5EM6A 2O65A 1KUTA 4D2SA 3KF7A 1CDKA 4QP1A 5CEQA 4M0YA 3UIUA 5LVLA 2ZMDA 4U5JA 4E5WA 2OFVA 2R3JA 4LOOA 4EONA 2YM3A 5JRSA 2X4ZA 3KKVA 1LUFA 4TWNA 5BUJA 4JIKA 4IVCA 5AMNA 1CKJA 3PG1A 5KMNA 3KRXA 3O2MA 3QXPA 4BR3A 1KOBA 4IANA 5EKNA 4Y46A 2P33A 4ZY4A 3L9MA 3PWYA 4HVDA 3S95A 3FSKA 1T45A 3QD3A 3QQHA 2HENA 3PP0A 4AN3A 2O8YA 5EHOA 4FKVA 4BIDA 2B9FA 5HE2A 3QLFA 4EOPA 4UMUA 4CYJA 4MF1A 3REPA 3S2PA 3W8QA 4D9TA 5DR2A 2EUFB 2J0JA 2XIKA 4XBRA 4GG5A 3ZCLA 4XG2A 5HQ0A 1YRPA 3M42A 3BWJA 4XP2A 1TVOA 4DFLA 5DMZA 4BKYA 3QD4A 4I20A 5IISA 3EQPA 3NMUF 4ONAA 1W83A 4JX7A 4AOJA 1OL7A 2W06A 3KRJA 3DDQA 3LAUA 5AJQA 1WBSA 4RVLA 5D7VA 3FI8A 4JRNA 1S9JA 2F49A 3I7CA 3PUPA 2ITZA 5M53A 4U7ZA 4IVDA 3HRCA 4NTTA 5AUTA 2IZRA 4NTSA 3P79A 2XBJA 4GUEA 4TYJA 3W2CA 3E8DA 3OT3A 1CSNA 2BILB 2W1FA 1PJKA 3R1NA 4U43A 3WZJA 1REKA 3LKMA 3UDBA 3DXQA 3O0GA 4CZYB 4D9UA 4UMTA 5K0KA 4D1ZA 4OGRA 2X8IA 4O0VA 3IW8A 4EEVA 3MA6A 3QF9A 1R1WA 4DT8A 1OIQA 4A7CA 5C03A 4YJRA 4FTUA 4NCTC 4D4RA 4O84A 1P2AA 1A06A 5TE0A 4IFGA 4BDCA 3LJ0A 4FK3A 3ZHPC 5M09A 5F95A 3L9NA 4CVAA 2C6OA 4JQ7A 3UMXA 1A48A 3CE3A 2UW7A 3DOGA 2H8HA 3ODZX 1Z9XA 4ZTMA 4FL2A 2FSMX 3H3CA 4XOZA 4I1ZA 5CENA 4EI4A 3Q4CA 3N9XA 3HV4A 1YI4A 2GHLA 2PZYA 2QOLA 3QTQA 4BCJA 4RFYA 4BI2A 5C8KA 4IMYA 4LL0A 4AU8A 5IQHA 5FEQA 2XS0A 3QA0A 1J1BA 2IZSA 3H9OA 4F99A 1MP8A 4NL0A 2OLCA 4IVAA 1PXLA 5GIPE 5C9CA 2Y7JA 5CSXA 3EFKA 4YNOA 2OWBA 3LLAA 2Y0AA 3MFUA 4JDJA 4O0WA 3W1FA 3ZLSA 2WQOA 5JZJA 4AA5A 3ZSIA 4QMQA 5I0BA 2G1TA 3R21A 3VS5A 3VW8A 3Q9YA 3PY1A 3RINA 3N4UA 4MTAA 4CV9A 5D11A 4UMRA 1XBAA 4O0RA 3OS3A 3SHEA 2JITA 2WIHA 4JVGA 3PVBA 3Q53A 3G9NA 5E4HA 3OZ6A 4XP0A 4YJOA 5C4LA 1YOMA 2PTKA 3NW6A 3PA4A 5HE1A 4QP7A 4RSSA 4ZK5A 2XIYA 3NNUA 3HDMA 1FVVA 1ZXEA 4LMUA 3ORKA 4FNWA 4RJ4A 4CG9A 4ZTNA 2BKZA 2X2MA 3KK8A 4AGCA 3EOCA 5DE2A 2RG6A 2ZM3A 3E7VA 4BDBA 5HX8A 3BIZA 3NS9A 1SYKA 3IS5A 3KMWA 4M12A 4PPBA 5CSHA 3GENA 1BYGA 3R9NA 4QTBA 4LQMA 5DN3A 5D12A 5AR5A 4HYUA 5J9LA 3TT0A 4UY9A 1I44A 3MN3A 2CGXA 4XV3A 2CKOA 2ZDTA 1TKIA 4HYSA 1H07A 5K9IA 3I5NA 3BLRA 2PK9A 5IEVA 1M17A 3LJ2A 3E8CA 5ETAA 5I3RA 3BI6A 2ETKA 1JOWB 1YKRA 1YXTA 2JKOA 2QHNA 2XK4A 4IX4A 1GJOA 1R39A 3MA3A 3NZ0A 3DBFA 1U4DA 2CN8A 5LVPA 4FEUA 2KULA 2W1GA 4CGAA 2JIIA 3ZEWA 5ITAA 5IEXA 4IWQA 2E9OA 2HY0A 3AC2A 3QQJA 2WMQA 3U55A 4KBAA 2ERZE 4O7YA 2QR8A 2VTMA 4I6FA 4F6WA 3LCDA 3FLZA 1H28A 4QYFA 5JT2A 4F4PA 2KTYA 4C61A 2EXEA 4R5YA 3IOKA 3HUCA 4II5A 2VWIA 3AD5A 5D10A 5BMMA 2C3JA 2EWAA 3OUNB 4HPUE 4TYGA 3BBTB 4LYNA 2IVUA 3KFAA 4GIHA 1RDQE 2CLXA 2JBOA 4I4EA 3BBWA 3WE8A 3AD6A 3LCKA 3HEGA 4KS7A 4LGDA 4V0GB 3ZYAA 5M4UA 3E64A 4GCJA 3PXFA 5H8GA 4ZEGA 1KE7A 1PMUA 5J7BA 5KMOA 1T46A 1FINA 2OGVA 3VS2A 3KCKA 1F3MC 1PRYA 5DH3A 3OBGA 4MXCA 4HPTE 4AS0A 4EH2A 1IG1A 4UN0C 4JOAA 4O21A 4QMTA 3TUDA 5AUZA 4L01A 4ALUA 3UOKA 4YJTA 3KRWA 3TV7A 5J1WA 2PU8A 3NCZA 4QMYA 4RC4A 3JPVA 4C33A 4IAIA 2PSQA 5HO7A 4ANBA 5E92A 5L2WA 4GUBA 3SD0A 4EZ7A 4RFMA 3K5VA 3R8VA 3WF5A 3OROA 1JKSA 1I09A 3CQWA 3MFSA 2VU3A 1PW2A 4FKQA 5ETIA 4A06A 4X6QC 1DI9A 4EOKA 2WMXA 3MY0A 4FSNA 3R71A 4QMPA 2PVLA 5A4EA 1H24A 4M68A 3GCQA 5FM2A 4QQJA 3A61A 4GL9A 4L43A 4IX3A 5HO6A 4AN2A 5KMMA 2J9MA 3GC7A 3CEKA 1QPCA 3F6XA 3B2TA 4V0GA 4XLVA 3UZTA 2C5VA 4S2ZA 4KSPA 5DPVA 4QP8A 3SX9A 3MH2A 4GH2A 2V7AA 2BAQA 4RC3A 4I0RA 4CFMA 3LFAA 3C0GA 4P5ZA 3E62A 4RIWB 1G5SA 3RPRA 5L8KA 1VZOA 4JAJA 4XLIA 4UX9A 4AW5A 4NM3A 3QCSA 4L8MA 3PIZA 4GRBA 3F82A 1R3CA 4O1OA 4FOCA 5DA3A 2YZLA 3GGFA 5TO8A 4EHVA 4MXZA 4DCAA 4BDDA 4OAUC 4OBPA 3KC3A 4XBUA 1WBTA 3L9LA 4YO6A 5A46A 4KWPA 4QTCA 4QQTA 5BVDA 2BVAA 4YZ9A 2G2FA 4OTWA 3QC4A 3NW5A 5GNKA 3NYVA 5E1SA 1NVRA 3UTOA 3VS3A 5A4QA 4TZRA 3W2RA 3EQCA 3FHRA 2X2KA 1FVRA 1UU3A 3VN9A 2C3KA 3ZRMA 5K4IA 2B9HA 3GFEA 4FIGA 4FSTA 3V3VA 4WSQA 4AT3A 2Y9QA 5KUPA 3AD4A 2W7XA 4PL5A 1L3RE 2ZV8A 3K5UA 2RFEA 5L6WL 4AQCA 4EH6A 2QKRA 3SW4A 5KZIA 1FVTA 3RK5A 2C3LA 4D4SA 5J5TA 3PXKA 5A9UA 3ORPA 5IG1A 4UALA 4PTCA 4OTIA 1J7UA 4YLLA 2Y4PA 5FD2A 2YDKA 2PUPA 3Q6WA 4NFMA 3P7CA 4GG7A 4F0GA 4B4LA 3O17A 5DRDA 2BDJA 4IDVA 5CEOA 3R8MA 3QTZA 3RPVA 4O82A 2QQ7A 3LFFA 3DLZA 4YBJA 4AFJA 2JKKA 2VX1A 4KS8A 4AW0A 4EHGA 5DR9A 3JY0A 2A19B 3A7IA 3IONA 4GK3A 5JFWA 4X6RA 4FKWA 4DH7A 4BZOA 5HOAA 4GK4A 2WU7A 2XRWA 5LOHA 2GHMA 2UVZA 2XA4A 4LRJA 4FG8A 3UVRA 4D2WA 2QOCA 4GW8A 4O96A 4OW8A 4ZJIA 3CTJA 2Z02A 5CXHA 3ZO3A 3WILA 4OUCA 4Y8DA 1WMKA 2YLFA 3U9NA 1H0WA 4F7JA 3Q04A 5EYDA 5KMKA 3SXSA 3D7TA 5CU4A 5CALA 4BDJA 4LFIA 4FEXA 3PXQA 3UIBA 5L4QA 3HV3A 3MTLA 5GINE 3F61A 3TV6A 1YW2A 4PDYA 1Y6BA 5C26A 1KSWA 3H4JA 4JG6A 5AX9A 2BRHA 4C4JA 2IW8A 1NA7A 4ACMA 4FT3A 4FE2A 3DB6A 4KNBA 5EM5A 4M69A 3R6XA 4IWPA 5FXRA 4R8QA 5BX0A 2XMYA 3PLSA 4RQVA 4R7IA 2C5XA 4J99A 4ZLZA 5D9HA 4YJPA 4C7TA 2ERKA 2OIDA 4FL3A 2W9FB 4RA4A 5HNIX 4DLIA 2I40A 3MY1A 3OOGA 4XX9A 5AP7A 3ZEPA 5KE0A 4WNPA 4WT6A 1P14A 3FBVA 4OTQA 4CKRA 5GZ8A 5K5XA 3BQCA 3DZQA 4NKSA 4DYMA 2WHBA 4XG4A 1GZ8A 3P9JA 3D4QA 2GNIA 3T9IA 2OJGA 4A4LA 4XEYA 4R3CA 3HUBA 3RAIA 3G90X 4GYGA 5KX8A 4ANQA 5L2SA 3RK9A 4RIYA 5BUIA 3U4UA 4E4NA 5IH6A 2OH4A 4MXAA 5KHWA 3I6WA 3F7ZA 3ZXTA 4X2JA 2PVKA 3VBXA 2WB8A 3MSSA 5CEPA 4IZAA 4L67A 4EK3A 4PL3A 3R1SA 3CC6A 5DNRA 4TWCA 2XM9A 4IHPA 4DTAA 3U87A 4MK0A 3VJOA 1Q62A 3RM6A 5AR4A 1PYEA 4NEUA 2BRMA 5KZ0A 3LFQA 3FMMA 4J53A 3VQHA 3E8NA 4RLKA 1K2PA 3QYZA 4OR5A 4WRSA 4FV3A 4XRLA 3I7BA 3O51A 2WMBA 1H1PA 2XKCA 2H6DA 4RFZA 4AE9A 5CVHA 2C3IB 1Q8TA 1UKHA 3AG9A 3VAPA 2YIRA 3G5DA 1ATPE 2C4GA 5IQEA 3SW7A 4DH1A 4C4GA 2YWVA 3L9PA 3CR0A 4ACHA 3EQGA 2JGZA 3THBA 3OG7A 1O9UA 2XEYA 2QU6A 4NK9A 3LFDA 3QWKA 3R1QA 3ZUTA 2UW5A 3EQRA 3POOA 1URCA 3EL8A 4OLIA 4F1TA 3R7IA 1SNXA 1Y57A 4WBBB 3WYXA 3E5AA 5J5SA 3BEAA 3QTWA 4FL1A 2W1ZA 5E8VA 1JAMA 3C13A 3RBWA 3JVRA 2VO3A 3EKKA 2VTQA 3EQDA 5AP0A 3H30A 1OKZA 1UWJA 4H36A 1SMHA 4G3DA 5ANIA 5EYKA 3FAAA 3UNZA 5DBXA 3ZLXA 4IWOA 4CMOA 3BYOA 4RC2A 5I9UA 4ASEA 3OXZA 2QD9A 3NUSA 3PXRA 2XUUA 4O91A 3QZGA 4U9AA 3V5WA 4O86A 4ZZOA 2CJMA 4DH5A 2PVFA 4ZIMA 5EM8A 5L2QA 4AZSA 3MWUA 5HTBA 1Q8YA 2I6LA 4PTEA 4XNEA 4XH6A 2PMNX 4HGTA 3BLHA 3QZIA 5CQUA 3FL4A 4ZY6A 4FV9A 3FDNA 3EHAA 3LW0A 4IE9A 4UYNA 5EQYA 3UE4A 5AM6A 4NIFA 2B4SB 4W4WA 4AZTA 3FI4A 5L2IA 3UQFA 5LXMA 3KVXA 1PXIA 3SV0A 2QU5A 5TOZA 5HX6A 3RNIA 3C9WA 3D2KA 1WBWA 1MRVA 3L8VA 3DBDA 3KMMA 3VS1A 4DEGA 5M06A 4ENYA 3P08A 1PXMA 3KXGA 2RF9A 4QTDA 3D14A 5H9BA 1IEPA 4R5SA 4DHFA 2R0UA 2VX3A 4MCVA 5FDXA 3SOAA 3SQQA 1UU8A 5AP3A 4DFUA 3UMWA 3ZBFA 3Q2JA 5CU3A 4BF2A 1J7IA 5HG9A 2JDVA 4W9XA 2IW6A 2IO6A 3P1AA 2ZVAA 1MRUA 2GS2A 3UVPA 3PSDA 5EDPA 4LGHA 1HOWA 5M57A 2IWIA 2VNYA 2X8EA 4AXAA 5M4FA 1NXKA 3LCSA 2UW8A 4N4SA 2BALA 4K2RA 4FTTA 3BU6A 3P7AA 3VWAA 3EN5A 5J95A 4JJRA 4ACCA 3MIYA 1H00A 3FYJX 4QMUA 3CP9A 4UXLA 4HOKA 3AT3A 5AP6A 2IZTA 3UYSA 3V5QA 2R3RA 2UZTA 2PULA 4BCHA 2QOKA 3PJCA 4EC9A 3W2OA 3R9DA 4BHZA 4IB1A 3U8WA 1NW1A 5AR2A 4F7NA 5GZAA 2OJIA 4PRJA 3I81A 4WG4A 2WELA 2ZB1A 2XNBA 5IA5A 4E73A 2RGPA 1PXKA 1PYXA 4MNEB 1H1SA 2OU7A 2BMCA 4FV6A 4IJ9A 3DKGA 3ET7A 2C0IA 5ANKA 2YIWA 5DHJA 3KCFA 5CEKA 2CCHA 2RFNA 2YAAA 4MXOA 5BMSA 4XYFA 1UNGA 3DGKA 3TZ9A 3NYNA 3ZBXA 2OJJA 3PVGA 3FLNC 4WUNA 4AZEA 3WE4A 5A6OA 1DAWA 4RVKA 3QGYA 3LM0A 3R28A 3L8XA 4A9TA 4QYYA 4Z7HA 2JBPA 5A4LA 3TNPC 2P2IA 4ZXTA 4O7ZA 3TACA 3QXOA 3TTJA 2HAKA 4RZVA 5IA1A 3O7LB 5JH6A 3NPCA 4LMNA 3ENHA 2PUNA 2GQSA 2WEIA 4RG0A 4LM5A 1W82A 3BGQA 4QMLA 2C6DA 3RM7A 1ND4A 1STCE 2XNNA 2B55A 2FSLX 4R3RA 5C27A 4FA2A 2WAJA 2X2LA 1YXVA 4B99A 3UZRA 5J9ZA 4MNEA 4Y95A 4EBVA 4EWQA 5CQWA 3HKOA 4A9RA 5I9XA 1W84A 4YHFA 3HL7A 3C0IA 4L42A 2XRUA 3OCGA 4DTKA 1PF8A 4IX6A 4GT5A 1ZARA 2R3PA 3QHWA 4FTLA 4YC6A 4CQEA 4EHEA 4ZS4A 2R3FA 3BPRA 3ATTA 4QMXA 4D5HA 2J4ZA 5IH5A 4JR3A 3E8EA 4O22A 4JQ8A 4I23A 3DAJA 4YJUA 3PE2A 5CF8A 3OY3A 1OUYA 3GB2A 2JEDA 3B2WA 3MY5A 4G3EA 4XUFA 2X0GA 2C6KA 2WMSA 3A99A 3ULIA 2C68A 2YEXA 3A7JA 3TUCA 3UGCA 3DK7A 4ZLOA 2WKMA 2UUEA 3FXXA 2XNEA 3RGFA 3QCYA 3FE3A 4IW0A 4HVSA 2QI8A 2WMUA 3V04A 4EJ7A 3ZM4A 4IB0A 1LEWA 3FUPA 3KL8A 5EI2A 3WF6A 2ZB0A 3HAMA 3POZA 2QOFA 3D9VA 4FKJA 2VO0A 4NWMA 3QHRA 4HCTA 4TTHB 5HBJA 3HGKA 4DEHA 1CMKE 1HCLA 3IKAA 4RWKA 4UEUA 2YLEA 5FTQA 3F2AA 3NGAA 4E6QA 3ELJA 4KRDA 4LRKA 4L7SA 3VS0A 2I0EA 4M15A 2Q0NA 4MWHA 4EK6A 2WMTA 3S4QA 2WO6A 1J91A 5LARA 3W32A 4XG7A 1XH4A 5FTOA 5J87A 1CTPE 3OXIA 5A14A 3PY0A 4MXXA 3F5GA 2WMWA 2XIXA 3FQHA 2HYYA 1ZLTA 3BELA 3DFAA 3I5ZA 4FZ6A 3C7QA 4GEOA 4I5MA 4QYEA 4TY1A 1XH7A 2V55A 4F09A 4BI0A 4NFNA 5KBQA 2R3HA 4KBCA 4ALWA 4U80A 3MH0A 4GKIA 3R9HA 4I6QA 3ITZA 5B2KA 2F2CB 3U6IA 5FWKK 5FUTA 2XIZA 5DG5A 3PZHA 2QNJA 3FZ1A 3HV6A 4ANNA 4NH1A 2PE0A 2CDZA 2YCFA 4Y5HA 3FPQA 5FDPA 1DS5A 2UZOA 3CSVA 2WZJA 1JLUE 2XP2A 1DI8A 3DPKA 4FODA 3BQRA 3ZDIA 4O7SA 4I24A 2DUVA 2GNJA 1W98A 4G6NA 5HE0A 3KQ7A 5EFQA 4X3FB 5LVNA 1BKXA 4ID7A 2ZV7A 3C4XA 2UV2A 3MFRA 4FNZA 3A62A 3OT8A 2QKWB 3TNWA 2Z7LA 2XNGA 1PXOA 5EOBA 3DXNA 4ZS0A 3RAWA 4PDOA 2XK9A 3MVJA 2ZV9A 2G01A 3A60A 1V0BA 3IGGA 3V5LA 4DFNA 3CKXA 2QC6A 3F5PA 1ZYLA 3ZRKA 3GQIA 2IPXA 1W8CA 4QMOA 4F0IA 4NZWB 4DGLC 5CS6A 4FVPA 3F2RA 4RWJA 4ZSLA 1XR1A 4QMVA 4EWHA 4KIPA 3ZH8A 4L52A 4BTKA 1IRKA 2E9UA 3ANQA 3OWPA 4S34A 1YXUA 4UWYA 3W18A 3NW7A 4TPTA 4DFZE 3AQVA 4MF0A 3SA0A 2J5FA 3L1SA 3OHTA 4X3FA 2OBJA 3V6RA 4EQUA 4FBXA 2VN9A 4ERWA 4BCKA 2B9JA 2O64A 4S33A 5AP5A 4G1WA 3OTVA 4ACGA 3VQUA 4ANSA 2WTDA 3EYGA 1OZ1A 3CGOA 4RMZA 5FBOA 2W1IA 5FXQA 3SVVA 2VTRA 4FV7A 3D5XA 3TXOA 4JQEA 4UMQA 2VWBA 2CGUA 4K9YA 4EH5A 2VX0A 5ANJA 5ACKA 3BX5A 3VS6A 3F3ZA 4G31A 5KO1A 1PXPA 4Q5EA 4XRJA 4ZTHA 4CCUA 4G3CA 3I4BA 3R00A 1ZY4A 4UBAA 4FTKA 3UC3A 5HKMA 4DEEA 4C58A 4IFCA 4WNOA 1QMZA 3MPTA 3NDMA 3DTCA 4NM5A 1H08A 4IM2A 4UB7A 5CSWA 3P7BA 4BI1A 5IDPA 3D5UA 2XJ0A 4FSUA 4S31A 3E88A 4FYNA 1OL6A 3O7LD 5J9YA 5TF9A 2XJ1A 4ZTLA 3R2BA 2YIQA 4WA9A 2VTNA 3UODA 5L2TA 5BYLA 1WVXA 3PWDA 4TNDA 3DJ7A 3FQSA 2CNQA 2X7GA 3SAYA 4ERKA 2R3GA 1E1XA 4BWKA 5DYJA 1JQHA 3HX4A 4R6VA 5J79A 4P2KA 3WIGA 4F0FA 4M13A 4H3QA 5E8UA 4FYOA 2HZ0A 2ITXA 3PP1A 3VBVA 3BYVA 1XKKA 3W2PA 4F64A 3VUHA 2W05A 1OIUA 4APPA 4EQCA 1PXNA 4FV2A 4IIRA 2FH9A 5HG7A 4D5KA 3GEQA 2Z7SA 3F5XA 4O81A 2BZJA 4MBIA 4KD1A 4G9CA 4YTIA 3OUKA 2YZAA 2PZIA 2I0HA 5I9YA 2Y6OA 4AF3A 3FC1X 4EH3A 4M14A 3EMGA 4JNWA 4RJ7A 2OZAB 3FYKX 2B9IA 4U8ZA 3VJNA 4USFA 5IA3A 5IUHA 5K0XA 1U54A 4YC8A 3E3BX 4CCBA 4X2GA 3FLQA 3LHJA 5HU3A 1VYZA 4DINA 3ZXZA 3ORLA 3GCSA 2OIQA 4C0TA 3Q9ZA 5HCZA 3O8PA 4BYJA 3UBDA 2YIYA 4AACA 4IH8A 3CQEA 2XK8A 1Y6AA 2WNTA 3H9FA 4FKIA 2FGIA 3FKOA 5AV2A 3VUGA 2W5HA 3T9TA 3W55A 5B0XA 2B53A 1QL6A 1GIIA 4I0SA 3IDBA 4ASDA 1BI7A 5D41A 3QRJA 4TXCA 2BDFA 3KY2A 3WBLA 4P5QA 3R2YA 4I22A 2J50A 4EL9A 3DKOA 5EDQA 4E1ZA 4YU2A 4R78A 4Y73A 3CBLA 4MBLA 3TKIA 4BYIA 4EYMA 4ASXA 2OZAA 2P3GX 3P23A 1ZMVA 3TNHA 2EB3A 2VTSA 2VTIA 2VTHA 4MX9A 5BVFA 4AW1A 2JDTA 4FX3A 3NVKI 2PUIA 3RTPA 4WSYA 5LVMA 3PA3A 4FZ7A 3GU8A 3DNEA 2R7IA 2YAKA 3Q5ZA 1P4OA 2R3NA 4XOYA 4BCPA 5KMLA 4UZDA 4PPCA 2YM6A 4FMQA 5DLSA 1OM1A 4GU6A 1NT2A 3FI2A 2HW6A 2QO2A 2ZM4A 3MB7A 4C3RA 4C4EA 4L6QA 4R1YA 4A4XA 4F1MA 3ZTXA 4HZRA 3ROCA 3CPCA 3QLGA 3ANRA 3AC5A 2WTKB 4JDIA 4E4XA 1Q8ZA 2Y8OA 4EK8A 5BVOA 2BIKB 3HYHA 4H3BA 4JBPA 2O5KA 4C62A 4WIHA 3EN4A 2ITTA 1P4FA 3KMUA 1FMOE 3LM5A 1KE5A 3UQCA 3WARA 3AGMA 4O38A 3V5JA 1YDSE 2VTLA 3NUPA 4ALVA 4FTOA 1Y8YA 4MKCA 5BVNA 1YHVA 1MRYA 3GC0A 4TKSA 3H0YA 3OCSA 1AGWA 2UVYA 2WPAA 4GJ2A 4D58A 1G8SA 4JBVA 4FNYA 1KV1A 1OKWA 2Z2WA 3DT1A 4H39A 4AFEA 2Q0BA 4AWIA 5TR6A 3ROYA 4JXFA 4D0XA 2OZOA 2W1CA 3PVUA 3PLAE 4WNKA 1ZAOA 4HVIA 3SGCA 5FQDC 4E6CA 3PSCA 3ZS5A 4FV8A 2W1EA 1KE6A 4ZTQA 5DFPA 4BICA 5CAVA 4IEBA 3ZSHA 5LCJA 4PQNA 4AGDA 3G51A 3NIEA 4O1PA 4X3FC 4FTCA 3BV3A 3PJ2A 2I1MA 4L00A 3C51A 2J7TA 3KRLA 5EW9A 1OBDA 4DE4A 1MUOA 3B8QA 3TL8A 4ZZNA 1YXSA 3LIJA 3B8RA 5AAFA 1S9IA 2LAVA 1Q3WA 2XNPA 1BL6A 2GS7A 2WTVA 5CU2A 2WOTA 1SVGA 4BC6A 1MQBA 3EIDA 1H8FA 2HZNA 2JKQA 3NRMA 3U51A 4I5PA 5ACBC 4DF3A 3PIYA 4J96A 4L7FA 2PVHA 2XH5A 4QMWA 3TJCA 3F5UA 5CZHA 4YZNA 3UPXA 1IR3A 4E26A 4FKSA 4BIBA 2GDOA 4QO9A 3G15A 3AC8A 1AD5A 1J1CA 4E3CA 1JSUA 3V8WA 1ZYCA 1WAKA 3HP5A 1YOLA 3E93A 4M0ZA 3R7VA 5B2LA 3BHUA 1B6CB 3F3UA 3OEFX 4PMSA 3LQ8A 4GV1A 3ZU7A 3D7TB 3BRBA 5M55A 4BGQA 3WF9A 2ZMCA 2WFYA 4FI1A 2JFMA 2QOIA 4GU9A 4TN6A 3ZFXA 5LMKA 4NW6A 2E9PA 5CT0A 3RWQA 2CGVA 3SC1A 3ZRLA 4HNFA 3EZVA 4GVAA 4Z9LA 5LMBA 2UZVA 4RX8A 1BLXA 1VJYA 2VRXA 3EWHA 3G9LX 4V04A 4X2KA 3BHVA 4Q2AA 2BHHA 3NIZA 4M69B 5EKOA 4IZ5A 4MVFA 3QQUA 4CD0A 4I0TA 3QALE 4YR8A 4EORA 4DC2A 2YHVA 4FVRA 1VEBA 4U45A 4AOTA 1YWVA 3DLSA 1H27A 3LXPA 5J8IA 3KEXA 5HIEA 3A4OX 5I5ZA 1BMKA 4DGMA 2PVYA 2BZKB 4DEBA 3Q32A 4JBQA 3ZM9A 2X4FA 1XWSA 3DCVA 2R3QA 4RIXB 5DWRA 5M4CA 5E8SA 5AP4A 2XNMA 2UZNA 4QP6A 5ANOA 3BYSA 1FOTA 1OI9A 4IBMA 2F9GA 3DAEA 5M51A 4U42A 4BTMA 4U81A 4ACDA 4YLJA 3R7OA 5HCYA 4RIYB 4X3JA 2QO9A 4FUXA 4RVMA 5DR6A 4DH3A 4Y72A 3FSFA 1ZOGA 2WTIA 4FTAA 2F7XE 2WMVA 3MV5A 4FZAB 4JG7A 3SXRA 4AGUA 5IA2A 5M08A 4RA5A 4NYEA 3CS9A 4HGEA 4OT5A 4DT9A 2OIBA 1OBGA 2C47A 2VD5A 1OIRA 4HGSA 3EH9A 3ZLWA 3R8ZA 3FLYA 3LVPA 4IADA 5JK3A 4HCUA 2ITPA 2J2IB 1OIYA 5LCKA 3EFWA 4EH7A 3TTIA 3R9OA 1SVEA 5AUWA 3P0MA 3GBZA 3MPMA 3WZUA 3D15A 3HAVA 5EI8A 3M11A 5G1XA 4RIXA 5C8MA 1WBNA 4U97A 1Q8UA 1WBPA 2C1AA 1KOAA 4ZAUA 3KB7A 1YDTE 4QPMA 4W8DA 4IVBA 3RAHA 3R0TA 3R73A 4X2FA 3UG2A 4DG3E 4CNHA 4ZJVA 4WKQA 2UW3A 3BE9A 4CZUA 2JDRA 3GUBA 1UNHA 4FV4A 4ASZA 1BX6A 5BQ0A 4I6BA 2J90A 3DU8A 3CD8A 3ZLYA 4AZFA 5EYMA 3I79A 4ZOGA 2XCHA 3QWJA 3GP0A 4XCUA 4E6DA 2CKEA 2PUUA 1WCCA 3TDVA 3AC3A 2YA9A 1R0PA 3FC2A 3AGLA 3MH3A 4TL0A 3ZOSA 1JPAA 4D2TA 3IK3A 3FKNA 4LRMA 5AR7A 5EOLA 3UIMA 4ORKA 4HYHA 3FY0A 3QQKA 4QP2A 5KMIA 5E9EA 5L3AA 3OOMA 3C0HA 3G0EA 5CYIA 5KCVA 4G3FA 3ORTA 5E7RA 3NX8A 4KKEA 5A3XA 3VUDA 4GKHA 1PKGA 1RW8A 3V5PA 3BHHA 4XG3A 2GS6A 4ZSEA 3COHA 3Q2MA 4DEDA 4KRCA 5AM7A 4BCGA 4OTDA 3M2WA 4AX8A 2PZPA 3Q4UA 2FYSA 3GU5A 1YI6A 4EUUA 1M2PA 3TIYA 3T3VA 2Y4IC 2A4LA 4O2ZA 2IVSA 4BFMA 2JKMA 1GZOA 3QRKA 4Q9SA 4FSRA 2YABA 2E9VA 3GCPA 4M3QA 3G2FA 3PPZA 3OWLA 4J98A 4BDGA 5I9VA 3C5IA 2EU9A 3EN7A 4ANMA 3TKUA 4BGGA 3JVSA 4NIFB 3CD3A 3D0EA 4AA0A 2I7QA 2VZ6A 4L53A 1ZY5A 4JX3A 4MD8E 5HHWA 4BVUA 2W0JA 2UW9A 5EK7A 4YJNA 1OVEA 1JWHA 3BE2A 2HW7A 2HWPA 2QOBA 3CCNA 3ODYX 4NM0A 5E8TA 4EBWA 5BNJA 3DTWA 3OCBA 4C57A 2X1NA 5AA8A 2XKEA 2WTKC 3LFCA 5IDNA 4P4CA 5BUEA 5AADA 5L8LA 1XBCA 1J3HA 2WQBA 2R64A 4ZMEA 5IF1A 3P4KA 4JG8A 1J7LA 1QCFA 1OPLA 1H1QA 1NVQA 2ONLA 4K0YA 4FEVA 2R5TA 3PFQA 1XJDA 1YWNA 4WHZA 5HZNA 1R0EA 4DN5A 3UNJA 1GNGA 3HV5A 4C02A 3LZBA 3EB0A 3ALNA 1FQ1B 2FA2A 3QZFA 4APCA 4U3ZA 2HZ4A 4I5HA 4M67A 3NVMB 3I0OA 3RHXA 2XB7A 2YACA 3VS7A 3L8PA 3UQGA 3EKNA 4BBEA 4TWPA 4CZTA 5DT0A 3R8UA 4IC8A 4AN9A 5HLNA 2X6DA 4YP8A 2RKUA 1YVJA 4QOXA 3CJFA 5AV4A 3KGAA 1K9AA 3GCVA 2UZLA 4FNXA 3OWJA 2ZJWA 3QQLA 5IU2A 5LMKC 4Q9ZA 4O0TA 3QRUA 3LCOA 4N70A 5IH4A 3MPAA 5ICPA 3IO7A 3DB8A 4EH9A 3IW5A 4RZWA 4CFXA 1SNUA 3R30A 3V51A 2XCKA 3E92A 4A9SA 2HELA 4NKAA 4PUZA 3RI1A 2VTPA 3BEGA 5E8YA 3UC4A 2G2IA 4LUEA 2RFSA 3D94A 3SKCA 3FQEA 2P4IA 3G6HA 2PE2A 3W2QA 4N57A 2NRYA 4C3FA 3QKLA 1YHWA 4KKHA 4BKZA 4C36A 3FEGA 3KN6A 3TV4A 2VO6A 1XO2B 4BWXA 5LVOA 4UWCA 3ZDUA 2VWVA 3O8UA 4L46A 2CSNA 3COKA 5IA0A 4Z55A 3HMOA 3EL7A 3ULZA 3DBCA 2ITNA 2UZWE 4Z7GA 4DEIA 4MH7A 4U3YA 3FMLA 3VBTA 2AC5A 4PWNA 2BCJA 2B1PA 2OXXA 3RPSA 3NAYA 3KU2A 3FXWA 4FKPA 3UP7A 3NR9A 2F7EE 4O7WA 1L8TA 3QQFA 4L3PA 3GOKA 3EQIA 3OW4A 5M07A 4AAAA 2YCSA 3FWQA 3IDCA 1A9UA 4RX7A 4NM7A 3FHIA 3PY3A 4J97A 4PNIA 3MDYA 2NPQA 5HI2A 3GVUA 4C3PA 4FGRA 3BGPA 4U40A 3QL8A 2OJFE 4CTBA 2ZYBA 4TWOA 1MQ4A 3TI1A 4PDSA 4IQ6A 4UZHA 3R7YA 4O6EA 3ZZEA 4EZ3A 3SG8A 2J0LA 2V62A 4I3ZA 3PJ3A 5C8NA 1YDRE 4I6HA 5AA9A 1PY5A 2WXVA 3BWFA 4LGGA 1B38A 2ITUA 1JBPE 2E9NA 2QHMA 2RFDA 1YOJA 4K18A 4MQ2A 5CWZA 4B8LA 4ZTRA 2C6IA 4BBFA 3QGWA 4IDTA 4BDAA 4EOQA 1IASA 5KNJA 4IAFA 2C30A 2HOGA 2OH0E 5CANA 3MW1A 3WOWA 3ZO2A 3DS6A 4BHNA 4UYAA 4C37A 3P78A 4I4FA 2ZOQA 4JT3A 4EH8A 3HA8A 3UPZA 4NJDA 4UWBA 2BDWA 2WQEA 3CQUA 3E87A 4OT6A 4LI5A 3LQ5A 4JRVA 3PVWA 1XH5A 4FSYA 5EW3A 4XV2A 2ETRA 5AAEA 3GC8A 3QTSA 2GQRA 5EM7A 3W33A 4I92A 4DG0E 3A8XA 3PE1A 3PSBA 5AUXA 3U4WA 4ANOA 5JN2A 3UOLA 4BBMA 4ZLYA 3EQHA 3AMYA 5CI7A 4ZP5A 3ZMMA 4C8BA 4BTJA 4EOOA 1LEZA 2XM8A 2FSTX 4FIIA 4D4VA 2B7AA 1Y8GA 3DA6A 1Q61A 3UO5A 2YISA 5CI6A 1O6LA 2QR7A 5HVYA 3RP9A 4AZVA 1PHKA 2JD5A 5C01A 2BFXA 3NNXA 3NUYA 3MJ1A 1JSVA 3WYYA 2NNWB 1F0QA 4G5PA 1OUKA 2QURA 3Q9XA 4MBJA 4HVHA 5B2MA 2VTTA 5AV0A 1E1VA 4K11A 5EQPA 4O6LA 5F94A 3GC9A 2J5EA 4LOQA 4EOJA 2OICA 4B0GA 5EI6A 3W2SA 5BVEA 3LFNA 3DAKA 2XEZA 4GK2A 2YM7A 2XIRA 2IW9A 5FP5A 3GXLA 4KIKB 3IECA 1U46A 2XK3A 4IB5A 4H1MA 5BYYA 5HICA 4PP7A 2VWWA 1GOLA 3EZRA 4IWDA 1SVHA
chains in the Genus database with same CATH superfamily
4E4LA 4GFOA 2PMOX 4EK5A 4XG8A 3GU6A 4FT0A 3W0PA 4RLLA 3K3JA 3FZTA 3W16A 4OAVB 3MESA 4AP7A 5AWMA 1WBOA 4EK4A 3GCUA 2W17A 4QMMA 4TRLA 2A2AA 2PZRA 2O63A 4QNYA 2PY3A 3ID6C 4UXQA 3C4FA 1H1WA 2YFXA 4BDIA 4QEBA 4JL9A 2ONLC 3RPYA 4B8MA 4CRLA 4CXAA 2UW4A 2RSVA 3CIKA 2JDOA 4YZBA 3VBYA 4YSJA 5KMJA 5I3OA 3F7WA 1UWHA 3ORIA 2X6EA 4FV5A 4U0IA 5DVRA 3Q52A 3C4ZA 4AGWA 5K4JA 4YSMA 4DTBA 2GFCA 3R83A 2CGWA 2YCQA 2PZ5A 3EFLA 1JNKA 4CMTA 5HBHA 4FF8A 3FMDA 4KINA 3T3UA 4L45A 2V5QA 4KIKA 5HTCA 3VRYA 2C69A 4JAIA 1NY3A 4QMNA 4FG7A 5GIOE 4FEQA 3F69A 3DK6A 3FLWA 4J7BA 4BDEA 2XBAA 3HRBA 3V6SA 1M2QA 3DJ5A 2FSOX 2A27A 3NYXA 1YWRA 5DT3A 3QFVA 4B6LA 4F7SA 2A1AB 2YERA 4X2NA 4DH8A 2JAVA 2RIOA 5M56A 2IG7A 2VGOA 1O6YA 1KV2A 1PMEA 4JR7A 2X81A 4CEGA 2C0OA 2J0MB 2HXLA 4O83A 4DG2E 4U41A 5CNNA 1W2FA 2BTRA 5CVFA 2VWYA 2UZDA 3RKBA 2BKKA 4O7LA 2ITQA 3COIA 1XQZA 3OVVA 4F9YA 1JKTA 2P55A 3MJ2A 5GZ9A 2X9FA 4MD9E 2DQ7X 2VWZA 4F9WA 1JSTA 2EVAA 4D1XA 4FGBA 3Q4ZA 3UOHA 3UVQA 1UU9A 4FKOA 4FZFB 5AUUA 5HU9A 2DS1A 4QTAA 4EYJA 5E8XA 2IVVA 4EQMA 5E90A 3WF7A 3LMGA 4BZDA 2VNWA 3A7FA 3QTRA 4K8AA 2JDSA 2IN6A 5ANDA 4DEAA 4GS6A 4LV5A 4IC7A 3R7EA 3DKFA 3VBWA 4OTPA 1EH4A 2WD1A 3TZMA 3IW7A 4BTFA 2ACXA 4ITHA 1KE9A 2VUWA 4DGOA 2JFLA 2PPQA 4DBXA 4BIEA 4D2VA 2YWPA 3O5AA 4PP9A 2YJRA 3QCXA 4LV8A 4RBLA 3C4WA 4X21A 3BU3A 3KVWA 3DQWA 3MVLA 1HCKA 4FTJA 4GVJA 4BKJA 3P86A 1XH9A 3DZOA 1Q97A 2BZIB 1WZYA 5IQCA 5HCXA 5JFVA 3PXZA 4AOIA 4ARKA 3BZ3A 4EKLA 5TKDA 4AZWA 4EZ5A 3ZFYA 1BI8A 3DV3A 4DGGA 2C5OA 3O96A 3GNIB 4E6AA 2X0OA 1M7QA 4L3LA 3FZOA 4W8EA 2OW3A 1FMKA 2A0CX 2GMXA 4DFXE 3AKKA 3NEWA 3DKCA 1CKIA 3F9NA 4KB8A 4OBQA 4PV0A 5CU6A 5GJFA 3RZFA 3S3IA 3HMNA 2YM8A 4WBOA 5I9ZA 3A2CA 4C34A 2AYPA 4J8NA 2GU8A 3EFJA 2VWXA 2CNVA 3EN9A 2BTSA 3ZC6A 2EXCX 2W4JA 5HG8A 2PWLA 5D1JA 2Z7RA 5HNBA 5HO8A 4FG9A 2QG7A 4NSTA 4FZDB 4F9AA 4MHAA 2B54A 4E7WA 2RL5A 4FKGA 1NVSA 2F2UA 5FTGA 2OJ9A 2BUJA 4BRXA 1H1RA 3A7GA 1PMNA 4YBKA 3TJDA 3RZBA 3IDPA 2QOQA 5CTPA 1H25A 2YDIA 2QODA 2VWUA 3CTHA 3WF8A 4EOIA 2JC6A 1OECA 4LOPA 1Q3DA 4G6LA 4M97A 5FP6A 4Z3VA 4BCIA 1WVWA 3BLAA 3BLQA 5HTIA 3KREA 1U54B 1KE8A 4OTRA 5DEYA 5H2UA 4YJVA 5F9EA 1FGKA 1V1KA 1YHSA 3F3VA 1H26A 5AP1A 5I9WA 5KKRB 2HK5A 3D83A 2C5NA 4EJNA 3R22A 2Z8CA 5T68A 3OTUA 4G5JA 3G6GA 3IOPA 2WGJA 1W0XC 4NT4A 4YTFA 5CF6A 3O71A 4I21A 5AIRA 4FTNA 3QUDA 1RE8A 3GFWA 1M14A 3DY7A 3LOKA 2QOHA 3I0QA 3F2NA 2WMAA 1ZMUA 3LXKA 3NUXA 5FEEA 2XYNA 5HESA 4V01A 3VBQA 4F9CA 3NFFB 3GT8A 5CX9A 2ITOA 4CLIA 1VYWA 1W7HA 1TQIA 2E2BA 3NWWA 4GMYA 3ZZWA 4C4FA 4AUAA 1H4LA 2YM4A 3KXXA 4ZTSA 4FT7A 3E63A 5HVKA 3VS4A 3QC9A 3DQXA 2XNOA 3F66A 4J8MA 2GSFA 4FSMA 4N0SA 2CKQA 5JFSA 2HWOA 2F4JA 5AR8A 4BCMA 3MFTA 3AMAA 1O6KA 4O4FA 3LXNA 2QONA 3AT4A 5FG8A 1TQPA 2ITYA 3COMA 1AQ1A 1VR2A 4RT7A 4XS2A 5ETFA 5ETCA 2PMLX 4F9BA 3IG7A 2X7FA 3G0FA 4X7QA 3R9RA 3U6JA 3NUNA 3TCPA 5K5NA 4S30A 4R7HA 1FPUA 1OPKA 3P5KA 5DGZA 3PA5A 5H3QA 2XKDA 5IUIA 4B9DA 3R7UA 4CFWA 4LDTA 3LMHA 4YJQA 4CFUA 3A4PA 4QP4A 3CJGA 5HD4A 1KWPA 1GZNA 1WVYA 2ETMA 4XG6A 2Z60A 4YPSA 3C4CA 4YJSA 5EH0A 3ZSGA 3OWKA 4QP3A 5E91A 5HBEA 5HEZA 2OFUA 3DNDA 2O0UA 1GAGA 4BL1A 3ZO4A 4CRSA 3FJQE 2I0VA 4O0UA 5JGBA 3FMHA 1JVPP 4YNEA 5CY3A 3RHKA 4D0WA 3PXYA 3KN5A 2Y4IB 4M8TA 2C5YA 2DWBA 4BDFA 4W4YA 4YZCA 4BWPA 5LWMA 4YO4A 1XBBA 4M66A 3S0OA 3VUMA 4JDKA 1OGUA 1UU7A 3HZTA 5CXZA 2BIYA 4FIEA 5HG5A 5JSMA 4LL5A 5JQ5A 2Y6MA 4HNIA 3U9CA 4RGJA 4ZSGA 4P7EA 4O0YA 5HIBA 4O27B 1OPJA 4KBKA 4I5CA 3TWJA 3UDTA 3KXHA 4ZMFA 1ZMWA 5HLPA 4Y85A 3U6HA 2ZAZA 3ACKA 3H9RA 2QCSA 3M1SA 4DFYA 3QD2B 3GQLA 1QPJA 2B52A 3IW4A 3PUFC 1H01A 3BV2A 4J52A 4O2PA 4QTEA 3AKLA 3NYOA 3HP2A 4A9YA 3JR1A 3MB6A 4TT7A 3RMFA 1V0PA 2UZUE 3VHEA 4D2PA 4YMJA 4GJ3A 4I93A 3NAXA 5CAUA 3W0OA 4U44A 5FRIA 4HW7A 4BN1A 4WNMA 4YPDA 3MS9A 3IQ7A 3A7HA 3QTUA 3QAME 4JI9A 4FTIA 3R8LA 5T6KA 4CKIA 1QPDA 3HMIA 3HDNA 4NUSA 4RX5A 4O0SA 2V7OA 1V0OA 3LE6A 4FTMA 3UZPA 4TYEA 3N4VA 5TT7A 3UG1A 2CLQA 3PG3A 3FMJA 3OBJA 3L8SA 1H0VA 3PRIA 4JIAA 2B0QA 3HRFA 4LG4A 1P5EA 3GI3A 2QOOA 3V8TA 5FBNC 4BDKA 2OI4X 4C2VA 3RAKA 2AC3A 4CT1A 1IAJA 5F4NA 1UVRA 2ITWA 4H3PA 1CM8A 3MTFA 2FVDA 5G6VA 3TNQB 4CMUA 3D2IA 3JUHA 3WZEA 4QT1A 2BR1A 2GTNA 4MD7E 2QO7A 4FUYA 4QPAA 2WIPA 3BU5A 4G16A 5CU0A 4QYGA 2NRUA 3DDPA 4IAYA 5I4NA 3QKMA 1M2RA 3ORNA 4GT3A 5CNOA 3PFYA 1M52A 2WEVA 3ENMA 4W4VA 5AX3A 3A8WA 4YGAA 4C38A 5IMEA 3NUAA 5K3YA 2J6MA 4ITIA 3ZFMA 5CT7A 2HCKA 2GFSA 4P90A 4BGHA 4CSVA 2VTAA 4HVGA 2SRCA 3TDWA 4BCOA 3KXNA 2BROA 2W5AA 2QLUA 4Q5HA 4F65A 4O4CA 4RPVA 4H58A 1BL7A 1APME 1IA8A 2CPKE 3LLTA 5CF5A 3F3WA 4L3JA 3PIXA 2WOUA 1RQQA 1Z57A 3ACJA 5IQFA 3Q60A 4FR4A 5M4IA 4D2RA 3QKKA 3RJCA 3VF9A 5A6NA 4CLJA 5IUGA 5T3QA 4H1JA 3N51A 1ZYDA 1RJBA 4FSWA 4U79A 3HNGA 1U5RA 2P0CA 1TQMA 2YIXA 2R3KA 4YTHA 2XJ2A 1SZMA 1JKLA 3C5UA 4YHJA 3S1HA 3W0MA 1IA9A 3C1XA 4FKUA 2F7ZE 3QX4A 3AXWA 3TUBA 4TW9A 1PKDA 2X39A 4WO5A 4ZJJA 4B7TA 4R7BA 1M7NA 5HIDA 5IQDA 4BCNA 2WU6A 3QU0A 3ETAA 1DM2A 3LCTA 4O7VA 3W8LA 5JQ8A 1ZZ2A 4G34A 4NJ3A 5L8JA 4AG8A 4KIOA 4RIWA 1OL2A 4D55A 5F20A 4E8AA 2J51A 2J0KA 4ITJA 3KF4A 4F6UA 2JIVA 3QUPA 4CV8A 3HECA 3MVMA 4MWIA 3V01A 4WUAA 4LUDA 3PRFA 3AOXA 2PE1A 3MI9A 4FSQA 2GCDA 4RWLA 1GY3A 4PNKA 2PHKA 5KKRC 4IB3A 5JGDA 1GIJA 2P2HA 3FPMA 2DYLA 4IAKA 3NCGA 4J1RA 4A9UA 1G3NA 1Q5KA 2ZM1A 3C50A 2R3OA 3GU4A 3VO3A 4CFNA 3H10A 4ENXA 1GZKA 4EH4A 4L68A 5CASA 2PVNA 2WQMA 2OK1A 3R04A 4D28A 2ITVA 4E20A 2C6EA 4CKJA 3N4TA 3OY1A 3OD6X 3VULA 3K3IA 4BB4A 5IA4A 5IQAA 4AA4A 3VF8A 2X7OA 3K54A 4BZNA 4KA3A 2UW0A 5FLFA 3LPBA 3RWPA 5AUVA 3TG1A 4YZDA 1OITA 3AC1A 3PYYA 4CT2A 3BL7A 5M44A 3CY3A 2OO8X 3EN6A 2HIWA 2R9SA 2REIA 4PDPA 2JIUA 4E5AX 5IKWA 3QTIA 4DA5A 1OB3A 2PVRA 1F5QA 4RWIA 4EOLA 3UJGA 4CFVA 3E3PA 3DBQA 2O2UA 3IPHA 2YDJA 3RCJA 2ESMA 2ZV2A 4F08A 3VHKA 4K6ZA 3CKWA 3R02A 4DBNA 4OTGA 1X8BA 2FUMA 2BRGA 3LQ3A 2FB8A 4IZYA 3QYWA 3NNWA 5H8BA 3HVCA 3VRZA 4BCQA 4ZSAA 2IZUA 1SM2A 3EYHA 2CMWA 2W4KA 3SOCA 3VW6A 4BCFA 5J1VA 4EKKA 5CAOA 1UV5A 5CZIA 5AV3A 5CLPA 4IXPA 3EQFA 4RJ5A 5BV3A 5IMXA 2UW6A 3H0ZA 3JY9A 4AT5A 4PTGA 2W5BA 4S32A 4F70A 2XK6A 5AP2A 2YM5A 4MYGA 3LFEA 4WG3A 3FV8A 4O7NA 3Q6UA 5EW8A 4F63A 5CF4A 4EHZA 5CSPA 2I0YA 3CXWA 2QVSE 4FSZA 4C59A 3PTGA 2F57A 2NO3A 2W9ZB 4FV1A 5HE3A 2CCIA 4FIJA 5JZNA 4CFFA 3PDTA 4KIQA 3SG9A 1DAYA 3R7GA 4NW5A 4QQ5A 5AFVA 1ZZLA 2R3MA 2Z7QA 2UVXA 4GIIA 1Q8WA 3LXLA 5JFXA 5A4TA 4GYIA 4GT4A 4PF4A 4IM3A 4R1VA 3VVHA 4X0MA 5FM3A 4EOMA 4IM0A 4IX5A 2R0IA 2J0IA 2XVDA 3BHYA 3Q96A 5GJGA 4CYIA 4FT5A 2C6TA 4N6YA 1YXXA 2EB2A 3QRTA 4FOBA 3VIDA 3R01A 2R4BA 4AW2A 1Y91A 1YI3A 4FKLA 4PMPA 2VTOA 4F7LA 3T8OA 4HCVA 4KUJA 3MGYA 3F3TA 3OFMA 1PXJA 2UZBA 2GNHA 5ANEA 2BZHB 4A4OA 3QZHA 4C4IA 3ZUUA 4FIHA 4CTCA 3U54A 4PL4A 3II5A 2NP8A 3HMPA 2OG8A 3UYTA 5A54A 5L6PA 4FVQA 4OTHA 5JEBA 2YN8A 3D5WA 2OKRA 3AC4A 3CGFA 3RCDA 3V8SA 4AT4A 1WBVA 4KABA 4LV7A 2LGCA 4ZY5A 5HD7A 2GHGA 2W96B 3DFCB 5GJDA 4F6SA 2XZSA 3KK9A 4AE6A 2WMRA 2CNUA 2OXDA 3LFSA 3PJ8A 1LP4A 4ANLA 4RRVA 1XMMA 5AV1A 4KSQA 4MEDA 3SLSA 2IVTA 5JKGA 3K2LA 4BY9E 4WRGA 5BVWA 3SDJA 2BFYA 3JYAA 3NUUA 4K77A 2R3LA 5EHLA 2IJMA 5IQBA 3OCTA 4W4XA 5IQIA 1Q24A 3MBLA 3FMEA 3SRVB 3QD0A 1Q4LA 3ORXA 4FT9A 2GNLA 4RJ6A 5DIAA 3VUIA 4FJVA 4CG8A 2C1BA 3BYUA 3BYMA 1ZRZA 4PY1A 4HGLA 4XHKB 4I94A 5ANGA 3TZ7A 5HNGA 4FTRA 5E8WA 3GOPA 3VONA 4RQKA 4G2FA 3GU7A 4PPAA 2HXQA 5CAPA 2GPHA 2YITA 4E4MA 1G8KA 2QG5A 4PMMA 3EJ1A 4FICA 1IAHA 3NFGB 4FIFA 3MVHA 5LWNA 3CLYA 3JXWA 4EUTA 3UNKA 5EHYA 1ZYSA 3QBNA 3FMNA 4E5BA 5BYZA 5FXSA 1K3AA 2XK7A 5L6OA 5GHVA 3DXPA 1JKKA 5EG3A 4O7RA 4QD6A 5FGKA 4FEWA 3FI3A 4I41A 3MH1A 3WZKA 1XH8A 4DDIA 2G15A 3FMKA 4M84A 2YCRA 4F1OA 2XKFA 4WG5A 1LR4A 1Q99A 4RJ3A 3UIXA 4QP9A 3O23A 3WI6A 3I1AA 3CY2A 3SRVA 2H96A 2WTWA 4O0XA 5HORA 4YC3A 3Q9WA 4TYHB 4DAWA 1ZOEA 4XMOA 5CAQA 3RNYA 3IGOA 2R7BA 4TYIA 2WTCA 1G8AA 4AQKA 3JS2A 2VO7A 2X9EA 5LMAA 1UA2A 3TIZA 3QA8A 3NLBA 4USEA 1URWA 5EQEA 3OC1A 2JAMA 3BGZA 3QX2A 3E7OA 2AEGA 1UNLA 4RIOA 3RALA 2C6LA 3PZEA 4YUQA 1LPUA 3I60A 3NNVA 4NU1A 4AAYA 2PVJA 4FTQA 3D7ZA 4K1BA 1UKIA 5AIKA 5JMSA 3ATSA 2GNFA 4V05A 3RK7A 1XH6A 3TKHA 3R1YA 4DCEA 3C4EA 5IZFA 2QLQA 4IACA 2BPMA 3VUKA 5DEWA 3FL5A 5AAGA 3QCQA 2R2PA 5KBRA 5HGIA 1ST0A 4MQ1A 4YURA 3TEIA 2AUHA 4YHTA 4XV1A 5FEDA 4GFGA 3ZC5A 4RJ8A 2XAOA 1FGIA 1ERKA 3OP5A 4QNAA 4KKGA 4UMPA 2R3IA 4TYHA 3WIKA 3ALOA 5IQGA 1XHAA 5BPYA 3KXMA 3OEZA 5AR3A 5DT4A 3DK3A 5C4KA 5A4CA 1OL1A 4RX9A 5DRBA 4J95A 5JGAA 2WTJA 4OBOA 4E93A 1OKVA 4MAOA 3D5VA 3HV7A 2C6MA 5HLWA 2GTMA 3LFBA 4C35A 3PPJA 4G6OA 2PYWA 5EYCA 4FKRA 3QRIA 4IAZA 2W4OA 3Q3BA 5D7AA 3KULB 4BDHA 2BRBA 4NCTA 1PMVA 4QPSA 2CN5A 4YLKA 4R77A 3CPBA 2FO0A 1OGYA 3SXFA 5AUYA 2ZDUA 2HZIA 5LJJA 5E1EA 4QMSA 4C4HA 4DGNA 2OF2A 4DLJA 2OXYA 4DITA 4FK6A 4G9RA 4IAAA 3FY2A 3TMOA 3AT2A 4XP3A 4JLCA 5CSVA 3O8TA 3R63A 2CKPA 2W99B 3ZONA 4A07A 4G17A 3HA6A 4EOSA 4YTCA 5C1QB 2JLDA 5F1ZA 5AEPA 1E9HA 5EDRA 2UZEA 2VTJA 3BKBA 3HLLA 2YJSA 2C0TA 4UV0A 4Y83A 5CEIA 4XG9A 1B39A 1OKYA 3PPKA 4QRCA 4IJPA 2PL0A 3LJ1A 3OMVA 5CVGA 1U59A 2HY81 3Q5IA 4JS8A 3UO6A 4L9IA 2V0DA 4GFMA 5KHXA 2XF0A 3FZRA 2WQNA 3OF0A 4ZZMA 4C2WA 4TNBA 1QPEA 3KXZA 2BAKA 4XJ0A 4PX6A 3KULA 4D1SA 1ZYJA 3G33A 4FC0A 1YQJA 2W1DA 3QQGA 4M7IA 3LMIA 4HYIA 5IPJA 1CKPA 1Z5MA 3MIAA 2GQGA 3IW6A 2XANA 3I6UA 3V5TA 3AMBA 3EQBA 3PJ1A 4CQGA 1WFCA 2EXMA 3O50A 3R8PA 3QTXA 1FBNA 4J71A 3BHTA 4O4EA 4KAOA 3TZ8A 3F88A 3DBEA 4PMTA 3Q4TA 2O3PA 4FKTA 3FLSA 2X8DA 4JBOA 3FXZA 2BRNA 4ZSJA 4DFBA 3ORZA 4Z16A 4XV9A 5E8ZA 4O7TA 3DJ6A 2H34A 3VUTA 4QYHA 3VNTA 4GSBA 4Y5QA 2VAGA 3RPOA 4N6ZA 3ERKA 3OXTA 4WOVA 3HMMA 3MYGA 4HJOA 1BUHA 4IZ7A 4YZMA 5HVJA 3TN8A 5DOSA 3CTQA 4QMZA 4U6RA 2BAJA 2V22A 3BCEA 3UO4A 3UP2A 4R3PA 1REJA 3W10A 3NSZA 5J7HA 2Q83A 1OMWA 3FKLA 2CHLA 3TNIA 2GNGA 3VC4A 5LQFA 3ZUVA 4AXCA 4FV0A 3ZO1A 4O4BB 5H8EA 4O4DA 4MNFA 4MXYA 3FZPA 4G3GA 3S00A 5CEMA 4JDHA 2W1HA 1Q41A 3TM0A 1R78A 4EC8A 2PVMA 1ZOHA 2PMIA 3ORMA 5BVKA 2G2HA 5DI1A 2G9XA 3OW3A 2XYUA 2VGPA 3RVGA 2RG5A 1ZWSA 4W9WA 4K33A 2OF4A 4USDA 4HZSA 4OTFA 3WZDA 2OSCA 2BHEA 1U5QA 4D4YA 5IEYA 1GIHA 4L44A 5JRQA 2H9VA 3UOJA 3FZSA 3TYKA 1OL5A 5B7VA 4H05A 3KA0A 3QUEA 4RVTA 3KRRA 4WD5A 2VV9A 4QQCA 5EM6A 2O65A 1KUTA 4D2SA 3KF7A 1CDKA 4QP1A 5CEQA 4M0YA 3UIUA 5LVLA 2ZMDA 4U5JA 4E5WA 2OFVA 2R3JA 4LOOA 4EONA 2YM3A 5JRSA 2X4ZA 3KKVA 1LUFA 4TWNA 5BUJA 4JIKA 4IVCA 5AMNA 1CKJA 3PG1A 5KMNA 3KRXA 3O2MA 3QXPA 4BR3A 1KOBA 4IANA 5EKNA 4Y46A 2P33A 4ZY4A 3L9MA 3PWYA 4HVDA 3S95A 3FSKA 1T45A 3QD3A 3QQHA 2HENA 2X0QA 3PP0A 4AN3A 2O8YA 5EHOA 4FKVA 4BIDA 2B9FA 5HE2A 1ST4A 3QLFA 4EOPA 4UMUA 4CYJA 4MF1A 3REPA 3S2PA 3W8QA 4D9TA 5DR2A 2EUFB 2J0JA 2XIKA 4XBRA 4GG5A 3ZCLA 4XG2A 5HQ0A 1YRPA 3M42A 3BWJA 4XP2A 1TVOA 4DFLA 5DMZA 4BKYA 3QD4A 4I20A 5IISA 3EQPA 3NMUF 4ONAA 1W83A 4JX7A 4AOJA 1OL7A 2W06A 3KRJA 3DDQA 3LAUA 5AJQA 1WBSA 4RVLA 5D7VA 2NYAA 3FI8A 4JRNA 1S9JA 2F49A 3I7CA 3PUPA 2ITZA 5M53A 4U7ZA 4IVDA 3HRCA 4NTTA 5AUTA 2IZRA 4NTSA 3P79A 2XBJA 4GUEA 4TYJA 3W2CA 3E8DA 3OT3A 1CSNA 2BILB 2W1FA 1PJKA 3R1NA 4U43A 3WZJA 1REKA 3LKMA 3UDBA 3DXQA 3O0GA 4CZYB 4D9UA 4UMTA 5K0KA 4D1ZA 4OGRA 2X8IA 4O0VA 3IW8A 4EEVA 3MA6A 3QF9A 1R1WA 4DT8A 1OIQA 4A7CA 5C03A 4YJRA 4FTUA 4NCTC 4D4RA 4O84A 1P2AA 1A06A 5TE0A 4IFGA 4BDCA 3LJ0A 4FK3A 3ZHPC 5M09A 5F95A 3L9NA 4CVAA 2C6OA 4JQ7A 3UMXA 1A48A 3CE3A 2UW7A 3DOGA 2H8HA 3ODZX 1Z9XA 4ZTMA 4FL2A 2FSMX 3H3CA 4XOZA 4I1ZA 5CENA 4EI4A 3Q4CA 3N9XA 3HV4A 1YI4A 2GHLA 2PZYA 2QOLA 3QTQA 4BCJA 4RFYA 4BI2A 5C8KA 4IMYA 4LL0A 4AU8A 5IQHA 5FEQA 2XS0A 3QA0A 1J1BA 2IZSA 3H9OA 4F99A 1MP8A 4NL0A 2OLCA 4IVAA 1PXLA 5GIPE 5C9CA 2Y7JA 5CSXA 3EFKA 4YNOA 2OWBA 3LLAA 2Y0AA 3MFUA 4JDJA 4O0WA 3W1FA 3ZLSA 2WQOA 5JZJA 4AA5A 3ZSIA 4QMQA 5I0BA 2G1TA 3R21A 3VS5A 3VW8A 3Q9YA 3PY1A 3RINA 3N4UA 4MTAA 4CV9A 5D11A 4UMRA 1XBAA 4O0RA 3OS3A 3SHEA 2JITA 2WIHA 4JVGA 3PVBA 3Q53A 3G9NA 5E4HA 3OZ6A 4XP0A 4YJOA 5C4LA 1YOMA 2PTKA 3NW6A 3PA4A 5HE1A 4QP7A 4RSSA 4ZK5A 2XIYA 3NNUA 3HDMA 1FVVA 1ZXEA 4LMUA 3ORKA 4FNWA 4RJ4A 4CG9A 4ZTNA 2BKZA 2X2MA 3KK8A 4AGCA 3EOCA 5DE2A 2RG6A 2ZM3A 3E7VA 4BDBA 5HX8A 3BIZA 3NS9A 1SYKA 3IS5A 3KMWA 4M12A 4PPBA 5CSHA 3GENA 1BYGA 3R9NA 4QTBA 4LQMA 5DN3A 5D12A 5AR5A 4HYUA 5J9LA 3TT0A 4UY9A 1I44A 3MN3A 2CGXA 4XV3A 2CKOA 2ZDTA 1TKIA 4HYSA 1H07A 5K9IA 3I5NA 3BLRA 2XALA 2PK9A 5IEVA 1M17A 3LJ2A 3E8CA 5ETAA 5I3RA 3BI6A 2ETKA 1JOWB 1YKRA 1YXTA 2JKOA 2QHNA 2XK4A 4IX4A 1GJOA 1R39A 3MA3A 3NZ0A 3DBFA 1U4DA 2CN8A 5LVPA 4FEUA 2KULA 2W1GA 4CGAA 2JIIA 3ZEWA 5ITAA 5IEXA 4IWQA 2E9OA 2HY0A 3AC2A 3QQJA 2WMQA 3U55A 4KBAA 2ERZE 4O7YA 2QR8A 2VTMA 4I6FA 4F6WA 3LCDA 3FLZA 1H28A 4QYFA 5JT2A 4F4PA 2KTYA 4C61A 2EXEA 4R5YA 3IOKA 3HUCA 4II5A 2VWIA 3AD5A 5D10A 5BMMA 2C3JA 2EWAA 3OUNB 4HPUE 4TYGA 3BBTB 4LYNA 2IVUA 3KFAA 4GIHA 1RDQE 2CLXA 2JBOA 4I4EA 3BBWA 3WE8A 3AD6A 4DHJA 3LCKA 3HEGA 4KS7A 4LGDA 4V0GB 3ZYAA 5M4UA 3E64A 4GCJA 3PXFA 5H8GA 4ZEGA 1KE7A 1PMUA 5J7BA 5KMOA 1T46A 1FINA 2OGVA 3VS2A 3KCKA 1F3MC 1PRYA 5DH3A 3OBGA 4MXCA 4HPTE 4AS0A 4EH2A 1IG1A 4UN0C 4JOAA 4O21A 4QMTA 3TUDA 5AUZA 4L01A 4ALUA 3UOKA 4YJTA 3KRWA 3TV7A 5J1WA 2PU8A 3NCZA 4QMYA 4RC4A 3JPVA 4C33A 4IAIA 2PSQA 5HO7A 4ANBA 5E92A 5L2WA 4GUBA 3SD0A 4EZ7A 4RFMA 3K5VA 3R8VA 3WF5A 3OROA 1JKSA 1I09A 3CQWA 3MFSA 2VU3A 1PW2A 4FKQA 5ETIA 4A06A 4X6QC 1DI9A 4EOKA 4QDVA 2WMXA 3MY0A 4FSNA 3R71A 4QMPA 2PVLA 4AXDA 5A4EA 1H24A 4M68A 3GCQA 5FM2A 4QQJA 3A61A 4GL9A 4L43A 4IX3A 5HO6A 4AN2A 5KMMA 2J9MA 3GC7A 3CEKA 1QPCA 3F6XA 3B2TA 4V0GA 4XLVA 3UZTA 2C5VA 4S2ZA 4KSPA 5DPVA 4QP8A 3SX9A 3MH2A 4GH2A 2V7AA 2BAQA 4RC3A 4I0RA 4CFMA 3LFAA 3C0GA 4P5ZA 3E62A 4RIWB 1G5SA 3RPRA 5L8KA 1VZOA 4JAJA 4XLIA 4UX9A 4AW5A 4NM3A 3QCSA 4L8MA 3PIZA 4GRBA 3F82A 1R3CA 4O1OA 4FOCA 5DA3A 2YZLA 3GGFA 5TO8A 4EHVA 3P5JC 4MXZA 4DCAA 4BDDA 4OAUC 4OBPA 3KC3A 4XBUA 1WBTA 3L9LA 4YO6A 5A46A 4KWPA 4QTCA