4A06A

Human pdk1 kinase domain in complex with allosteric activator ps114 bound to the pif-pocket
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
283
structure length
282
Chain Sequence
b'KKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
publication title Allosteric Regulation of Protein Kinase Pkczeta by the N-Terminal C1 Domain and Small Compounds to the Pif-Pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 282
sequence length 283
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4a06A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4a06A01
4RIWA 4M12A 1SVGA 5JK3A 2YLEA 4IQ6A 3DKFA 3CP9A 3ITZA 3KXXA 3BBWA 3OROA 4KA3A 3KEXA 4M0YA 3BPRA 4OTHA 5LVPA 1YDRE 3ROCA 2VRXA 5KUPA 5L3AA 2AC3A 3DAJA 3QTQA 3DY7A 3QQUA 5E91A 4EHVA 3F6XA 1ND4A 3ZO2A 3TNWA 4BBFA 2WQNA 4DTBA 3EYHA 4PDYA 2W1DA 3LZBA 3ZS5A 4UX9A 4JVGA 2EB3A 5EOBA 5IQBA 5KMJA 1REKA 5EI8A 3SD0A 2WGJA 3KXZA 3E8NA 4NW5A 2YCFA 5KHWA 3L8XA 3R83A 1IAHA 3P78A 4O7ZA 4DT9A 5JN2A 2IW6A 1GZOA 3UOHA 4Z3VA 1O6YA 2WEIA 3K3JA 4FTOA 3I6UA 4KKGA 5A14A 4EH4A 4R7IA 5A3XA 4IADA 4CTCA 3MVJA 1OIRA 3UMXA 4CGAA 4FZ6A 4M69A 1YI6A 4AACA 2JFMA 5D7AA 1PYXA 3ORLA 3QKMA 2JDRA 5EG3A 3GBZA 5A9UA 1KOAA 3R30A 3MGYA 3LCDA 4FSQA 5AUYA 3MBLA 4U80A 4EYMA 5C8KA 3OC1A 2RL5A 4GVJA 1JBPE 3D7TA 4C36A 2BDFA 3OT3A 5HO7A 4I6HA 2YACA 4FV9A 3G0EA 3TUBA 4BBEA 5ITAA 5EYDA 4AAAA 4FK6A 3M42A 4C37A 5LVNA 5IQDA 4K18A 4MHAA 2VZ6A 4JBVA 3KREA 3V5LA 4AG8A 4FL3A 3ZH8A 2X2KA 4DF3A 3VUDA 3F2RA 3DLSA 4RJ3A 3GFWA 2XM8A 1OKYA 1ZMWA 3BX5A 4DH3A 3CPCA 1L3RE 4XUFA 2PU8A 3U51A 4P90A 4ZS0A 2UW6A 2CPKE 3KXGA 4XV9A 5ANDA 3JR1A 4EOLA 4U0IA 3FPQA 1ZMUA 5IUIA 2CLXA 1PW2A 2AUHA 2O5KA 3EH9A 3FL5A 4QYGA 3SX9A 4KWPA 4DFNA 3COMA 3ZBFA 3QQHA 4CD0A 5FD2A 3BRBA 3HGKA 1JWHA 4G3GA 4CEGA 3NVMB 4BWXA 4EC8A 5HNBA 2XNPA 3NUSA 4FTNA 1J1BA 1ZLTA 3E87A 3DAKA 5K3YA 4C7TA 3VW6A 3PJCA 5E1SA 4X2KA 2CKPA 4FV2A 4KBCA 3FI3A 4EJNA 3GGFA 3KMWA 1JSTA 3I4BA 5ETIA 3Q3BA 3ZLSA 5CXZA 4J7BA 3ZZEA 3UBDA 3DFCB 3FHRA 2LAVA 3G0FA 3RINA 4F7JA 5CANA 1V0BA 4C61A 2YISA 3NUAA 2YIQA 2WMVA 4BDJA 1JAMA 3ELJA 5HE2A 2WB8A 3D9VA 3O7LD 5KX8A 5CXHA 2HZIA 2WFYA 2QKWB 4ZMFA 1TQPA 4LOPA 1JSVA 4PV0A 3TI1A 2WOUA 2GTNA 5AAGA 4O91A 3SW4A 3PJ1A 3VNTA 4EHZA 5IQEA 2JKMA 3ODYX 3O8TA 5CVHA 2QOHA 5I4NA 4GU9A 4OTPA 4U5JA 2HZNA 5JGAA 4CG9A 4PY1A 1BX6A 4WHZA 5HO6A 3C13A 3QQKA 3MVHA 5EOLA 5C27A 5CAQA 3HECA 5DH3A 4A07A 4LV5A 4N6ZA 4TNBA 1F3MC 3AT2A 4AZEA 3UNKA 2YZLA 4XG9A 5LVOA 4OGRA 3ZO4A 5I3OA 3AC5A 2B7AA 4ZY6A 4MEDA 5M06A 3ULZA 4GT5A 4Y5QA 5C26A 3OCSA 4ZZMA 1H1WA 4NU1A 4TT7A 4D2RA 4G3FA 3TIZA 4GG5A 4OUCA 5CYIA 3QRKA 2W96B 2J2IB 1TQMA 4FKSA 3T8OA 1OB3A 5M4UA 2J50A 3I0OA 3E93A 3I79A 5I9XA 1WVWA 5E7RA 5EQYA 5ANOA 4MXAA 3C0GA 3NUYA 2BAQA 4FTCA 4QP2A 2P55A 4I92A 1M2RA 4F7SA 3Q9YA 1MQ4A 3QTSA 2OW3A 3UPXA 5E8YA 3KCFA 3QTXA 3EKKA 4XOYA 4ZY5A 1ATPE 3QC4A 3T3VA 1OITA 3C5UA 4AZWA 4EH2A 3NR9A 5LARA 1QPCA 4TXCA 4UXLA 4FEQA 5AUWA 3OTVA 4CYJA 1B38A 5K9IA 2WO6A 3TIYA 2Z8CA 3UE4A 2XK9A 3AC2A 2GHMA 3A61A 3NGAA 4CFNA 3FI2A 1PHKA 2ITWA 2F7EE 3I81A 3NIZA 3PG3A 4C4IA 1GIIA 2XBJA 3HAVA 3EJ1A 4BIBA 2PL0A 3S00A 4DBXA 5IA2A 2Y9QA 3FZSA 1U5RA 1B6CB 1RW8A 3WE8A 5HVKA 4ITIA 3PPZA 4P4CA 4U45A 3V3VA 5C9CA 4BKZA 3RTPA 4E7WA 2PVJA 5D7VA 2E9UA 4O84A 2PTKA 3P1AA 1Q61A 3GCVA 4FE2A 5CX9A 2H34A 4GV1A 2VNWA 3E7OA 5KMOA 3R73A 3GI3A 4JI9A 1DS5A 1SNXA 2JBPA 2CLQA 5H8BA 3V8WA 1YWVA 4E5BA 1FMOE 1OKVA 3BQRA 2BFXA 5H8GA 1A48A 3H9RA 1RE8A 2R3OA 3LFCA 3LXLA 3TZMA 2R2PA 1KE8A 5CQUA 5AEPA 3NYVA 4PX6A 3R8UA 2UW4A 3KC3A 4ACHA 1V0OA 3QF9A 2R3JA 3E3BX 1PXNA 3FMMA 4DEIA 1I09A 2OH0E 1Z9XA 3NNUA 3PE2A 5KMNA 2YLFA 2PVFA 4DFBA 3G2FA 1LEZA 3MPTA 3ZBXA 2VTAA 3TNPC 1Q62A 3FQSA 4Y83A 3QQLA 4C3FA 2AYPA 1E1VA 4DFUA 1W98A 2O3PA 2ZYBA 2JDSA 3THBA 4EK6A 3U54A 5I9YA 2X81A 5F94A 2XEZA 3MIYA 5GZ8A 2RFNA 5DEYA 1H07A 4R5YA 3VRZA 4D9UA 3P0MA 2OJFE 5FTGA 3NAYA 5J1VA 4TW9A 5BNJA 4L42A 2YIRA 5C1QB 4HGSA 3P7CA 1PMUA 4XOZA 2QU6A 3MH1A 1ZXEA 4PP9A 4F63A 2YCQA 5EK7A 3G51A 2VV9A 3RK7A 1XKKA 5E8ZA 2FUMA 2JGZA 4H3PA 5CVFA 2E9PA 2HXLA 3KRXA 3S4QA 4PMMA 4ZY4A 4FNZA 4FV0A 4LOQA 4F65A 1SVEA 2W4KA 3QALE 5E92A 1RDQE 3WF6A 5B7VA 4YHTA 4NCTA 5JH6A 2UZTA 2WTKB 4DGLC 4YJRA 3A8XA 4G9CA 4BI2A 5HCZA 3Q4CA 1Q8TA 4OTIA 3OCBA 4GKIA 2PUPA 2X0GA 3V01A 2Y0AA 3BYMA 4BCGA 3AC8A 5AAFA 4C33A 4FKOA 4U79A 5FEQA 3FSFA 2BRHA 2C3LA 4KSQA 3RM6A 3PXRA 4MD7E 3M11A 3PSCA 4FT9A 5EM7A 4MK0A 3IGGA 5J1WA 3NUPA 1LEWA 4HCVA 4OR5A 1XH5A 3TKIA 4E20A 5GZAA 3ZFXA 3PIZA 4FIGA 2F2UA 4F99A 4LOOA 5AV3A 4LV8A 5EW9A 5TR6A 2W9FB 2V55A 3GEQA 3E62A 3UYTA 4UB7A 5AR2A 4CLIA 2CDZA 3ATTA 2I0EA 3JXWA 4YNEA 4FA2A 3DGKA 1AD5A 3ZLWA 2Q0NA 4L7FA 4WUNA 4EH3A 2WTCA 2YM3A 4EZ5A 3I0QA 1Q8ZA 3GNIB 4AQCA 4R8QA 1V0PA 4QYYA 2ZM3A 1XH7A 4H58A 3P79A 3DKCA 4UWBA 3UTOA 3FLSA 3R7VA 4Q9ZA 5IQFA 3FSKA 3G9LX 3F2NA 4OTGA 3U6IA 5L4QA 4QP8A 4PNIA 4ENYA 5AP7A 2QLUA 5JKGA 3ZSHA 4CRLA 3F7WA 5KBQA 1MUOA 3GQLA 4AE9A 5CEKA 1SMHA 2VTIA 2C4GA 5HG5A 2J90A 1TQIA 4NWMA 2REIA 4ZXTA 1WBTA 2R0UA 3QD4A 4FVPA 4RRVA 1JKLA 1WBWA 2JDOA 4I5HA 4ZAUA 2VN9A 1HCKA 3KXNA 3Q5ZA 4EK4A 3A7JA 4FV7A 1Q4LA 2PMNX 4K9YA 3WF5A 3TZ8A 5BQ0A 5L2IA 3EQGA 3OOMA 2ZDTA 3OBJA 4CXAA 3LJ2A 3VUIA 3RBWA 4RX5A 4L52A 4IWQA 2XUUA 3PYYA 5ANKA 2QOQA 1BL7A 3MY5A 4S33A 4C62A 4F70A 5ANIA 3A7GA 4KBAA 3V6RA 4DCEA 4LGHA 4RGJA 4ZSEA 4ZK5A 2I0VA 4BL1A 1R0PA 2P2HA 2JAMA 2JFLA 4GFOA 4PL4A 4ZTQA 3H4JA 1XBCA 1Q99A 2EXMA 4MBIA 5T68A 4BZDA 4PL5A 4IZ5A 2WZJA 3OWPA 3IO7A 3PY0A 1MP8A 3RKBA 2O0UA 4LUDA 3RWPA 2BDWA 4FMQA 4S2ZA 4S30A 5LMAA 5CY3A 4XYFA 3D0EA 4ZTRA 2ZDUA 3DZOA 4BF2A 3RAWA 3BKBA 3SV0A 4FKPA 4FKTA 4GFMA 4QMWA 4E4MA 3QUEA 5D41A 1AQ1A 3Q2JA 3SG8A 3PIXA 4I6BA 4ITHA 3BWFA 2H8HA 3R1YA 3R7EA 5LMKA 3QBNA 1ZY5A 4ZTMA 3FUPA 4YJUA 4C3PA 4WO5A 4D2SA 5JT2A 4N70A 4D2TA 2VO7A 1NVRA 2VO0A 3MPMA 3P08A 4E93A 3HEGA 5HX6A 4FNYA 3N4VA 3TWJA 4C4GA 2WELA 2XYNA 3UYSA 4Z7GA 2VX3A 3VS3A 2BR1A 4LFIA 3RHKA 4QQ5A 2ZM4A 3OWLA 3AG9A 3LVPA 3W16A 4ALWA 4UN0C 5I9VA 2XBAA 4IVAA 3K3IA 5ANGA 1XH9A 2GNJA 4IXPA 4FL1A 2X7OA 3OVVA 3O17A 5CWZA 2GNLA 2OBJA 3KGAA 5GIOE 3DNEA 2RF9A 3FBVA 3R1QA 4X7QA 2X4ZA 1FVVA 4HCUA 3V5JA 4JG7A 5DPVA 5IA0A 1U4DA 2PZPA 4WRSA 5FLFA 4X2NA 2PVMA 4BTMA 4WIHA 5IEVA 3RNYA 3WZUA 4FTKA 3F3WA 4FBXA 4JJRA 3DT1A 3PJ2A 3C4FA 5AIRA 5L6PA 4DFYA 3CTJA 3I6WA 2C6OA 4DGMA 3ZEWA 4TWPA 2XRWA 4FVQA 3EQRA 2GDOA 4TN6A 5E8TA 2XCKA 3LMIA 2YERA 3PP1A 3QYZA 5CEQA 4ZJVA 5A4TA 2C0OA 2GTMA 3WZDA 5IZFA 4P5ZA 2YAAA 1BMKA 2CSNA 3RPVA 4JNWA 5CAUA 3EN6A 4UYAA 4UMQA 5C01A 4PRJA 3HYHA 3VC4A 3OFMA 4O7TA 3ZO1A 4BTJA 2RFDA 4WUAA 1DAWA 1MRVA 1GZKA 3N4UA 5FWKK 2JITA 2A4LA 5KKRC 4HGTA 4YO4A 4N57A 3Q6UA 1OBGA 2Q0BA 2R5TA 2QNJA 2R3LA 1Q8UA 3C51A 4CFWA 3HUCA 3MYGA 1M17A 5DLSA 4KBKA 3TT0A 5AR7A 4CCUA 1YXSA 5JQ8A 4HVDA 5EYKA 2DS1A 2FSMX 2QVSE 4RFYA 4JBQA 5EM6A 4F1MA 4Z16A 5JFVA 1M14A 2QG7A 3CLYA 4EH5A 2YJRA 4U7ZA 4XG8A 5IQCA 1UNLA 3BYUA 3PPKA 4ANOA 4I0RA 4FV5A 4E4NA 5E4HA 2QD9A 3OP5A 1Q41A 2GHLA 3ORNA 2IJMA 3POOA 3R28A 4AGUA 4G2FA 4IM2A 2PZRA 3D5UA 3ZUUA 4DG3E 2YIWA 4S32A 2XIYA 3RCJA 3BYSA 5EYMA 5E1EA 4DGOA 5CF8A 3W2PA 3VBWA 5KMMA 1FQ1B 3LFEA 1YXXA 2J7TA 5HQ0A 1KV2A 3D14A 2WTJA 4RIOA 2UVZA 3LXKA 2YM4A 5J9ZA 2RG6A 3H0YA 3KMUA 5IQIA 4XBUA 3A99A 1ZOGA 3L8SA 4FV6A 4UMTA 4MXYA 5L6OA 3G15A 3TTJA 3WF9A 1IEPA 5AP1A 3U8WA 4O22A 3U6HA 1TKIA 2X7GA 5FUTA 3R7YA 2R7BA 1U5QA 4GG7A 2ACXA 3GCQA 3CTHA 2W05A 3OUNB 3EIDA 3IONA 4QQCA 3TKHA 3CBLA 3QD0A 1H1PA 4BDAA 4OTDA 4XG3A 4QP7A 4YP8A 2FYSA 2RKUA 2FO0A 2PMIA 5AA8A 3AT3A 3ORIA 4CNHA 3EN9A 3FDNA 4PPAA 2DYLA 4U42A 4N6YA 4FX3A 4KABA 5AV2A 4ANSA 1WBSA 2XK8A 3L1SA 4UEUA 4LYNA 4A7CA 1GOLA 5DT4A 1CKIA 4BGGA 2QI8A 3O0GA 3MA6A 3ZLYA 4EOJA 5I9ZA 3Q04A 3PPJA 2XK7A 4UYNA 4ACDA 2F2CB 5HNIX 4CZTA 4XS2A 4LMNA 4NEUA 4O7NA 3PFQA 4BY9E 4YJTA 1VEBA 2VTPA 3LMHA 4JBPA 3LCOA 4O2PA 4EOPA 4JDIA 4X3FB 4TNDA 1DAYA 3F66A 4F64A 2X6DA 5G6VA 2PWLA 3A4OX 4CKIA 1Q3DA 2QHMA 3MFSA 3R8VA 4NKAA 1RQQA 3DKOA 3IK3A 4FC0A 5DHJA 2B0QA 2X8DA 3CQEA 4LRJA 3HUBA 4M7IA 4O0XA 4F6WA 5M44A 3JPVA 4DITA 1Q97A 3H0ZA 4EK5A 4L53A 4Y46A 3SHEA 4FGRA 3GFEA 4MQ1A 3UVPA 4B99A 5BYYA 3MVMA 3FZPA 3Q53A 4M15A 3V8SA 3PJ8A 1E9HA 3GU4A 3UNJA 3UP2A 4D4SA 3TZ7A 3LIJA 4DT8A 5EYCA 3FZRA 2JIVA 3DB8A 1OECA 3C4ZA 4CFUA 2QOBA 4GT3A 3O7LB 4FSNA 1K2PA 3ZSIA 3V5TA 4BDBA 4J96A 4RVTA 4FF8A 3V5WA 5IG1A 1JVPP 3CJFA 3VS2A 4RC4A 3HLLA 1GIHA 3NCZA 3CJGA 2ESMA 3OEFX 3QWKA 4RA5A 4CSVA 3NAXA 2W4OA 3P5KA 1GZNA 3NW5A 5CZHA 4EYJA 5JZJA 4A9YA 4EHGA 4CV8A 3NW6A 4F08A 4AFEA 4IFGA 5DFPA 3M2WA 4QD6A 4EC9A 5CAVA 4NTTA 4YC6A 4AWIA 3KVXA 4ZS4A 2IZTA 1RJBA 2XK3A 5CU4A 4O7WA 2PHKA 3C9WA 3BE2A 4I23A 4ZLYA 5IA3A 3L9PA 5AP5A 2PK9A 2P3GX 3QCXA 4RQVA 4FV4A 2UZEA 4AT5A 3NMUF 3E3PA 4IB0A 5CU6A 2CKEA 2OKRA 2R64A 4XX9A 5I3RA 3OG7A 1YOMA 5HBHA 3LJ1A 3ZFMA 5H9BA 2QHNA 2JLDA 4CFMA 2GMXA 2JEDA 3SG9A 3BYOA 3DCVA 3Q9ZA 4MD9E 3R9RA 3G5DA 5DR2A 2X6EA 3UQGA 3FXXA 4X2JA 2WQMA 3RHXA 2UV2A 2PPQA 3LQ8A 3ZO3A 4FKUA 4F4PA 4PPCA 3T3UA 3R9HA 4F0GA 4BWPA 2YAKA 1PXKA 4D4VA 4FTTA 1S9JA 4F9YA 4L46A 3LQ3A 2QO7A 2QOOA 4RSSA 3DB6A 2PVRA 5HBEA 4FIHA 3E5AA 3LCKA 1Y91A 4I6QA 4J71A 3LW0A 3VBYA 4F6UA 2A1AB 3BE9A 5IMXA 2QOFA 1U59A 1J91A 3QRIA 2J51A 3KRRA 4C4EA 3MFRA 2IW9A 3PSDA 4BFMA 3FZTA 1OL5A 2E2BA 2ZOQA 3UZPA 3ZTXA 2QONA 4IVDA 1FGIA 4L67A 5CU2A 4AGCA 3AGLA 3QL8A 3QTRA 3GENA 4GVAA 1GNGA 5HKMA 2V5QA 3QCYA 2JAVA 3TV7A 5A54A 5IU2A 2C3IB 3GU6A 3VJOA 3UO4A 4DEHA 3L8PA 4YC8A 3ZM4A 5HIDA 2XJ2A 3TL8A 3UPZA 3ATSA 2B54A 4FT5A 1OL1A 5DRBA 1H8FA 3MESA 3FYKX 3AD4A 5K0XA 3PE1A 3LFNA 4E6CA 3Q6WA 5D12A 2PVLA 3KF7A 4YGAA 3REPA 4CQGA 5BPYA 5K5NA 3CIKA 1CKPA 1QPJA 2A0CX 3RMFA 4QTBA 4IAKA 4A4XA 4PDPA 3PDTA 3DBDA 3EQPA 3AGMA 2F7ZE 1KWPA 4XMOA 5AIKA 5DBXA 2ZV7A 4DCAA 3ZXTA 4YTFA 3SRVB 4FTUA 3BZ3A 3HA6A 5JFXA 3A60A 4X3FA 3R8MA 2YWPA 2BALA 3FZOA 3VULA 4FKIA 3O71A 3VUHA 3ZDIA 1M52A 4K1BA 5HHWA 3NVKI 4I0TA 2UW8A 4X2FA 2YCSA 4YR8A 1U54B 3U4WA 2GFCA 4MQ2A 5IPJA 4IWOA 2R3RA 4G3DA 2H96A 3MA3A 4ITJA 3OCGA 2VTHA 1CSNA 3HKOA 4X6QC 5TF9A 4FKWA 2X2MA 2X8IA 4F7NA 4XP2A 2J0LA 2EXEA 4HPUE 5J9LA 2XH5A 2OF4A 3GCSA 3F5GA 4EQMA 1E1XA 3ORKA 4EZ3A 4YC3A 1MQBA 4DGGA 3CKXA 4FT0A 3LE6A 2GQRA 3F3TA 4PMPA 2JD5A 2OIDA 4HVGA 4XHKB 3TTIA 4DC2A 3RAKA 4EK3A 3EN4A 3ZSGA 3PVUA 5L2SA 3GVUA 2C6KA 2C30A 4XBRA 4EEVA 1ZYDA 4X0MA 4DEDA 2ZJWA 2HOGA 5FBOA 3UG2A 4WNMA 2WHBA 5HEZA 4D2PA 3MY0A 5DNRA 5AUTA 1QCFA 4ZTHA 3KN5A 1Q5KA 5IQGA 2WD1A 2C1AA 4M0ZA 4BHNA 4F9WA 3BV3A 3LFAA 3BGPA 4F9BA 2PMLX 5A46A 3LHJA 4TKSA 1OMWA 4L43A 3ZXZA 4FSMA 3CPBA 3QC9A 5FG8A 1YDSE 1CDKA 3DQWA 3QFVA 2E9VA 3EQCA 3FMJA 3NRMA 3CY2A 3QHWA 4JRNA 5IA5A 3LFFA 4NM5A 4DINA 5D9HA 3MV5A 2BPMA 4U43A 5FDXA 3VS7A 3OXTA 2UUEA 3ZYAA 2OSCA 4BVUA 3HNGA 1XHAA 3PWYA 3IOPA 4PWNA 3DDQA 4FSUA 4TWNA 3GU7A 3CSVA 3BHVA 3GC9A 3NUUA 4HZRA 4W4WA 5JEBA 4CT2A 1M7QA 3ID6C 3I5NA 3R00A 4WOVA 4Y5HA 2Q83A 3P4KA 4USFA 3FI4A 3W18A 4NT4A 4FZ7A 4FGBA 2X7FA 4MXCA 3R7OA 3C4XA 2UW7A 4TRLA 4XJ0A 1JQHA 1G5SA 4H39A 4UALA 3ZHPC 2PUIA 4PDSA 3F82A 3DJ7A 4MKCA 4BIEA 1LP4A 3COIA 4QNYA 5CU0A 4EKKA 4HYHA 5TOZA 2BRBA 4MF1A 3V51A 2A27A 4EORA 1OIUA 2VTJA 3OTUA 2BROA 3PXFA 5F4NA 1PRYA 3WIKA 4BZNA 1F5QA 4C57A 2OXDA 4EOOA 3MY1A 2Z7SA 4AOJA 1R1WA 2QKRA 3PA4A 4B7TA 5JFWA 3W2QA 1UV5A 5LCJA 4R5SA 1J3HA 3Q2MA 5EKNA 3KL8A 1YHSA 3KU2A 5CEIA 2OIQA 2YIYA 4ALUA 5A6OA 2VUWA 5KKRB 3OY3A 2C5NA 4RPVA 1UU7A 1KE7A 1HCLA 2SRCA 3PRFA 3CS9A 4IANA 3II5A 4PP7A 5IH5A 1Z57A 4PTEA 2C69A 4IWDA 5LWMA 3P86A 3ORTA 1JKTA 4JG6A 5IMEA 2C3KA 2C5VA 4ANMA 4RBLA 2Z2WA 3QTZA 4QQTA 2YFXA 3ZMMA 1O6LA 4IBMA 2YN8A 3VBVA 2IG7A 2WU6A 1UU8A 5CSPA 3Q52A 2H9VA 4DLIA 3KFAA 2OJIA 4G3EA 5DE2A 1MRUA 3POZA 2ITYA 5LCKA 1WZYA 4XNEA 3VIDA 3HMOA 3L8VA 3C4CA 5DN3A 2B9JA 3P9JA 2O65A 4GSBA 1IRKA 3F3ZA 4JRVA 3ZRKA 4K77A 2HK5A 2BZHB 4OAUC 3SRVA 3PY1A 3CXWA 3R02A 3FY0A 4UBAA 4JAJA 4PNKA 2YJSA 4I20A 5E8SA 4LGDA 1PXMA 3FMEA 5AADA 2Z7RA 2YHVA 3COKA 4R78A 3C50A 3LPBA 3MPAA 4KIPA 2QODA 3VS5A 2BCJA 4BBMA 3VBXA 4D5HA 3KVWA 3NZ0A 1U54A 4EZ7A 3HRBA 4IZAA 4XCUA 3LFQA 2OJJA 2PVYA 2ITUA 4FYOA 3UG1A 3ZUVA 3PXKA 5CSHA 3FXZA 5FM2A 4DH1A 3W2SA 3BQCA 3EHAA 1B39A 4O27B 4DE4A 3CTQA 3QX4A 3NSZA 3I7BA 4M3QA 2GS6A 2QOCA 2O2UA 4AW0A 4BYJA 3KRWA 5AUXA 1OZ1A 2UZNA 2YDJA 4IWPA 4I6FA 2V0DA 3QRUA 3HRFA 3IDBA 4C0TA 5H8EA 4M84A 4GKHA 4QMZA 4QP9A 4WNKA 4J1RA 5A4LA 4FEWA 2NP8A 3F3UA 3GCUA 1JSUA 4AZVA 3KN6A 5M07A 1PF8A 4JL9A 2Y6MA 3NNWA 2VWBA 3DTWA 3EQIA 4I4EA 1OIYA 3CD3A 4GIIA 4XG7A 5BMMA 2WTDA 3RZBA 4BIDA 2YDKA 4NZWB 3FQHA 4KRDA 3BBTB 4YUQA 4BDGA 4EWHA 4QT1A 2BTSA 1XWSA 3HDNA 4RT7A 5IEYA 1H1SA 2O8YA 5FEEA 3GC0A 5CI6A 5EH0A 4L68A 4O0RA 3NYNA 3ROYA 2I40A 5DR9A 4DH5A 4K6ZA 4HW7A 3PTGA 3Q4TA 2W17A 5CSVA 2R3IA 2YIXA 3U9CA 4NW6A 4X2GA 3HDMA 4EQCA 1UKIA 4Z55A 1OI9A 4FT7A 5EKOA 4NIFB 3FEGA 4CVAA 3AC1A 2X8EA 4BDEA 4PDOA 2B4SB 4WSYA 3FAAA 4EOQA 4AX8A 3C4WA 3UJGA 3LCSA 4I3ZA 3VUMA 3ORZA 4DBNA 4LRMA 4J8MA 2VAGA 2CN8A 2YZAA 4G16A 5IQHA 5M08A 3GCPA 2WIPA 2VU3A 4QPMA 2F57A 2WKMA 4U8ZA 3LAUA 2B1PA 4CQEA 3C0IA 3QU0A 3QAME 1NA7A 4U41A 3C1XA 3DBQA 3PLAE 4O7LA 5C4LA 4IAZA 5HE1A 3TG1A 4AZTA 2W1GA 2IZRA 4QTAA 5CEOA 5GINE 1K3AA 1ZYLA 3QRJA 2IWIA 4I93A 5BVWA 4EL9A 4CRSA 4QP1A 2HW6A 3VF8A 2QLQA 2J9MA 5CEPA 3QZGA 5J9YA 5HTBA 5L2TA 3WI6A 2C3JA 4LL0A 3C0HA 4MNFA 4Y72A 4O81A 2R3QA 4YJVA 4W9WA 3UOKA 4FSZA 4GIHA 2Y4PA 5A4QA 4FL2A 3F5UA 4IX3A 3RZFA 1APME 3QKKA 2A2AA 4GEOA 4NJ3A 3MIAA 1PJKA 2G2IA 4C38A 4PTGA 5A6NA 2RFEA 2RSVA 3KRJA 2ZMCA 2OWBA 4QYHA 3CY3A 4IAFA 5AUVA 3SGCA 2J0IA 3ZONA 5FXQA 2VO6A 4FR4A 4FIFA 2BRGA 2E9OA 4EH8A 3QWJA 2ZM1A 3R2BA 4PTCA 4DH8A 4GS6A 2C47A 4NSTA 3DAEA 3KQ7A 3N51A 2FVDA 1YI4A 4J99A 4U97A 5L8KA 1GJOA 4F6SA 3OUKA 4JLCA 1GAGA 4O0YA 3TCPA 4JX7A 3IW7A 4AN2A 2JKKA 3ENMA 3B8QA 3Q9WA 1P5EA 2FA2A 4L44A 1O6KA 4TWCA 5AR8A 4ZSAA 1OUYA 1IASA 3MB7A 4K33A 3R21A 1F0QA 3JY9A 4R6VA 4IJPA 4C59A 2QQ7A 5AR5A 3EFLA 1TVOA 2G1TA 4O86A 4GYIA 4R1VA 5F1ZA 3A2CA 4NM0A 5HIEA 4YJOA 3DXPA 2ZV9A 3VQHA 2BDJA 4FTIA 3H10A 2R0IA 4FKJA 4GUEA 4QMSA 3DXQA 3ODZX 1IA9A 1I44A 1SYKA 1H01A 4E6QA 2BUJA 5AM7A 4H1MA 4KB8A 3HZTA 1VJYA 3WYYA 4FUXA 4A9TA 5KCVA 4C2VA 3S3IA 2Z60A 4FSRA 4I5CA 1UA2A 3NNVA 3P7BA 3Q5IA 4U44A 2C1BA 2G2FA 3DOGA 4EH7A 4KRCA 5JMSA 3KCKA 3ERKA 4RJ8A 4KIOA 4D58A 4L9IA 4AT3A 5L8LA 4TL0A 3U55A 5I9UA 4YZ9A 4FEVA 4CMTA 3HV3A 2OF2A 3PXYA 3A8WA 2JC6A 1OBDA 3ALNA 2PYWA 4IJ9A 3TXOA 3DA6A 4TYGA 5JSMA 2ETMA 4RX9A 4V04A 1PXOA 3RPRA 3EL8A 3O23A 3NW7A 3OHTA 1A06A 1H0WA 2EXCX 4NK9A 5LWNA 1NVSA 3NX8A 3QYWA 2UZLA 5HGIA 3D7ZA 2FSTX 3KULB 4QP4A 5EHOA 3TN8A 3E8CA 4FKRA 4QYFA 4UMPA 3DV3A 3WBLA 3EFKA 1ZOHA 2W1ZA 4JX3A 2GU8A 3AMAA 3W2CA 2WQEA 1XH6A 4DTKA 5IA4A 3HMNA 2PVNA 2IW8A 3ZOSA 4FSTA 2P4IA 1LR4A 2XJ1A 5EDPA 2WMXA 5GJDA 4EHEA 3OZ6A 4YBJA 1W84A 2PMOX 3NLBA 5J7BA 2BHEA 3CR0A 2KULA 5HX8A 4NIFA 2XRUA 1OPKA 3QZHA 3MJ2A 4O1OA 3CQWA 4KIQA 2I0HA 2ITVA 2HWOA 3DS6A 4J98A 5ETAA 2OFVA 4ZTNA 3SA0A 3MH2A 1QMZA 2PZYA 3Q4ZA 4O1PA 1CKJA 2WQBA 4RJ4A 4WKQA 1UNGA 2V62A 5CAPA 5DMZA 1STCE 4MAOA 4YSMA 3CD8A 4YNOA 1YRPA 3KXHA 4BTFA 4M8TA 1NVQA 2ITTA 4FZFB 1W7HA 5FQDC 4Z9LA 4M68A 5FTQA 3LOKA 3AXWA 4FT3A 4L45A 4ZZNA 1YXVA 4TYJA 4E6AA 1FBNA 3MDYA 4QTDA 2VD5A 4IB5A 1P2AA 2OU7A 4W4XA 5TE0A 4V01A 3S2PA 2GS2A 4CT1A 1KE5A 4YMJA 1ZYSA 3OXIA 4UXQA 2WAJA 3FLWA 2J6MA 3RJCA 1OUKA 4AN3A 2C6EA 4L6QA 4OTWA 4I5PA 2PE0A 1OM1A 4U6RA 5I0BA 2J0KA 5B2KA 5BVNA 2UZUE 4NM3A 3MTLA 1OVEA 3R1SA 4OBPA 3HV6A 5CASA 5ACBC 1Q3WA 5M4IA 1ERKA 2BKKA 4FK3A 1VYZA 2OJGA 4FSYA 3BEAA 5D10A 4LQMA 4M14A 3FMHA 5IDPA 4BCIA 1ZY4A 4GL9A 3TJDA 4O7RA 1GIJA 4F9CA 4OTQA 3S95A 4RJ7A 5CQWA 3R8PA 4QMMA 5E8XA 4O96A 2IVVA 1REJA 3RGFA 5LXMA 1FGKA 1ZMVA 4MXOA 3P7AA 3K54A 4DG2E 3CEKA 3O8UA 4AU8A 4KUJA 1PMEA 3D5WA 3E8DA 4WG3A 4JIAA 3FI8A 4OLIA 5CT7A 3PUPA 3ET7A 4FTMA 4NFNA 5HNGA 2C6IA 3W8QA 1WBPA 3E7VA 4GYGA 3SXRA 3P23A 4K0YA 4IAYA 4FG8A 4F0FA 4TYHB 3DKGA 3FXWA 4ZMEA 3I1AA 2BRNA 1H25A 2VTOA 1YVJA 3ZRLA 4YPDA 3RVGA 2B53A 3GC7A 4XV3A 5KMKA 2G2HA 2ZAZA 4D1ZA 5HTIA 1Y8YA 5AP2A 3WILA 5J5TA 4QMTA 5L6WL 2F49A 4BCMA 4G3CA 3QLFA 2XKDA 4IEBA 3BHHA 4W4VA 1V1KA 4RWKA 2R3FA 4XEYA 3LJ0A 3R7GA 4AN9A 4EWQA 3Q96A 5KO1A 2JDVA 3JVSA 3M1SA 3BHYA 3ZFYA 3DK7A 4BHZA 4PUZA 4C02A 4BGQA 5HZNA 3WE4A 5HLWA 4HJOA 5GHVA 4L3JA 3QXOA 2XS0A 4EOSA 4WSQA 3HX4A 4I41A 2R9SA 4FTQA 4OBQA 1OPJA 3SXSA 2HZ4A 2WIHA 4RG0A 2OK1A 3LFDA 4IX6A 1YHVA 4WRGA 4FV1A 5LMBA 2W9ZB 4F09A 3W8LA 3G90X 1Q8YA 3KULA 4IX4A 3W2RA 5LMKC 1L8TA 4GJ3A 2PULA 5HU3A 4UV0A 4V05A 4IB3A 4YU2A 2B9HA 4BZOA 4QP6A 4DAWA 1H28A 3TV6A 4A9RA 1SZMA 3DU8A 2C5YA 5EM8A 3Q60A 2XB7A 4AW1A 4BCFA 4GW8A 2G01A 2XNGA 3CC6A 2GNFA 4YZBA 4BCJA 1YWRA 2R4BA 3VUGA 3PSBA 4G9RA 2XKFA 4R1YA 4BDFA 4HCTA 3FC1X 4IM0A 3TNQB 4UWCA 3QQGA 4AW2A 2I6LA 3D2IA 5HVYA 2J0JA 4AUAA 4USDA 1YKRA 2JIIA 3VUKA 3WOWA 3FLQA 2NPQA 5HE3A 2HY81 4AT4A 5HD4A 2WPAA 4ACGA 3GU8A 5AR3A 1Y57A 4II5A 4FTJA 3U9NA 2UVYA 3QLGA 3QZIA 1AGWA 3PP0A 4N0SA 2ONLC 3BGZA 4XV2A 2PZ5A 2WTKC 4R7BA 2B55A 4RA4A 3TACA 3L9MA 1BYGA 3LQ5A 3MSSA 3PVGA 4LUEA 5FM3A 2BFYA 1YQJA 4AOTA 2XEYA 2YABA 3B2TA 2UW3A 3OY1A 3RPSA 5CSWA 1Q8WA 2QG5A 2VWXA 2BTRA 3BLRA 3R22A 4GRBA 4ZOGA 5GNKA 3UOLA 1PXPA 2FSOX 5HIBA 1Y8GA 3OXZA 4AS0A 3KF4A 3U6JA 4O83A 5EDQA 2XKCA 5J95A 5BYLA 3RALA 2HELA 3SXFA 4L3PA 3RK9A 5AP3A 4H3QA 5AM6A 1FVRA 4QMNA 4QMYA 2BMCA 3FLNC 3Q32A 4IAAA 4IFCA 4D2VA 3EL7A 3GOPA 3ZC6A 3IS5A 1R39A 3QZFA 4YHFA 5CSXA 5CF4A 4F0IA 3FPMA 4QTCA 4DA5A 4XRLA 5AX9A 3UO5A 1WCCA 4PQNA 3EYGA 2YDIA 2GNGA 2BHHA 4BICA 3EZRA 4PPBA 5IF1A 1P14A 3VBQA 2ITXA 1W83A 4NL0A 4M67A 3R7UA 5K4JA 4XP0A 4MD8E 2BIYA 2PSQA 3O51A 4D4RA 3OW3A 1VZOA 5HG7A 3QKLA 4V0GB 4Y8DA 2Y6OA 2BIKB 3KRLA 2QR8A 5HOAA 4DN5A 4RWJA 3V8TA 4CFFA 4D5KA 4EJ7A 2WTWA 5HCXA 4O0UA 4C4HA 5E8UA 3KB7A 2WEVA 3QTIA 5DWRA 5HG8A 4TYHA 3QRTA 2YA9A 1WBNA 2V22A 4X6RA 4M97A 4Q9SA 5AV4A 2JKOA 4ZJIA 1YXUA 5DRDA 1KSWA 4AF3A 1WMKA 2DWBA 2X39A 4BTKA 4I94A 2EVAA 2E9NA 2OG8A 3BCEA 4L01A 3ZLXA 2QCSA 5LJJA 4IACA 1BKXA 4EKLA 2W7XA 2JIUA 3EMGA 1OL2A 3KA0A 3QCSA 4RQKA 4IM3A 1CTPE 1NY3A 4QO9A 3IOKA 3V5PA 3VS6A 1YXTA 3PVWA 1YOLA 5CVGA 2VTTA 3LKMA 4JG8A 4RX7A 2QC6A 4H1JA 4BCOA 2Y7JA 2GCDA 1ZARA 2XNNA 2VGPA 4EH9A 1ZYCA 2RGPA 3ANQA 3QA0A 3QTUA 1BI7A 2NO3A 3R71A 4LRKA 4GJ2A 2W5HA 4YJSA 3FLZA 3OWJA 4U81A 4E8AA 3T9IA 3R7IA 4J8NA 2UW9A 4R7HA 2BVAA 4KSPA 4NM7A 4O6LA 2I1MA 3WIGA 2CHLA 2HW7A 3DBFA 3FMLA 3R9OA 3OF0A 1T46A 3SC1A 4K8AA 4E73A 1R3CA 2XK6A 2R3KA 3C7QA 4FOBA 4HYSA 3GU5A 3S0OA 3WZKA 5IH4A 3UZTA 2ITPA 4QMXA 2OXXA 3SOAA 4UY9A 5EQEA 3FZ1A 2WXVA 5EM5A 5JZNA 3HV5A 1W82A 4ZP5A 1UWHA 4AE6A 4DEBA 3UO6A 1ZWSA 4ASZA 4FOCA 4RZVA 3N4TA 1BUHA 1FOTA 2X9EA 5M56A 4UMUA 4AA5A 1FMKA 2W1EA 4J52A 4OAVB 5M09A 4RJ6A 4KAOA 4BDDA 4UZDA 4BR3A 3E88A 2BILB 4TWOA 5ETCA 2VTQA 3SQQA 4EONA 1JPAA 1UU3A 4FKQA 4AGWA 4D4YA 2CCIA 3NWWA 5M57A 4ID7A 2W99B 2CN5A 4ZIMA 4BYIA 1OPLA 2XF0A 1CM8A 3LM5A 5DT0A 4YJQA 4LM5A 1H00A 3PJ3A 4DGNA 3BU5A 2C0TA 2R3GA 3UODA 2CKOA 5HD7A 1W0XC 4UZHA 4HZSA 4MXXA 5CS6A 4QNAA 5LOHA 4BDKA 5J79A 5LVMA 4U3YA 3HVCA 4CG8A 4RIXB 5C03A 4IDTA 4KKHA 3I7CA 2VTMA 4IE9A 4QMVA 5BMSA 5L8JA 3DBCA 4J95A 4CMOA 4QMOA 4L3LA 2UZVA 4FZDB 5LQFA 5IDNA 2CGUA 3LFBA 2FGIA 3HA8A 4FUYA 4D28A 2W0JA 3CGFA 4MWHA 2W5AA 5HTCA 2W1HA 5B2LA 3TJCA 4BI1A 4AFJA 4TPTA 4NFMA 2HENA 3RM7A 2YM8A 5FP6A 2ZB0A 4FIIA 3PG1A 5D11A 3AC4A 4ONAA 2V7AA 2Y8OA 4XH6A 4ZEGA 3EQHA 3WZJA 4H05A 3NCGA 4KNBA 4FYNA 4RVLA 5ACKA 4FTAA 4JR3A 4B6LA 4BDCA 4QYEA 3UC4A 5EHLA 3DK3A 3HP2A 4TTHB 3HV7A 3F88A 2ZB1A 4Y73A 1QPDA 2GNIA 3MFUA 3ZU7A 2XP2A 3AD5A 4ZJJA 2ETKA 3UQCA 2GQSA 4QRCA 4ZSGA 5J5SA 1XJDA 5DGZA 4O7VA 5HE0A 5T3QA 5BUIA 1H1RA 2XKEA 3I60A 3V04A 3S1HA 4V0GA 5ANEA 5F20A 2LGCA 3MI9A 4AP7A 2NRYA 4EK8A 3VUTA 4CLJA 4DTAA 3OEZA 3SW7A 1K9AA 4FSWA 3DZQA 1ZAOA 4RFMA 5M4FA 1XH8A 4WNOA 4DH7A 3UQFA 5GJFA 4H3BA 3SDJA 4OT6A 5BVOA 1Z5MA 2F4JA 2W1FA 2YM7A 3GOKA 5DA3A 4Z7HA 5CENA 2P33A 2VTSA 5AWMA 4YPSA 2J5FA 2XIRA 5BVDA 2BZKB 4CCBA 4BWKA 3F69A 4ZLOA 1XO2B 1H24A 4YZMA 2OJ9A 4S34A 4BDHA 4EOIA 5KMIA 5DVRA 4RIYB 4I1ZA 2Y4IC 3KKVA 5EW8A 1Y6BA 4IH8A 5LVLA 4UWYA 4O7SA 4CTBA 3ACKA 2R3NA 4E3CA 2XNBA 1Q24A 2WOTA 5IUGA 2UZDA 3DPKA 1IG1A 2FB8A 4FEUA 4XLIA 2JBOA 2F7XE 4PMTA 4YZCA 3NYXA 3VAPA 3VJNA 2GHGA 4G6LA 3U4UA 3VQUA 3VO3A 3GP0A 3R04A 3O96A 2WMBA 2WU7A 1H27A 3OS3A 4H36A 3VW8A 3R01A 1FINA 3D4QA 2OI4X 2VGOA 3FE3A 4BKJA 4GK2A 2P0CA 5FXRA 4GMYA 3JS2A 3A62A 3QUDA 5K5XA 2XIZA 1SM2A 3R1NA 4IHPA 4MBJA 3LM0A 3GC8A 5FTOA 3E8EA 2CNUA 1OL7A 5M4CA 2W5BA 3FQEA 4FIJA 2JKQA 5HICA 4D1SA 1HOWA 5AP6A 4CMUA 3OWKA 4XLVA 4C34A 4IDVA 3MVLA 4OBOA 4RX8A 3D15A 3E64A 1P4OA 1P4FA 2BZIB 5BVKA 3TUDA 3D5VA 3IKAA 2AC5A 3MN3A 1NT2A 1OKZA 4FKGA 3E92A 4X3FC 3NEWA 3AC3A 3WZEA 4JOAA 2KTYA 4PL3A 5K0KA 4DFXE 3FHIA 3KMMA 3W32A 4J97A 2NNWB 2V7OA 1X8BA 4IZ7A 2ERZE 3W2OA 4BN1A 3PZEA 1BL6A 3HL7A 3RPYA 4FICA 3AQVA 4UMRA 3W1FA 3F5PA 1J1CA 2PVHA 3WARA 1PYEA 3TDWA 4A9UA 3KXMA 3BHTA 3FMKA 1PKGA 4EUUA 2VWWA 3IDPA 4E6DA 3FJQE 3BU6A 3LFSA 3PLSA 4MXZA 4APPA 2IVSA 4RIXA 2XVDA 4E5AX 2OIBA 3MJ1A 2YM6A 5CAOA 4JDKA 4G5PA 1BI8A 2Z7LA 1XBAA 3I5ZA 4L8MA 1DM2A 2UVXA 1W8CA 4JDJA 5CNOA 4OT5A 2DQ7X 3GT8A 4O0TA 5EDRA 3QD3A 5BVFA 4O0SA 2R3MA 3GXLA 3ZZWA 4XG4A 4BCPA 5EFQA 1NW1A 1WBOA 3JUHA 1ZZLA 3DTCA 4FV3A 4TYEA 4FODA 4E4LA 2XIXA 4O6EA 2PUUA 1EH4A 3MW1A 3OBGA 1UNHA 3DQXA 4DG0E 4Q2AA 1R0EA 4U9AA 3ENHA 4YO6A 4E4XA 5JRQA 4USEA 4B8MA 2VX0A 4YJNA 1G3NA 4RC2A 3FL4A 3PXZA 5EHYA 1Y6AA 1BLXA 1GY3A 5ETFA 4QMQA 4D2WA 4R3CA 4NH1A 1WVYA 1PY5A 4ZSJA 3BELA 5KZ0A 5TKDA 5K4IA 3UVRA 2OFUA 3FC2A 3CKWA 3NUNA 4G34A 3V6SA 4CKRA 4GT4A 4C58A 3QGWA 3RK5A 4DYMA 2FSLX 3ORXA 4FKLA 4YTCA 5E90A 2XMYA 3CGOA 4EI4A 2IVUA 5FXSA 5C8NA 5C8MA 3BEGA 3EFJA 2DUVA 3MH3A 1OKWA 4ZTSA 2ITOA 5HI2A 1UWJA 1J7UA 3RCDA 4ARKA 5AR4A 3D83A 3PRIA 4ANNA 3UIXA 2B9FA 3B2WA 4I24A 3QGYA 4G17A 4RZWA 2OZAB 3ETAA 3HMMA 4IVCA 5DOSA 5T6KA 4CKJA 5HORA 2PVKA 3MWUA 4RLKA 1PMVA 1YW2A 3F9NA 3ZM9A 2VX1A 4ANLA 4PMSA 2PY3A 2HZ0A 4ANQA 3RP9A 2XZSA 1WVXA 4U40A 4E26A 3JYAA 3IW5A 3A4PA 2IPXA 4X3JA 3AMBA 4U3ZA 3VWAA 4BI0A 5IA1A 2PE2A 3PA3A 5B0XA 5A4CA 2ITZA 4W4YA 5EW3A 3BHUA 2CMWA 3QUPA 3CE3A 4CYIA 4RVKA 2CJMA 3K2LA 4Q5HA 4RIYA 2G15A 4NTSA 2XJ0A 3EWHA 2UW0A 3EQDA 3NIEA 4G1WA 5J87A 4EQUA 3F61A 3UP7A 3BLHA 3R9DA 2B9IA 2YCRA 4BB4A 5KMLA 4FTLA 3TKUA 3UMWA 3PA5A 3VS1A 3LCTA 4YLJA 5HBJA 2WTVA 2CKQA 3K5VA 1QPEA 4MNEB 3E63A 3V5QA 4JT3A 4K11A 4MH7A 2GFSA 3FMNA 4KD1A 3GUBA 4YBKA 2ERKA 3RI1A 3ULIA 5FP5A 3FMDA 4S31A 1YOJA 2J4ZA 2C5XA 2VTRA 3ACJA 3D5XA 3H9FA 4C4JA 2Z02A 2IN6A 4FKVA 3OW4A 5AV1A 1NXKA 3B8RA 1J7IA 3ZDUA 3EN5A 4QPAA 3QXPA 1XBBA 5ICPA 4HVHA 3L9NA 5HCYA 5GJGA 4RJ5A 2QO2A 4APCA 2OZOA 4D9TA 2GPHA 5CNNA 3IW8A 2C6MA 3PVBA 3AT4A 4L7SA 3W10A 1YI3A 3R0TA 1UU9A 3NUXA 2W1CA 3TEIA 4GUBA 4ALVA 4ACCA 1H08A 5CT0A 2FH9A 5L2QA 3HRCA 1G8AA 4I22A 4YJPA 4WBOA 2J5EA 4FNXA 1JOWB 3ALOA 2O64A 4C3RA 2NRUA 3PZHA 4I4FA 5TT7A 1MRYA 5KNJA 3VS0A 4F1TA 2WMAA 3FKNA 4MWIA 5AFVA 3Q4UA 3FYJX 4EOMA 2IZUA 4WG4A 1OGUA 4XP3A 4EBVA 5M53A 5DEWA 4ZZOA 3EKNA 2UW5A 3TZ9A 4GU6A 5CF5A 4MBLA 2IZSA 3COHA 5E8WA 4EH6A 3QD2B 3IECA 1PMNA 4Y85A 4ERWA 3EB0A 4J53A 2XM9A 4TY1A 3TV4A 3AOXA 5EI6A 2X4FA 3W33A 3C5IA 3G6HA 2UZOA 3QCQA 4B0GA 2O63A 2QURA 2ZVAA 3F3VA 2R3HA 3PXQA 3DDPA 1XH4A 4KIKB 4O0VA 5DI1A 4AZFA 4R77A 4I0SA 3VN9A 5EQPA 3Q9XA 1KV1A 3OOGA 5DR6A 1URCA 3L9LA 3TM0A 2WMRA 2YITA 4ZLZA 4HGEA 5CALA 2CCHA 2QR7A 2HY0A 3EN7A 3SKCA 3F7ZA 4M66A 2WQOA 2GQGA 4ASXA 2YWVA 3UVQA 4ORKA 4FEXA 2ITQA 4IIRA 4P7EA 3BV2A 3VHEA 2ETRA 3HMPA 3G9NA 1OL6A 1JKKA 3MTFA 3AMYA 3LXPA 1G8SA 2XK4A 4D0WA 4Q5EA 1KE9A 1LPUA 2VWZA 4YZDA 2OLCA 5HU9A 1M2QA 5JQ5A 5HVJA 4D0XA 1SNUA 2YM5A 3OT8A 4M13A 5G1XA 3EQBA 4ASDA 3FKLA 3PY3A 2QO9A 1ZOEA 2QOIA 4P5QA 2H6DA 2ZV8A 4NCTC 5AMNA 3EZVA 2VWIA 3FLYA 3QQFA 2OGVA 3DNDA 3K5UA 4G6OA 4GK4A 4NUSA 4B9DA 4QTEA 5AA9A 5I9WA 5E9EA 5JRSA 2ONLA 3R2YA 4JXFA 2PUNA 2C6TA 1XQZA 3DK6A 3HP5A 4KINA 5DG5A 1VR2A 3U87A 4ACMA 3DJ5A 2OO8X 5TO8A 2EWAA 2OZAA 4W8DA 3VS4A 3G6GA 4NJDA 4WD5A 1XR1A 1DI9A 2C68A 4BDIA 1UKHA 3VHKA 2XNEA 4C8BA 3OCTA 4RMZA 2VWUA 2C0IA 3RAIA 1M2PA 4HYIA 4Y95A 5BVEA 1PXJA 3RPOA 1ZYJA 4RFZA 4W9XA 1T45A 1YWNA 3MFTA 3ZEPA 1JLUE 4YURA 5BYZA 3IDCA 4KS8A 2UZWE 5BX0A 4JBOA 1PKDA 4O38A 1KUTA 5KHXA 4B4LA 4BCHA 1IA8A 2BAJA 3W55A 5BUJA 3GQIA 5HESA 4F9AA 4F7LA 2CNQA 2RIOA 5FDPA 4BKYA 4HVSA 4G31A 4MYGA 4TZRA 5IQAA 5GIPE 5D1JA 4BC6A 3LLTA 2VWYA 3SAYA 2ZV2A 3SOCA 1WFCA 3G33A 4MNEA 4P2KA 4FG9A 5HLPA 2Z7QA 4EUTA 4EBWA 5AV0A 5CZIA 2VO3A 4R3RA 4IB1A 4OTRA 4BRXA 2EUFB 3ANRA 3MH0A 2CGWA 5FRIA 4PF4A 1URWA 2QU5A 4DEEA 2XNOA 1H4LA 3IPHA 4AA0A 2HYYA 4YSJA 4W8EA 3TNHA 4FI1A 4FZAB 4JIKA 5HO8A 3ZUTA 3WF8A 1DI8A 3CQUA 4JS8A 2OXYA 2BAKA 3A7HA 4XV1A 3TDVA 4JDHA 3BU3A 2WMTA 3A7IA 5CTPA 3UDBA 3IGOA 4WG5A 4XG6A 4CFVA 4LGGA 5JFSA 1KOBA 4IAIA 4BCQA 3UZRA 4DEAA 3VVHA 5F9EA 4CFXA 4EOKA 1H26A 1IAJA 2Y4IB 3DFAA 2W06A 3BI6A 4L00A 4MTAA 4MVFA 1JKSA 1WBVA 4FV8A 3FKOA 4G5JA 5GZ9A 2R7IA 3BIZA 4FIEA 4C35A 4AGDA 3RAHA 5JGBA 4RIWB 3SLSA 4QMPA 2BZJA 3NPCA 3DBEA 3IW4A 4A9SA 2OICA 4RVMA 2XA4A 5F95A 3H9OA 1J7LA 1KE6A 3H30A 3R9NA 2EU9A 4A4LA 5DT3A 1PXIA 5CF6A 2VNYA 4O0WA 4TYIA 3GB2A 5AUZA 5AP0A 5DYJA 4CV9A 3WYXA 3EFWA 3FWQA 4I5MA 3ZC5A 4DEGA 3JY0A 4YTIA 1SVHA 5KE0A 4MF0A 4I21A 2QOLA 3TUCA 2HWPA 3BYVA 4QMLA 4JQEA 3ORPA 2HIWA 4HNFA 1H0VA 3EQFA 4KIKA 5H2UA 2WMWA 2VWVA 3F2AA 5FEDA 5HG9A 5A4EA 4BCNA 3C4EA 1PXLA 3DLZA 4FNWA 2PE1A 4O2ZA 3TNIA 4BCKA 3O2MA 2JDTA 3KK9A 2HCKA 3NS9A 4HVIA 3KY2A 4NYEA 1UVRA 2X9FA 5AX3A 5KZIA 3NNXA 2WMQA 3CCNA 3QHRA 4O82A 4RWLA 3R8ZA 3HV4A 4M69B 3R63A 4DFLA 4GH2A 1QL6A 4ASEA 4JQ8A 3A7FA 4IX5A 5CLPA 2G9XA 2EB2A 4QQJA 4JQ7A 3WF7A 5BUEA 4HPTE 3H3CA 5E8VA 2C5OA 5JGDA 5M55A 4F1OA 3QTWA 4HGLA 3MB6A 4GCJA 1ZRZA 3VRYA 2X1NA 3PIYA 3UNZA 3D7TB 4AW5A 4QP3A 5CI7A 4GFGA 3BGQA 2F9GA 4YLKA 2PZIA 4O7YA 1S9IA 5EI2A 5B2MA 4ANBA 4KKEA 5IKWA 3D2KA 4IC8A 4AA4A 4DLJA 4YLLA 2I7QA 3QQJA 3DJ6A 4YHJA 3RWQA 4LG4A 5FGKA 4IW0A 1YDTE 4K2RA 3UOJA 5L2WA 2UZBA 3AD6A 3F5XA 3ZCLA 5M51A 5I5ZA 2RG5A 1H1QA 5FBNC 3OMVA 4ENXA 1YHWA 4RLLA 2R3PA 4MCVA 4HNIA 4D1XA 1LUFA 2IO6A 3UIUA 4IC7A 2CGXA 4WNPA 5CU3A 2W4JA 1M7NA 4IZYA 4YTHA 3RNIA 5HLNA 2C6DA 2IVTA 5AP4A 4HYUA 1R78A 2WTIA 2VTNA 3ZRMA 3MS9A 4JAIA 4LL5A 3R8LA 3HAMA 2WMSA 3R6XA 2B52A 4A06A 1IR3A 3UIMA 2GSFA 5C4KA 5AJQA 3T9TA 4G6NA 2XCHA 3IQ7A 5AAEA 1FPUA 4QPSA 4OW8A 3OD6X 1GZ8A 1WAKA 4QOXA 3PWDA 4AZSA 3BLQA 4IMYA 4QMUA 4XG2A 4E1ZA 5IEXA 5J8IA 2P2IA 1JNKA 4RWIA 1FVTA 2VTLA 1OIQA 3O8PA 4ZTLA 4O21A 3BWJA 4X21A 4E5WA 2ZMDA 3JVRA 3ORMA 4AXAA 4DHFA 3D94A 4LI5A 2QOKA 2J0MB 3FY2A 4GK3A 2WNTA 3DXNA 4A4OA 4B8LA 5DIAA 3UIBA 2A19B 4YZNA 4BGHA 2HXQA 5IH6A 1O9UA 3FV8A 3LXNA 2W1IA 3QA8A 4HOKA 4RC3A 3UC3A 2OH4A 3IW6A 3N9XA 1ZZ2A 4WBBB 5ANJA 5CEMA 2XYUA 4N4SA 3HMIA 3NYOA 2HAKA 3IG7A 4C2WA 2YEXA 4IVBA 3VF9A 3KK8A 1CMKE 4XRJA 4DFZE 3VBTA 5AUUA 5J7HA 4NKSA 4FVRA 4LMUA 2X2LA 2ITNA 2RFSA 2WMUA 3EOCA 4JR7A 4WT6A 4AOIA 2BRMA 2CGVA 4OTFA 5IISA 4CZYB 4FG7A 4R3PA 2BKZA 2GS7A 2C6LA 3LMGA 3QX2A 2GNHA 5H3QA 5IUHA 4MX9A 1U46A 3UGCA 3LLAA 3O50A 4CZUA 4FTRA 3NDMA 1VYWA 2XIKA 4C4FA 2CNVA 3SVVA 5KBRA 4KS7A 4ERKA 1A9UA 4ZSLA 4D55A 2XNMA 2I0YA 4WA9A
chains in the Genus database with same CATH superfamily
4RIWA 4M12A 1SVGA 5JK3A 2YLEA 4IQ6A 3DKFA 3CP9A 3ITZA 3KXXA 4O4CA 3BBWA 3OROA 4KA3A 3KEXA 4M0YA 3BPRA 4OTHA 5LVPA 1YDRE 3ROCA 2VRXA 5KUPA 5L3AA 2AC3A 3DAJA 3QTQA 3DY7A 3QQUA 5E91A 4EHVA 3F6XA 1ND4A 3ZO2A 3TNWA 4BBFA 2WQNA 4DTBA 3EYHA 4PDYA 2W1DA 3LZBA 3ZS5A 4UX9A 4JVGA 2EB3A 5EOBA 5IQBA 5KMJA 1REKA 5EI8A 3SD0A 2WGJA 3KXZA 3E8NA 4NW5A 2YCFA 5KHWA 3L8XA 3R83A 1IAHA 3P78A 4O7ZA 4DT9A 5JN2A 2IW6A 1GZOA 3UOHA 4Z3VA 1O6YA 2WEIA 3K3JA 4FTOA 3I6UA 4KKGA 5A14A 4EH4A 4R7IA 5A3XA 4IADA 4CTCA 3MVJA 1OIRA 3UMXA 4CGAA 4FZ6A 4M69A 1YI6A 4AACA 2JFMA 5D7AA 1PYXA 3ORLA 3QKMA 2JDRA 5EG3A 3GBZA 5A9UA 1KOAA 3R30A 3MGYA 4QEBA 3LCDA 4FSQA 5AUYA 3MBLA 4U80A 4EYMA 5C8KA 3OC1A 4DDGA 2RL5A 4GVJA 1JBPE 3D7TA 4C36A 2BDFA 3OT3A 5HO7A 4I6HA 2YACA 4FV9A 3G0EA 3TUBA 4BBEA 5ITAA 5EYDA 4AAAA 4FK6A 3M42A 4C37A 5LVNA 5IQDA 4K18A 4MHAA 2VZ6A 4JBVA 3KREA 3V5LA 4AG8A 4FL3A 3ZH8A 2X2KA 4DF3A 3VUDA 3F2RA 3DLSA 4RJ3A 3GFWA 2XM8A 1OKYA 1ZMWA 3BX5A 4DH3A 3CPCA 1L3RE 4XUFA 2PU8A 3U51A 4P90A 4ZS0A 2UW6A 2CPKE 3KXGA 4XV9A 5ANDA 3JR1A 4EOLA 4U0IA 3FPQA 1ZMUA 5IUIA 2CLXA 1PW2A 2AUHA 2O5KA 3EH9A 3FL5A 4QYGA 3SX9A 4KWPA 4DFNA 3COMA 3ZBFA 3QQHA 4CD0A 5FD2A 3BRBA 3HGKA 1JWHA 4G3GA 4CEGA 3NVMB 4BWXA 1TFFA 4EC8A 5HNBA 2XNPA 3NUSA 4FTNA 1J1BA 1ZLTA 3E87A 3DAKA 5K3YA 4C7TA 3VW6A 3PJCA 5E1SA 4X2KA 2CKPA 4FV2A 4KBCA 3FI3A 4EJNA 3GGFA 3KMWA 1JSTA 3I4BA 5ETIA 3Q3BA 3ZLSA 5CXZA 4J7BA 3ZZEA 3UBDA 3DFCB 3FHRA 2LAVA 3G0FA 3RINA 4F7JA 5CANA 1V0BA 4C61A 2YISA 3NUAA 2YIQA 2WMVA 4BDJA 1JAMA 3ELJA 5HE2A 2WB8A 3D9VA 3O7LD 5KX8A 5CXHA 2HZIA 2WFYA 2QKWB 4ZMFA 1TQPA 4LOPA 1JSVA 4PV0A 3TI1A 2WOUA 2GTNA 5AAGA 4O91A 3SW4A 3PJ1A 3VNTA 4EHZA 5IQEA 2JKMA 3ODYX 3O8TA 5CVHA 2QOHA 5I4NA 4GU9A 4OTPA 4U5JA 2HZNA 5JGAA 4CG9A 4PY1A 1BX6A 4WHZA 5HO6A 3C13A 3QQKA 3MVHA 5EOLA 5C27A 5CAQA 3HECA 5DH3A 4A07A 4LV5A 4N6ZA 4TNBA 1F3MC 3AT2A 4AZEA 3UNKA 2YZLA 4XG9A 5LVOA 4OGRA 4AAYA 3ZO4A 5I3OA 3AC5A 2B7AA 4ZY6A 4MEDA 5M06A 3ULZA 4GT5A 4Y5QA 5C26A 3OCSA 4ZZMA 1H1WA 4NU1A 4TT7A 4D2RA 4G3FA 3TIZA 4GG5A 4OUCA 5CYIA 3QRKA 2W96B 2J2IB 1TQMA 4FKSA 3T8OA 1OB3A 5M4UA 2J50A 3I0OA 3E93A 3I79A 5I9XA 1WVWA 5E7RA 5EQYA 5ANOA 4MXAA 3C0GA 3NUYA 2BAQA 4FTCA 4QP2A 2P55A 4I92A 1M2RA 4F7SA 3Q9YA 1MQ4A 3QTSA 2OW3A 3UPXA 5E8YA 3KCFA 3QTXA 3EKKA 4XOYA 4ZY5A 1ATPE 3QC4A 3T3VA 1OITA 3C5UA 4AZWA 4EH2A 3NR9A 5LARA 1QPCA 4TXCA 4UXLA 4FEQA 5AUWA 3OTVA 4CYJA 1B38A 5K9IA 2WO6A 3TIYA 2Z8CA 3UE4A 2XK9A 3AC2A 2GHMA 3A61A 3NGAA 4CFNA 3FI2A 1W2CA 1PHKA 2ITWA 2F7EE 3BL9A 3I81A 3NIZA 3PG3A 4C4IA 1GIIA 2XBJA 3HAVA 3EJ1A 4BIBA 2PL0A 3S00A 4DBXA 5IA2A 2Y9QA 3FZSA 1U5RA 1B6CB 1RW8A 3WE8A 5HVKA 4ITIA 3PPZA 4P4CA 4U45A 3V3VA 5C9CA 4BKZA 3RTPA 4E7WA 2PVJA 5D7VA 2E9UA 3TYKA 4O84A 2PTKA 3P1AA 1Q61A 3GCVA 4FE2A 5CX9A 2H34A 4GV1A 2VNWA 3E7OA 5KMOA 3R73A 3GI3A 4JI9A 1DS5A 1SNXA 2JBPA 2CLQA 5H8BA 3V8WA 1YWVA 4AXCA 4E5BA 1FMOE 1OKVA 3BQRA 2BFXA 5H8GA 1A48A 3H9RA 1RE8A 2R3OA 3LFCA 3LXLA 3TZMA 2R2PA 1KE8A 5CQUA 5AEPA 3NYVA 4PX6A 3R8UA 2UW4A 3KC3A 4ACHA 1V0OA 3QF9A 2R3JA 3E3BX 1PXNA 3FMMA 4DEIA 1I09A 2OH0E 1Z9XA 3NNUA 3PE2A 5KMNA 2YLFA 2PVFA 4DFBA 3G2FA 1LEZA 3MPTA 3ZBXA 2VTAA 3TNPC 1Q62A 3FQSA 4Y83A 3QQLA 4C3FA 2AYPA 1E1VA 4DFUA 1W98A 2O3PA 2ZYBA 2JDSA 3THBA 4EK6A 3U54A 5I9YA 2X81A 5F94A 2XEZA 3MIYA 5GZ8A 2RFNA 5DEYA 1H07A 4R5YA 3VRZA 4D9UA 3P0MA 2OJFE 5FTGA 3NAYA 5J1VA 4TW9A 5BNJA 4L42A 2YIRA 5C1QB 4HGSA 3P7CA 1PMUA 4XOZA 2QU6A 3MH1A 1ZXEA 4PP9A 4F63A 2YCQA 5EK7A 3G51A 2VV9A 3RK7A 1XKKA 5E8ZA 2FUMA 2JGZA 2XARA 4H3PA 5CVFA 2E9PA 2HXLA 3KRXA 3S4QA 4PMMA 4ZY4A 4FNZA 4FV0A 4AQKA 4LOQA 4F65A 1SVEA 2W4KA 3QALE 5E92A 1RDQE 3WF6A 5B7VA 4YHTA 4NCTA 5JH6A 2UZTA 2WTKB 4DGLC 4YJRA 3A8XA 4G9CA 4BI2A 5HCZA 3Q4CA 1Q8TA 4OTIA 3OCBA 4GKIA 2PUPA 2X0GA 3V01A 2Y0AA 3BYMA 4BCGA 3AC8A 5AAFA 4C33A 4FKOA 4U79A 5FEQA 3FSFA 2BRHA 2C3LA 4KSQA 3RM6A 3PXRA 4MD7E 3M11A 3PSCA 4FT9A 5EM7A 4MK0A 3IGGA 5J1WA 3NUPA 1LEWA 4HCVA 4OR5A 1XH5A 3TKIA 4E20A 5GZAA 3ZFXA 3PIZA 4FIGA 2F2UA 4F99A 4LOOA 5AV3A 4LV8A 5EW9A 5TR6A 2W9FB 2V55A 3GEQA 3E62A 3UYTA 4UB7A 5AR2A 4CLIA 2CDZA 3ATTA 2I0EA 3JXWA 4YNEA 4FA2A 3DGKA 1AD5A 3ZLWA 2Q0NA 4L7FA 4WUNA 4EH3A 2WTCA 2YM3A 4EZ5A 3I0QA 1Q8ZA 3GNIB 4AQCA 4R8QA 1V0PA 4QYYA 3UDZA 2ZM3A 1XH7A 4H58A 3P79A 3DKCA 4UWBA 3UTOA 3FLSA 3R7VA 4Q9ZA 5IQFA 3FSKA 3G9LX 3F2NA 4OTGA 3U6IA 5L4QA 4QP8A 4PNIA 4ENYA 5AP7A 2QLUA 5JKGA 3ZSHA 4CRLA 3F7WA 5KBQA 1MUOA 3GQLA 2X0QA 4AE9A 1SMHA 2VTIA 2C4GA 5HG5A 5CEKA 2J90A 1TQIA 4NWMA 2REIA 4ZXTA 1WBTA 2R0UA 3QD4A 4FVPA 4RRVA 1JKLA 1WBWA 2JDOA 4I5HA 4ZAUA 2VN9A 1HCKA 3KXNA 3Q5ZA 4EK4A 3A7JA 4FV7A 1Q4LA 2PMNX 4K9YA 3WF5A 3TZ8A 5BQ0A 5L2IA 3EQGA 3OOMA 2ZDTA 3OBJA 4CXAA 3LJ2A 3VUIA 3RBWA 4RX5A 4L52A 4IWQA 2XUUA 3PYYA 5ANKA 2QOQA 1BL7A 3MY5A 4S33A 4C62A 4F70A 5ANIA 3A7GA 4KBAA 3V6RA 4DCEA 4LGHA 4RGJA 4ZSEA 4ZK5A 2I0VA 4BL1A 1R0PA 2P2HA 2JAMA 2JFLA 4GFOA 4PL4A 4ZTQA 3H4JA 1XBCA 1Q99A 2EXMA 2X0OA 4MBIA 5T68A 4BZDA 4QDVA 4PL5A 4IZ5A 2WZJA 3OWPA 5BV3A 3IO7A 3PY0A 1MP8A 3RKBA 2O0UA 4LUDA 3RWPA 2BDWA 4FMQA 4S2ZA 4S30A 5LMAA 5CY3A 4XYFA 3D0EA 4ZTRA 2ZDUA 3DZOA 4BF2A 3RAWA 3BKBA 3SV0A 4FKPA 4FKTA 4GFMA 4QMWA 4E4MA 3QUEA 5D41A 1AQ1A 3Q2JA 3SG8A 3PIXA 3W0MA 4I6BA 4ITHA 3BWFA 2H8HA 3R1YA 1OGYA 3R7EA 5LMKA 3QBNA 1ZY5A 4ZTMA 3FUPA 4YJUA 4C3PA 4WO5A 4D2SA 3W0RA 5JT2A 4N70A 4D2TA 2VO7A 1NVRA 2VO0A 3MPMA 3P08A 4E93A 3HEGA 5HX6A 4FNYA 3N4VA 3TWJA 4C4GA 2WELA 2XYNA 3UYSA 4Z7GA 2VX3A 3VS3A 2BR1A 4LFIA 3RHKA 4QQ5A 2ZM4A 3OWLA 3AG9A 3LVPA 3W16A 4ALWA 4UN0C 5I9VA 2XBAA 4IVAA 3K3IA 5ANGA 1XH9A 2GNJA 4IXPA 4FL1A 2X7OA 3OVVA 3O17A 5CWZA 2GNLA 2OBJA 3KGAA 5GIOE 3DNEA 2RF9A 3FBVA 3R1QA 4X7QA 2X4ZA 1FVVA 4HCUA 3V5JA 4JG7A 5DPVA 5IA0A 1U4DA 2PZPA 4WRSA 5FLFA 4X2NA 2PVMA 4BTMA 4WIHA 5IEVA 3RNYA 3WZUA 4FTKA 3F3WA 4FBXA 4JJRA 3DT1A 3PJ2A 3C4FA 5AIRA 5L6PA 4DFYA 3CTJA 3I6WA 2C6OA 4DGMA 3ZEWA 4TWPA 2XRWA 4FVQA 3EQRA 2GDOA 4TN6A 5E8TA 2XCKA 3LMIA 2YERA 3PP1A 3QYZA 5CEQA 4ZJVA 5A4TA 2C0OA 2GTMA 3WZDA 5IZFA 4P5ZA 2YAAA 1BMKA 2CSNA 3RPVA 4JNWA 5CAUA 3EN6A 2X0PA 4UYAA 4UMQA 5C01A 4PRJA 3HYHA 3VC4A 3OFMA 4O7TA 3ZO1A 4BTJA 2RFDA 4WUAA 1DAWA 1MRVA 1GZKA 3N4UA 5FWKK 2JITA 2A4LA 5KKRC 4HGTA 4YO4A 4N57A 3Q6UA 1OBGA 2Q0BA 2R5TA 2QNJA 2R3LA 1Q8UA 3C51A 4CFWA 3HUCA 3MYGA 1M17A 5DLSA 4KBKA 3TT0A 5AR7A 4CCUA 1YXSA 5JQ8A 4HVDA 5EYKA 2DS1A 2FSMX 2QVSE 4RFYA 4JBQA 5EM6A 4F1MA 4Z16A 5JFVA 1M14A 2QG7A 3CLYA 4EH5A 2YJRA 4U7ZA 4XG8A 5IQCA 1UNLA 3BYUA 3PPKA 4ANOA 4I0RA 4FV5A 4E4NA 5E4HA 2QD9A 3OP5A 1Q41A 2GHLA 3ORNA 2IJMA 3POOA 3R28A 4AGUA 4G2FA 4IM2A 2PZRA 3D5UA 3ZUUA 4DG3E 2YIWA 4S32A 2XIYA 3RCJA 3BYSA 5EYMA 5E1EA 4DGOA 5CF8A 3W2PA 3VBWA 5KMMA 1FQ1B 2XANA 3LFEA 1YXXA 2J7TA 5HQ0A 4FJVA 1KV2A 3D14A 2WTJA 4RIOA 2UVZA 3LXKA 2YM4A 5J9ZA 2RG6A 3H0YA 3KMUA 5IQIA 4XBUA 3A99A 1ZOGA 3L8SA 4FV6A 4UMTA 4MXYA 5L6OA 3G15A 3TTJA 3WF9A 1IEPA 5AP1A 3U8WA 4O22A 3U6HA 1TKIA 2X7GA 5FUTA 3R7YA 2R7BA 1U5QA 4GG7A 2ACXA 3GCQA 3W0QA 3CTHA 2W05A 3OUNB 3EIDA 3IONA 4QQCA 3TKHA 3CBLA 3QD0A 1H1PA 4BDAA 4OTDA 4XG3A 4QP7A 4YP8A 1XMLA 2FYSA 2RKUA 2FO0A 2PMIA 5AA8A 3AT3A 3ORIA 4CNHA 3EN9A 3FDNA 4PPAA 2DYLA 4U42A 4N6YA 4FX3A 4KABA 5AV2A 4ANSA 1WBSA 2XK8A 3L1SA 4UEUA 4LYNA 4A7CA 1GOLA 5DT4A 1CKIA 4BGGA 2QI8A 3O0GA 3MA6A 3ZLYA 4EOJA 5I9ZA 3Q04A 3PPJA 2XK7A 4UYNA 4ACDA 2F2CB 5HNIX 4CZTA 4XS2A 4LMNA 1W2FA 4NEUA 3PFQA 4O7NA 4YJTA 4BY9E 1VEBA 2VTPA 3LMHA 4JBPA 3LCOA 4O2PA 4EOPA 4JDIA 4X3FB 4DHZA 4TNDA 1DAYA 3F66A 4F64A 2X6DA 5G6VA 2PWLA 3A4OX 4CKIA 1Q3DA 2QHMA 3MFSA 3R8VA 4NKAA 1RQQA 3DKOA 3IK3A 4FC0A 5DHJA 2B0QA 2X8DA 3CQEA 4LRJA 3HUBA 4M7IA 4O0XA 4F6WA 5M44A 3JPVA 4DITA 1Q97A 3H0ZA 4EK5A 3W0OA 4L53A 4Y46A 3SHEA 4FGRA 3GFEA 4MQ1A 3UVPA 4B99A 5BYYA 3MVMA 3FZPA 3Q53A 4M15A 3V8SA 3PJ8A 1E9HA 3GU4A 3UNJA 3UP2A 4D4SA 3TZ7A 3LIJA 4DT8A 5EYCA 3FZRA 2JIVA 3DB8A 1OECA 3C4ZA 4CFUA 2QOBA 4GT3A 3O7LB 4FSNA 1K2PA 3ZSIA 3V5TA 4BDBA 4J96A 4RVTA 4FF8A 3V5WA 5IG1A 1JVPP 3CJFA 3VS2A 4RC4A 3HLLA 1GIHA 3NCZA 3CJGA 2ESMA 3OEFX 3QWKA 4RA5A 4CSVA 3NAXA 2W4OA 3AKKA 3P5KA 1GZNA 3NW5A 5CZHA 4EYJA 5JZJA 4A9YA 4EHGA 4CV8A 3NW6A 4F08A 4AFEA 4IFGA 5DFPA 3M2WA 4QD6A 4EC9A 5CAVA 4NTTA 4YC6A 4AWIA 3KVXA 4ZS4A 2IZTA 1RJBA 2XK3A 5CU4A 4O7WA 2PHKA 3C9WA 3BE2A 4I23A 4ZLYA 5IA3A 3L9PA 5AP5A 2PK9A 2P3GX 3QCXA 4RQVA 4FV4A 2UZEA 4AT5A 2NYAA 3E3PA 4IB0A 5CU6A 2CKEA 3NMUF 2OKRA 2R64A 4XX9A 5I3RA 3OG7A 1YOMA 5HBHA 3LJ1A 3ZFMA 5H9BA 2QHNA 2JLDA 4CFMA 2GMXA 2JEDA 3SG9A 3BYOA 3DCVA 3Q9ZA 4MD9E 3R9RA 3G5DA 5DR2A 2X6EA 3UQGA 3FXXA 4X2JA 2WQMA 3RHXA 2UV2A 2PPQA 3LQ8A 3ZO3A 4FKUA 4F4PA 4PPCA 3T3UA 3R9HA 4F0GA 4BWPA 2YAKA 1PXKA 4D4VA 4FTTA 1S9JA 4F9YA 4L46A 3LQ3A 2QO7A 2QOOA 4RSSA 3DB6A 2PVRA 5HBEA 4FIHA 3E5AA 3LCKA 1Y91A 4I6QA 4J71A 3LW0A 3VBYA 4F6UA 2A1AB 3BE9A 5IMXA 2QOFA 1U59A 1J91A 3QRIA 2J51A 3KRRA 4C4EA 3MFRA 2IW9A 3PSDA 4BFMA 3FZTA 1OL5A 2E2BA 2ZOQA 3UZPA 3ZTXA 2QONA 4IVDA 1FGIA 4L67A 5CU2A 4AGCA 3AGLA 3QL8A 3QTRA 3GENA 4GVAA 1GNGA 5HKMA 2V5QA 3QCYA 2JAVA 3TV7A 5A54A 5IU2A 2C3IB 3GU6A 3VJOA 3UO4A 4DEHA 3L8PA 4YC8A 3ZM4A 5HIDA 2XJ2A 3TL8A 3UPZA 3ATSA 2B54A 4FT5A 1OL1A 5DRBA 1H8FA 3MESA 3FYKX 3AD4A 5K0XA 3PE1A 3LFNA 4E6CA 3Q6WA 5D12A 2PVLA 3KF7A 4YGAA 3REPA 4CQGA 5BPYA 5K5NA 3CIKA 1CKPA 1QPJA 2A0CX 3RMFA 4QTBA 4IAKA 4A4XA 4PDPA 3PDTA 3DBDA 3EQPA 3AGMA 2F7ZE 1KWPA 4XMOA 5AIKA 5DBXA 2ZV7A 4DCAA 3ZXTA 4YTFA 3SRVB 4FTUA 1G8JA 3BZ3A 3HA6A 5JFXA 3A60A 4X3FA 3R8MA 2YWPA 2BALA 3FZOA 3VULA 4FKIA 3O71A 3VUHA 3ZDIA 1M52A 4K1BA 5HHWA 3NVKI 4I0TA 2UW8A 4X2FA 2YCSA 4YR8A 1U54B 3U4WA 2GFCA 4MQ2A 5IPJA 4IWOA 2R3RA 4G3DA 2H96A 3MA3A 4ITJA 3OCGA 2VTHA 1CSNA 3HKOA 4X6QC 5TF9A 4FKWA 2X2MA 2X8IA 4F7NA 4XP2A 2J0LA 2EXEA 4HPUE 5J9LA 2XH5A 2OF4A 3GCSA 3F5GA 4EQMA 1E1XA 3ORKA 4EZ3A 4YC3A 1MQBA 4DGGA 3CKXA 4FT0A 3LE6A 4F78A 2GQRA 3F3TA 4PMPA 2JD5A 2OIDA 4HVGA 4XHKB 3TTIA 4DC2A 3RAKA 4EK3A 3EN4A 3ZSGA 3PVUA 5L2SA 3GVUA 2C6KA 4I6LA 2C30A 4XBRA 4EEVA 1ZYDA 4X0MA 4DEDA 2ZJWA 2HOGA 5FBOA 3UG2A 4WNMA 2WHBA 5HEZA 4D2PA 3MY0A 5DNRA 5AUTA 1QCFA 4ZTHA 3KN5A 1Q5KA 5IQGA 2WD1A 2C1AA 4M0ZA 4BHNA 4F9WA 3BV3A 3LFAA 3BGPA 4F9BA 2PMLX 5A46A 3LHJA 4TKSA 1OMWA 4L43A 3ZXZA 4FSMA 3CPBA 3QC9A 5FG8A 1YDSE 1CDKA 3DQWA 3QFVA 2E9VA 3EQCA 3FMJA 3NRMA 3CY2A 3QHWA 4JRNA 5IA5A 3LFFA 4NM5A 4DINA 5D9HA 3MV5A 2BPMA 4U43A 5FDXA 3VS7A 3OXTA 2UUEA 3ZYAA 2OSCA 4BVUA 3HNGA 1XHAA 3PWYA 3IOPA 4PWNA 3DDQA 4FSUA 4TWNA 3GU7A 3CSVA 3BHVA 3GC9A 3NUUA 4HZRA 4W4WA 5JEBA 4CT2A 1M7QA 3ID6C 3I5NA 3R00A 4WOVA 4Y5HA 2Q83A 3P4KA 4USFA 3FI4A 3W18A 4NT4A 4FZ7A 4FGBA 2X7FA 4MXCA 3R7OA 3C4XA 2UW7A 4TRLA 4XJ0A 1JQHA 1G5SA 4H39A 4UALA 3ZHPC 2PUIA 4PDSA 3F82A 3DJ7A 4MKCA 4BIEA 1LP4A 3COIA 4QNYA 5CU0A 4EKKA 4HYHA 5TOZA 2BRBA 4MF1A 3V51A 2A27A 4EORA 1OIUA 2VTJA 3OTUA 2BROA 3PXFA 5F4NA 1PRYA 3WIKA 4BZNA 1F5QA 4C57A 2OXDA 4EOOA 3MY1A 2Z7SA 4AOJA 1ST0A 1R1WA 2QKRA 3PA4A 4B7TA 5JFWA 3W2QA 1UV5A 5LCJA 4R5SA 1J3HA 3Q2MA 5EKNA 3KL8A 1YHSA 3KU2A 5CEIA 2OIQA 2YIYA 4ALUA 5A6OA 2VUWA 5KKRB 3OY3A 2C5NA 4RPVA 1UU7A 1KE7A 1HCLA 2SRCA 3PRFA 3CS9A 4IANA 3II5A 4PP7A 5IH5A 1Z57A 4PTEA 2C69A 4IWDA 5LWMA 3P86A 3ORTA 1JKTA 4JG6A 5IMEA 3PUFC 2C3KA 2C5VA 4ANMA 4RBLA 2Z2WA 3QTZA 4QQTA 2YFXA 3ZMMA 1O6LA 4IBMA 2YN8A 3VBVA 2IG7A 2WU6A 1UU8A 5CSPA 3Q52A 2H9VA 4DLIA 3KFAA 2OJIA 4G3EA 5DE2A 3VONA 1MRUA 3POZA 2ITYA 5LCKA 1WZYA 4XNEA 3VIDA 3HMOA 3L8VA 3C4CA 5DN3A 2B9JA 3P9JA 2O65A 4GSBA 1IRKA 3F3ZA 4JRVA 3ZRKA 4K77A 2HK5A 2BZHB 4OAUC 3SRVA 3PY1A 3CXWA 3R02A 3FY0A 4UBAA 4JAJA 4PNKA 2YJSA 4I20A 5E8SA 4LGDA 1PXMA 3FMEA 5AADA 2Z7RA 2YHVA 3COKA 4R78A 3C50A 3LPBA 3MPAA 4KIPA 2QODA 3VS5A 2BCJA 4BBMA 3VBXA 4D5HA 3KVWA 3NZ0A 1U54A 4EZ7A 3HRBA 4IZAA 4XCUA 3LFQA 2OJJA 2PVYA 2ITUA 4FYOA 3UG1A 3ZUVA 3PXKA 5CSHA 3FXZA 5FM2A 4DH1A 3W2SA 3BQCA 3EHAA 1B39A 4O27B 4DE4A 3CTQA 3QX4A 3NSZA 3I7BA 4M3QA 2GS6A 2QOCA 2O2UA 4AW0A 4BYJA 3KRWA 5AUXA 1OZ1A 2UZNA 2YDJA 4IWPA 4I6FA 2V0DA 3QRUA 3HRFA 3IDBA 4C0TA 3W0PA 5H8EA 4M84A 4GKHA 4QMZA 4QP9A 4WNKA 4J1RA 5A4LA 4FEWA 2NP8A 3F3UA 3GCUA 1JSUA 4AZVA 3KN6A 5M07A 1PF8A 4JL9A 2Y6MA 3NNWA 2VWBA 3DTWA 3EQIA 4I4EA 1OIYA 3CD3A 4GIIA 4XG7A 5BMMA 2WTDA 3RZBA 4BIDA 2YDKA 4NZWB 3FQHA 4KRDA 3BBTB 4YUQA 4BDGA 4EWHA 4QT1A 2BTSA 1XWSA 3HDNA 4RT7A 5IEYA 1H1SA 2O8YA 5FEEA 3GC0A 5CI6A 5EH0A 4L68A 4O0RA 3NYNA 3ROYA 2I40A 5DR9A 4DH5A 4K6ZA 4HW7A 3PTGA 3Q4TA 2W17A 5CSVA 2R3IA 2YIXA 3U9CA 4NW6A 4X2GA 3HDMA 4EQCA 4AXDA 1UKIA 4Z55A 1OI9A 4FT7A 5EKOA 4NIFB 3FEGA 4CVAA 3AC1A 2X8EA 4BDEA 4PDOA 2B4SB 4WSYA 3FAAA 4EOQA 4AX8A 3C4WA 3UJGA 3LCSA 4I3ZA 3VUMA 3ORZA 4DBNA 4LRMA 4J8MA 2VAGA 2CN8A 2YZAA 4G16A 5IQHA 5M08A 3GCPA 2WIPA 2VU3A 4QPMA 2F57A 2WKMA 4U8ZA 3LAUA 2B1PA 4CQEA 3C0IA 3QU0A 3QAME 1NA7A 4U41A 3C1XA 3DBQA 3PLAE 4O7LA 5C4LA 4IAZA 5HE1A 3TG1A 4AZTA 2W1GA 2IZRA 4QTAA 5CEOA 5GINE 1K3AA 1ZYLA 3QRJA 2IWIA 4I93A 5BVWA 4O4BB 4EL9A 4CRSA 4QP1A 2HW6A 3VF8A 2QLQA 2J9MA 5CEPA 3QZGA 5J9YA 5HTBA 5L2TA 3WI6A 2C3JA 4LL0A 3C0HA 4MNFA 4Y72A 4O81A 2R3QA 4YJVA 4W9WA 3UOKA 4FSZA 3W0SA 4GIHA 2Y4PA 5A4QA 4FL2A 3F5UA 4IX3A 3RZFA 1APME 3QKKA 2A2AA 4GEOA 4NJ3A 3MIAA 1PJKA 2G2IA 4C38A 4PTGA 5A6NA 2RFEA 2RSVA 3KRJA 2ZMCA 2OWBA 4QYHA 3CY3A 4IAFA 5AUVA 3SGCA 2J0IA 3ZONA 5FXQA 2VO6A 4FR4A 4FIFA 2BRGA 2E9OA 4EH8A 3QWJA 2ZM1A 3R2BA 4PTCA 4DH8A 4GS6A 2C47A 4NSTA 1VLRA 3DAEA 3KQ7A 3N51A 2FVDA 1YI4A 4J99A 4U97A 5L8KA 1GJOA 4F6SA 3OUKA 4JLCA 1GAGA 4O0YA 3TCPA 4JX7A 3IW7A 4AN2A 2JKKA 3ENMA 3B8QA 3Q9WA 1P5EA 2FA2A 4L44A 1O6KA 4TWCA 5AR8A 4ZSAA 1OUYA 1IASA 3MB7A 4K33A 3R21A 1F0QA 3JY9A 4R6VA 4IJPA 4C59A 2QQ7A 5AR5A 3EFLA 1TVOA 2G1TA 4O86A 4GYIA 4R1VA 5F1ZA 3A2CA 4NM0A 5HIEA 1XMMA 4YJOA 4AXFA 3DXPA 2ZV9A 3VQHA 2BDJA 4FTIA 3H10A 2R0IA 4FKJA 4GUEA 4QMSA 3DXQA 3ODZX 1IA9A 1I44A 1SYKA 1H01A 4E6QA 2BUJA 5AM7A 4H1MA 4KB8A 3HZTA 1VJYA 3WYYA 4FUXA