4PMMA

The structure of trka kinase bound to the inhibitor n-(3-cyclopropyl-1-phenyl-1h-pyrazol-5-yl)-2-{4-[3-methoxy-4-(4-methyl-1h-imidazol-1-yl)phenyl]-1h-1,2,3-triazol-1-yl}acetamide
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
291
structure length
285
Chain Sequence
CVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLDKMLVAVKALKESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords High affinity nerve growth factor receptor
publication title Maximizing diversity from a kinase screen: identification of novel and selective pan-Trk inhibitors for chronic pain.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 285
sequence length 291
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4pmmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pmmA01
2J0KA 1QPJA 4C4GA 3PIYA 4O7NA 2DYLA 5ETFA 5GNKA 4F09A 3R8LA 3RNIA 4IVAA 2ONLC 3QKLA 5HLWA 3WZEA 1R0EA 3E62A 2JDSA 2BRBA 4G3CA 4XG6A 2PMLX 3ZONA 4ERKA 2JGZA 1PXMA 4DTAA 3UNKA 3WF7A 3JVRA 4OBQA 5CVHA 4BTMA 3SA0A 4YPSA 4K33A 2GDOA 3PSDA 3TCPA 4X2GA 4LUEA 3VS4A 3DAEA 3GENA 4MYGA 4AA5A 4V05A 3GB2A 4BI1A 3GCSA 2C69A 4Z7HA 2G1TA 2W0JA 4AT5A 3MH3A 3DJ5A 3IQ7A 4QP3A 3Q6WA 3BGPA 1BL7A 4DITA 3F69A 4D4RA 2R3PA 4MWIA 4FKOA 1U5RA 2VTSA 1TQIA 4GYGA 3GFWA 4ANOA 4CQEA 2VWXA 3MVJA 4PX6A 2QOOA 4MX9A 3CGOA 3II5A 2OH0E 3FI4A 3LFCA 3NUPA 4Y73A 4XBRA 3KVXA 1KOBA 1XO2B 2GNHA 3NR9A 3SAYA 4AQCA 4ANLA 2C47A 3FMJA 4RWLA 3DAKA 2VZ6A 2R9SA 2XYUA 4IWOA 4A4LA 4BDCA 2IN6A 3ZM4A 3V8WA 4CFXA 4DFUA 1OGUA 3L8XA 2DQ7X 5DBXA 4HNIA 3UP2A 3H0ZA 1ZOEA 3RK9A 4F08A 3QAME 1B39A 4X2KA 3HMOA 4ASZA 1NA7A 1SMHA 5EM7A 1OIRA 3VUMA 3D2IA 4Z16A 4CKJA 4NW6A 2WTWA 5BUIA 2IZRA 2B4SB 2WB8A 3TACA 4RVMA 1PXLA 2ZB0A 1H1SA 3Q4ZA 3U4UA 1MQ4A 3AOXA 2QC6A 5JFSA 4MXOA 4F9YA 2LGCA 2X39A 5DE2A 4ACCA 3ENMA 2IW8A 2C3IB 1WVYA 5BVKA 3EIDA 2QG5A 4G16A 3W2PA 4X21A 5DFPA 4C3FA 2UW9A 4S30A 4UMRA 4U3YA 3B2WA 2AYPA 4OTQA 2QI8A 3O50A 3DB8A 1H07A 3CSVA 4D5KA 2I0HA 4ZTRA 4HOKA 3EN4A 4KNBA 3ZRLA 4PP7A 4JXFA 4GG7A 4JG6A 4QMOA 3OY3A 4C4FA 4H39A 3ERKA 3ZLSA 1TQPA 2OIDA 1E1VA 3BIZA 4GL9A 4XP2A 2WMUA 4ZJJA 3U6HA 3ZBXA 2X2MA 2I0EA 2P2IA 3B2TA 4HZRA 4GK4A 3GNIB 3QZGA 1WZYA 4IACA 3AT4A 3VBYA 4EOQA 3QF9A 2JKKA 3DT1A 3QD0A 3TIZA 4FL3A 3HMMA 1OKZA 4R5SA 5K4IA 2C3KA 3DB6A 4U81A 3FQHA 2YM8A 2J7TA 4JQ7A 2BUJA 2PVRA 2Y7JA 1YWNA 3FSFA 4P5ZA 3RWQA 4KS8A 4BBEA 3KKVA 4X3JA 2G15A 4FTAA 4YNEA 4JI9A 4NTSA 2PTKA 3R7OA 1REKA 4FX3A 4EH2A 3OCSA 4YBKA 1OBDA 4FTIA 4EC8A 2WIPA 4Y5HA 2Y4IC 5AX3A 4KIKA 2WTDA 3V5JA 3KK9A 3Q3BA 3WE8A 5ANOA 3WF5A 5I5ZA 5AIKA 3HNGA 4I6HA 5L2SA 3Q4UA 2Y6MA 2VTAA 2CGUA 2O0UA 5HTBA 3EFKA 1M2QA 4F9WA 3BU5A 3QQHA 3VUTA 1UU3A 3VQHA 4IADA 4FKGA 2ITNA 3ZZWA 3C50A 2BTSA 4NFNA 4U43A 3VS3A 4E3CA 4OUCA 5ACBC 3HP5A 4FSUA 3DXQA 4EH4A 3NMUF 5HG5A 2RFSA 4J7BA 4IB5A 1U54A 4JBOA 4WOVA 2BROA 3W33A 1OL5A 3M1SA 3OG7A 2BRGA 4D28A 3KRWA 3GQIA 4FSZA 1PXOA 2VX1A 2R7IA 3ZFXA 3AT3A 3MH1A 2YM6A 5L3AA 3TZ8A 2BKZA 4W9WA 3TJCA 2XMYA 3MWUA 1W83A 2VO0A 3OCGA 4OTRA 4QP1A 4AE6A 3ZRMA 4H3BA 4B4LA 2CKEA 2ITVA 3U4WA 4HGEA 2Y4PA 3FYKX 4YZNA 4QQJA 3EQPA 4GU9A 4HVDA 2F49A 3QLGA 3OUKA 1BUHA 4ZTSA 5CU6A 2YCSA 4IDTA 2XNPA 4F9AA 1JAMA 4CLJA 3S1HA 4TY1A 4AN2A 3DV3A 4U6RA 5HIBA 3VS0A 3PXKA 3DXPA 4DT8A 2X7FA 5CSWA 4JBQA 5IZFA 3EQRA 3BLQA 4F1MA 3CTQA 4X3FA 1FGIA 2GHLA 2YIRA 2W5BA 4G9CA 3V5PA 3FUPA 5EHYA 4Z7GA 4CMUA 2X0GA 3U87A 2WQMA 4ZLYA 5DOSA 3N4VA 3MPMA 5BUEA 4EOSA 5IF1A 3ORMA 3F5XA 4J1RA 4IVCA 5AR4A 4PTGA 3LFSA 4IB3A 4RC2A 3DOGA 2NNWB 4F1OA 3UIUA 3DA6A 4DG0E 2XZSA 5CX9A 3QQJA 4XUFA 3FXXA 1OL7A 1OZ1A 5IDNA 2HYYA 4FGBA 4KBCA 2OWBA 4FOCA 3TEIA 4BCQA 3QU0A 5E7RA 3NAXA 2HWPA 3AGLA 3NEWA 3KGAA 5C27A 3W10A 1L8TA 4O7TA 2V62A 2UW5A 2PK9A 3KN5A 4LOOA 3FXZA 5HBEA 1YHWA 1M17A 1ZWSA 4V04A 3UIXA 4DH8A 2IVVA 4RVTA 3DBFA 3D5XA 4FT0A 3UZRA 3QTZA 3RAWA 5HNIX 4KA3A 2ZMCA 4DTKA 4I24A 4XG3A 4FL2A 3ULIA 5IQEA 4DFNA 3FKNA 2IJMA 5J5TA 1OUKA 5HORA 3E5AA 1KE7A 2Q83A 3VS1A 3PXQA 2YAKA 1IAJA 3Q60A 4PUZA 3A7IA 3HUCA 2J5EA 4GW8A 5GZAA 2Q0NA 4L3JA 1GZNA 4TYEA 2JDVA 3V04A 4H3QA 4F9CA 3QQKA 3CPCA 4D1XA 3MJ1A 1XH4A 3GQLA 4EK8A 4QP7A 1YDSE 2C6TA 3PFQA 4HW7A 3NDMA 2OGVA 2JC6A 4TT7A 2QOIA 1G8AA 4BHZA 5JFWA 4L52A 4AZVA 4JAJA 2BRMA 3L8SA 3DPKA 5H9BA 1Z57A 5AR3A 1YQJA 4UEUA 4WNMA 4DA5A 4YTFA 4LMNA 2YM3A 3LCOA 3R8PA 2IZSA 4GVAA 2C0IA 3TUCA 4D0XA 4XOZA 1DS5A 3ZZEA 4CMTA 4EQMA 3FDNA 2WD1A 4UV0A 4KKGA 4IBMA 3BE9A 4TYGA 4YNOA 2WAJA 5DG5A 4BDJA 2GTMA 4M67A 5LWNA 5J1WA 4AW0A 5HBJA 4DEGA 2XH5A 5CI7A 4FKSA 4J8NA 4MTAA 5L2IA 5DRDA 2CGWA 5IEXA 3H30A 3I79A 3FY0A 1GIHA 4NW5A 3TUBA 3U6IA 1Q99A 4O0TA 4BCOA 1OB3A 3P7BA 2PZPA 2OU7A 3DAJA 2C5VA 1P5EA 2C3LA 4OT5A 5DI1A 1FVTA 3T8OA 4NK9A 4UWCA 4C4IA 3UMXA 1TQMA 3IDBA 2JBPA 3ANRA 3E64A 4O1OA 3VW8A 2R3OA 3ZDIA 2PPQA 2QO7A 3W18A 3NYXA 4QRCA 4KKEA 3ANQA 4FIEA 3DQXA 2VTHA 4BCJA 5C8MA 4U3ZA 4D58A 3GCQA 2B9IA 4XRJA 2RG5A 3F2AA 2ONLA 1O6KA 1Q3WA 5BVEA 2X1NA 3A8WA 5JK3A 1XH5A 4FVQA 1CKPA 2X4ZA 3DCVA 4CKIA 4QNAA 2YLFA 4GV1A 3Q32A 4KKHA 3P1AA 3Q9XA 3CC6A 4QPSA 1VJYA 5AP7A 3VBWA 3BU6A 2NPQA 3ZCLA 4FEVA 4M0YA 2B53A 5C4LA 4CT2A 4JL9A 2XJ0A 3LFDA 3DLZA 1STCE 5CU2A 3FC1X 3ZLXA 4RIYA 1S9IA 4F1TA 4DE4A 4I41A 3FMEA 4CZUA 3FI2A 4JQEA 5HG9A 2C3JA 4GS6A 4RPVA 3R9HA 4NKAA 3FLWA 3GC8A 5FTGA 3R0TA 2GFSA 3MI9A 4FZAB 5J9YA 3LMIA 5EQPA 3N51A 1ZARA 1UU7A 4ZTLA 3I6UA 3F3VA 4S31A 3SKCA 5H2UA 1Q41A 4S33A 4BDKA 3FLZA 3RAHA 3F9NA 4O0YA 3ULZA 1ZYJA 4HVGA 1JLUE 5CAPA 3CTHA 2WMRA 3CY2A 5JRSA 1LEWA 2Y4IB 4FV1A 3LQ5A 3V6SA 4GKIA 3FZPA 1LP4A 3UP7A 3IS5A 4IE9A 5CF4A 4O0UA 4E4XA 4QMQA 3Q5ZA 5IA1A 4NFMA 4OBOA 3UNZA 4BGHA 4F99A 4F6SA 1H0WA 3OEZA 4BZNA 5D1JA 2EB3A 2WO6A 4E73A 3ORZA 3WBLA 1DI8A 4MAOA 4U44A 5D12A 4O91A 2QKWB 2C5NA 5KMIA 2WELA 2C6DA 1PKDA 1H1RA 4CYJA 2GHGA 4R7HA 4UY9A 5DHJA 4B7TA 1H26A 3PJCA 5AAEA 2ZM4A 4JR3A 1BL6A 1M52A 5B2LA 3UQFA 3MBLA 2GQGA 3MFRA 3U9NA 4BGQA 5CU0A 3LCDA 4U7ZA 3FLYA 4C2WA 4UZDA 2EB2A 4QP8A 2UW8A 3NIZA 4ZJIA 2J0MB 3D7TB 5A54A 3FZSA 3O0GA 3WZDA 5HX8A 5A4QA 2W96B 4YLLA 4F7LA 5EH0A 4RBLA 4BC6A 1GZOA 2UW4A 2XS0A 4QYYA 3LCKA 5CU3A 3H0YA 4HPUE 1W7HA 4XOYA 1Q8YA 2XUUA 3RPOA 4BHNA 5ITAA 2WQEA 1O6LA 3BYUA 3FY2A 2O63A 5EKNA 5KHWA 4EUTA 3EYHA 4GT4A 2PUNA 3FEGA 3POOA 3WARA 4DH5A 4HGSA 2XNBA 3VC4A 5CXZA 3RK7A 2YCFA 3LMGA 3IK3A 4G9RA 4K2RA 2BKKA 3RINA 3DBCA 2GQSA 3TL8A 4AN9A 5BX0A 4NSTA 4WKQA 4UXQA 4O96A 5IUIA 2Y6OA 2GNIA 2F7XE 4I5CA 4D2RA 3EFWA 4C38A 5ACKA 5DT3A 3CCNA 4LG4A 4O0WA 3C51A 3UQGA 5BUJA 3ODYX 4FG7A 3ENHA 4YSMA 3DS6A 3F82A 5AP5A 2UZEA 2AC5A 1OKWA 3MPTA 4TYHA 3LJ2A 2BIKB 2XJ1A 4PV0A 4EORA 3I1AA 3ZRKA 4D4VA 2PVNA 1GAGA 4IM2A 1QCFA 1GZ8A 2ZAZA 4FF8A 4DEHA 3F66A 4E7WA 4ZY6A 4AGUA 2JITA 1GY3A 3ELJA 2GPHA 2YDKA 2BMCA 2FH9A 3FMDA 3OVVA 4KIOA 1OBGA 2YM5A 3ORLA 1DI9A 5CZHA 3FWQA 3MA6A 4FTNA 4DHFA 4ZTMA 2YZAA 3UPZA 4IC7A 4LMUA 4F0IA 3OY1A 5EYMA 3RJCA 5ANJA 3COMA 3QA8A 4AZEA 3KK8A 3V5TA 5KMLA 1ZMVA 5AMNA 4EOMA 5HCYA 2IW6A 1R39A 4XJ0A 1A48A 4WUNA 4C61A 1CKIA 5AUXA 5CYIA 5F94A 3ZLYA 4CZTA 4LM5A 3AD4A 5CEPA 4U79A 5K3YA 3FBVA 4OTWA 1PMNA 3ORNA 3QWKA 3KULB 3MTFA 4LQMA 4B6LA 3SG8A 1JSVA 4M15A 3SOAA 4IMYA 3PE2A 5CNOA 2BDFA 3FLQA 4PPAA 4C58A 3VRYA 4YUQA 2OZAB 3DK7A 1J3HA 3HUBA 3VS5A 2VWBA 3C0GA 4ZIMA 5HOAA 3SRVB 4BDEA 4BTKA 4BCPA 2XEZA 4QYHA 3H3CA 4MVFA 2R3LA 2R3HA 3ZMMA 3CS9A 3UOHA 5IUGA 2VWYA 5GHVA 1Z5MA 3C13A 3D2KA 5I9VA 3NX8A 1URWA 3HP2A 3P7CA 4NEUA 1OUYA 2XK7A 3KY2A 3WZJA 1F5QA 1M7NA 3JY0A 4FIGA 1Q8TA 4G6NA 3VWAA 5FWKK 3TDWA 4ZMEA 3K54A 2R3FA 1KV2A 2ITWA 2Z8CA 3R63A 3V51A 4EQUA 4O7RA 4GT5A 4JRNA 3CQWA 4RWKA 4JVGA 2OFUA 2E9NA 2I40A 2ZMDA 2VTLA 3BHHA 3BYSA 2JIUA 1IR3A 3ZBFA 3CLYA 5EW9A 2IWIA 1FVRA 2VWIA 3VBTA 1XWSA 3Q9YA 5F20A 4IM3A 4KAOA 2WMTA 2UZVA 4M8TA 2HXQA 3GCVA 3ROCA 3LFAA 3FHIA 3PWDA 2VX0A 5EM6A 4BDDA 1QL6A 2HW6A 2I0VA 2WKMA 2XK4A 3G2FA 4CFUA 4DEDA 3I0QA 1RQQA 3QWJA 4L43A 4BWPA 3I7BA 5HG7A 3TT0A 2RSVA 3ALNA 3C9WA 4BIEA 4OR5A 5CEQA 4JR7A 4XH6A 4DFXE 2QOHA 5FXRA 5AM7A 4JJRA 3VAPA 1Q62A 3ZYAA 3ITZA 2XKDA 4IB1A 3QL8A 4I4EA 2GNJA 4L44A 4AU8A 4B8LA 3R7UA 3LHJA 4R6VA 1S9JA 3DTWA 4BVUA 5JEBA 1H25A 2PVHA 5TO8A 4FKIA 3NYOA 3RAKA 5HVKA 3UJGA 4C59A 2E9PA 2BFXA 2WMVA 3FL5A 3PIZA 1R1WA 5C4KA 2FA2A 2BTRA 3F3WA 3G5DA 4M69A 3GOKA 4MBLA 3VULA 3ZUTA 1H24A 3HGKA 3IW8A 3NNVA 4NU1A 3VW6A 2H96A 5M4FA 1WCCA 3EL7A 3H4JA 5E8YA 4CTBA 3D7ZA 4KINA 4RWJA 5CF8A 4OAVB 3VBXA 1CSNA 4I6FA 4CD0A 4BZOA 2W9FB 1BI7A 2GMXA 3ORKA 4QTEA 2XIXA 3CJGA 3QTRA 2P0CA 4FL1A 1KOAA 4LRKA 5ANKA 4C3PA 1GNGA 2P4IA 3GUBA 1U4DA 3IG7A 3UYTA 3Q2JA 4PMSA 4KD1A 2ZVAA 4E20A 2CGXA 1MP8A 2ITZA 1R3CA 2WQOA 3AMAA 4MD7E 5AV1A 5LXMA 2B52A 3PP1A 3QTUA 5HO6A 3TKUA 1SVGA 4RX8A 2XIKA 3AC2A 4QMPA 4S32A 3IKAA 4D9UA 4AOJA 1Q61A 4H1JA 4N70A 4DCEA 5LQFA 5H3QA 5EM8A 2OJJA 2BCJA 4MNFA 5EDRA 2CKQA 3UTOA 4OTFA 4CEGA 4EOKA 2XRWA 4EK5A 1GOLA 2E9UA 3LJ0A 4I6QA 4FV0A 4WG4A 3DKFA 5HEZA 2GHMA 2R3JA 3NLBA 5J8IA 2P33A 2R3GA 3DBQA 3E63A 2WU7A 3ID6C 1ZMWA 2CGVA 5KE0A 3L9NA 5L8JA 4ENYA 3ZSHA 2QURA 3TIYA 4I0SA 4JBVA 4BDHA 4B9DA 4I4FA 2HXLA 3LXLA 4AT3A 3KXNA 5BPYA 4XYFA 4RQVA 5GJGA 5JFVA 4FSNA 3ZDUA 1O9UA 3BYOA 4R3RA 2Z7QA 4R1VA 5FRIA 2UZOA 1YHVA 2CNVA 2UZTA 4ID7A 1K2PA 3BWFA 2E2BA 4O2PA 4EYMA 5LVNA 1YXXA 2KULA 4DGMA 4CFMA 4D1SA 2B1PA 3HYHA 5FM3A 2X6EA 4WG3A 5DEYA 5IQDA 2W5AA 3FL4A 4II5A 4OTIA 3FMNA 2J4ZA 2Y9QA 4YO4A 3RM6A 2CKOA 4O7SA 3OCBA 1J7UA 3EQIA 5L8LA 4AP7A 2UV2A 2R3MA 5BVWA 4O83A 4GFMA 3LFQA 2B9JA 2FGIA 3UIBA 5KMOA 2YZLA 3IW5A 4ZZOA 2BVAA 4FK3A 3ETAA 1H01A 5IDPA 5K5NA 2B0QA 1H0VA 4N57A 3GC9A 2JKQA 2X81A 1NW1A 3ZUVA 5ANIA 2PSQA 3NVMB 4IH8A 3OTVA 1XJDA 5T6KA 4PTEA 3SXRA 4U9AA 3UPXA 3HX4A 3NNXA 3PY1A 5G6VA 2BDJA 4EWQA 2WMXA 3OC1A 2PMOX 2NO3A 4UBAA 3PDTA 2YISA 2XBAA 5HESA 4USEA 4FSYA 4FYOA 5J1VA 3G90X 5K0KA 4ZXTA 4YBJA 3HA8A 3R21A 3QA0A 5AA8A 2Q0BA 2V5QA 4OT6A 4FIIA 2PULA 5DR6A 3TZ7A 1GIJA 5JSMA 4ZK5A 3VUKA 3QTIA 3BBWA 5GJDA 3R7EA 3UVRA 2PZIA 4A9SA 3ET7A 5A46A 4YJNA 4AT4A 4CYIA 3KA0A 2X8EA 4DLJA 2QR8A 2EWAA 4GRBA 2X4FA 3M11A 2CN8A 2OFVA 4BIDA 1P14A 3LM0A 3S2PA 5IQHA 2QKRA 3QYWA 4WO5A 1Q5KA 3UVQA 3QQLA 4CRSA 3RMFA 2G2HA 2GFCA 4FTTA 4ZP5A 2R7BA 4QMNA 4ARKA 3UG2A 1WVXA 2QODA 2EVAA 3EYGA 3PJ2A 4QP2A 1FQ1B 1G3NA 5A3XA 1WFCA 2UZNA 3LW0A 5KMNA 2PY3A 3DFAA 3EN9A 4XV9A 2XJ2A 2XEYA 1OECA 2CN5A 3QX2A 4LL5A 4A06A 4Q9SA 4L7SA 4GK3A 4DINA 1NXKA 4ITHA 5L8KA 4Z55A 3TKIA 3UQCA 4XRLA 4IC8A 5G1XA 5CNNA 1ZZLA 3VO3A 2RFNA 2OJ9A 1UU8A 2ACXA 1OL1A 2FUMA 2VTPA 3DTCA 3P7AA 5CQUA 2YITA 2J5FA 1M2RA 4FZ7A 3P78A 5AUWA 4ASEA 5BNJA 3EKNA 4MNEB 3BV2A 5LVPA 3TNWA 4RX9A 4TRLA 5D11A 3G51A 1CKJA 4B99A 5M4CA 4C2VA 1QPDA 1WBSA 4F4PA 5M07A 2BR1A 5IQIA 2RKUA 4AACA 1Q24A 2W1IA 3BYVA 2C4GA 3N9XA 5I9XA 3HDNA 1Q8ZA 2BILB 2UVXA 3QYZA 4FMQA 5ETIA 3VUDA 4FOBA 4RFYA 4D4SA 3PA5A 3NYVA 5A6NA 4HGTA 2X6DA 4YHJA 1CM8A 4JDIA 2PZRA 2OJIA 3IPHA 3LOKA 4JIAA 4RJ8A 2RF9A 3DKCA 3JY9A 2J9MA 1ZYCA 3O7LD 3S95A 3C4XA 3IGGA 4DH3A 4HYSA 2JDRA 4L68A 2OH4A 5FP5A 3I4BA 3E8EA 2KTYA 1ZY4A 3OP5A 5EFQA 1IAHA 5IKWA 3FJQE 4QP9A 4F7JA 3ORPA 3EZRA 4UYAA 4PNIA 4EL9A 3TJDA 3SDJA 2OLCA 5DA3A 1UNHA 4APCA 2JDTA 4FZDB 4CV8A 3D94A 1Y6AA 3SXSA 4FEUA 2VTQA 4E8AA 4CQGA 4MQ1A 4FKJA 3TV7A 3LXNA 5KCVA 4OGRA 1HCLA 2ETRA 3WF6A 4PWNA 5HD7A 5DT4A 2Z02A 5M08A 4FG9A 5EI8A 3LVPA 4TN6A 2FSTX 1U59A 3BEAA 3OOGA 5EW8A 3WZKA 2G9XA 1WBWA 4PL3A 4Y95A 1PXNA 4IAFA 4W4YA 4XEYA 5HNGA 3Q04A 4D5HA 4CZYB 1PMEA 2HENA 3BWJA 3TV4A 4BKZA 4J99A 4L67A 4F6WA 4KIPA 4CCUA 3E7VA 1JOWB 3DU8A 3R22A 3SV0A 4I5MA 3ZSIA 1YW2A 2OW3A 1Q3DA 2X9EA 3NS9A 4E26A 4FE2A 5AUZA 3QXPA 3A2CA 4UXLA 4F70A 5DEWA 4MNEA 4IAKA 4W8EA 2OG8A 4F7NA 2BZKB 3L8VA 3MY5A 3EQFA 3UO4A 1PXKA 4ENXA 4A7CA 5AUVA 4RLLA 5KHXA 5IQCA 5E92A 4H3PA 3HZTA 4EHEA 2C6LA 2ERZE 1J7LA 2A2AA 3D4QA 4YJOA 2C0OA 5EYDA 2GS7A 3PA3A 3QRTA 4RX5A 2C5YA 3MV5A 1CDKA 4NWMA 4U80A 3KMWA 3JS2A 2Z7LA 5HCZA 4OAUC 5HHWA 3BV3A 4BF2A 3CEKA 3R7VA 5DGZA 3D9VA 3DJ7A 4W4VA 3OS3A 4ZSJA 5IQBA 2P2HA 5HI2A 4R8QA 3EOCA 4ZSGA 3FZ1A 4M66A 1JVPP 5GIPE 2QR7A 2V0DA 3C4CA 5BYLA 1OIYA 3F3TA 4CFVA 4LV8A 4ZOGA 4YLKA 3SD0A 4JIKA 2FVDA 4OBPA 2ZM1A 1FINA 2HAKA 3GC7A 3MTLA 4K77A 3KCFA 5AP6A 2WTJA 4ACGA 4EJNA 4ZLZA 3GU5A 4PPCA 1M7QA 3QQUA 4IVDA 4P90A 2OXDA 2W99B 4ZY4A 3FMKA 4U97A 4IZ5A 4JOAA 3TG1A 4QMMA 3OUNB 4IZYA 3UNJA 3VBVA 4BDIA 2GSFA 3KL8A 3NW6A 2XNNA 2OJGA 1IA8A 1YHSA 3QCQA 3UYSA 4A4XA 4FKRA 4KABA 3UE4A 2X2LA 3V6RA 3TNHA 3LM5A 3NYNA 4Q2AA 4YJUA 3PZHA 2F2CB 4GIHA 4ANBA 5CANA 3JUHA 5CT0A 4RIWB 4CG8A 5TF9A 2VWWA 4X6QC 2CLXA 3Q9ZA 3PVBA 4IX6A 5CY3A 3S4QA 1T45A 3UDBA 4BCKA 4FGRA 1P2AA 1H27A 4J8MA 2UVYA 3NUAA 4P7EA 4EHVA 3QUDA 4FI1A 4LRMA 3WILA 3GT8A 5C1QB 5DRBA 4YZBA 3EMGA 3EN7A 4P2KA 3AGMA 5GINE 1ERKA 4E6DA 4NUSA 3GVUA 2W1EA 4IXPA 4QMXA 4YJPA 3PXRA 2PVFA 4O7ZA 4O81A 5K5XA 5LCJA 2UUEA 3NUXA 3PWYA 1G5SA 4M7IA 4G3EA 5BQ0A 5HU9A 5AP3A 4QT1A 3HAVA 1PY5A 1GJOA 4GEOA 1PYEA 2JAVA 1SZMA 3MIAA 5IU2A 3QZIA 2JFLA 1Q97A 2FSOX 3TWJA 5FP6A 4ZJVA 2FYSA 5JGBA 3ZC5A 3MVLA 5EHOA 3CGFA 3JR1A 2JLDA 3EZVA 4FIFA 3V8TA 2WIHA 3DK3A 4FTQA 2YIXA 1MQBA 3TKHA 2WOUA 3NWWA 4BBMA 3P4KA 3QGWA 4J98A 4KRDA 2ITQA 4LFIA 4WRSA 3EFJA 2X8IA 3RHXA 2OI4X 1KE8A 5L6OA 3BHYA 4WBOA 4D55A 5HE3A 3G6HA 1SYKA 3E8DA 4XV3A 3UC4A 2RL5A 3ATTA 4MD8E 4XP3A 2IVUA 3RKBA 2QOFA 3IW6A 4S2ZA 4RIOA 2B54A 4D2PA 4DFYA 4FZ6A 3HV7A 5CVGA 3W2QA 3PTGA 5JQ8A 2OSCA 5IA4A 2WXVA 3PUPA 3MN3A 4UMUA 2PZYA 2VWUA 3B8RA 4BICA 3Q96A 4F0GA 2XBJA 3GCUA 1J7IA 5CXHA 1XH9A 2VGPA 4FT3A 3PE1A 4HCVA 2CNUA 3PPZA 4ORKA 4EI4A 5AJQA 5L6PA 5L2TA 3BLRA 2C30A 5FTQA 5BVFA 4FSQA 5BVDA 4IVBA 4BB4A 5BYYA 1PXPA 3DBDA 4G1WA 3R1SA 3CQEA 4YTHA 2QU5A 4PP9A 5LJJA 4QP6A 1Q8WA 2XNMA 2NRUA 3GU8A 4NM5A 2WQBA 4L7FA 5FXQA 3W2SA 5HLNA 5HGIA 3MH2A 4FV2A 2OKRA 3UZTA 5TE0A 4Z3VA 3G9LX 4MK0A 3O17A 2WOTA 4R3CA 3R8VA 4R77A 2O65A 4ZTNA 3RPYA 4CFFA 3F2NA 1A06A 3BX5A 3EQCA 3PA4A 4JLCA 4U42A 5CAUA 5GIOE 4RWIA 4Y5QA 1SNXA 4DEIA 3OF0A 1URCA 2G01A 2W17A 4FA2A 4DBXA 2C5XA 1E9HA 1ZOHA 3TV6A 3UOLA 3ZFYA 3O8TA 5BMSA 2JEDA 1YKRA 3O51A 4PNKA 2VNYA 3LAUA 5CTPA 5E9EA 3SLSA 3B8QA 3FMHA 5AM6A 2QQ7A 1PMUA 4D2WA 4I1ZA 4TPTA 3U55A 3TTIA 3SW7A 4IDVA 3AC3A 5E8VA 4HYIA 3UZPA 4ASDA 3KQ7A 4QMVA 5AV0A 3RCJA 4ZSAA 3KCKA 3R71A 3LFFA 4AW5A 4FSRA 5M57A 5D41A 2B9HA 2JD5A 4D2SA 4MQ2A 2QLQA 3Q4CA 4UWYA 3S3IA 5I9UA 2RFEA 1J91A 2XNGA 5IQAA 2UZWE 3QTSA 4N6ZA 5ETAA 4FT9A 5AR8A 3KRJA 4NCTC 1TKIA 4IJ9A 5HVYA 3EQBA 4YJVA 1PF8A 4HVHA 2ZDUA 3S0OA 2IG7A 2VTJA 3Q2MA 3N4UA 5K0XA 4MXZA 4Q5EA 4HJOA 2ZV8A 2ZDTA 2WTVA 2PWLA 4UYNA 2OO8X 4JQ8A 3A7JA 5T3QA 4F63A 3RM7A 1I44A 4L01A 3BHVA 3Q53A 2YDJA 2GNFA 2ZV9A 5CENA 4TTHB 4E1ZA 4EH9A 4EOIA 5HIEA 3LKMA 3W1FA 4K0YA 3MB6A 3CIKA 3CD8A 2WQNA 3KU2A 3VIDA 4FUXA 4I94A 5CSXA 4LRJA 3MDYA 4O7YA 4BRXA 5IEVA 4UWBA 2W4OA 5LMAA 3LIJA 5A4TA 4EHGA 1OM1A 3V5QA 4BDGA 3Q4TA 1BYGA 3TNPC 3E92A 4FNXA 3CP9A 2BZHB 4QMZA 1XKKA 3E8NA 3OWJA 3PJ3A 4H36A 4DGNA 5A14A 2HZ4A 1NY3A 3UG1A 4C37A 1W98A 5DR9A 5CLPA 3ZEWA 4G2FA 4E93A 5D9HA 3VJNA 2QU6A 2XB7A 5AP0A 3W16A 1V0PA 4LYNA 1V0OA 1MRUA 4M68A 3VVHA 5TT7A 1W8CA 4ZAUA 4G3FA 4AAAA 4CT1A 4O7VA 2HIWA 1SM2A 3CKWA 4GIIA 1OIQA 3K3IA 5EDPA 2ZB1A 4L9IA 4XS2A 3ZO4A 1PKGA 1JSUA 3LXPA 5FLFA 1LPUA 4FTLA 3ZSGA 1BKXA 5HKMA 5FUTA 2BZJA 3H9RA 4EC9A 3A4OX 4YO6A 4AW1A 4GJ2A 3RGFA 3DZQA 4NJ3A 4R5YA 2ERKA 3HRFA 4YJRA 4RQKA 5AX9A 1VYZA 3BCEA 5BYZA 4D9TA 5KBRA 5TOZA 3PYYA 3V01A 5C8NA 3DK6A 4CCBA 3I81A 5HG8A 4XG9A 3TZMA 1UWHA 2O3PA 5F4NA 4AOIA 3IONA 1CMKE 5LVMA 4GSBA 1H1PA 4PDSA 1V0BA 2ZV7A 5CAQA 2A27A 1UNGA 3NCGA 5ICPA 1ATPE 2W1HA 2GU8A 3R04A 4W8DA 4AX8A 3AMYA 3PVGA 4XMOA 3D7TA 3WE4A 5J95A 4TKSA 4CFNA 5B7VA 3P79A 5D10A 1BI8A 2BRNA 3FLNC 4YHTA 2XK3A 3MESA 4EKKA 4EYJA 3QTQA 4X2NA 5LMKC 4AGWA 4GFOA 3MFTA 2X7OA 4EZ3A 3HVCA 4ASXA 1Y91A 4RMZA 4GUEA 4M0ZA 3TM0A 4OTGA 1FPUA 1BLXA 3COIA 3SW4A 3POZA 2OIBA 2WZJA 3TNIA 5BVOA 4RA5A 2RFDA 3LFBA 5C03A 1RJBA 2BIYA 1W82A 5FD2A 4IZAA 4XP0A 3OCTA 1L3RE 2PE1A 3T3UA 2OXXA 1PXIA 1UVRA 4ERWA 3MB7A 5JQ5A 4FV5A 4RX7A 3FMMA 4FKLA 5E1SA 4AXAA 1PRYA 2JIIA 3ZU7A 4AN3A 4YMJA 1ZRZA 1DM2A 4WIHA 2FSMX 3COHA 3VUGA 3I7CA 1PJKA 4CG9A 5LOHA 4DYMA 2CJMA 4IHPA 1G8SA 4JBPA 4BCIA 3PG3A 4IAIA 4J52A 5CT7A 2W1CA 4RJ3A 2W4KA 4RG0A 3MY0A 4YC8A 3FAAA 3VQUA 4EJ7A 5JH6A 4O38A 2YWPA 4BN1A 3RPRA 2ZJWA 4AS0A 4OLIA 4ZS4A 2CDZA 4FKUA 4BWKA 4ANSA 4AG8A 3QTXA 1JKTA 3OEFX 2QOKA 3JXWA 4MKCA 4NYEA 1M2PA 4DGOA 2ITYA 4IAZA 3NUSA 1Q4LA 3HA6A 1B6CB 3DNDA 3FC2A 4L00A 4K6ZA 2C1AA 3QC4A 2ETKA 5CQWA 2YCQA 3MYGA 4FV3A 5J9LA 5AA9A 2RG6A 4E5AX 4J95A 4AOTA 5JKGA 2VUWA 3E93A 4J96A 3CQUA 4ZY5A 5HE1A 4G6OA 5CAVA 5CWZA 4BBFA 2VTRA 5CAOA 2YHVA 3ZO3A 4RVLA 5KUPA 3KULA 2BAJA 4H05A 1RDQE 2QVSE 2CCHA 1H1QA 3O2MA 3ZFMA 3ZEPA 2UW7A 3QFVA 4M3QA 1KSWA 2W06A 1F3MC 4NM3A 2OZAA 3KXHA 3Q5IA 4AFEA 5M09A 3GXLA 4QMTA 1J1BA 4M12A 2UZBA 1FGKA 2F57A 5E8SA 3R83A 3SRVA 2JBOA 4MCVA 5AV4A 1OMWA 2YABA 4FIJA 5E8WA 3IGOA 5HZNA 4O0XA 4X3FC 4YJQA 4DBNA 5HO7A 3MW1A 4TW9A 5IA2A 5AP1A 3KC3A 3ZHPC 1IA9A 5I3OA 4UN0C 4N4SA 3Q6UA 2J2IB 1YOLA 4GT3A 1W84A 3L8PA 3LFEA 3S00A 3MGYA 3MIYA 4I22A 4NJDA 2YIQA 3REPA 5J5SA 5EYCA 2WTIA 4EH8A 2R0UA 1MRYA 3R8ZA 4CV9A 3QGYA 4NM7A 3HDMA 3EH9A 3VN9A 3ZH8A 4BI2A 4E5WA 2GNGA 5C9CA 1OKYA 1V1KA 5M51A 4A4OA 1WBVA 2OICA 3BKBA 5FEQA 5M06A 4L42A 3EN6A 5EK7A 5AFVA 1OL2A 4RZVA 4DH7A 3EN5A 4WNPA 3DKGA 3ZXZA 2GS2A 3AC1A 5H8BA 3ROYA 2XNEA 3C0HA 3T3VA 4ZMFA 1PXJA 1XQZA 3KFAA 3KMUA 2PUUA 2J0JA 2P3GX 3PJ1A 4EBWA 4JNWA 3THBA 2PVYA 5HX6A 3QZFA 4QPAA 2JFMA 4UALA 4O7WA 5BVNA 1YDTE 3D5WA 4BKYA 3LFNA 3RNYA 2ZYBA 4MXYA 5FM2A 4ITIA 4O7LA 4XLVA 2C5OA 2YLEA 4CGAA 4JX3A 2R3IA 2WMQA 3BRBA 3DGKA 3GFEA 1HOWA 3CTJA 2UZUE 4GG5A 4IW0A 2VN9A 4C57A 2C0TA 2GNLA 4RRVA 3CD3A 1OPLA 3WF8A 4EH6A 3A7HA 2QG7A 2NRYA 3NZ0A 5AV2A 3UVPA 5HNBA 3RI1A 5I9WA 3NUUA 2J51A 3DDQA 3R7IA 3VHKA 4CKRA 2YERA 5HTCA 5J9ZA 4Q9ZA 5FG8A 4DEBA 1KV1A 5FTOA 1FMOE 5CSHA 4G5PA 4NM0A 4O27B 5FGKA 3OZ6A 2HELA 1H4LA 3UODA 5C26A 4GKHA 1IRKA 4PMMA 4MBJA 1LEZA 3PSBA 2X9FA 2P55A 3D0EA 5L2QA 1NVQA 1JSTA 5CSVA 2C6EA 3COKA 4QO9A 4MF1A 3CR0A 4G3GA 2XVDA 4O0VA 4I0TA 3RALA 4RFZA 2XNOA 5CASA 3O71A 4AFJA 2Y0AA 4L46A 3QCXA 5IG1A 2VAGA 5D7AA 2B55A 1KE9A 3KXGA 3MA3A 1BX6A 3QXOA 5C01A 4JDHA 2XK8A 2YN8A 1A9UA 2Z7SA 3OOMA 4I93A 3M42A 4RT7A 4RSSA 3M2WA 3EKKA 4L3PA 3H10A 4PDOA 3SXFA 4FODA 4JDJA 1YOMA 3QX4A 1H8FA 3TI1A 4MHAA 1T46A 3V5LA 4YJTA 3OXTA 3OHTA 4YGAA 5EQEA 3OT3A 2UW3A 1VEBA 5HLPA 3NRMA 3W8LA 4FTUA 4Y85A 5BMMA 3R2YA 3AG9A 3R9RA 5FEDA 3PLAE 4ALWA 5JGAA 1YI3A 4FV9A 3NSZA 3R6XA 3F2RA 4YHFA 3QD4A 3FE3A 4RVKA 3PRIA 4NIFB 4NCTA 3MH0A 3I5ZA 4RLKA 3TN8A 5HE0A 2XYNA 3BELA 3JPVA 4PF4A 1LUFA 2QLUA 2XKEA 1UU9A 3C4WA 1XH6A 2J0LA 3NIEA 4FKTA 1KUTA 2JDOA 4MD9E 4H1MA 3R00A 1OI9A 5AV3A 2PVKA 1WBPA 4EKLA 2ITUA 2QOLA 4A9UA 2A19B 5GZ8A 4DCAA 3IO7A 1Z9XA 5L4QA 4FZFB 2VRXA 2J50A 3W2RA 1YXUA 1KE6A 2YACA 3BZ3A 5HE2A 1GZKA 3RCDA 4TZRA 3WYYA 4C02A 4EH5A 5JRQA 2QOBA 5DPVA 3HAMA 3FLSA 4G17A 1J1CA 2WPAA 4DGGA 2WEIA 3A7GA 4XCUA 4PMTA 2OK1A 1UV5A 2UZLA 4AF3A 3FZRA 5IMEA 1XH7A 3DFCB 4O21A 2IW9A 3RP9A 3KREA 4PDYA 3MJ2A 4JG7A 2R4BA 2CPKE 2VTNA 3A62A 4GH2A 3R30A 3DZOA 4K8AA 4EQCA 4C62A 3DJ6A 5KMKA 2PYWA 4KBAA 1RE8A 3WIKA 5CF6A 2R5TA 3BYMA 5LARA 4KIKB 5LVOA 1Q8UA 2B7AA 2I1MA 3RK5A 1YOJA 3BLHA 3I60A 5CSPA 4KUJA 3VHEA 4IM0A 1B38A 3L9PA 4RFMA 4FV8A 1JQHA 4FT5A 5EDQA 3HLLA 3IECA 3OBGA 4RZWA 5AUTA 3E3PA 1PYXA 5ETCA 4C4HA 3O96A 3QBNA 3LXKA 4EH7A 2R3QA 3HRBA 3BQRA 4FTCA 2J6MA 4EBVA 3G15A 4CLIA 1FOTA 2XK9A 1H28A 3BHUA 2I6LA 2SRCA 5M4UA 4X7QA 3W2CA 3KRRA 2PE2A 2C68A 4IAYA 2YCRA 4E6CA 1MRVA 2XCHA 4QYFA 4XV2A 3TXOA 4EOLA 2YM4A 5TKDA 4XG8A 3OWPA 1U54B 3KRLA 3QRIA 3GCPA 1W0XC 1U46A 2VTTA 3OXIA 4HYHA 3PXFA 1CTPE 3QRUA 4RIXB 4X6RA 2F4JA 3QKKA 4NIFA 5AP4A 3EFLA 1JKLA 4S34A 3V8SA 3W2OA 5DN3A 2WGJA 3E8CA 4O86A 4EK4A 3U8WA 2W05A 4EONA 4V0GB 4C4EA 4M14A 2C6KA 4HVIA 4U41A 2W7XA 5H8GA 4FK6A 1AD5A 3UOKA 5DLSA 3GEQA 4GMYA 5M53A 5LMKA 1BMKA 4EK3A 3LQ3A 2R3KA 3L9MA 4HGLA 4IWDA 3EHAA 2OZOA 4IEBA 1K9AA 2QO2A 3AD5A 1XR1A 4J71A 1EH4A 2AUHA 2R64A 3DY7A 5CZIA 4AZSA 3FXWA 3A99A 4YLJA 3UGCA 4X3FB 4EOPA 5HTIA 4M97A 1ZOGA 2WHBA 3CY3A 2WFYA 3HV6A 3MSSA 4LGGA 4FT7A 3QD3A 4QPMA 4C7TA 4ANQA 4XNEA 3GBZA 3P9JA 1RW8A 3R9NA 4CMOA 4D4YA 4DFLA 4EOOA 5FDPA 3N4TA 3F3ZA 3K2LA 4G3DA 4L3LA 5FQDC 3R9DA 2HY0A 4C35A 2YDIA 4BFMA 4BY9E 3GOPA 3NPCA 4IANA 4NH1A 1NVSA 2YEXA 4ZLOA 5IEYA 5KZIA 3D5UA 4B8MA 4PTCA 3LE6A 1YWVA 4GYIA 5EOLA 5AAFA 3FHRA 2IO6A 4E4MA 5JZJA 3VJOA 4N6YA 3PG1A 2V55A 3V3VA 5LMBA 3PXZA 4KBKA 4FTJA 1XH8A 3K5UA 4XV1A 1TVOA 3LLAA 3LCSA 4ACHA 4BCGA 4TWOA 3L9LA 3FI3A 2X7GA 4DF3A 1YI4A 2HY81 4YZ9A 3QCYA 3C4EA 4FV6A 4USFA 2W1FA 4MH7A 2XM9A 4I20A 2CMWA 4RIXA 5AAGA 4ZZNA 4J97A 4I0RA 4WSQA 4FYNA 3RBWA 4UMTA 2O5KA 2VO3A 1JNKA 3MS9A 4G5JA 4C3RA 2XIRA 4IJPA 4K18A 5EM5A 4DG3E 4V0GA 3C0IA 3IDPA 3O8PA 5AR5A 3OFMA 2QO9A 5ANGA 4R1YA 4MEDA 1FBNA 3NNWA 4CFWA 3G0FA 1H08A 2R2PA 3C4FA 4YZCA 2AC3A 5IA3A 1OVEA 2C6IA 1IASA 5AADA 2YWVA 4RJ4A 3HV3A 4TYJA 4YTCA 3G33A 4RC4A 2CCIA 5A9UA 4IFGA 3ZXTA 4UX9A 3OROA 4K11A 1OPKA 4JG8A 3C7QA 4IAAA 3HV5A 1DAYA 2EUFB 4OTHA 5EG3A 3RTPA 4HYUA 4JDKA 2CLQA 3VS6A 4DC2A 4NL0A 4HCUA 4YP8A 2W9ZB 4BCMA 4I5PA 2BAKA 5CI6A 2PMIA 3O8UA 3RAIA 3WIGA 4E5BA 5CF5A 3R8MA 3AD6A 3QRKA 4MWHA 4D0WA 5C8KA 4FUYA 5JMSA 1JBPE 4PRJA 3LPBA 5H8EA 2E9OA 4AA4A 5F9EA 4X2JA 4RJ5A 4O82A 5E8TA 4GUBA 4IX5A 3ZO2A 3OWKA 4WHZA 4BWXA 5B2MA 4ZEGA 2ITPA 4FTRA 4XG4A 3ORIA 3MVHA 4O6LA 5L2WA 4KS7A 4W4XA 5DMZA 5M56A 5AWMA 4Z9LA 4F6UA 3ATSA 3GU4A 4BI0A 3DXNA 4IQ6A 1JWHA 1VYWA 1XBAA 2WEVA 2FB8A 3OWLA 4FG8A 4N0SA 3K3JA 3RWPA 1ZY5A 5CEOA 2Z60A 3MY1A 4ZS0A 4P5QA 3HRCA 2PVMA 4BCHA 2FSLX 2YA9A 4J53A 4BYIA 4A9RA 1X8BA 4AW2A 2BRHA 4USDA 3AC4A 4AGDA 4LV5A 2YJSA 2OIQA 1YXSA 4QQ5A 4FKQA 4DEEA 4F0FA 5I4NA 2YAAA 4RC3A 5IPJA 4BIBA 2YIWA 3HMIA 5A4EA 4YU2A 2QD9A 3FKLA 2BDWA 4IB0A 4K1BA 3W8QA 2HK5A 3HEGA 1YVJA 4I6BA 4AUAA 4ANMA 3E3BX 3A4PA 3DBEA 3R7GA 3QALE 1R78A 4O2ZA 5HO8A 1YXTA 2GCDA 4HZSA 5KNJA 4CRLA 1JPAA 4QD6A 3PZEA 3P08A 1E1XA 4BTFA 2CNQA 3EQDA 4X2FA 4RIYB 4F64A 1OPJA 4QMSA 3VUHA 4AGCA 4EUUA 4OTPA 5IQGA 2V7OA 3FMLA 4JS8A 4HPTE 4JX7A 5A4LA 5KBQA 2DUVA 2VWVA 4Y83A 3ALOA 2A4LA 3GGFA 4FBXA 5HU3A 1KWPA 5FDXA 2OJFE 1UKHA 2W1ZA 3W55A 4IWPA 2CSNA 3GU6A 3BE2A 2V7AA 4KIQA 5E1EA 5GJFA 1AQ1A 3IW7A 3KF7A 3QZHA 2O64A 3KXXA 4R7BA 3PY0A 2UW6A 4FNWA 5HVJA 1WBTA 3C4ZA 3QQFA 4G6LA 2EXMA 2XIYA 4BL1A 3BI6A 3FPQA 4D2VA 3ORXA 4FR4A 5DNRA 2OF2A 4F7SA 5L6WL 4RIWA 4FSWA 4TNDA 3KB7A 5F95A 2GS6A 4KB8A 2BZIB 1ZYDA 3BBTB 2WMAA 3R8UA 4CVAA 5AUUA 5EYKA 4QMUA 3P0MA 4WRGA 5HICA 5TR6A 4BGGA 2JKOA 3SHEA 4WG5A 4C0TA 2PZ5A 3P86A 2J0IA 2F7ZE 3Q9WA 3LLTA 4LOPA 3PJ8A 4FVPA 2XKFA 1GIIA 2VV9A 3QQGA 4HCTA 4I23A 3U51A 3WZUA 4BTJA 4PL4A 4LL0A 4QNYA 4YSJA 4U8ZA 5JFXA 2VU3A 3FKOA 3CJFA 5AR7A 3W32A 5M4IA 4DT9A 3EL8A 3KEXA 4WA9A 4W4WA 1UKIA 3LJ1A 3UO6A 5M55A 4G34A 3SVVA 1DAWA 1LR4A 3E7OA 3VS2A 3F6XA 3FZOA 3ORTA 1WMKA 1REJA 1Y8GA 4LGDA 4QMYA 3UBDA 4PY1A 4FTOA 4ZSLA 4GU6A 3ZC6A 3KVWA 5HD4A 2O8YA 3RZFA 4GJ3A 4RJ6A 1JKKA 3Q52A 1UNLA 3PVWA 2PE0A 4FNYA 4TWCA 3FZTA 3TZ9A 4IX4A 4JAIA 4EK6A 4QQTA 5DH3A 3AMBA 3KXMA 4FICA 1PW2A 2WTKC 4DFZE 3EQGA 3KN6A 2ZV2A 2CKPA 4X0MA 4UMPA 3OTUA 3QRJA 4MBIA 4HVSA 3FQEA 4Q5HA 4Y46A 2X8DA 5HQ0A 2H34A 4CSVA 3R2BA 2OBJA 1U5QA 3SC1A 3D83A 2E9VA 4ZZMA 5JZNA 3EJ1A 4ONAA 2ETMA 5KO1A 3C1XA 4H58A 5DT0A 4TNBA 5E4HA 3FPMA 2W1GA 4F65A 5LCKA 3QTWA 2OXYA 1IG1A 4O0SA 5J79A 3CBLA 1ZZ2A 4TYHB 3JYAA 3H9FA 5JT2A 1SVEA 3HECA 2IVTA 1ZYSA 3MVMA 2HOGA 5FBNC 2ITTA 3U9CA 2C6MA 3JVSA 4EH3A 5KMMA 2IZTA 1XBCA 5KKRC 3A7FA 4RGJA 3E88A 2PHKA 2VNWA 4NT4A 1K3AA 2VD5A 4QTCA 5LVLA 2BHHA 2UZDA 4IX3A 4YZMA 5EI6A 1XBBA 5CS6A 5KMJA 1MUOA 3LMHA 4FEQA 3SQQA 3ACJA 2WU6A 4QTAA 4BCFA 2QOQA 4R78A 5K9IA 2HZ0A 4D1ZA 4XX9A 3BEGA 4ALVA 3SG9A 3ZUUA 4YC3A 4LOQA 5EHLA 1UA2A 3F61A 2G2FA 3IOKA 2XCKA 3F5GA 4L45A 3ZLWA 2REIA 5CALA 4FIHA 4EOJA 2IPXA 3V5WA 1NVRA 2CHLA 2YM7A 2VTOA 2F2UA 4I3ZA 4KRCA 5DVRA 3U54A 2XA4A 2ZOQA 1AGWA 3OD6X 4D2TA 2VO7A 2YJRA 4PPBA 3F88A 4WBBB 3FQSA 4IIRA 5AR2A 4QYEA 4A07A 5EW3A 3PXYA 4IZ7A 5AUYA 4FC0A 5E91A 2XM8A 5EI2A 5EKOA 1R0PA 3E87A 3PPJA 4LGHA 4QMLA 3BGQA 3AXWA 5FXSA 2YFXA 4PL5A 4AZTA 5D7VA 1O6YA 3ACKA 4TXCA 3QUEA 4KWPA 4RJ7A 4WT6A 4XBUA 3R9OA 4MXCA 2JIVA 3WI6A 3HMNA 4PMPA 5FBOA 4WNKA 5FEEA 4WNOA 5A4CA 4OW8A 3HKOA 4L8MA 2BALA 3OW3A 3VBQA 2XK6A 1ZMUA 3R1YA 3AC8A 4O84A 5AEPA 1YXVA 4FKVA 3H9OA 1WBOA 2WTCA 4ACMA 3EWHA 2HCKA 2R3RA 1ZLTA 3R1QA 4ZTQA 5EQYA 2QHNA 1OL6A 4GVJA 2WMWA 3QHWA 4FV7A 3CXWA 2PUPA 3UOJA 1PMVA 3NUNA 4Y8DA 4FNZA 3ZM9A 1P4FA 2QOCA 2WNTA 5M44A 3FV8A 2VX3A 2W5HA 5CEIA 3CKXA 2H6DA 4DTBA 5I3RA 3QCSA 4MXAA 4K9YA 5I9YA 3VF9A 3ODZX 3G0EA 4UZHA 3MPAA 2A1AB 5HIDA 3RHKA 2F7EE 2QCSA 4AZFA 5DIAA 4GCJA 4LI5A 3VF8A 5E90A 5I9ZA 2HZNA 3HL7A 4YJSA 5IA0A 4BKJA 4I5HA 4GK2A 4Y72A 2A0CX 2O2UA 4E6QA 3R28A 3G9NA 5J7BA 2GQRA 3TDVA 5IA5A 5F1ZA 3DQWA 4BYJA 5CU4A 2UVZA 3F5UA 4UMQA 3R01A 4BR3A 4CTCA 4EEVA 4GFGA 3OXZA 4P4CA 2PUIA 3T9IA 3EB0A 4XG2A 4BDAA 3WOWA 4KSQA 5AIRA 5DYJA 2H8HA 5CEKA 2G2IA 2GTNA 4FEWA 4R3PA 1FMKA 3VRZA 3G6GA 4PDPA 3NCZA 3ZS5A 4DEAA 1SNUA 3PSCA 4C34A 4YZDA 1UWJA 4BZDA 4C4JA 3OMVA 3KXZA 4PQNA 4M69B 3CE3A 4DFBA 3WF9A 5IMXA 1OKVA 2XP2A 4HNFA 4AE9A 1HCKA 5AP2A 3PP0A 4O1PA 2ITOA 4FVRA 2I7QA 1OIUA 4MXXA 2Z7RA 3A60A 3P23A 4ZTHA 4ALUA 2W1DA 4DN5A 2Z2WA 3NNUA 3LQ8A 4JT3A 4C33A 3D5VA 3K5VA 1OITA 2QHMA 3F7ZA 3PY3A 4FSTA 4FSMA 4NKSA 4B0GA 2LAVA 3A61A 1JKSA 1FVVA 1H1WA 1ZYLA 3NAYA 3AT2A 3TTJA 3TUDA 4FKPA 1Y6BA 4FTMA 4OTDA 5CVFA 3SGCA 2BPMA 3BU3A 2VO6A 3F5PA 2J90A 3VNTA 1SVHA 4TYIA 4V01A 3D14A 1PHKA 1YDRE 4FKWA 4F9BA 4LUDA 3RPVA 2ITXA 1XHAA 2I0YA 4QP4A 3UMWA 1QPCA 3I6WA 4MF0A 3UO5A 2NP8A 2XRUA 3PVUA 2PU8A 4NTTA 3R73A 5J87A 4A9TA 2EU9A 1YWRA 5IH6A 3NW7A 3OT8A 2VGOA 3UC3A 1VR2A 3NW5A 3OBJA 2EXCX 2WMSA 2H9VA 4I92A 4L53A 1P4OA 4XHKB 4ACDA 3DNEA 4U0IA 2B9FA 4U45A 5HBHA 2PL0A 2VWZA 4CNHA 3QD2B 4EZ5A 4QTBA 3FSKA 5IH4A 3DKOA 3L1SA 2RGPA 3PPKA 3HV4A 2IVSA 2IZUA 5J7HA 3CPBA 3NVKI 3IDCA 1ND4A 3KMMA 4YTIA 3P5KA 4TWPA 1YRPA 2W4JA 2XIZA 3HMPA 4ZSEA 4APPA 4DGLC 5IQFA 4BDFA 1Y8YA 2BAQA 2ZM3A 4FTKA 3RVGA 4E4LA 3LZBA 5K4JA 3LCTA 1VZOA 5LWMA 3RPSA 2BHEA 5CEMA 5IUHA 3DLSA 4KSPA 3RZBA 2PVLA 1NT2A 2C1BA 2ESMA 3OW4A 4O6EA 4R7IA 3TNQB 2QONA 4O0RA 1QPEA 3F7WA 4WUAA 4M84A 3GP0A 2VTIA 4IWQA 2RIOA 2X2KA 4YR8A 3QUPA 3A8XA 3C5UA 4M13A 4A9YA 2WTKB 5EOBA 4YPDA 2Y8OA 1ZAOA 3D15A 1YI6A 3QLFA 4U40A 4ITJA 4CXAA 5JN2A 4L6QA 4U5JA 4ANNA 3GU7A 3NGAA 4IFCA 5B0XA 5KX8A 3ZOSA 2DWBA 5E8XA 1KE5A 2C6OA 5JGDA 2HW7A 3BGZA 1APME 5DWRA 3QKMA 3PLSA 4BCNA 2EXEA 4I21A 4QOXA 3BPRA 3KRXA 4AZWA 2PVJA 3SX9A 3GI3A 4XLIA 4WSYA 3R1NA 4JRVA 5IH5A 3AC5A 3BHTA 5KKRB 3BQCA 2VTMA 1IEPA 2R0IA 3I5NA 4DLIA 3O7LB 5HCXA 4DG2E 1Y57A 5E8ZA 3C5IA 3KF4A 3FYJX 2PMNX 3AQVA 3PRFA 4EWHA 1M14A 3U6JA 2QNJA 5DR2A 1WBNA 2XF0A 3MFUA 2BFYA 5E8UA 3VUIA 2JAMA 4C8BA 3EQHA 4O22A 5I0BA 3T9TA 4G31A 4FV4A 3IW4A 4QYGA 2WMBA 3GC0A 4XG7A 4YC6A 3ZO1A 5A6OA 2DS1A 2F9GA 4W9XA 3VS7A 3QHRA 4AA0A 2HZIA 5ANEA 4E4NA 3I0OA 4QMWA 3PIXA 1I09A 1QMZA 2FO0A 5KZ0A 4DH1A 4E6AA 1H00A 3NUYA 1F0QA 5GZ9A 3R02A 4EZ7A 5T68A 1ZXEA 2UW0A 4UB7A 5ANDA 4FEXA 3F3UA 4WD5A 4DAWA 2HWOA 4C36A 3UIMA 4TL0A 2YIYA 4TWNA 3QC9A 4BDBA 4QQCA 3WYXA 2JKMA 4YURA 3DDPA 2V22A 5B2KA 4RA4A 3SOCA 3MFSA 5IISA 3ZTXA 2R3NA 1WVWA 3IOPA 4QTDA 3O23A 4NZWB 2XKCA 1WAKA 3FI8A 4EHZA 4AWIA 2OF4A 3R7YA
chains in the Genus database with same CATH superfamily
2J0KA 1QPJA 4C4GA 3PIYA 4O7NA 2DYLA 5ETFA 5GNKA 4F09A 3R8LA 3RNIA 4IVAA 2ONLC 1ST4A 3QKLA 4DHJA 5HLWA 3WZEA 1R0EA 3E62A 2JDSA 2BRBA 4G3CA 4XG6A 2PMLX 3ZONA 4ERKA 2JGZA 1PXMA 4DTAA 3UNKA 3WF7A 3JVRA 4OBQA 5CVHA 4BTMA 3SA0A 4YPSA 4K33A 2GDOA 3PSDA 3TCPA 4X2GA 4LUEA 3VS4A 3DAEA 3GENA 4MYGA 4AA5A 4V05A 3GB2A 4BI1A 3GCSA 2C69A 4Z7HA 2G1TA 2W0JA 4AT5A 3MH3A 3DJ5A 3IQ7A 4QP3A 3Q6WA 3BGPA 1BL7A 4DITA 3F69A 4D4RA 2R3PA 4MWIA 4FKOA 1U5RA 2VTSA 1TQIA 4GYGA 3GFWA 4ANOA 4CQEA 2VWXA 3MVJA 4PX6A 2QOOA 4MX9A 3CGOA 3II5A 2OH0E 3FI4A 3LFCA 3NUPA 4Y73A 4XBRA 3KVXA 1KOBA 1XO2B 2GNHA 3NR9A 3SAYA 4AQCA 4ANLA 2C47A 3FMJA 4RWLA 3DAKA 2VZ6A 2R9SA 2XYUA 4IWOA 4A4LA 4BDCA 2IN6A 3ZM4A 3V8WA 4CFXA 4DFUA 1OGUA 3L8XA 2DQ7X 5DBXA 4HNIA 3UP2A 3H0ZA 1ZOEA 3RK9A 4F08A 3QAME 1B39A 4X2KA 3HMOA 4ASZA 1NA7A 1SMHA 5EM7A 4QDVA 1OIRA 3VUMA 3D2IA 4Z16A 4CKJA 4NW6A 2WTWA 5BUIA 2IZRA 2B4SB 2WB8A 3TACA 4RVMA 1PXLA 2ZB0A 1H1SA 3Q4ZA 3U4UA 1MQ4A 3NFGB 3AOXA 2QC6A 4O4BB 5JFSA 4MXOA 4F9YA 2LGCA 2X39A 5DE2A 4ACCA 3ENMA 2IW8A 2C3IB 1WVYA 5BVKA 3EIDA 2QG5A 4G16A 3W2PA 4X21A 5DFPA 4C3FA 4DHZA 2UW9A 4S30A 4UMRA 4U3YA 3B2WA 2AYPA 4OTQA 2QI8A 3O50A 3DB8A 1H07A 3CSVA 4D5KA 2I0HA 4ZTRA 4HOKA 3EN4A 4KNBA 3ZRLA 4PP7A 4JXFA 4GG7A 4JG6A 4QMOA 3OY3A 4C4FA 4H39A 3ERKA 3ZLSA 1TQPA 2OIDA 1E1VA 3BIZA 4GL9A 4XP2A 2WMUA 4ZJJA 3U6HA 3ZBXA 2X2MA 2I0EA 2P2IA 3B2TA 4HZRA 4GK4A 3GNIB 3QZGA 1WZYA 4IACA 3AT4A 3VBYA 4EOQA 3QF9A 2JKKA 3DT1A 3QD0A 3TIZA 4FL3A 3HMMA 1OKZA 4R5SA 5K4IA 2C3KA 3DB6A 4U81A 3FQHA 1TFFA 2YM8A 2J7TA 4JQ7A 2BUJA 2PVRA 2Y7JA 1YWNA 3FSFA 4P5ZA 3RWQA 4KS8A 4BBEA 3KKVA 4X3JA 2G15A 4FTAA 4YNEA 4JI9A 4NTSA 2PTKA 3R7OA 1REKA 4FX3A 4EH2A 3OCSA 4YBKA 1OBDA 4FTIA 4EC8A 2WIPA 4Y5HA 2Y4IC 5AX3A 4KIKA 2WTDA 3V5JA 3KK9A 3Q3BA 3WE8A 5ANOA 3WF5A 5I5ZA 5AIKA 3HNGA 4I6HA 5L2SA 3Q4UA 2Y6MA 2VTAA 2CGUA 2O0UA 5HTBA 3EFKA 1M2QA 4F9WA 3BU5A 3QQHA 3VUTA 1UU3A 3VQHA 4IADA 4FKGA 2ITNA 3ZZWA 3C50A 2BTSA 4NFNA 4U43A 3VS3A 4E3CA 4OUCA 5ACBC 3HP5A 4FSUA 3DXQA 4EH4A 3NMUF 5HG5A 2RFSA 4J7BA 4IB5A 1U54A 4JBOA 4WOVA 2BROA 3W33A 1OL5A 3M1SA 3OG7A 2BRGA 4D28A 3KRWA 3GQIA 4FSZA 1PXOA 2VX1A 2R7IA 3ZFXA 3AT3A 3MH1A 2YM6A 5L3AA 3TZ8A 2BKZA 4W9WA 3TJCA 1XMMA 2XMYA 3MWUA 1W83A 2VO0A 3OCGA 4OTRA 4QP1A 4AE6A 3ZRMA 1W2FA 4H3BA 4B4LA 2CKEA 2ITVA 3U4WA 4HGEA 2Y4PA 3FYKX 4YZNA 4QQJA 3EQPA 4GU9A 4HVDA 2F49A 3W0NA 3QLGA 3OUKA 1BUHA 4ZTSA 5CU6A 2YCSA 4IDTA 2XNPA 4F9AA 1JAMA 4CLJA 3S1HA 4TY1A 4AN2A 5BV3A 3DV3A 4U6RA 5HIBA 3VS0A 3PXKA 3DXPA 4DT8A 2X7FA 5CSWA 4JBQA 5IZFA 3EQRA 3BLQA 4F1MA 3CTQA 4X3FA 1FGIA 2GHLA 2YIRA 2W5BA 4G9CA 3V5PA 3FUPA 5EHYA 4Z7GA 4CMUA 2X0GA 3U87A 2WQMA 4ZLYA 5DOSA 3N4VA 3MPMA 5BUEA 4EOSA 5IF1A 3ORMA 3F5XA 4J1RA 4IVCA 5AR4A 4PTGA 3LFSA 4IB3A 4RC2A 3DOGA 2NNWB 4F1OA 3UIUA 3DA6A 4DG0E 2XZSA 5CX9A 3QQJA 3W0MA 4XUFA 3FXXA 1OL7A 1OZ1A 5IDNA 2HYYA 4FGBA 4KBCA 2OWBA 4FOCA 3TEIA 4BCQA 3QU0A 5E7RA 3NAXA 2HWPA 3AGLA 3NEWA 3KGAA 5C27A 3W10A 1L8TA 4JMQA 2V62A 2UW5A 2PK9A 3KN5A 4LOOA 3FXZA 5HBEA 1YHWA 1M17A 1ZWSA 4V04A 3UIXA 4DH8A 2IVVA 4RVTA 3DBFA 3D5XA 4FT0A 3UZRA 3QTZA 3RAWA 5HNIX 4KA3A 2ZMCA 4DTKA 4I24A 4XG3A 4FL2A 3ULIA 5IQEA 4DFNA 3FKNA 2IJMA 5J5TA 1OUKA 5HORA 3E5AA 1KE7A 2Q83A 3VS1A 3PXQA 2YAKA 1IAJA 3Q60A 4PUZA 3A7IA 3HUCA 2J5EA 4GW8A 5GZAA 2Q0NA 4L3JA 1GZNA 4TYEA 2JDVA 3V04A 4H3QA 4F9CA 3QQKA 3CPCA 4D1XA 3MJ1A 1XH4A 3GQLA 4EK8A 2AEGA 4QP7A 1YDSE 2C6TA 3PFQA 4HW7A 3NDMA 2OGVA 2JC6A 4TT7A 2QOIA 1G8AA 4BHZA 5JFWA 4L52A 4AZVA 4JAJA 2BRMA 3L8SA 3DPKA 5H9BA 1Z57A 5AR3A 1YQJA 4UEUA 4WNMA 4DA5A 4YTFA 4LMNA 2YM3A 3LCOA 3R8PA 2IZSA 4GVAA 2C0IA 3TUCA 4D0XA 4XOZA 1DS5A 3ZZEA 4CMTA 4EQMA 3FDNA 2WD1A 4UV0A 4KKGA 4IBMA 3BE9A 4TYGA 4YNOA 2WAJA 5DG5A 4BDJA 2GTMA 4M67A 5LWNA 5J1WA 4AW0A 5HBJA 4DEGA 2XH5A 5CI7A 4FKSA 4J8NA 4MTAA 5L2IA 5DRDA 2CGWA 5IEXA 3H30A 3I79A 3FY0A 1GIHA 4NW5A 3TMOA 3TUBA 3U6IA 1Q99A 4O0TA 4BCOA 1OB3A 3P7BA 2PZPA 2OU7A 3DAJA 2C5VA 1P5EA 2C3LA 4OT5A 5DI1A 1FVTA 3T8OA 4NK9A 4UWCA 4C4IA 3UMXA 1TQMA 3IDBA 2JBPA 2A98A 3ANRA 3E64A 4O1OA 3VW8A 2R3OA 3ZDIA 2PPQA 2QO7A 3W18A 3NYXA 4QRCA 4KKEA 3ANQA 4FIEA 3DQXA 2VTHA 4BCJA 5C8MA 4U3ZA 4D58A 3GCQA 2B9IA 4XRJA 2RG5A 3F2AA 2ONLA 1O6KA 1Q3WA 5BVEA 2X1NA 3A8WA 5JK3A 1XH5A 4FVQA 1CKPA 2X4ZA 3DCVA 4CKIA 4QNAA 2YLFA 4GV1A 3Q32A 4KKHA 3P1AA 3Q9XA 3CC6A 4QPSA 1VJYA 5AP7A 3VBWA 3BU6A 2NPQA 3ZCLA 4FEVA 4M0YA 2B53A 5C4LA 4CT2A 4JL9A 2XJ0A 3LFDA 3DLZA 1STCE 5CU2A 3FC1X 3ZLXA 4RIYA 1S9IA 4F1TA 4DE4A 4I41A 3FMEA 4CZUA 3FI2A 4JQEA 5HG9A 2C3JA 4LV7A 4GS6A 4RPVA 3R9HA 4NKAA 3FLWA 3ML1A 3GC8A 5FTGA 3R0TA 2GFSA 3MI9A 4FZAB 5J9YA 3LMIA 5EQPA 3N51A 1ZARA 1UU7A 4ZTLA 3I6UA 3F3VA 4S31A 3SKCA 5H2UA 1Q41A 4S33A 4BDKA 3FLZA 3RAHA 3F9NA 4O0YA 3ULZA 1ZYJA 4HVGA 1JLUE 5CAPA 3CTHA 2WMRA 3CY2A 5JRSA 1LEWA 2Y4IB 4FV1A 3LQ5A 3V6SA 4GKIA 3FZPA 1LP4A 3UP7A 3IS5A 4IE9A 5CF4A 4O0UA 4E4XA 4QMQA 3Q5ZA 5IA1A 4NFMA 4OBOA 3UNZA 4BGHA 4F99A 4F6SA 1H0WA 3OEZA 4BZNA 5D1JA 2EB3A 2WO6A 4E73A 3ORZA 3WBLA 1DI8A 4MAOA 4U44A 5D12A 4O91A 2QKWB 2C5NA 5KMIA 2WELA 2C6DA 1PKDA 1H1RA 4CYJA 2GHGA 4R7HA 4UY9A 5DHJA 4B7TA 1H26A 3PJCA 5AAEA 2ZM4A 4JR3A 1BL6A 1M52A 5B2LA 3UQFA 3MBLA 2GQGA 3MFRA 3U9NA 4BGQA 5CU0A 3LCDA 4U7ZA 3FLYA 4C2WA 4UZDA 2EB2A 4QP8A 2UW8A 3NIZA 4O4FA 4ZJIA 2J0MB 3D7TB 5A54A 3FZSA 3O0GA 3WZDA 5HX8A 5A4QA 2W96B 4YLLA 4F7LA 5EH0A 4RBLA 4BC6A 1GZOA 2UW4A 2XS0A 4QYYA 3LCKA 5CU3A 3H0YA 4HPUE 1W7HA 4XOYA 1Q8YA 2XUUA 3RPOA 4BHNA 5ITAA 2WQEA 1O6LA 3BYUA 3FY2A 2O63A 5EKNA 5KHWA 4EUTA 3EYHA 4GT4A 2PUNA 3FEGA 3POOA 3WARA 4DH5A 4HGSA 2XNBA 3VC4A 5CXZA 3RK7A 2YCFA 3LMGA 3IK3A 4G9RA 4LDTA 4K2RA 2BKKA 3RINA 3DBCA 2GQSA 3TL8A 4AN9A 5BX0A 4NSTA 4WKQA 4UXQA 4O96A 5IUIA 2Y6OA 2GNIA 2F7XE 4I5CA 4D2RA 3EFWA 4C38A 5ACKA 4I6LA 5DT3A 3CCNA 4LG4A 4O0WA 3C51A 3UQGA 5BUJA 3ODYX 4FG7A 3ENHA 4YSMA 3DS6A 3F82A 5AP5A 2UZEA 2AC5A 1OKWA 3MPTA 4TYHA 3LJ2A 2BIKB 2XJ1A 4PV0A 4EORA 3I1AA 3ZRKA 4D4VA 2PVNA 1GAGA 4IM2A 1QCFA 1GZ8A 2ZAZA 4FF8A 4DEHA 3F66A 4E7WA 4ZY6A 4AGUA 2JITA 1GY3A 3ELJA 2GPHA 2YDKA 2BMCA 2FH9A 3FMDA 3OVVA 4KIOA 1OBGA 2XARA 2YM5A 3ORLA 1DI9A 5CZHA 3FWQA 3MA6A 4FTNA 4DHFA 4ZTMA 2YZAA 3UPZA 4IC7A 4LMUA 4F0IA 3OY1A 5EYMA 3RJCA 5ANJA 3COMA 3QA8A 4AZEA 3KK8A 3V5TA 5KMLA 1ZMVA 5AMNA 4EOMA 5HCYA 2IW6A 1R39A 4XJ0A 1A48A 4WUNA 4C61A 1CKIA 5AUXA 5CYIA 5F94A 3ZLYA 4CZTA 4LM5A 3AD4A 5CEPA 4U79A 5K3YA 3FBVA 4OTWA 1PMNA 3ORNA 3QWKA 3KULB 3MTFA 4LQMA 4B6LA 3SG8A 1JSVA 4M15A 3SOAA 4IMYA 3PE2A 5CNOA 2BDFA 3FLQA 4PPAA 4C58A 3VRYA 4YUQA 2OZAB 3DK7A 1J3HA 3HUBA 3VS5A 2VWBA 3C0GA 4ZIMA 5HOAA 3SRVB 4BDEA 4BTKA 4BCPA 2XEZA 4QYHA 3H3CA 4MVFA 2R3LA 2R3HA 3ZMMA 3CS9A 3UOHA 5IUGA 2VWYA 5GHVA 1Z5MA 3C13A 3D2KA 5I9VA 3NX8A 1URWA 3HP2A 3P7CA 4NEUA 1OUYA 2XK7A 3KY2A 3WZJA 1F5QA 1M7NA 3JY0A 4FIGA 1Q8TA 4G6NA 3VWAA 5FWKK 3TDWA 4ZMEA 3K54A 2R3FA 1KV2A 2ITWA 2Z8CA 3R63A 3V51A 3BL7A 4EQUA 4O7RA 4GT5A 4JRNA 3CQWA 4RWKA 3O5AA 4JVGA 2OFUA 2E9NA 2I40A 2ZMDA 2VTLA 3BHHA 3BYSA 2JIUA 1IR3A 3ZBFA 3CLYA 5EW9A 2IWIA 1FVRA 2VWIA 3VBTA 1XWSA 3Q9YA 5F20A 4IM3A 4KAOA 2WMTA 4DDIA 2UZVA 4M8TA 2HXQA 3GCVA 3ROCA 3LFAA 3FHIA 3PWDA 2VX0A 5EM6A 4BDDA 1QL6A 2HW6A 2I0VA 2WKMA 2XK4A 3G2FA 4CFUA 4DEDA 3I0QA 1RQQA 3QWJA 4L43A 4BWPA 3I7BA 5HG7A 3TT0A 2RSVA 3ALNA 3C9WA 4BIEA 4OR5A 5CEQA 4JR7A 4XH6A 4DFXE 2QOHA 5FXRA 5AM7A 4JJRA 3VAPA 1Q62A 3ZYAA 3ITZA 2XKDA 4IB1A 3QL8A 4I4EA 2GNJA 4L44A 4AU8A 4B8LA 3R7UA 3LHJA 4R6VA 1S9JA 3DTWA 4BVUA 5JEBA 1H25A 2PVHA 5TO8A 1XMLA 4FKIA 3NYOA 3RAKA 5HVKA 3UJGA 4C59A 2E9PA 2BFXA 2WMVA 3FL5A 3PIZA 1R1WA 3VONA 2FA2A 2BTRA 3F3WA 3G5DA 4M69A 3GOKA 4MBLA 3VULA 5C4KA 3ZUTA 1H24A 3HGKA 3IW8A 3NNVA 4NU1A 3VW6A 2H96A 5M4FA 1WCCA 3EL7A 3H4JA 5E8YA 4CTBA 2ZFYA 3D7ZA 4KINA 4RWJA 5CF8A 4OAVB 3VBXA 1CSNA 4I6FA 4CD0A 4BZOA 2W9FB 1BI7A 2GMXA 3ORKA 4QTEA 2XIXA 3CJGA 3QTRA 2P0CA 4FL1A 1KOAA 4LRKA 5ANKA 4C3PA 1GNGA 2P4IA 3GUBA 1U4DA 3IG7A 3UYTA 3Q2JA 4PMSA 4KD1A 2ZVAA 4E20A 2CGXA 1MP8A 4FJVA 2ITZA 1R3CA 2WQOA 3AMAA 4MD7E 5AV1A 5LXMA 2B52A 3PP1A 3QTUA 5HO6A 3TKUA 1SVGA 4RX8A 2XIKA 3AC2A 4QMPA 4S32A 3IKAA 4D9UA 4AOJA 1Q61A 4H1JA 4N70A 4DCEA 5LQFA 5H3QA 5EM8A 2OJJA 2BCJA 4MNFA 5EDRA 2CKQA 3UTOA 4OTFA 4CEGA 4EOKA 2XRWA 4EK5A 1GOLA 2E9UA 3LJ0A 4I6QA 4FV0A 4WG4A 3DKFA 5HEZA 2GHMA 2R3JA 3NLBA 5J8IA 2P33A 2R3GA 3DBQA 3E63A 2WU7A 3ID6C 1ZMWA 2CGVA 5KE0A 3L9NA 5L8JA 4ENYA 3ZSHA 2QURA 3TIYA 4I0SA 4JBVA 4BDHA 4B9DA 4I4FA 2HXLA 3LXLA 4AT3A 3KXNA 5BPYA 4XYFA 4RQVA 5GJGA 5JFVA 4FSNA 3ZDUA 1O9UA 3BYOA 4R3RA 2Z7QA 4R1VA 5FRIA 2UZOA 1YHVA 2CNVA 2UZTA 4ID7A 1K2PA 3BWFA 2E2BA 4O2PA 4EYMA 5LVNA 1YXXA 2KULA 4DGMA 4CFMA 4D1SA 2B1PA 3HYHA 5FM3A 2X6EA 4WG3A 5DEYA 5IQDA 2W5AA 3FL4A 4II5A 4OTIA 3FMNA 2J4ZA 2Y9QA 4YO4A 3RM6A 2CKOA 4O7SA 4QDEA 3UDTA 3OCBA 1J7UA 3EQIA 5L8LA 4AP7A 2UV2A 2R3MA 5BVWA 4O83A 4GFMA 3LFQA 2B9JA 2FGIA 3UIBA 5KMOA 2YZLA 3IW5A 4ZZOA 2BVAA 4FK3A 3ETAA 1H01A 5IDPA 5K5NA 2B0QA 1H0VA 4N57A 3GC9A 2JKQA 2X81A 1NW1A 3ZUVA 5ANIA 2PSQA 3NVMB 4IH8A 3OTVA 1XJDA 5T6KA 4PTEA 3SXRA 2X0PA 4U9AA 3UPXA 3HX4A 3NNXA 3PY1A 5G6VA 2BDJA 4EWQA 2WMXA 3OC1A 2PMOX 2NO3A 4UBAA 3PDTA 2YISA 2XBAA 5HESA 4USEA 4FSYA 4FYOA 4O4EA 5J1VA 3G90X 5K0KA 4ZXTA 4YBJA 3HA8A 3R21A 3QA0A 5AA8A 2Q0BA 2V5QA 4OT6A 4FIIA 2PULA 5DR6A 3TZ7A 1GIJA 5JSMA 4ZK5A 3VUKA 3QTIA 3BBWA 5GJDA 3R7EA 3UVRA 2PZIA 4A9SA 3ET7A 5A46A 4YJNA 4AT4A 4CYIA 3KA0A 2X8EA 4DLJA 2QR8A 2EWAA 4GRBA 2X4FA 3M11A 2CN8A 2OFVA 4BIDA 1P14A 3LM0A 3S2PA 5IQHA 2QKRA 3QYWA 4WO5A 1Q5KA 3UVQA 3QQLA 4CRSA 3RMFA 2G2HA 2GFCA 4FTTA 4ZP5A 2R7BA 4QMNA 4ARKA 3UG2A 1WVXA 2QODA 2EVAA 3EYGA 3PJ2A 4QP2A 1FQ1B 1G3NA 5A3XA 1WFCA 2UZNA 3LW0A 4QEBA 5KMNA 2PY3A 3DFAA 3EN9A 4XV9A 2XJ2A 2XEYA 1OECA 2CN5A 3QX2A 4LL5A 4A06A 1VLRA 4Q9SA 4L7SA 4GK3A 4DINA 1NXKA 4ITHA 5L8KA 4Z55A 3TKIA 3UQCA 4XRLA 4IC8A 5G1XA 5CNNA 1ZZLA 3VO3A 2RFNA 2OJ9A 1UU8A 2ACXA 1OL1A 2FUMA 2VTPA 3DTCA 3P7AA 5CQUA 2YITA 2J5FA 1M2RA 4FZ7A 3P78A 5AUWA 4ASEA 5BNJA 3EKNA 4MNEB 3BV2A 5LVPA 3TNWA 4RX9A 4TRLA 5D11A 3G51A 1CKJA 4B99A 5M4CA 4C2VA 1QPDA 1WBSA 4F4PA 5M07A 2BR1A 5IQIA 2RKUA 4AACA 1Q24A 2W1IA 3BYVA 2C4GA 3N9XA 5I9XA 3HDNA 1Q8ZA 2BILB 2UVXA 3QYZA 4FMQA 5ETIA 3VUDA 4FOBA 4RFYA 4D4SA 3PA5A 3NYVA 5A6NA 4HGTA 2X6DA 4YHJA 1CM8A 4JDIA 2PZRA 2OJIA 3IPHA 3LOKA 4JIAA 4RJ8A 2RF9A 3DKCA 3JY9A 2J9MA 1ZYCA 3O7LD 3S95A 3C4XA 3IGGA 4DH3A 4HYSA 2JDRA 4L68A 2OH4A 5FP5A 3I4BA 3E8EA 2KTYA 1ZY4A 3OP5A 5EFQA 1IAHA 5IKWA 3FJQE 4QP9A 4F7JA 3ORPA 3EZRA 4UYAA 4PNIA 4EL9A 3TJDA 3SDJA 2OLCA 5DA3A 1UNHA 4APCA 2JDTA 4FZDB 4CV8A 3D94A 1Y6AA 3SXSA 4FEUA 2VTQA 4E8AA 4CQGA 4MQ1A 4FKJA 3TV7A 3LXNA 5KCVA 4OGRA 1HCLA 2ETRA 3WF6A 4PWNA 5HD7A 5DT4A 2Z02A 5M08A 4FG9A 5EI8A 3LVPA 4TN6A 3BEAA 2FSTX 1U59A 3OOGA 5EW8A 3WZKA 2G9XA 1WBWA 4PL3A 4Y95A 1PXNA 4IAFA 4W4YA 4XEYA 5HNGA 3Q04A 4D5HA 4CZYB 1PMEA 3PUFC 2HENA 3BWJA 3TV4A 4BKZA 4J99A 4L67A 4F6WA 4KIPA 4CCUA 3E7VA 1JOWB 3DU8A 3R22A 3SV0A 4I5MA 3ZSIA 4AQKA 1YW2A 2OW3A 1Q3DA 2X9EA 3NS9A 4E26A 4FE2A 5AUZA 3QXPA 3A2CA 4UXLA 4F70A 5DEWA 4MNEA 4IAKA 4W8EA 2OG8A 4F7NA 2BZKB 3L8VA 3MY5A 3EQFA 3UO4A 1PXKA 4ENXA 4A7CA 5AUVA 4RLLA 5KHXA 5IQCA 5E92A 4H3PA 3HZTA 4EHEA 2C6LA 2ERZE 1J7LA 3AKJA 2A2AA 3D4QA 4YJOA 2C0OA 5EYDA 2GS7A 3PA3A 3QRTA 4RX5A 2C5YA 3MV5A 1CDKA 4NWMA 4U80A 3KMWA 3JS2A 2Z7LA 5HCZA 4OAUC 5HHWA 3BV3A 4BF2A 3CEKA 3R7VA 5DGZA 3D9VA 3DJ7A 4W4VA 3OS3A 4ZSJA 5IQBA 2P2HA 5HI2A 4R8QA 3EOCA 4ZSGA 3FZ1A 4M66A 1JVPP 5GIPE 2QR7A 2V0DA 3C4CA 5BYLA 1OIYA 3F3TA 4CFVA 4LV8A 4ZOGA 4YLKA 3SD0A 4JIKA 2FVDA 4OBPA 2ZM1A 1FINA 2HAKA 3GC7A 3MTLA 4K77A 3KCFA 5AP6A 2WTJA 4ACGA 4EJNA 4ZLZA 3GU5A 4PPCA 1M7QA 3QQUA 4IVDA 4P90A 2OXDA 2W99B 4ZY4A 3FMKA 4U97A 4IZ5A 4JOAA 3TG1A 4QMMA 3OUNB 4IZYA 3UNJA 3VBVA 4BDIA 2GSFA 3KL8A 3NW6A 2XNNA 2OJGA 1IA8A 1YHSA 3QCQA 3UYSA 4A4XA 4FKRA 4KABA 3UE4A 2X2LA 3V6RA 3TNHA 3LM5A 3NYNA 4Q2AA 4YJUA 3PZHA 2F2CB 4GIHA 4ANBA 5CANA 3JUHA 5CT0A 4RIWB 4CG8A 5TF9A 2VWWA 4X6QC 2CLXA 3Q9ZA 3PVBA 4IX6A 5CY3A 3S4QA 1T45A 3UDBA 4BCKA 4FGRA 1P2AA 1H27A 4J8MA 2UVYA 3NUAA 4P7EA 4EHVA 3QUDA 4FI1A 4LRMA 3WILA 3GT8A 5C1QB 5DRBA 4YZBA 3EMGA 3EN7A 4P2KA 3AGMA 5GINE 1ERKA 4E6DA 4NUSA 3GVUA 2W1EA 4IXPA 1TZDA 4QMXA 4YJPA 3PXRA 2PVFA 4O7ZA 4O81A 5K5XA 5LCJA 2UUEA 3NUXA 3PWYA 1G5SA 4M7IA 4G3EA 5BQ0A 5HU9A 5AP3A 4QT1A 3HAVA 1PY5A 1GJOA 4GEOA 3W0SA 1PYEA 2JAVA 1SZMA 3MIAA 4O4DA 5IU2A 3QZIA 2JFLA 1Q97A 2FSOX 3TWJA 5FP6A 4ZJVA 2FYSA 5JGBA 3ZC5A 3MVLA 5EHOA 3CGFA 3JR1A 2JLDA 3EZVA 4FIFA 3V8TA 2WIHA 3DK3A 4FTQA 2YIXA 1MQBA 3TKHA 2WOUA 3NWWA 4BBMA 3P4KA 3QGWA 4J98A 4KRDA 2ITQA 4LFIA 4WRSA 3EFJA 2X8IA 3RHXA 2OI4X 1KE8A 5L6OA 3BHYA 4WBOA 4D55A 5HE3A 3G6HA 1SYKA 3E8DA 4XV3A 3UC4A 2RL5A 3ATTA 4MD8E 4XP3A 2IVUA 3RKBA 2QOFA 3IW6A 4S2ZA 4RIOA 2B54A 4D2PA 4DFYA 4FZ6A 3HV7A 5CVGA 3W2QA 3PTGA 5JQ8A 2OSCA 5IA4A 2WXVA 3PUPA 3MN3A 4UMUA 2PZYA 2VWUA 3B8RA 4BICA 3Q96A 4F0GA 2XBJA 3GCUA 1J7IA 5CXHA 1XH9A 2VGPA 4FT3A 3PE1A 4HCVA 2CNUA 3PPZA 4ORKA 4EI4A 5AJQA 5L6PA 5L2TA 3BLRA 2C30A 5FTQA 5BVFA 4FSQA 5BVDA 4IVBA 4BB4A 5BYYA 2NYAA 1PXPA 3DBDA 4G1WA 3R1SA 3CQEA 4YTHA 2QU5A 4PP9A 5LJJA 4QP6A 1Q8WA 2XNMA 2NRUA 3GU8A 4NM5A 2WQBA 4L7FA 5FXQA 3W2SA 5HLNA 5HGIA 3MH2A 4FV2A 2OKRA 3UZTA 5TE0A 4Z3VA 3G9LX 4MK0A 3O17A 2WOTA 4R3CA 3R8VA 4R77A 2O65A 4ZTNA 3RPYA 4CFFA 3F2NA 1A06A 3BX5A 3EQCA 3PA4A 4JLCA 4U42A 5CAUA 5GIOE 4RWIA 4Y5QA 1SNXA 4DEIA 3OF0A 1URCA 4MUQA 2G01A 2W17A 4FA2A 4DBXA 2C5XA 1E9HA 1ZOHA 3TV6A 3UOLA 3ZFYA 3O8TA 5BMSA 2JEDA 1YKRA 3O51A 4PNKA 2VNYA 3LAUA 5CTPA 5E9EA 3SLSA 3B8QA 3FMHA 5AM6A 2QQ7A 1PMUA 4D2WA 4I1ZA 4TPTA 3U55A 3TTIA 3SW7A 4IDVA 3AC3A 5E8VA 4HYIA 2AQXA 3UZPA 3KQ7A 4QMVA 5AV0A 3RCJA 4ASDA 4ZSAA 3KCKA 3R71A 3LFFA 4AW5A 4FSRA 5M57A 5D41A 2B9HA 2JD5A 4D2SA 1ST0A 4MQ2A 2QLQA 3Q4CA 4UWYA 3S3IA 5I9UA 2RFEA 1J91A 2XNGA 5IQAA 2UZWE 3QTSA 4N6ZA 5ETAA 4FT9A 5AR8A 3KRJA 4NCTC 1TKIA 4IJ9A 5HVYA 3EQBA 4YJVA 1PF8A 4HVHA