4PMMA

The structure of trka kinase bound to the inhibitor n-(3-cyclopropyl-1-phenyl-1h-pyrazol-5-yl)-2-{4-[3-methoxy-4-(4-methyl-1h-imidazol-1-yl)phenyl]-1h-1,2,3-triazol-1-yl}acetamide
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
291
structure length
285
Chain Sequence
CVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLDKMLVAVKALKESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords High affinity nerve growth factor receptor
publication title Maximizing diversity from a kinase screen: identification of novel and selective pan-Trk inhibitors for chronic pain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 94
structure length 285
sequence length 291
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4pmmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pmmA01
2OBJA 2R5TA 2G2FA 4JIKA 4IFGA 5CEPA 2PMLX 1PKDA 4KB8A 3Q04A 1P2AA 2I40A 3C4CA 4FEQA 4X3FB 4LOQA 5DEWA 3UIUA 2E9UA 4QYYA 3ORMA 4V0GA 4C4GA 4DFNA 1OL2A 2XCKA 4QQCA 4TYGA 3R6XA 4U42A 5IH5A 4XV2A 1HCKA 3CTQA 3L8XA 1L3RE 5HOAA 3W16A 5I3RA 1OL5A 2JIUA 3RAHA 2C0OA 4F1TA 4FG9A 5IF1A 5K9IA 2F9GA 4BCHA 2HXLA 4QT1A 4RJ8A 4AF3A 1Q4LA 4HCVA 1IAJA 3R02A 2C3IB 3GOKA 4LUEA 4WG5A 4ZLOA 3GUBA 3WE8A 4ZZNA 2J6MA 4S34A 4MH7A 3R1YA 3FY0A 5CAUA 2GQRA 4BIBA 2FUMA 5CF8A 5EM6A 2WMQA 3GVUA 1H1WA 3DJ7A 3TUDA 3Q2MA 3G6HA 4KS7A 3QA8A 4CFXA 2XIXA 3TUBA 4E6CA 5BVDA 4L3PA 4BKJA 3NUPA 4GH2A 3TN8A 3EFJA 3THBA 1BUHA 4BDGA 4BGHA 5IU2A 4KBAA 2R3FA 3R04A 4F7SA 2YABA 1W84A 4KNBA 4UEUA 4EH4A 3ZXTA 3O23A 4WRGA 4JAIA 4MQ2A 2AYPA 3LXPA 3KQ7A 4R1VA 1XWSA 2YJRA 4I24A 5L2SA 3QTWA 2PVNA 3NW5A 1Q8YA 4FA2A 1XH7A 4YJOA 4YJRA 5C03A 3KGAA 3TKHA 1S9IA 5IPJA 3V01A 1YXXA 5HBHA 1JSUA 4NEUA 3FZPA 4DH5A 1CSNA 4EH8A 4K0YA 1F0QA 4OAVB 4FG8A 3ZSGA 5DA3A 5IQAA 3C5UA 4F0FA 4FV2A 4E5WA 4LL5A 3HV7A 4U45A 2HCKA 1VYWA 3MB6A 5H2UA 2XNNA 3R22A 4TYHB 4YZNA 4F0GA 3UO6A 4O1OA 1Y6AA 4TTHB 2QOFA 4I1ZA 4MNEB 2C6EA 3S1HA 5I9XA 1FGIA 5M56A 2B54A 4J53A 5CNOA 4A9UA 2QNJA 2B53A 4BDHA 4FGRA 4XG6A 2A19B 4I21A 4K1BA 3LXKA 1KUTA 2OSCA 5E8SA 5KCVA 3C5IA 1XBAA 4GG5A 5E8UA 3CQEA 5I3OA 1YRPA 3OWJA 3ZC5A 4FIIA 2JD5A 4IX4A 4RIXB 3IKAA 3EKNA 4XYFA 3ODZX 4J7BA 2OFUA 2X8DA 3SAYA 2G15A 3E8EA 1G8SA 3AT2A 3HV6A 1YWVA 3TCPA 2XJ2A 5IUGA 3CY3A 4CEGA 3E8DA 4ASZA 4IH8A 3SD0A 3ZUTA 1ZWSA 3BV3A 2G2HA 5DT0A 1NXKA 2CMWA 4BDKA 3EKKA 5F94A 4DEIA 2ITTA 2X2MA 4G3EA 5CF4A 3WOWA 4CZTA 3HLLA 1YDRE 2EWAA 4X6QC 5CEKA 4FEUA 2VTHA 3MVLA 3OC1A 3PWYA 5I9UA 5L4QA 3R8VA 2UZVA 3PE2A 4CFVA 5CU2A 4F63A 5J1WA 2YFXA 3UE4A 4FV7A 4QP7A 4DH7A 2REIA 2Y4PA 4EK6A 4YZ9A 5A4TA 4C38A 4CSVA 5FTQA 3VBWA 4BIDA 4QTDA 3QQJA 3RP9A 3BQRA 3QRKA 4OUCA 4ITHA 2R3RA 3KXMA 4DHFA 2W9ZB 5HICA 4DN5A 1UVRA 5AUYA 4KBKA 1GZOA 4XJ0A 2W1ZA 3A8XA 1KE7A 2OJ9A 3F82A 5E92A 3HMOA 1W7HA 3RAIA 1O9UA 2E9OA 4FYOA 4IWDA 4P5QA 3PY3A 4CKIA 4Q2AA 1VYZA 4S32A 5HGIA 3F3VA 4DLJA 2BROA 2YN8A 4IB3A 3ZM4A 4M84A 4J96A 2EB2A 4FTNA 5M57A 4ZLZA 4CMUA 5AAFA 5AP2A 4QTBA 2ZB1A 2ITVA 4AWIA 4EOPA 4BGGA 5IQCA 2YDKA 4Y95A 2VTAA 5M09A 3ORLA 4V04A 4WG3A 3WF8A 2FVDA 2PE0A 3TM0A 3MH0A 3MFSA 4MD7E 5T3QA 2JBOA 3RGFA 5FXSA 5ANIA 4NKAA 5AV4A 3D83A 4GEOA 2VTSA 3Q6UA 2ZB0A 3H0YA 2RFDA 4UWCA 3CIKA 3R00A 2O5KA 3MGYA 4FYNA 2QODA 2WD1A 4LI5A 4RWKA 4FKQA 4O0UA 3W2SA 3HVCA 3DTCA 3EYGA 3B8QA 3LJ0A 5CT7A 1PMVA 4RVKA 4PPAA 3I6UA 4O84A 4JDIA 3A8WA 4YBJA 4O7RA 2PZ5A 4WNPA 4X7QA 5A46A 1XBCA 3QD4A 4B99A 2IZRA 5JGDA 2Z7SA 3NS9A 1JLUE 3RPSA 4CYJA 2BRBA 3U4WA 1A48A 3ZRMA 3LCKA 5T6KA 4D9UA 2CKEA 3TT0A 4IJ9A 4I5PA 3GC7A 2VGOA 1OKZA 3HKOA 5C9CA 5JN2A 1OKYA 4FT0A 3R9HA 4Y85A 1VJYA 1OBGA 1OPJA 5IH6A 2WMAA 3FWQA 3OCTA 1UKIA 4X2KA 4L8MA 2FO0A 2OW3A 2W4JA 2YAKA 5FUTA 3ZHPC 1R39A 3D5WA 3DJ5A 3FKNA 3FZ1A 1XH8A 2J4ZA 4FOBA 4AP7A 4EZ7A 5IMEA 4PY1A 4EYMA 3T3UA 4G17A 1U4DA 1FINA 2Z60A 4YLJA 5EDQA 4EQMA 1OB3A 3IW5A 4OBOA 3LCTA 2X1NA 4BKZA 3GNIB 3HRCA 4M69A 4PTCA 1RJBA 5L8LA 2I1MA 4JBVA 2OLCA 5FRIA 3I4BA 4P5ZA 4FTTA 3QWJA 3DB6A 1YHWA 5KBRA 5B2LA 2C6KA 4Y5QA 5IEYA 2HELA 1PYEA 3LMHA 3IO7A 3A60A 4CCUA 4M66A 4RLKA 2ZV9A 2B9JA 5EG3A 2WU7A 2EUFB 4GV1A 3CP9A 3MH2A 1H0WA 2C69A 3QRJA 4YO6A 3P1AA 4AAAA 2WTCA 3OY3A 2VD5A 3NRMA 1OGUA 4C4FA 1ZYCA 5BVWA 4UZHA 2PZYA 4MXYA 4WUAA 3V5QA 1YWRA 3ZFXA 4D2PA 3IGGA 1LPUA 2O2UA 3GQIA 4O2PA 5LVOA 4Q9SA 4U79A 2R2PA 4F7NA 3NCGA 3IDCA 2HWOA 3W2OA 5HE1A 3CCNA 4Y8DA 1GZ8A 4RJ3A 4FODA 4EK3A 5CAOA 3DFCB 4ERWA 3VULA 4FV1A 5GNKA 5HCZA 3GCPA 5HNBA 2XRWA 4EWQA 3Q9XA 3ZOSA 5LVMA 3MFRA 4M15A 1OITA 3R21A 3PDTA 3MB7A 2YM3A 3W1FA 3PYYA 5C1QB 4OR5A 4KA3A 1I44A 2RL5A 3QHRA 4FEVA 3F9NA 5L6WL 5K5NA 3FI8A 1LR4A 4EORA 2WMTA 4F6SA 2Y6OA 3FZRA 3C1XA 3WYXA 4M97A 5KBQA 4L43A 5K0KA 3U87A 2WQNA 4U8ZA 3T9IA 4AA4A 3R8LA 4JQ7A 1W82A 4BWKA 4YTCA 4FKGA 3BRBA 4APPA 2BKZA 3F2AA 3LQ8A 4LYNA 5JGBA 3SGCA 4KRCA 2BKKA 3DOGA 3PVBA 3QZGA 4W4VA 4QPMA 2QHMA 2A27A 4D0XA 3I5NA 2I0VA 3VS2A 1ZZLA 1Y91A 3GCUA 2XMYA 4O21A 4DCAA 3GU4A 3DXPA 4LL0A 3NUAA 3HRBA 4RIOA 4UALA 3FI3A 4FUXA 4O7NA 3E3BX 3GENA 2OG8A 1F5QA 4UYAA 4RIWA 4XX9A 1OBDA 5KMLA 2Q83A 3NUNA 3ORIA 4GS6A 4QP4A 1BYGA 3P86A 1WVXA 3TZMA 2GHMA 3U4UA 4UBAA 1O6YA 1DI8A 2NPQA 4NTSA 2UVZA 2OIQA 4ITJA 5D7VA 2CN5A 4OTDA 2ITUA 2W4KA 3ZUUA 5E8YA 2CNUA 4QMTA 2YJSA 3ZLXA 4RT7A 4FSYA 5ETAA 1H4LA 3FJQE 3PPZA 3A61A 3FLSA 3FMJA 3ZUVA 5AADA 3BU3A 3DFAA 3CKXA 4IJPA 2HY0A 4FTUA 4FKIA 3MY5A 4BCIA 1V0OA 4WHZA 4ZTNA 3HV3A 5HTBA 2YIRA 2WQMA 4FKLA 4M0YA 3FMMA 2WTWA 4YZCA 3BKBA 1XBBA 3Q4CA 1KV1A 2XKDA 2JDVA 1IRKA 4EJNA 1Q5KA 4IZ5A 4XG4A 3ATSA 3EN5A 3RPVA 4U40A 4BYJA 4BGQA 4CZYB 3QX2A 1J7IA 3R7UA 5I9YA 5LVNA 4GVJA 3TV4A 3L9NA 2PE2A 4EHVA 2XS0A 2VX0A 1YHSA 2ZM3A 4UWYA 1Y8GA 1YXTA 4J1RA 2FSOX 1R0EA 2QKWB 5AUXA 3OTVA 3FC2A 1M52A 3CJFA 2X9EA 3V51A 3FPQA 3WIGA 4L3JA 4JG6A 2VTLA 1XJDA 3PSBA 4UMTA 1U46A 1PF8A 5H8EA 3UOHA 2JDRA 2HOGA 4CV8A 3IW6A 4GYGA 3OOMA 3POOA 3OFMA 5M4UA 4RVMA 3L8PA 4EUTA 3LFAA 5K5XA 3FE3A 1Q62A 3FYJX 2XIYA 4N6YA 2VWBA 5HNIX 2J0IA 2VV9A 1JNKA 4FKPA 4ZY6A 3WE4A 4Z3VA 2UZWE 5JFWA 1ND4A 4AGDA 3LFEA 2QD9A 3P4KA 4KKEA 3C13A 3RBWA 2PVLA 2WTVA 5HIEA 5EDPA 4YUQA 1UNGA 3ZRKA 3C7QA 3REPA 3NYXA 3KXZA 5DEYA 3UQCA 4S2ZA 2H6DA 4PMPA 3KA0A 4K2RA 3QCSA 1YQJA 4ARKA 3HZTA 4MTAA 2C6TA 3WF6A 4KAOA 3DY7A 4W4YA 3NAYA 4NIFB 4EH2A 2YDIA 4B0GA 4RGJA 5HVYA 3ZC6A 4A06A 2WTKC 3W2QA 1E9HA 3D14A 3UMXA 3VUKA 4F9WA 4FV6A 2JIVA 4F64A 4IVCA 2PZRA 4RX7A 2OJFE 3LFSA 4ZEGA 2ZAZA 1WBOA 5L2WA 4DINA 3R2BA 5C4KA 4KD1A 4O7LA 3P5KA 5HG9A 3ANQA 5HX8A 5IA2A 3Q96A 2PVRA 3II5A 4FT3A 4O91A 3D0EA 2OF4A 3DBEA 4AOIA 2BDJA 5FXQA 3LFNA 4O0WA 5J87A 1KE8A 3ET7A 4GRBA 4QMPA 5HO8A 4QMSA 3R30A 3EJ1A 4WNKA 2QOOA 3KVXA 3UVQA 4ZZMA 3O7LB 5C8NA 2WNTA 3MTFA 4IWOA 4NFMA 4D28A 2CN8A 2PL0A 3E62A 5CZHA 3O2MA 2GNLA 4S31A 4BZOA 1UNLA 4MXOA 3U9NA 5J7BA 1IASA 1JSVA 3PY1A 2W1IA 4PNKA 4CCBA 4JDJA 3VF8A 2KTYA 4DFZE 5IA4A 5HU3A 5LMKA 5IUHA 3EQFA 3GP0A 5K0XA 2C5YA 4G16A 2P0CA 4IWPA 3AGMA 3FAAA 4U5JA 5IKWA 3DZQA 1QPDA 1OKVA 4AGWA 3GCSA 4TT7A 4ANMA 4CV9A 5KMOA 1JWHA 2GPHA 4CKRA 1OIYA 2UV2A 5HLNA 3CTHA 3TEIA 3SXRA 4BICA 4ZS0A 4NUSA 4B6LA 2G2IA 4F0IA 5AJQA 4V0GB 4OTHA 4MF0A 1H08A 4USDA 4B8LA 4JJRA 4FMQA 3PXZA 4RJ7A 2CCIA 2CPKE 4MVFA 4EWHA 5GZ8A 3QQUA 2C3KA 3V8SA 5LVPA 3HMNA 4IE9A 4O82A 5BNJA 3HGKA 2VN9A 4M68A 3R9DA 2V7AA 5JFXA 2JC6A 1ZYSA 2CSNA 4MX9A 3DAJA 5DGZA 3Q3BA 3CTJA 3BQCA 4CRLA 1YHVA 3HEGA 5ANJA 4K9YA 4WA9A 2BRMA 2A1AB 3WI6A 4WD5A 2J5FA 4OLIA 2BVAA 4LG4A 2F7EE 4AW0A 3OW3A 1LEZA 2CJMA 2HZIA 4CG8A 2RGPA 5EYCA 3LIJA 3DK6A 2BHHA 1SVHA 4IDVA 2WIPA 3KVWA 1JKLA 4IHPA 4GIIA 5DR2A 5IG1A 1JPAA 5J79A 2WMBA 1IG1A 4ANNA 1FVVA 1WZYA 5TT7A 4NFNA 2VTQA 3TJDA 2YAAA 4K11A 3H3CA 4CGAA 4M3QA 4ACCA 3GC0A 3DBQA 5DHJA 3V3VA 3NCZA 3BE9A 3ENMA 4EH5A 3H0ZA 4C36A 4I94A 4MD8E 4FOCA 4BCKA 4O38A 4J97A 3DNDA 3EL7A 3D2IA 3MH3A 4NU1A 4FZ7A 5DPVA 2XEZA 3SW7A 2WIHA 3NIZA 4I0RA 5KZIA 3QZFA 1ZMUA 2VX3A 2OH4A 5DG5A 4FL1A 4LQMA 2ZYBA 4BCGA 5E8VA 4G3CA 2V55A 4PRJA 1M17A 4YZMA 4IZ7A 4U6RA 1GOLA 5HG5A 5BX0A 5IH4A 1UWHA 1I09A 4IANA 5CALA 5FWKK 5AUZA 1SNXA 3PLAE 4CMOA 5BVEA 2IVVA 5AV2A 5DI1A 4R7HA 3D5XA 3MW1A 1JKSA 3CPCA 4RRVA 3R83A 4DA5A 3MSSA 3UG2A 5CU4A 4B4LA 2RFSA 4XLVA 3FHIA 1K2PA 3IS5A 4DFYA 4FUYA 2DYLA 4RFYA 3PIXA 4GVAA 3KF4A 3NEWA 2X8EA 4I3ZA 2RFEA 1IA8A 4ZSAA 3PZEA 3TL8A 5J1VA 5BQ0A 3D15A 4RJ5A 3SVVA 3R7YA 4ZY4A 3FL5A 2B9IA 4XBUA 1KOAA 4I20A 3ZBXA 5FXRA 4R3RA 1OL7A 3VBTA 4NW5A 5DN3A 3R1NA 3A7HA 4O27B 3KREA 4CMTA 3ZLWA 5HHWA 3PP1A 4TWNA 2KULA 3FV8A 4YZBA 4O81A 3UQGA 5AUWA 2PVMA 3VS1A 3PXFA 4DGMA 4FTKA 4O0RA 1QMZA 5AR5A 2R7IA 2PUPA 2JDTA 2WAJA 5IZFA 4DTBA 4ORKA 4TYJA 2XK3A 4RPVA 5E9EA 2W4OA 4IEBA 4PPBA 2XIZA 3UO4A 3HUCA 1Q8UA 4IM0A 2C5NA 3GC8A 3QQFA 3JR1A 4OTFA 1U5QA 2BZIB 1W0XC 3KN5A 2QG7A 2ONLA 3ZH8A 5EM8A 4FEXA 5M06A 3LOKA 2PMNX 3IGOA 2P2IA 3OUKA 4PTEA 4FTJA 2BHEA 3T8OA 5H3QA 3TNHA 4XS2A 4E73A 4F1MA 2FA2A 5I0BA 4N6ZA 4ZLYA 3BGQA 4IADA 2GNHA 3LM5A 3ZZWA 4O7WA 3SG8A 4TL0A 5JQ5A 4JDKA 3DLSA 3QAME 1BL6A 3QC9A 4HYSA 2RG6A 4IAIA 4L01A 2BALA 2JKMA 5ANOA 3Q4ZA 4DE4A 4CKJA 2WMUA 3OVVA 5BPYA 4FZAB 2O8YA 4I0TA 4BTFA 2UUEA 4IWQA 5AUUA 4L46A 3KCFA 3R7IA 2HZ4A 3V5WA 1KSWA 3VC4A 3C0HA 2G1TA 1OM1A 5CQUA 5JKGA 3C50A 4D55A 1PMEA 1H1SA 3AGLA 3FQEA 4QO9A 3QKMA 3LAUA 3WF7A 5ETCA 5LCJA 1KOBA 2VTOA 3D7ZA 4WBOA 4CT1A 1IA9A 5HE2A 3QX4A 3A2CA 3W2PA 5HKMA 4IVAA 3PJ1A 4XP2A 4ENXA 3KK8A 2UZUE 4GT3A 4AX8A 2Z7LA 5LVLA 3BYUA 2PTKA 3G9NA 3WIKA 4FV4A 3EH9A 5L3AA 1GIJA 3LLAA 4JS8A 4C3FA 3H4JA 2CGXA 2J7TA 4KWPA 3PG3A 3S2PA 3UP7A 3CLYA 3F5UA 3LZBA 4RC4A 3TKIA 2QONA 2ZDTA 2QOBA 3IG7A 4BDDA 4OAUC 3TACA 3O8TA 3FEGA 4I4EA 5CSWA 3DLZA 2B9HA 2XJ1A 3LQ5A 4JRNA 3TUCA 4E26A 3QA0A 2R7BA 4JG7A 4XG2A 5FD2A 3UPZA 3O17A 3OS3A 5FEEA 4L45A 1GIHA 4A9SA 2YWVA 1PY5A 3DPKA 2WB8A 3F5PA 3D94A 1R3CA 5IEVA 4GFMA 4RWLA 3PVUA 2UW8A 3KRXA 2F2CB 3Q9ZA 5AR2A 2PY3A 2VTIA 4BN1A 3VVHA 4BBEA 4E7WA 5HO7A 3ORZA 2E2BA 4FIHA 3N4VA 3O50A 4HVIA 4CYIA 5HVKA 4HCUA 4AT5A 2J9MA 3FL4A 3OBJA 4MXXA 3VF9A 3QZHA 4D1SA 5HTIA 3W2RA 1SVEA 5IQIA 4JX3A 4LGDA 3WBLA 3FQSA 1YI4A 3OD6X 5HNGA 4EL9A 2OO8X 4FC0A 2W5BA 3ULIA 3ZTXA 2AC5A 4C4HA 2QU6A 2O3PA 3LVPA 3BELA 3MVJA 3S3IA 5I5ZA 1O6KA 3QFVA 4MYGA 4CQGA 4A9TA 4FVRA 4E4MA 4NH1A 4FSRA 3RPYA 4ENYA 2E9NA 3HMPA 2J90A 2EVAA 3RZBA 4DFBA 1PRYA 4U3ZA 4W8EA 3L1SA 3CS9A 5GJFA 1TQMA 1REJA 3Q9YA 3OWLA 4GK2A 4JX7A 3BWFA 5CEQA 5H9BA 1WBWA 3EFLA 5GZAA 4F9CA 5DYJA 3NUUA 5HBEA 4RJ4A 4WT6A 5ACKA 4EOMA 4MCVA 4FIJA 3EZVA 4H3PA 4XV3A 2VUWA 5EQYA 2VTPA 5HD7A 1GNGA 4G6LA 1XH5A 3COIA 3UMWA 4YSJA 2B4SB 4FV0A 1PXJA 3GGFA 4R5YA 1BMKA 3GI3A 4FKSA 4ASDA 1K9AA 3OT3A 3ZEWA 3ODYX 5F20A 3NNWA 5F4NA 5TE0A 5AFVA 4I92A 4U3YA 3BYOA 2ITXA 4AE9A 4ZTSA 2F57A 1PW2A 4U0IA 2W1FA 3NNUA 5B2KA 4QQ5A 4IB1A 3W8QA 3AOXA 3MY0A 4GK3A 4YZDA 3GBZA 1JKTA 4MXAA 4QMXA 5GJGA 4BDFA 3S00A 5HE3A 4DAWA 3PJCA 1XQZA 3DT1A 1RE8A 2YERA 4USEA 5KZ0A 3QTZA 3JY0A 4L00A 4WKQA 3VWAA 2V0DA 3AT3A 1Z9XA 1FVTA 3NMUF 4FX3A 4X2FA 5A3XA 2J0JA 1XH4A 4CFUA 3L9MA 2XZSA 4EHEA 2J5EA 4EBVA 3PLSA 4UXQA 4OTWA 4A4LA 1YKRA 4KSPA 4CNHA 2YEXA 1U54A 3KY2A 1OL6A 3M1SA 4FBXA 4O96A 5EHLA 4EZ3A 2Z02A 2B52A 3OG7A 2XNBA 3VBVA 2C6IA 3AC5A 1H0VA 1PXKA 3LHJA 4QMQA 5DMZA 3TTJA 3MA6A 2VWUA 2ITPA 3ZM9A 4X3FC 4J99A 5HG7A 4RMZA 4YPSA 4XRJA 4QNAA 4HGEA 3U51A 2P2HA 3GFEA 4EHZA 3P7BA 4TRLA 3KEXA 4E5BA 4FNYA 3FMNA 5M4IA 3W32A 4ZS4A 3HX4A 3G2FA 3DZOA 4PP9A 4FT7A 2OIDA 4P4CA 4TN6A 2GTMA 3BYMA 3BV2A 4C4EA 3CGOA 4Z7HA 2OU7A 2PE1A 3EN6A 4KIPA 3EQRA 5CVFA 1EH4A 1XR1A 3LM0A 4ZP5A 5E8WA 1U59A 4ANQA 4IZAA 4JL9A 2CLQA 5EFQA 3DTWA 4NM0A 1DS5A 1NW1A 3NVMB 3RCDA 4DGNA 5CYIA 2CNQA 4ACMA 3BGPA 4PDYA 1CKIA 4PUZA 3DKCA 3O8UA 1IAHA 3QTIA 5CVGA 2VWZA 1ATPE 3MBLA 3FLZA 4YURA 4C8BA 3KC3A 3C51A 3GU6A 3DBFA 3L8VA 4TPTA 3E8NA 3LFCA 3FMEA 4BWPA 2JEDA 4PL3A 3RKBA 2VWVA 4LRJA 1YXUA 2JFLA 2CKOA 3E5AA 3UVPA 3R0TA 2Y0AA 1WVWA 4QMNA 1CM8A 4CFMA 4IC8A 2HYYA 3RVGA 4DH1A 3QTRA 1CKJA 5KMIA 4H58A 2QOKA 3KL8A 4O0TA 4JG8A 1OI9A 2OH0E 2PMIA 3FMHA 1B38A 5EM7A 2XM9A 4DC2A 3VUDA 2EXMA 2DUVA 4QTEA 4M12A 4Q5HA 4M14A 1TQPA 3R1QA 1M7QA 5IDNA 3U54A 5GIPE 2GSFA 5E1SA 5DT4A 2QLUA 3ORXA 5CU6A 3G33A 4ZJIA 3D7TA 4FTCA 5IUIA 4O2ZA 4A9RA 4B9DA 3UVRA 5K3YA 4L44A 3IPHA 2VU3A 4E5AX 2GU8A 5A4QA 4AE6A 2JAMA 1FMOE 1NY3A 4EH3A 3ZO1A 3QQLA 4WNOA 2XUUA 1GAGA 3UIMA 5AR7A 4GKIA 2XIRA 3R73A 3FHRA 3A7GA 3KRLA 2W05A 3KKVA 4KABA 5CU0A 1CTPE 5AM6A 1WBTA 3MPMA 4H39A 4NTTA 3DQXA 4YJVA 2YA9A 4F1OA 4LGHA 3VS4A 1TVOA 5D11A 2ITQA 5IA0A 3CGFA 4RVTA 5CEIA 3I6WA 4AGUA 5IQEA 3BI6A 4H1MA 4PF4A 4XRLA 2C6MA 5EDRA 3GU8A 4GL9A 5FEDA 2QO2A 4QYHA 2JITA 3FXZA 4ITIA 4LOOA 4TYEA 4YJQA 5AWMA 5H8GA 3VUTA 4EBWA 5HBJA 4I6BA 3PA3A 4FL3A 4AOJA 3CEKA 3L8SA 5K4IA 4GU9A 3MFTA 4UV0A 3RAWA 5CXHA 3LCDA 3EN7A 4QRCA 2X4ZA 3VS6A 3UP2A 4RX8A 4K33A 3TDWA 2BRNA 2EB3A 3DAEA 3KXHA 4I93A 4OBPA 4G31A 4ALUA 4AZFA 5CQWA 4H3BA 4ACHA 4IBMA 5CZIA 2YCQA 3OT8A 5TF9A 4C4JA 3QYWA 4QPAA 3UGCA 5CSHA 1FQ1B 3KCKA 5EOLA 4NSTA 4GJ2A 1R78A 3RWQA 5KUPA 2PHKA 4TZRA 3DU8A 3EFWA 4FGBA 4C02A 2WTDA 4ZIMA 5CSXA 4EOIA 2WMRA 2ZJWA 3OZ6A 5GHVA 2Y4IB 3A7IA 4M8TA 2CGUA 2GDOA 3KK9A 3TDVA 2QOLA 2OXDA 4PQNA 1V0BA 1FOTA 4G3GA 1Y8YA 1UU3A 2R3OA 3IDPA 1H28A 5BYZA 3ZLSA 3I60A 5M53A 4EOSA 2BFXA 4RQVA 5G6VA 3UBDA 3G6GA 3I81A 4KIOA 5DFPA 1PJKA 1ZOGA 4G6NA 4KUJA 2IZTA 3BBWA 4O0YA 4D9TA 5HG8A 5JFVA 3EQIA 3GOPA 2QOHA 2ETMA 3V5LA 1YXSA 3GT8A 5L2IA 1ZYJA 5M55A 2VTMA 4G2FA 4EONA 4R3PA 3PSCA 4R8QA 5AP0A 4CTBA 4YO4A 2R3QA 4FK3A 2PVHA 4J95A 3LJ2A 3U6JA 1WAKA 1ZYLA 1BI8A 4NJ3A 4GG7A 4FTMA 4GUEA 2YLFA 1DAWA 4DFXE 1WBNA 4RIXA 5AR3A 3OEZA 4ONAA 2RKUA 2W9FB 1MQ4A 3FSKA 5HESA 4FV8A 4M13A 4BCFA 4HVHA 4WBBB 2XP2A 1H00A 2CHLA 3P7AA 1F3MC 4FICA 4FKVA 4G3FA 2BTRA 4R3CA 4TNBA 4BL1A 5LXMA 1YW2A 2BIYA 4YC6A 2VO6A 4LRMA 1OIQA 3UQFA 4IAZA 5A6OA 3U6HA 4CG9A 5CU3A 2EU9A 2QO9A 3DA6A 3HMIA 3MJ2A 4KIKA 5EI2A 5CXZA 3NLBA 3NNXA 2I7QA 5JMSA 3L9PA 1GZKA 1ZLTA 4C3PA 3LMIA 3R7GA 4F6UA 2C6LA 3PWDA 3ZBFA 1Q99A 4UXLA 4DEHA 4AGCA 2YM4A 3ZZEA 4Y73A 3TXOA 1H1QA 4QMVA 2WFYA 3GEQA 1FPUA 1GIIA 3VJNA 3TIYA 4D4RA 3OHTA 3IW4A 3E3PA 4PDSA 3UDBA 5BVFA 3EMGA 4ANBA 3IQ7A 4AN2A 2X6DA 4G3DA 3MDYA 2YM5A 3DDQA 3U6IA 2OJIA 3FZOA 4FZ6A 4GFGA 3R8ZA 1QPCA 3P08A 2IJMA 3UOLA 4NYEA 3KFAA 5CF6A 2GNJA 3B2WA 4IDTA 5ANDA 3OWKA 4IC7A 3NUXA 4LM5A 2BAJA 3VBXA 3UG1A 3C0GA 4XUFA 4HW7A 4MWHA 2W06A 2CKPA 4IXPA 5L6OA 5TO8A 4OBQA 3R7EA 4IX6A 5HE0A 4IAAA 5ANKA 3ANRA 3AXWA 4O6EA 5A6NA 4LRKA 1E1VA 2UZLA 4F65A 4EOOA 1YOMA 4D5KA 3QGYA 4II5A 4GYIA 5I9VA 5JK3A 3C4XA 2XYUA 3CBLA 2VO7A 2XK6A 2BTSA 3FYKX 1KE6A 3HL7A 4LMUA 3FI4A 4DLIA 3OXIA 3FLNC 3UZTA 4E4NA 3TNIA 3P23A 4I5CA 4PP7A 4XMOA 4D1XA 2OJGA 2ZV7A 3CQUA 2Y4IC 2C5VA 5AA9A 4FTAA 3ZXZA 2XBJA 4XP3A 3RK7A 4JI9A 4NCTC 2YISA 3PPKA 5JZNA 4HVDA 1J1BA 4J98A 5GJDA 3F6XA 3CY2A 4PL4A 2VO0A 4HGTA 2QOQA 3ETAA 1HOWA 2XA4A 3RALA 3VUGA 1DI9A 1Y57A 4Y72A 5KNJA 4RIYB 3W55A 3TJCA 1XO2B 4PL5A 1H27A 1P4FA 4X2NA 3AT4A 4DITA 5ANGA 3TNPC 2IPXA 3FBVA 2VNYA 4ZTHA 1H24A 3P79A 4QP9A 4DEBA 5HORA 3I7BA 2GFCA 4FTOA 3D5VA 5IA3A 2XK7A 2R3PA 1E1XA 4V01A 2OZAA 3C4FA 4FV3A 3QCYA 5GIOE 2C1BA 2R0IA 3BLHA 4U9AA 4BVUA 4C59A 5IDPA 5KHWA 4ASXA 5IQDA 5EOBA 4O7VA 3W8LA 2V5QA 2FH9A 4XG9A 3F61A 3FPMA 5EYKA 1M2PA 3VUMA 4MHAA 3BZ3A 5AIRA 2ZOQA 3RMFA 2OZOA 2QC6A 2P33A 3RWPA 1MUOA 2GNIA 4ZTRA 1XHAA 5EM5A 1SYKA 3NZ0A 4E6AA 3D4QA 2WMVA 4V05A 2OJJA 5C26A 2XKCA 3VW8A 5D1JA 3VUHA 3E93A 3IDBA 5JT2A 4JBPA 2E9PA 4QQTA 4AFEA 3LE6A 3E64A 2QKRA 3E8CA 4QP6A 1CDKA 2IVTA 2G01A 2VGPA 3F2RA 4YGAA 4YMJA 4S33A 1OIUA 2PVFA 2BCJA 2YHVA 3CR0A 3PVGA 3BPRA 2PK9A 4DF3A 4GCJA 5TKDA 4CFFA 4FNWA 4YTIA 3QXOA 1PMNA 5E8TA 3ZO2A 2OIBA 1KV2A 2ESMA 2PVYA 3GQLA 4BDAA 3DXQA 2VNWA 2X8IA 3DK7A 3UOJA 5EH0A 3UNJA 4TWOA 3ZLYA 5LMBA 3U8WA 3PJ2A 4AG8A 4E8AA 4ZJJA 3LFQA 3M42A 4HZSA 2O65A 4HGSA 2H9VA 3VHKA 3LMGA 3I1AA 3NUSA 4QP3A 4D2TA 4EK8A 3QF9A 1J1CA 3BU6A 4K8AA 5B7VA 2HWPA 3GXLA 1ZZ2A 1M2RA 3L9LA 4MQ1A 3DGKA 2UZBA 4HNFA 3RAKA 3UPXA 4DGLC 1JBPE 4O7SA 4FSTA 1OPLA 3EQHA 4HJOA 4G5JA 4DEGA 2X0GA 2XB7A 5ACBC 3MESA 5D41A 2UZEA 3UC4A 4I22A 5BVNA 3PPJA 1XH6A 3TZ9A 1W98A 1G3NA 3IW8A 2QCSA 3MIAA 4XNEA 3V8TA 4DEAA 4IX3A 3QC4A 3PSDA 4AOTA 4E6DA 4C35A 4WG4A 3K3JA 4BDCA 1YOLA 2BUJA 5FBOA 4IQ6A 4RX9A 1YWNA 4WRSA 2DQ7X 4AZWA 4IAKA 5AV1A 2ONLC 5CX9A 5JEBA 5BYLA 3QTQA 3QKKA 5D7AA 4R77A 2VO3A 3QRIA 4AA0A 5AEPA 4J8MA 3LXNA 3AC3A 4C37A 2G9XA 3DK3A 3WZDA 3I5ZA 4Q9ZA 3MJ1A 3O51A 4FK6A 1UKHA 5J5SA 3PXYA 5E91A 3QYZA 1QL6A 2HZNA 2J0KA 4BI2A 2QU5A 3KXGA 1LUFA 4JBQA 4YTHA 3E92A 3GU7A 5BYYA 4O7YA 2WELA 3JVRA 3QHWA 4RLLA 5BVOA 5EYDA 2ITWA 2XK4A 2JKKA 2YCSA 3VBQA 3AC8A 4J52A 5DLSA 4M0ZA 1SVGA 5C8MA 2NO3A 4FVQA 2IVSA 4P7EA 3UOKA 3WILA 2PWLA 3EQGA 4FT5A 4G9RA 4WO5A 5A4LA 3G90X 5J7HA 3QD2B 1PMUA 1PKGA 2E9VA 3EB0A 2BILB 4F9YA 2P3GX 2UW3A 2WZJA 3F69A 3NUYA 4KSQA 2C0IA 1Q61A 2QOIA 2VZ6A 4O1PA 4L42A 1RDQE 2B0QA 3D9VA 1U54B 3R01A 3C4ZA 3KF7A 3S4QA 3V8WA 4BRXA 4DBNA 5C8KA 3GFWA 1A9UA 3SDJA 3V04A 2VTNA 1HCLA 1TQIA 4OW8A 4IB5A 5BMSA 5CASA 1APME 1KE9A 4EJ7A 3OY1A 2YIXA 1M14A 4IW0A 3F5XA 3K2LA 4RSSA 3LCSA 4TWCA 4WIHA 1LEWA 2UVYA 3MH1A 4CFWA 2WEVA 2WXVA 4QP2A 1GY3A 5E4HA 3ZO4A 3LW0A 3UTOA 4XLIA 5M4FA 4HVSA 5CWZA 3H30A 5CAPA 3ID6C 2EXEA 3G51A 3BHTA 4UB7A 3TZ7A 5I9WA 5FLFA 2BR1A 3TTIA 4HOKA 4O86A 1PXMA 3SKCA 3OWPA 4DT9A 5A54A 4YTFA 3UO5A 4O0VA 4FIFA 2WMSA 4JQEA 3CC6A 3ZYAA 4WUNA 5HIDA 3COKA 3OXZA 4MXZA 4D4VA 4U80A 3WYYA 4FSNA 3H9RA 5LMAA 2PULA 4FSUA 2W7XA 3MVHA 5AP1A 5A4EA 2QOCA 4HCTA 2GNFA 2HW7A 4CLIA 2CNVA 3IOPA 4HZRA 5LARA 2ZM1A 4YHTA 1UA2A 1SNUA 2RF9A 1JAMA 2YM7A 4F6WA 4RX5A 3G9LX 5KKRB 4FZFB 3RINA 2GS7A 3A7FA 1OPKA 2WTJA 4UYNA 4XG7A 4RWIA 1STCE 3R9NA 3SXFA 3W18A 3BGZA 1BI7A 4C7TA 1G5SA 3BHVA 4XG8A 3SA0A 3CE3A 4AFJA 4ZOGA 3QUEA 4DG0E 3VBYA 4X0MA 3KXXA 3O96A 4FSMA 1AD5A 3E63A 2Z8CA 3HECA 4QTCA 3R7OA 4R78A 3QQKA 3QRTA 5M4CA 2RFNA 4BHNA 2PSQA 4L68A 2BFYA 1W8CA 3JYAA 3FLYA 1BX6A 4XCUA 3RK9A 3OCGA 3E7OA 4NM3A 3UNZA 2HK5A 2X81A 5F95A 3QD3A 1YXVA 3RHXA 2V62A 3EQPA 2JIIA 4PX6A 4QMYA 1SMHA 4JOAA 4OTRA 5HLWA 3SRVA 2W5AA 4D5HA 5AR4A 4D0WA 2XIKA 4HGLA 2IZSA 3V6SA 3ZEPA 3GU5A 3VS7A 3ORKA 1M2QA 3AG9A 3ZSHA 2C6OA 3P0MA 2QHNA 3D7TB 2R3NA 2I6LA 3H9OA 3KMMA 4K6ZA 4NKSA 3AD6A 4X3JA 4KINA 4O6LA 2UW4A 4AT4A 3FMDA 3SHEA 4LV8A 3POZA 1K3AA 2LAVA 4BZDA 2IWIA 5IEXA 3QUPA 3MN3A 3QCXA 5LWMA 3HAMA 1MP8A 3BU5A 4JLCA 3TV7A 2GMXA 4ASEA 5AP6A 3R28A 5E1EA 3QU0A 4OTPA 3QTXA 2A4LA 4MWIA 5DRBA 5FEQA 5AP4A 5EKNA 4JR7A 3TWJA 4BKYA 4W9XA 4DH3A 3Q9WA 1AQ1A 2IZUA 4YLLA 3UJGA 4M69B 3EN4A 3HP5A 4FNZA 3UODA 2UW5A 4EH9A 2VRXA 3MWUA 3SOAA 4JBOA 2C4GA 2V22A 2C1AA 2Y9QA 4QNYA 5M51A 4H05A 4ZSLA 4ANOA 3IW7A 3OUNB 3PZHA 3Q60A 4GJ3A 5E90A 4I5MA 4AU8A 3WARA 4GFOA 3HA6A 3DDPA 4EYJA 3JS2A 3F3TA 2RG5A 1VR2A 2XM8A 2ERKA 3VO3A 5DIAA 3VUIA 1Q41A 2X4FA 5ANEA 4E3CA 5M07A 2X9FA 3RPRA 5F9EA 2BMCA 5ETIA 2WKMA 1SZMA 4FVPA 5FDXA 4BCNA 1AGWA 4PDPA 3PP0A 3FQHA 3PTGA 3JPVA 4MAOA 2XNPA 3HA8A 3F66A 5L2TA 4BR3A 4HYIA 4KS8A 2SRCA 3BHUA 3Q5IA 4OTQA 4LOPA 2ZMDA 3TIZA 2F4JA 4XBRA 2BZJA 4D2RA 5J5TA 3KULA 5D12A 4BBMA 3SLSA 1ZMVA 3A4OX 4F7LA 3VRZA 5FP5A 4EOKA 2Q0NA 2QO7A 5CAQA 4NM5A 2QR8A 3PRIA 2ITZA 4RFZA 5AX9A 4DH8A 3EQDA 5LCKA 5E7RA 4FKJA 1XH9A 5DT3A 3WZJA 5KMNA 3O0GA 2IW8A 2C30A 5I4NA 5KMJA 4E1ZA 4USFA 2OWBA 4TXCA 5KKRC 4G5PA 3HV4A 2YIQA 4RVLA 4PMMA 2AUHA 4KKGA 5F1ZA 4I41A 3Q52A 5FGKA 3K3IA 3ORNA 1S9JA 2CLXA 2YCRA 5AR8A 2W96B 4IB0A 2Y8OA 3C0IA 3ZO3A 2GHGA 3O7LD 1MRVA 2QG5A 3FY2A 3HNGA 1Q8TA 5IMXA 5LJJA 4M67A 2OK1A 5IQHA 3IONA 5J8IA 5KO1A 3HP2A 2R0UA 5IISA 2YZAA 3BWJA 5BVKA 4YJNA 4GKHA 2V7OA 3P78A 2FSTX 3BHHA 4I6QA 4CZUA 4D4YA 2BRGA 4CTCA 3EQCA 3ZS5A 2VTTA 4RIWB 1ZOHA 3KRWA 3OEFX 4EHGA 3AMAA 5M44A 4PNIA 1G8AA 2PVJA 4AW2A 4O0SA 4R6VA 1CKPA 2HENA 4K18A 4EK5A 1ZARA 2XNOA 4WSQA 1OECA 4AS0A 4L6QA 4EOJA 3VJOA 2R64A 3ZSIA 5EI6A 4BDIA 5B2MA 3EOCA 3MIYA 4A4XA 4A9YA 1FBNA 5AV0A 1QPEA 4YR8A 2GS2A 4FF8A 5DR9A 4EQCA 4CD0A 1WCCA 2UW0A 4LFIA 2WEIA 1WFCA 2PMOX 2ITYA 3KB7A 4R7BA 3ZCLA 2QURA 2W5HA 2WO6A 5EK7A 4D4SA 3Q6WA 5AA8A 4A4OA 5DVRA 3NWWA 2A2AA 3QLFA 4YLKA 2BAKA 3ITZA 4M7IA 2OXYA 3WZKA 4RQKA 2PYWA 3D5UA 4KIKB 3FSFA 2O64A 4I0SA 3V5TA 1NVQA 4XHKB 3BIZA 3COMA 5C01A 5A14A 4UWBA 4UX9A 4ZK5A 4E20A 3SC1A 5FTOA 4O83A 2ACXA 3FKLA 3V5PA 3I0OA 5JZJA 3JVSA 3FKOA 1P4OA 4FNXA 2X7GA 4FKOA 1Q97A 2XJ0A 2ERZE 4RA5A 4NWMA 1H07A 3HV5A 3ACKA 4RJ6A 4C0TA 3NYVA 4YBKA 4DTKA 3RHKA 4BWXA 5HCYA 5HI2A 1PXIA 4O22A 3LFFA 3DNEA 4YJTA 3PXRA 2ZVAA 1UU9A 4YP8A 4BIEA 5ICPA 2ITNA 1V1KA 3LJ1A 5DR6A 5C4LA 1DM2A 2ZV2A 1UNHA 3R9OA 4TY1A 5IQFA 2RSVA 4X6RA 4AQCA 2UZDA 4H1JA 3SW4A 2PVKA 4FE2A 4LMNA 4QPSA 2I0YA 4KRDA 4FSZA 2C0TA 2BZKB 3A62A 3DQWA 2YM8A 3MA3A 1M7NA 3N51A 2Z7RA 2ZDUA 2FSMX 3ORTA 3UZRA 1RW8A 3PXKA 4IX5A 5HX6A 3DV3A 4O0XA 1FVRA 2YDJA 1Q3DA 2W0JA 2YCFA 2UW6A 3FDNA 4ID7A 4OTIA 3RNIA 4GU6A 2GNGA 2XK8A 4ACDA 4ALWA 4ACGA 1VZOA 4BCMA 3HYHA 4J8NA 3ULZA 3BBTB 1GZNA 3ATTA 3O8PA 3ALNA 4A7CA 3OW4A 1WMKA 4EK4A 4EQUA 3FLWA 2IVUA 2B1PA 3ZU7A 1YDSE 2WQBA 1J7UA 3QLGA 4PDOA 3VAPA 3VIDA 1MRUA 4GK4A 1BL7A 2YIYA 2XH5A 1O6LA 4ZMFA 1ZY4A 4W9WA 3E87A 5TOZA 2GHLA 2XCHA 4B8MA 2FYSA 1NVRA 2XRUA 2OFVA 5M08A 4DFLA 4AW1A 4HNIA 3LFDA 1H01A 1QCFA 4ZMEA 4FR4A 4BCPA 4FTIA 4Z7GA 3M2WA 3RZFA 3EL8A 2OZAB 3QXPA 4X3FA 5CSPA 5HQ0A 1RQQA 5JGAA 2CKQA 4FKRA 4B7TA 2I0EA 2XNGA 3COHA 3DKFA 4GMYA 4JQ8A 4X2GA 4C4IA 4F08A 5FTGA 2ZMCA 1NA7A 3T9TA 2JKQA 2GQSA 3R2YA 4FEWA 4NK9A 3OTUA 5L8JA 3W10A 4XH6A 4D58A 5DOSA 5E8ZA 1MRYA 4O7TA 3BLRA 1ZY5A 2CGVA 5L8KA 2R3MA 1IEPA 3RNYA 2I0HA 2VWIA 5BUJA 3R9RA 5EKOA 2W1DA 3ZMMA 4BI1A 3PFQA 4HYHA 4MNFA 1U5RA 4XP0A 3W2CA 4Z16A 3G0FA 1ZMWA 4MKCA 5ITAA 4G6OA 2YACA 4BF2A 2J51A 4C58A 2AC3A 4MK0A 4XOYA 3NW6A 3S0OA 4DEDA 4BCQA 2BPMA 4Y83A 2B9FA 3EYHA 4NT4A 5EYMA 4XG3A 3S95A 3GCQA 3CKWA 3K5UA 4FTLA 4K77A 3CSVA 1ERKA 1OVEA 2YITA 4JT3A 4RC2A 1R0PA 5JFSA 1FGKA 2JKOA 4YU2A 3PJ8A 4TNDA 1UU8A 3OXTA 4G9CA 4L9IA 5IA1A 4YJSA 1WBVA 5HIBA 2UVXA 3E88A 3PVWA 4PWNA 5AAEA 4H3QA 2UZTA 3OOGA 2B55A 2FSLX 4EUUA 5AP3A 4JDHA 4IIRA 3TI1A 3FLQA 3UYTA 4C62A 5KMMA 2O63A 2NRUA 3ZDIA 2JLDA 4CVAA 2XKFA 1PHKA 4ZTQA 4AZVA 3VHEA 3ZONA 3JY9A 4I6FA 4F99A 1Z57A 3BCEA 4Z9LA 4Y5HA 4TWPA 5JRSA 1J7LA 3KU2A 4TYHA 3R7VA 5JSMA 3CPBA 3Q5ZA 3WF5A 2C6DA 4L7FA 4GIHA 4MNEA 2XNMA 4BCJA 4EH6A 4OT6A 4MF1A 1PXLA 3AC1A 2F2UA 4ALVA 3CD3A 2F49A 3SQQA 2X2LA 5CTPA 2WTKB 2ZM4A 3EWHA 3RI1A 2LGCA 3B2TA 3KMWA 3FXWA 3ZDUA 3DAKA 4CQEA 5KX8A 1Q24A 4QYEA 1TKIA 3PE1A 5HLPA 3HDMA 3QQGA 5J9YA 3E7VA 4RZWA 3A99A 4ZTLA 2C5XA 2X6EA 3UYSA 5LQFA 3N4UA 3FC1X 1LP4A 2W17A 2PUNA 3MPTA 2PUIA 4FIGA 4E4XA 3OP5A 2BZHB 3JUHA 1KE5A 4IACA 4MEDA 4QMOA 2RIOA 3HAVA 4APCA 2XNEA 1DAYA 1A06A 5DH3A 5AX3A 4N0SA 4QMLA 4BBFA 2R3IA 2JBPA 4CFNA 4AUAA 2FB8A 4BDEA 4X2JA 3MI9A 3BX5A 1PXPA 4YC8A 2QVSE 2BIKB 4U44A 4BDJA 4TKSA 4C34A 3TG1A 2P55A 1OZ1A 2R3KA 3FXXA 2X2KA 4TYIA 3UZPA 2HY81 1CMKE 2VTJA 4ZY5A 4XEYA 5FG8A 2R3HA 4EC8A 3JXWA 5EW9A 2QI8A 4QD6A 2CCHA 5LWNA 2FGIA 2Y6MA 3G5DA 2YLEA 3EHAA 3NX8A 3UNKA 3AC4A 4QYFA 4U7ZA 2WMXA 2XVDA 3FZTA 5CLPA 4AZEA 1UV5A 3R63A 1OKWA 3C9WA 4P2KA 1WBPA 3H10A 4FSQA 4F09A 4QQJA 3P9JA 3QL8A 3TNQB 3WZEA 4UMRA 5LMKC 4I6HA 3A7JA 3EN9A 3NIEA 5KE0A 4EH7A 2UZNA 5AM7A 4YNEA 4DEEA 4XV1A 2DS1A 4W8DA 3VNTA 3I7CA 4PMTA 4ZSGA 4QYGA 4ANLA 3I0QA 3IK3A 4I4FA 2GTNA 4LV5A 4RA4A 3LFBA 4RZVA 4KIQA 3SXSA 4FKWA 4DG3E 1Y6BA 4YHJA 4ZSJA 4FZDB 3SX9A 2H96A 3OCBA 3ENHA 2CGWA 3F7ZA 4IAFA 5AV3A 3VS0A 1NVSA 4MBJA 2BDWA 3A4PA 4FL2A 3CJGA 4L53A 2YZLA 3RJCA 5BUIA 1KWPA 4AA5A 3DBDA 2P4IA 4JAJA 3DS6A 4AT3A 1V0PA 5H8BA 4G1WA 4YC3A 3UIBA 4CLJA 4N57A 4UZDA 1ZXEA 3ELJA 2WOTA 3LKMA 3TV6A 3PXQA 4ANSA 2HAKA 4Z55A 5EI8A 5CI7A 2PUUA 3FZSA 4C3RA 3R8MA 5K4JA 4FV9A 4MXCA 4U97A 5L6PA 4LUDA 5IQBA 4RG0A 4Q5EA 4GSBA 1UU7A 1REKA 2JDOA 3VQUA 5BUEA 3EFKA 4U41A 4UMPA 3LCOA 3NGAA 5DWRA 4LGGA 2Z2WA 1YI6A 3DJ6A 2BAQA 3PJ3A 4FI1A 2W1HA 4RC3A 3BLQA 2IW9A 3TZ8A 3LPBA 3NNVA 3QBNA 5HD4A 4OT5A 1URCA 2W99B 2WMWA 2ETKA 2XK9A 1H8FA 2WQOA 2X7OA 5AP7A 3Q53A 4IM3A 3ROCA 3PIYA 5CVHA 5CF5A 2GS6A 3NYOA 4O7ZA 3GC9A 5CEOA 3H9FA 4C33A 5EW8A 3AMBA 4PTGA 4C2VA 5A4CA 5T68A 4TW9A 2VTRA 3OROA 3BE2A 3N4TA 4W4XA 3SRVB 4I23A 4IFCA 4BHZA 4CT2A 3UIXA 4EKLA 1Z5MA 1MQBA 3ORPA 3BYSA 5CNNA 4HYUA 3LLTA 1X8BA 2HIWA 3F5GA 3KXNA 4DG2E 4ZJVA 3F3UA 2PZIA 3RCJA 5LOHA 4E6QA 4AZTA 2GCDA 4CXAA 4DBXA 3NAXA 2PU8A 2R9SA 3QALE 1ZAOA 2OF2A 1UWJA 2C3JA 2EXCX 4GUBA 3KRJA 5DRDA 3PIZA 3HDNA 2ZV8A 2WPAA 4HPTE 3PRFA 2R3GA 3DBCA 4X21A 2JGZA 4IZYA 3KN6A 2GQGA 4UY9A 4YJPA 3VS3A 5GINE 1H26A 5HVJA 3NSZA 3OMVA 4BZNA 4H36A 4L52A 4UMQA 3R1SA 3RK5A 4W4WA 5AAGA 3C4WA 3LXLA 3DB8A 4L7SA 2WU6A 5IA5A 2PZPA 4QMUA 4CRSA 4IAYA 5GZ9A 3O71A 4D2SA 4YJUA 4BY9E 5D10A 2UW9A 4AACA 1Q3WA 4RBLA 2UW7A 4WOVA 4DTAA 3B8RA 4L3LA 4WNMA 5FM2A 2XKEA 1YVJA 3QQHA 4BTMA 3FMKA 3QUDA 2B7AA 4ZAUA 4D1ZA 2VAGA 1B6CB 4QOXA 4BFMA 5FP6A 1H1PA 5DBXA 5CAVA 3VW6A 3Q2JA 4NCTA 4G34A 3ERKA 2QR7A 4Y46A 4F9BA 4DCEA 1OIRA 3FMLA 5JQ8A 2YIWA 3F3WA 3PA5A 4L67A 2Z7QA 3DXNA 3TNWA 4ERKA 4F4PA 3ZRLA 5I9ZA 1PXOA 3DCVA 3G0EA 1URWA 3QTSA 4BDBA 4DFUA 4YHFA 3Q4UA 4JR3A 2BRHA 3QRUA 3CD8A 2QLQA 3OBGA 5CENA 4IM2A 2QQ7A 5E8XA 3ZFYA 1YDTE 5AMNA 4BB4A 4DGOA 2GFSA 3ZFMA 1R1WA 2XBAA 5AIKA 3KULB 2C5OA 2WHBA 2OGVA 3FI2A 3U9CA 4QP8A 2OKRA 3EZRA 3NVKI 4BYIA 3T3VA 1XKKA 2J2IB 4S30A 3VN9A 5EQPA 1P5EA 3UC3A 5CSVA 4F9AA 3PY0A 4JRVA 5G1XA 5EHYA 1YI3A 2HZ0A 3MTLA 3PG1A 1T46A 2IN6A 2O0UA 1W83A 3F2NA 2BDFA 4RFMA 5EHOA 3V5JA 3BEGA 4R1YA 1Q8ZA 2W1GA 4FG7A 5EW3A 5EQEA 3U55A 3NDMA 3Q32A 3R8PA 4FV5A 5DNRA 4FTQA 5FQDC 3F88A 1L8TA 2C68A 3WZUA 1JQHA 3R8UA 3ALOA 2HW6A 4GW8A 5B0XA 2R4BA 1PXNA 5D9HA 4QTAA 4ZSEA 1QPJA 1BLXA 4NZWB 1YOJA 4C57A 5FM3A 1OUKA 1OMWA 1WVYA 2WOUA 3MVMA 2OICA 2X39A 3BEAA 2XF0A 3EIDA 4NJDA 4OGRA 5CT0A 3G15A 4JIAA 4HVGA 3N9XA 5BMMA 1P14A 4FT9A 4P90A 3C4EA 2WQEA 4BTJA 3PA4A 2XYNA 4EEVA 4ZZOA 4R5SA 2A0CX 5L2QA 2OI4X 1PYXA 4QMWA 4YPDA 1ZYDA 4D2VA 3AQVA 2UZOA 3MPAA 1GJOA 5J9ZA 2F7ZE 3M11A 4PV0A 5AUVA 3SG9A 2Q0BA 1JSTA 3AD4A 5KHXA 5A9UA 3I79A 3WF9A 4EC9A 4BTKA 2WGJA 1B39A 2J50A 3HRFA 5CS6A 3RM6A 2JFMA 5C27A 3TKUA 4UMUA 2C47A 3GCVA 3VQHA 2W1CA 2J0LA 4KKHA 2R3JA 4NW6A 4AN3A 4D2WA 4E93A 1BKXA 3PUPA 3Q4TA 4AZSA 2NNWB 1IR3A 3QWKA 3W33A 1SM2A 3NYNA 2IO6A 1J91A 2W1EA 3IECA 5HEZA 2NRYA 5J9LA 3ACJA 5CY3A 4YNOA 5CI6A 4DGGA 3AC2A 4RWJA 4QMMA 4EKKA 5HZNA 5TR6A 2H34A 4UN0C 4DYMA 3LQ3A 4EI4A 2J0MB 2DWBA 4FKUA 5FDPA 1Q8WA 3KRRA 4NM7A 5HO6A 4E4LA 3HMMA 2VWWA 3CXWA 4AN9A 2Y7JA 4JXFA 1FMKA 4IVBA 2VWXA 4JVGA 4AW5A 4I5HA 4IMYA 3QTUA 2X7FA 1ZRZA 4U43A 4F7JA 4AXAA 3MS9A 4WSYA 3BHYA 1NT2A 4NL0A 3CQWA 2IW6A 5KMKA 4F70A 3SOCA 3F3ZA 4C61A 4XV9A 2F7XE 4NIFA 3DKOA 1ZOEA 3QD0A 3OCSA 4JNWA 3K5VA 4R7IA 2PPQA 3BYVA 4QP1A 4GT5A 4PMSA 5ETFA 4EZ5A 1JOWB 2NP8A 5HCXA 5HU9A 5HTCA 4DT8A 4MD9E 2ETRA 3NR9A 1OUYA 4FTRA 4OTGA 4RIYA 3SV0A 3HUBA 1JVPP 4BI0A 4MBIA 4IVDA 2YWPA 3RPOA 3AD5A 2VWYA 5CANA 5CEMA 5JRQA 3RTPA 3V6RA 4N4SA 4FKTA 4PPCA 5DE2A 2OXXA 4BC6A 3DKGA 4XOZA 3IOKA 3MFUA 2H8HA 3QCQA 2XEYA 4U81A 3MV5A 4YSMA 3FUPA 3RM7A 3VS5A 3KMUA 5IQGA 3F7WA 3OF0A 3D2KA 2YM6A 3QKLA 2WTIA 4HPUE 1VEBA 3MYGA 1OL1A 4J71A 2VX1A 5JH6A 4FSWA 3NW7A 2R3LA 3GB2A 5FBNC 3K54A 3P7CA 3QZIA 3QGWA 5J95A 5AP5A 4GT4A 4ZXTA 4BCOA 2JAVA 3MY1A 3EQBA 2CDZA 1WBSA 2C3LA 3R71A 4A07A 4EOLA 1JKKA 4QMZA 4ZTMA 1J3HA 1H1RA 4MBLA 3NPCA 2HXQA 4EOQA 3VRYA 1H25A 4N70A 4KBCA 2ITOA 2JDSA 4FIEA 2IG7A 4C2WA 5AUTA 3AMYA 1T45A 3ROYA
chains in the Genus database with same CATH superfamily
2OBJA 2R5TA 2G2FA 4JIKA 4IFGA 5CEPA 2PMLX 1PKDA 4KB8A 3Q04A 1P2AA 2I40A 3C4CA 4FEQA 4X3FB 4LOQA 5DEWA 3UIUA 2E9UA 4QYYA 3ORMA 4V0GA 4C4GA 4DFNA 1OL2A 2XCKA 4QQCA 4TYGA 3R6XA 4U42A 5IH5A 4XV2A 1HCKA 3CTQA 3L8XA 1L3RE 5HOAA 3W16A 5I3RA 1OL5A 2JIUA 3RAHA 2C0OA 4F1TA 4FG9A 5IF1A 5K9IA 2F9GA 4BCHA 2HXLA 4QT1A 4RJ8A 4AF3A 1Q4LA 4HCVA 1IAJA 3R02A 2C3IB 3GOKA 4LUEA 4WG5A 4ZLOA 3GUBA 3WE8A 4ZZNA 2J6MA 4S34A 4MH7A 3R1YA 3FY0A 5CAUA 2GQRA 4BIBA 2FUMA 5CF8A 5EM6A 2WMQA 3GVUA 1H1WA 3DJ7A 3TUDA 3Q2MA 3G6HA 4KS7A 3QA8A 4CFXA 2XIXA 3TUBA 4E6CA 5BVDA 4L3PA 4BKJA 3NUPA 4GH2A 3TN8A 3EFJA 1OGYA 3THBA 1BUHA 4BDGA 4BGHA 5IU2A 4KBAA 2R3FA 3R04A 4F7SA 2YABA 1W84A 4KNBA 4UEUA 4EH4A 3ZXTA 3O23A 4WRGA 4JAIA 4MQ2A 2AYPA 3LXPA 3KQ7A 4R1VA 1XWSA 2YJRA 4I24A 5L2SA 3QTWA 2PVNA 3NW5A 1Q8YA 4FA2A 1XH7A 4YJOA 4YJRA 5C03A 3KGAA 3TKHA 1S9IA 5IPJA 3V01A 1YXXA 5HBHA 1JSUA 4NEUA 3FZPA 4DH5A 1CSNA 4EH8A 4K0YA 1F0QA 4OAVB 4FG8A 3ZSGA 5DA3A 5IQAA 3C5UA 4F0FA 4FV2A 4E5WA 4LL5A 3HV7A 4U45A 3UDZA 2HCKA 1VYWA 3MB6A 5H2UA 2XNNA 3R22A 4TYHB 4YZNA 4F0GA 3UO6A 4O1OA 1Y6AA 4TTHB 2QOFA 4I1ZA 4MNEB 2C6EA 3S1HA 5I9XA 1FGIA 5M56A 2B54A 4J53A 5CNOA 4A9UA 2QNJA 2B53A 4BDHA 4FGRA 4XG6A 2A19B 4I21A 4K1BA 3LXKA 1KUTA 2OSCA 2X0QA 5E8SA 5KCVA 1XBAA 4GG5A 5E8UA 3CQEA 3C5IA 5I3OA 1YRPA 3OWJA 3ZC5A 4FIIA 2JD5A 4IX4A 4RIXB 3IKAA 3EKNA 4XYFA 3ODZX 4J7BA 2OFUA 2X8DA 3SAYA 2G15A 3E8EA 1G8SA 3AT2A 3HV6A 1YWVA 3TCPA 2XJ2A 5IUGA 3CY3A 4CEGA 3E8DA 4ASZA 4DDIA 4IH8A 3SD0A 3ZUTA 1ZWSA 3BV3A 2G2HA 5DT0A 1NXKA 2CMWA 4BDKA 3EKKA 5F94A 4DEIA 2ITTA 2X2MA 4G3EA 5CF4A 3WOWA 4CZTA 3HLLA 1YDRE 2EWAA 4X6QC 5CEKA 4FEUA 2VTHA 3MVLA 3OC1A 3PWYA 5I9UA 5L4QA 3R8VA 2UZVA 3PE2A 4CFVA 5CU2A 4F63A 5J1WA 2YFXA 3UE4A 4FV7A 4QP7A 4DH7A 2REIA 2Y4PA 4EK6A 4YZ9A 5A4TA 4C38A 4CSVA 5FTQA 3VBWA 4BIDA 4QTDA 3QQJA 3RP9A 3BQRA 3QRKA 4OUCA 4ITHA 2R3RA 3KXMA 4DHFA 2W9ZB 5HICA 4DN5A 1UVRA 5AUYA 4KBKA 1GZOA 4XJ0A 2W1ZA 3A8XA 1KE7A 2OJ9A 3F82A 5E92A 3HMOA 1W7HA 3RAIA 1O9UA 2E9OA 4FYOA 4IWDA 4P5QA 3PY3A 4CKIA 4Q2AA 1VYZA 4S32A 5HGIA 3F3VA 4DLJA 2BROA 2YN8A 4IB3A 3ZM4A 4M84A 4J96A 2EB2A 4FTNA 5M57A 4ZLZA 4CMUA 5AAFA 5AP2A 4QTBA 2ZB1A 2ITVA 4AWIA 4EOPA 4BGGA 5IQCA 2YDKA 4Y95A 2VTAA 5M09A 3ORLA 4V04A 4WG3A 3WF8A 2FVDA 2PE0A 3TM0A 3MH0A 3MFSA 4MD7E 5T3QA 2JBOA 3RGFA 5FXSA 5ANIA 4NKAA 5AV4A 3D83A 4GEOA 2VTSA 3Q6UA 2ZB0A 3H0YA 2RFDA 4UWCA 3CIKA 3R00A 2O5KA 3MGYA 4FYNA 2QODA 2WD1A 4LI5A 4RWKA 4FKQA 4O0UA 3W2SA 3HVCA 3DTCA 3EYGA 3B8QA 3LJ0A 5CT7A 1PMVA 4RVKA 4PPAA 3I6UA 4O84A 4JDIA 3A8WA 4YBJA 4O7RA 2PZ5A 4WNPA 4X7QA 5A46A 1XBCA 3QD4A 4B99A 2IZRA 5JGDA 2Z7SA 3NS9A 1JLUE 3RPSA 4CYJA 2BRBA 3U4WA 1A48A 3ZRMA 3LCKA 5T6KA 4D9UA 2CKEA 3TT0A 4IJ9A 4I5PA 3GC7A 2VGOA 1OKZA 3HKOA 5C9CA 5JN2A 1OKYA 4FT0A 3R9HA 4Y85A 1VJYA 1OBGA 1OPJA 5IH6A 2WMAA 3FWQA 3OCTA 1UKIA 4X2KA 4L8MA 2FO0A 2OW3A 2W4JA 2YAKA 5FUTA 3ZHPC 1R39A 3D5WA 3DJ5A 3FKNA 3FZ1A 1XH8A 2J4ZA 4FOBA 4AP7A 4EZ7A 5IMEA 4PY1A 4EYMA 3T3UA 4G17A 1U4DA 1FINA 2Z60A 4YLJA 5EDQA 4EQMA 1OB3A 3IW5A 4OBOA 3LCTA 2X1NA 4BKZA 3GNIB 3HRCA 4M69A 4PTCA 1RJBA 5L8LA 2I1MA 4JBVA 2OLCA 5FRIA 3I4BA 4P5ZA 4FTTA 3QWJA 3DB6A 1YHWA 5KBRA 5B2LA 2C6KA 4Y5QA 5IEYA 2HELA 1PYEA 3LMHA 3IO7A 3A60A 4CCUA 4M66A 4RLKA 2ZV9A 2B9JA 5EG3A 2WU7A 2EUFB 4GV1A 3CP9A 3MH2A 1H0WA 2C69A 3QRJA 4YO6A 3P1AA 4AAAA 2WTCA 3OY3A 2VD5A 3NRMA 1OGUA 4C4FA 1ZYCA 5BVWA 4UZHA 2PZYA 4MXYA 4WUAA 3V5QA 1YWRA 3ZFXA 4D2PA 3IGGA 1LPUA 2O2UA 3GQIA 4O2PA 5LVOA 4Q9SA 4U79A 2R2PA 4F7NA 3NCGA 3IDCA 2HWOA 3W2OA 5HE1A 3CCNA 4Y8DA 1GZ8A 4RJ3A 4FODA 4EK3A 5CAOA 3DFCB 4ERWA 3VULA 4FV1A 5GNKA 5HCZA 3GCPA 5HNBA 2XRWA 4EWQA 3Q9XA 3ZOSA 5LVMA 3MFRA 4M15A 1OITA 3R21A 3PDTA 3MB7A 2YM3A 3W1FA 3PYYA 5C1QB 4OR5A 4KA3A 3PFYA 1I44A 2RL5A 3QHRA 4FEVA 3F9NA 5L6WL 5K5NA 3FI8A 1LR4A 4EORA 2WMTA 4F6SA 2Y6OA 3FZRA 3C1XA 3WYXA 4M97A 5KBQA 4L43A 5K0KA 3U87A 2WQNA 4U8ZA 3T9IA 4AA4A 3R8LA 4JQ7A 1W82A 4BWKA 4YTCA 4FKGA 3BRBA 4APPA 2BKZA 3F2AA 3LQ8A 4LYNA 5JGBA 3SGCA 4KRCA 2BKKA 3DOGA 3PVBA 3QZGA 4W4VA 4QPMA 2QHMA 2A27A 4D0XA 3I5NA 2I0VA 3VS2A 1ZZLA 1Y91A 3GCUA 2XMYA 4O21A 4DCAA 3GU4A 3DXPA 4LL0A 3NUAA 3HRBA 4RIOA 4UALA 3FI3A 4FUXA 4O7NA 3E3BX 3GENA 2OG8A 1F5QA 4UYAA 4RIWA 4XX9A 1OBDA 5KMLA 2Q83A 3NUNA 3ORIA 4GS6A 4QP4A 1BYGA 3P86A 1WVXA 3TZMA 2GHMA 3U4UA 4UBAA 1O6YA 1DI8A 2NPQA 4NTSA 2UVZA 2OIQA 4ITJA 5D7VA 2CN5A 4OTDA 2ITUA 2W4KA 3ZUUA 5E8YA 2CNUA 4QMTA 2YJSA 1XMMA 3ZLXA 4RT7A 4FSYA 5ETAA 1H4LA 3FJQE 3PPZA 3A61A 3FLSA 3FMJA 3ZUVA 5AADA 3BU3A 3DFAA 3CKXA 4IJPA 2HY0A 4FTUA 4FKIA 3MY5A 4BCIA 1V0OA 4WHZA 4ZTNA 3HV3A 5HTBA 2YIRA 2WQMA 4FKLA 4M0YA 3FMMA 2WTWA 4YZCA 3BKBA 1XBBA 3Q4CA 1KV1A 2XKDA 2JDVA 1IRKA 4EJNA 1Q5KA 4IZ5A 4XG4A 3ATSA 3EN5A 3RPVA 4U40A 4BYJA 4BGQA 4CZYB 3QX2A 1J7IA 3R7UA 5I9YA 5LVNA 4GVJA 3TV4A 3L9NA 2PE2A 4EHVA 2XS0A 2VX0A 1YHSA 2ZM3A 4UWYA 1Y8GA 1YXTA 4J1RA 2FSOX 1R0EA 2QKWB 5AUXA 3OTVA 3FC2A 3W0RA 1M52A 3CJFA 4MUQA 2X9EA 3V51A 3FPQA 3WIGA 4L3JA 4JG6A 2VTLA 1XJDA 3PSBA 4UMTA 1U46A 1PF8A 5H8EA 3UOHA 2JDRA 2HOGA 4CV8A 3IW6A 4GYGA 3OOMA 3POOA 3OFMA 5M4UA 2XAMA 4RVMA 3L8PA 4EUTA 3LFAA 5K5XA 3FE3A 1Q62A 3FYJX 2XIYA 4N6YA 2VWBA 5HNIX 2J0IA 2VV9A 1JNKA 4FKPA 4ZY6A 3WE4A 4Z3VA 2UZWE 5JFWA 1ND4A 4AGDA 3LFEA 2QD9A 3P4KA 4KKEA 3C13A 3RBWA 2PVLA 2WTVA 5HIEA 5EDPA 4YUQA 1UNGA 3ZRKA 3C7QA 3REPA 3NYXA 3KXZA 5DEYA 3UQCA 4S2ZA 2H6DA 4PMPA 3KA0A 4K2RA 3QCSA 1YQJA 4ARKA 3HZTA 4MTAA 2C6TA 3WF6A 4KAOA 3DY7A 4W4YA 3NAYA 4NIFB 4EH2A 2YDIA 4B0GA 4RGJA 5HVYA 3ZC6A 4QDEA 4A06A 2WTKC 3W2QA 1E9HA 3D14A 3UMXA 3VUKA 4F9WA 4FV6A 2JIVA 4F64A 4IVCA 2PZRA 4RX7A 2OJFE 3LFSA 4O4BB 2ZAZA 1WBOA 4ZEGA 4DINA 5L2WA 3R2BA 5C4KA 4KD1A 4O7LA 3P5KA 5HG9A 3ANQA 5HX8A 5IA2A 3Q96A 2PVRA 3II5A 4FT3A 4O91A 3D0EA 2OF4A 3DBEA 4AOIA 2BDJA 5FXQA 3LFNA 4O0WA 5J87A 1KE8A 3ET7A 4GRBA 4QMPA 5HO8A 4QMSA 3R30A 3EJ1A 4WNKA 2QOOA 3KVXA 3UVQA 4ZZMA 3O7LB 5C8NA 2WNTA 3MTFA 4IWOA 4NFMA 4D28A 2CN8A 2PL0A 3E62A 5CZHA 3O2MA 2GNLA 4S31A 4BZOA 1UNLA 4MXOA 3U9NA 5J7BA 1IASA 1JSVA 3PY1A 2W1IA 4PNKA 4CCBA 4JDJA 3VF8A 2KTYA 4DFZE 5IA4A 5HU3A 5LMKA 5IUHA 3EQFA 3GP0A 5K0XA 2C5YA 4G16A 2P0CA 4IWPA 3AGMA 3FAAA 4U5JA 5IKWA 3DZQA 1QPDA 1OKVA 4AGWA 3GCSA 4TT7A 4ANMA 4CV9A 5KMOA 1JWHA 2GPHA 4CKRA 1OIYA 2UV2A 5HLNA 3CTHA 3TEIA 3SXRA 4BICA 4ZS0A 4NUSA 4B6LA 2G2IA 4F0IA 5AJQA 4V0GB 2IF8A 4OTHA 4MF0A 1H08A 4USDA 4B8LA 4JJRA 4FMQA 3PXZA 4RJ7A 2CCIA 2CPKE 2XALA 4MVFA 4EWHA 5GZ8A 3QQUA 2C3KA 3V8SA 5LVPA 3HMNA 4IE9A 4O82A 5BNJA 3HGKA 2VN9A 4M68A 3R9DA 2V7AA 5JFXA 2JC6A 1ZYSA 2CSNA 4MX9A 3DAJA 5DGZA 3Q3BA 3CTJA 3BQCA 4CRLA 1YHVA 3HEGA 5ANJA 4K9YA 4WA9A 2BRMA 2A1AB 3WI6A 4WD5A 2J5FA 4OLIA 2BVAA 4LG4A 2F7EE 4AW0A 3OW3A 1LEZA 2CJMA 2HZIA 4CG8A 2RGPA 5EYCA 3LIJA 3DK6A 2BHHA 1SVHA 4IDVA 2WIPA 3KVWA 1JKLA 4IHPA 4GIIA 5DR2A 5IG1A 1JPAA 5J79A 2WMBA 1IG1A 4ANNA 1FVVA 1WZYA 5TT7A 4NFNA 2VTQA 3TJDA 2YAAA 4K11A 3H3CA 4CGAA 4M3QA 4ACCA 3GC0A 3DBQA 5DHJA 3V3VA 3NCZA 3BE9A 3ENMA 4EH5A 3H0ZA 4C36A 4I94A 4MD8E 4FOCA 4BCKA 4O38A 4DHJA 4J97A 3DNDA 3EL7A 3D2IA 3MH3A 4NU1A 4FZ7A 5DPVA 3NFFB 2XEZA 3SW7A 2WIHA 3NIZA 4I0RA 5KZIA 3QZFA 1ZMUA 2VX3A 2OH4A 5DG5A 4FL1A 4LQMA 2ZYBA 4BCGA 5E8VA 4G3CA 2V55A 4PRJA 1M17A 4YZMA 4IZ7A 4U6RA 1GOLA 5HG5A 5BX0A 5IH4A 1UWHA 1I09A 4IANA 5CALA 5FWKK 5AUZA 1SNXA 3PLAE 4CMOA 5BVEA 2IVVA 5AV2A 4O4DA 5DI1A 4R7HA 3D5XA 3MW1A 1JKSA 3CPCA 4O4FA 4RRVA 3R83A 4DA5A 3MSSA 3UG2A 4AAYA 5CU4A 4B4LA 2RFSA 4XLVA 3FHIA 4DHZA 1K2PA 3IS5A 4DFYA 4FUYA 2DYLA 4RFYA 3PIXA 3AKLA 4GVAA 3KF4A 3NEWA 2X8EA 4I3ZA 2RFEA 1IA8A 4ZSAA 3PZEA 3TL8A 5J1VA 5BQ0A 3D15A 4RJ5A 3SVVA 3R7YA 4ZY4A 3FL5A 2B9IA 4XBUA 1KOAA 4I20A 3ZBXA 5FXRA 4R3RA 1OL7A 3VBTA 4NW5A 5DN3A 3R1NA 3A7HA 4O27B 3KREA 4CMTA 3ZLWA 5HHWA 3PP1A 4TWNA 2KULA 3FV8A 4YZBA 4O81A 3UQGA 2AQXA 5AUWA 2PVMA 3VS1A 3PXFA 4DGMA 4FTKA 4O0RA 1QMZA 5AR5A 2R7IA 2PUPA 2JDTA 2WAJA 5IZFA 4DTBA 4ORKA 4TYJA 2XK3A 4RPVA 5E9EA 2W4OA 4IEBA 4PPBA 2XIZA 3UO4A 3HUCA 1Q8UA 4IM0A 2C5NA 3GC8A 3QQFA 3JR1A 4OTFA 1U5QA 2BZIB 1W0XC 3KN5A 2QG7A 2ONLA 3ZH8A 5EM8A 4FEXA 5M06A 3LOKA 2PMNX 3IGOA 2P2IA 3OUKA 4PTEA 4FTJA 2BHEA 3T8OA 5H3QA 3TNHA 4XS2A 4E73A 4F1MA 2FA2A 5I0BA 4N6ZA 4ZLYA 3BGQA 4IADA 2GNHA 3LM5A 3ZZWA 4O7WA 3SG8A 4TL0A 5JQ5A 4JDKA 3DLSA 3QAME 1BL6A 3QC9A 4HYSA 2RG6A 4IAIA 4L01A 2BALA 2JKMA 5ANOA 3Q4ZA 4DE4A 4CKJA 2WMUA 3OVVA 5BPYA 4FZAB 2O8YA 4I0TA 4BTFA 3BL7A 2UUEA 4IWQA 5AUUA 4L46A 3KCFA 3R7IA 2HZ4A 3V5WA 1KSWA 3VC4A 3C0HA 2G1TA 1OM1A 5CQUA 5JKGA 1XMLA 3C50A 4D55A 1PMEA 1H1SA 3AGLA 3FQEA 4QO9A 3QKMA 3LAUA 3WF7A 5ETCA 5LCJA 1KOBA 2VTOA 3D7ZA 4WBOA 4CT1A 1IA9A 4AXFA 5HE2A 3QX4A 3A2CA 3W2PA 5HKMA 4IVAA 3PJ1A 4XP2A 4ENXA 3KK8A 2UZUE 4GT3A 4AX8A 2Z7LA 5LVLA 3BYUA 2PTKA 3G9NA 3WIKA 4FV4A 3EH9A 5L3AA 1GIJA 3LLAA 4JS8A 4C3FA 3H4JA 2CGXA 2J7TA 4KWPA 3PG3A 3S2PA 3UP7A 3CLYA 3F5UA 3LZBA 4RC4A 3TKIA 2QONA 2ZDTA 2QOBA 3IG7A 4BDDA 4OAUC 3TACA 3O8TA 3FEGA 4I4EA 5CSWA 3DLZA 2B9HA 2XJ1A 3LQ5A 4JRNA 3TUCA 4E26A 3QA0A 2R7BA 4JG7A 4XG2A 5FD2A 3UPZA 3O17A 3OS3A 5FEEA 4L45A 1GIHA 4A9SA 2YWVA 1PY5A 3DPKA 2WB8A 3F5PA 3D94A 1R3CA 5IEVA 4GFMA 4RWLA 3PVUA 2UW8A 3KRXA 2F2CB 3Q9ZA 5AR2A 2PY3A 2VTIA 4BN1A 3VVHA 4BBEA 4E7WA 5HO7A 3ORZA 2E2BA 4FIHA 3N4VA 3O50A 4HVIA 4CYIA 5HVKA 4HCUA 4AT5A 2J9MA 3FL4A 3OBJA 4MXXA 3VF9A 3QZHA 4D1SA 5HTIA 3W2RA 1SVEA 5IQIA 4JX3A 4LGDA 3WBLA 3FQSA 1YI4A 3OD6X 5HNGA 4EL9A 2OO8X 4FC0A 2W5BA 3ULIA 3ZTXA 2AC5A 4C4HA 2QU6A 2O3PA 3LVPA 3BELA 3MVJA 3S3IA 5I5ZA 1O6KA 3QFVA 4MYGA 4CQGA 4A9TA 4FVRA 4E4MA 4NH1A 4FSRA 3RPYA 4ENYA 2E9NA 3HMPA 2J90A 2EVAA 3RZBA 4DFBA 1PRYA 4U3ZA 4W8EA 3L1SA 3CS9A 5GJFA 1TQMA 1REJA 3Q9YA 3OWLA 4GK2A 4JX7A 3BWFA 5CEQA 5H9BA 1WBWA 3EFLA 5GZAA 4F9CA 5DYJA 3NUUA 5HBEA 4RJ4A 3UDTA 4WT6A 5ACKA 4EOMA 4MCVA 4FIJA 3EZVA 4H3PA 4XV3A 2VUWA 5EQYA 2VTPA 5HD7A 1GNGA 1G8KA 4G6LA 1XH5A 3COIA 3UMWA 4YSJA 2B4SB 4FV0A 1PXJA 3GGFA 4R5YA 1BMKA 3GI3A 4FKSA 4ASDA 1K9AA 3OT3A 3ZEWA 3ODYX 5F20A 3NNWA 5F4NA 5TE0A 5AFVA 4I92A 4U3YA 3BYOA 2ITXA 4AE9A 4ZTSA 2F57A 1PW2A 4U0IA 2W1FA 3NNUA 5B2KA 4QQ5A 5BV3A 4IB1A 3W8QA 3AOXA 3MY0A 4GK3A 4YZDA 3GBZA 1JKTA 4MXAA 4QMXA 5GJGA 4BDFA 3S00A 5HE3A 4DAWA 3PJCA 1XQZA 3DT1A 1RE8A 2YERA 4USEA 5KZ0A 3QTZA 3JY0A 4L00A 4WKQA 3VWAA 2V0DA 3AT3A 1Z9XA 1FVTA 3NMUF 4FX3A 4X2FA 5A3XA 2J0JA 1XH4A 4CFUA 3L9MA 2XZSA 4EHEA 2J5EA 4EBVA 3W0MA 3PLSA 4UXQA 4OTWA 4A4LA 1YKRA 4KSPA 4CNHA 2YEXA 1U54A 3KY2A 1OL6A 3M1SA 4FBXA 4O96A 5EHLA 4EZ3A 2Z02A 2B52A 3OG7A 2XNBA 3VBVA 2C6IA 3AC5A 1H0VA 1PXKA 3LHJA 4QMQA 5DMZA 3TTJA 3MA6A 2VWUA 2ITPA 3ZM9A 4X3FC 4J99A 5HG7A 4RMZA 4YPSA 4XRJA 4QNAA 4HGEA 3U51A 2P2HA 3GFEA 4EHZA 3P7BA 4TRLA 3KEXA 4E5BA 4FNYA 3FMNA 5M4IA 3W32A 4ZS4A 3HX4A 3G2FA 3DZOA 4PP9A 4FT7A 2OIDA 4P4CA 4TN6A 2GTMA 3BYMA 3UDSA 3BV2A 4C4EA 3CGOA 4Z7HA 2OU7A 2PE1A 3EN6A 4KIPA 3EQRA 5CVFA 1EH4A 1XR1A 3LM0A 4ZP5A 5E8WA 1U59A 4ANQA 4IZAA 4JL9A 2CLQA 5EFQA 3DTWA 4NM0A 1DS5A 1NW1A 3NVMB 3RCDA 4DGNA 5CYIA 2CNQA 4ACMA 3BGPA 4PDYA 1CKIA 4PUZA 3DKCA 3O8UA 4AXDA 1IAHA 3QTIA 5CVGA 2VWZA 1ATPE 3MBLA 3FLZA 4YURA 4C8BA 3KC3A 3C51A 3GU6A 3DBFA 3L8VA 4TPTA 3E8NA 3LFCA 3FMEA 4BWPA 2JEDA 4PL3A 3RKBA 2VWVA 4LRJA 1YXUA 2JFLA 2CKOA 3E5AA 3PUFC 3UVPA 3R0TA 2Y0AA 1WVWA 4QMNA 1CM8A 4CFMA 4IC8A 2HYYA 3RVGA 4DH1A 3QTRA 1CKJA 2A98A 5KMIA 4H58A 2QOKA 3KL8A 4O0TA 4JG8A 1OI9A 2OH0E 2PMIA 3FMHA 1B38A 5EM7A 2XM9A 2ZFYA 4DC2A 3VUDA 4QEBA 2EXMA 2DUVA 4QTEA 4M12A 4Q5HA 2X0OA 1TQPA 3R1QA 1M7QA 4M14A 5IDNA 3U54A 5GIPE 2GSFA 5E1SA 5DT4A 2QLUA 3ORXA 5CU6A 3G33A 4ZJIA 3D7TA 4FTCA 5IUIA 4O2ZA 4AQKA 4A9RA 4B9DA 3UVRA 5K3YA 4L44A 3IPHA 2VU3A 4E5AX 2GU8A 5A4QA 4AE6A 2JAMA 1FMOE 1NY3A 4EH3A 4BJJA 3ZO1A 3QQLA 4WNOA 2XUUA 1GAGA 3UIMA 5AR7A 4GKIA 2XIRA 3R73A 3FHRA 3A7GA 3KRLA 2W05A 3KKVA 4KABA 5CU0A 1CTPE 5AM6A 1WBTA 3MPMA 4H39A 4NTTA 3DQXA 4YJVA 2YA9A 4F1OA 4LGHA 3VS4A 1TVOA 5D11A 2ITQA 5IA0A 3CGFA 4RVTA 5CEIA 3I6WA 4AGUA 5IQEA 3BI6A 4H1MA 4PF4A 4XRLA 2C6MA 5EDRA 3GU8A 4GL9A 5FEDA 2QO2A 4QYHA 2JITA 3FXZA 4ITIA 4LOOA 4TYEA 4YJQA 5AWMA 5H8GA 3VUTA 4EBWA 5HBJA 4I6BA 3PA3A 4FL3A 4AOJA 3CEKA 3L8SA 5K4IA 4GU9A 3MFTA 4UV0A 3RAWA 5CXHA 3LCDA 3EN7A 4QRCA 2X4ZA 3VS6A 3UP2A 4RX8A 4K33A 3TDWA 2BRNA 2EB3A 3DAEA 3KXHA 4I93A 4OBPA 4G31A 4ALUA 4AZFA 5CQWA 4H3BA 4ACHA 4IBMA 5CZIA 2YCQA 3OT8A 5TF9A 4C4JA 3QYWA 4QPAA 3UGCA 5CSHA 1FQ1B 3KCKA 5EOLA 4NSTA 3ML1A 4GJ2A 1R78A 3RWQA 5KUPA 2PHKA 4TZRA 3DU8A 3EFWA 4FGBA 4C02A 2WTDA 4ZIMA 5CSXA 4EOIA 2WMRA 2ZJWA 3OZ6A 5GHVA 2Y4IB 3A7IA 4M8TA 2CGUA 2GDOA 3KK9A 3TDVA 2QOLA 2OXDA 4PQNA 1V0BA 1FOTA 4G3GA 1Y8YA 1UU3A 2R3OA 3IDPA 1H28A 5BYZA 3ZLSA 3I60A 5M53A 4EOSA 2BFXA 4RQVA 5G6VA 3UBDA 3G6GA 3I81A 4KIOA 5DFPA 1PJKA 1ZOGA 4G6NA 4KUJA 2IZTA 3BBWA 4O0YA 4D9TA 5HG8A 5JFVA 3EQIA 3GOPA 2QOHA 2ETMA 3V5LA 1YXSA 3GT8A 5L2IA 1ZYJA 5M55A 2VTMA 4G2FA 4EONA 4R3PA 3PSCA 4R8QA 5AP0A 4CTBA 4YO4A 2R3QA 4FK3A 2PVHA 4J95A 3LJ2A 3U6JA 1WAKA 1ZYLA 1BI8A 4NJ3A 4GG7A 4FTMA 4GUEA 2YLFA 4FRFA 1DAWA 4DFXE 1WBNA 4RIXA 5AR3A 3OEZA 4ONAA 2RKUA 2W9FB 1MQ4A 3FSKA 5HESA 4FV8A 4M13A 4BCFA 4HVHA 4WBBB 2XP2A 1H00A 2CHLA 3P7AA 1F3MC 4FICA 4FKVA 4G3FA 2BTRA 4R3CA 4TNBA 4BL1A 5LXMA 1YW2A 2BIYA 4YC6A 2VO6A 4LRMA 1OIQA 3UQFA 4IAZA 5A6OA 3U6HA 4CG9A 5CU3A 2EU9A 2QO9A 3DA6A 3HMIA 3MJ2A 4KIKA 5EI2A 5CXZA 3NLBA 3NNXA 2I7QA 5JMSA 3L9PA 1GZKA 1ZLTA 4C3PA 3LMIA 3R7GA 4F6UA 2C6LA 3PWDA 3ZBFA 1Q99A 4UXLA 4DEHA 4AGCA 2YM4A 3ZZEA 4Y73A 3TXOA 1H1QA 4QMVA 2WFYA 3GEQA 1FPUA 1GIIA 3VJNA 3TIYA 4D4RA 3OHTA 3IW4A 3E3PA 4PDSA 3UDBA 5BVFA 3EMGA 2XANA 4ANBA 3IQ7A 4AN2A 2X6DA 4G3DA 3MDYA 2YM5A 3DDQA 3U6IA 2OJIA 3FZOA 4FZ6A 4GFGA 3R8ZA 1QPCA 3P08A 2IJMA 3UOLA 4NYEA 3KFAA 5CF6A 2GNJA 3B2WA 4IDTA 5ANDA 3OWKA 4IC7A 3NUXA 4LM5A 2BAJA 3VBXA 3UG1A 3C0GA 4XUFA 4HW7A 4MWHA 2W06A 2CKPA 4IXPA 5L6OA 5TO8A 4OBQA 3R7EA 4IX6A 5HE0A 4IAAA 5ANKA 4AXEA 3ANRA 3AXWA 4O6EA 5A6NA 4LRKA 1E1VA 2UZLA 4F65A 4EOOA 1YOMA