3HRFA

Crystal structure of human pdk1 kinase domain in complex with an allosteric activator bound to the pif-pocket
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
285
structure length
284
Chain Sequence
RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Structure and allosteric effects of low-molecular-weight activators on the protein kinase PDK1.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 284
sequence length 285
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hrfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hrfA01
2ZB0A 4A06A 4U41A 3GT8A 1E1XA 2HENA 1W0XC 4ZXTA 4K1BA 4FTAA 3EKNA 2IJMA 3SDJA 4R3RA 3HYHA 2WTKB 3HEGA 2FSLX 3OXTA 4D1XA 2FGIA 3SRVB 2CJMA 4FX3A 4GG5A 4FOCA 5AV1A 3U55A 5AR8A 3G90X 5BYZA 5D12A 2WNTA 4OAVB 2P2HA 3RHKA 1YWVA 2ZAZA 5CEKA 3CPCA 3WF5A 4QP8A 3VS0A 4M15A 3RK5A 4QP3A 4ZOGA 5ACBC 4Q5EA 4IIRA 5HZNA 4RVKA 2P4IA 4EUUA 5J7BA 2OICA 3G15A 5E8VA 3TJCA 3E8EA 3P4KA 5BMSA 3ORZA 4X2KA 4DEGA 5EYCA 1OPLA 5JRSA 4FIIA 2W99B 4YC8A 3KXMA 1Z5MA 3OWPA 4MXXA 2R9SA 4M14A 3UZRA 2XIKA 3P23A 3LW0A 4WNMA 3HV4A 2OLCA 3QYZA 3PSBA 1J1CA 1OMWA 2C1AA 4DCAA 1OIQA 4FKUA 4RRVA 4P4CA 3ELJA 3IO7A 4GL9A 4CV8A 3HV7A 4ARKA 2ITNA 1REKA 3E62A 4GT3A 5EHYA 2ZB1A 3FLZA 3PLSA 1OECA 3LM0A 3HVCA 4KB8A 2C6OA 2CCIA 4U0IA 2QHNA 3JPVA 4TKSA 2B4SB 5FG8A 1AGWA 2YM4A 3K5UA 2BKZA 4M68A 2OU7A 2XIYA 3QTZA 3F3VA 4RGJA 4NT4A 2WQNA 2WTVA 3F7WA 3G6HA 4RT7A 4TWPA 3ZMMA 3GGFA 3QTUA 4H05A 5ANJA 4G1WA 1DAYA 4A9SA 2BR1A 4FG7A 1E9HA 2UZUE 1UU8A 4JDJA 5FBNC 3UQCA 4BR3A 3FI2A 4JR3A 2Z7LA 3DZOA 3UTOA 1R3CA 5I9WA 5FM2A 2B55A 3GQIA 2Y0AA 3F9NA 4BKZA 2V62A 4O96A 4UWBA 2EXCX 3AD4A 2XEZA 4ASEA 3DU8A 4MWIA 3VQUA 4D4VA 4O91A 4AW2A 4WA9A 3QBNA 4DTAA 5AUVA 3WYXA 2PY3A 4JQ8A 4H3PA 4QD6A 3PVWA 4E1ZA 1NVRA 3FC1X 4W8EA 4EYJA 3G0EA 5H8EA 3EFWA 4FTNA 4M66A 3TNWA 4E20A 2CNVA 4E26A 3CS9A 4OT6A 1VJYA 4M12A 4JBPA 3VRZA 3RCJA 5CAQA 5CXZA 4J96A 5EI6A 5E8TA 3O0GA 5ANOA 4WT6A 5FQDC 1M17A 1FVTA 1M2RA 3Q52A 2X81A 2QR8A 2VTAA 2WOUA 3EL8A 3MFTA 4U81A 2CDZA 2V22A 5IUIA 3N4TA 2OK1A 3NCGA 1KE9A 5DWRA 1H8FA 3I4BA 3MWUA 3MVLA 3TDVA 5F9EA 1H00A 4NYEA 3LFSA 4D5KA 4EK3A 4FL1A 5AR2A 4RX5A 1IA9A 3TACA 3EB0A 4A07A 2WQBA 1PKDA 4EK5A 3L9NA 2YN8A 4FTTA 5F4NA 3ZM4A 3ZRLA 3ZZEA 2IW6A 4CQGA 3IGOA 5LMKA 2UVYA 1FQ1B 1P14A 3VJNA 4D2RA 3DKFA 4KKEA 2XIRA 1QL6A 4L9IA 2VX1A 3REPA 3R8ZA 1QMZA 4R3PA 2ITTA 3R7UA 2W4OA 4FT0A 4BHZA 4E6DA 2ZDTA 3DB8A 1FINA 4MXYA 5CF5A 5D11A 3P9JA 1Y57A 3HV6A 5FM3A 2JIVA 1NVQA 1ZY4A 3BHTA 2V7AA 2C5VA 4Y83A 4EH7A 3NW7A 4QRCA 2Z02A 3DNEA 3W2RA 3W8QA 3TIZA 4L44A 4RVLA 3SV0A 3KL8A 4MX9A 4O0XA 5A4QA 2ITYA 2YCQA 3ZBXA 3HRFA 4QP7A 1Z57A 4FKIA 3EZRA 4MBLA 5HCYA 4ZY4A 5EG3A 5K5XA 1NXKA 2RG6A 4AGDA 5D41A 3A7GA 4JIAA 4L67A 2WOTA 3I5NA 5DRBA 4E4MA 4J71A 5E8UA 4AXAA 3S4QA 2ZV7A 3U6JA 1OUKA 4AACA 3F61A 5HX6A 3OBJA 4QTCA 2GFCA 4FNWA 4QMLA 3ACKA 3TTJA 4IEBA 5FTOA 4LOQA 4L53A 2QVSE 4JT3A 1REJA 3BE2A 4OBOA 5CVGA 3HMMA 3PIXA 4CKRA 3MY0A 3SGCA 3FKNA 5ICPA 4NM7A 4FV6A 2C5NA 3TZ7A 1Q8WA 2H34A 5CX9A 3EFJA 5HO6A 3ZU7A 4AOTA 5LWNA 2VO7A 5DH3A 2BRNA 4P2KA 4QMTA 5C4KA 2ETKA 5LMAA 2HK5A 1Y91A 2QI8A 4IC8A 4Y85A 4BTFA 1T45A 2WD1A 3MVJA 5E8SA 2IZRA 4DG0E 4LGHA 2IW8A 4BN1A 3OCGA 3IECA 4FKSA 4G31A 1L3RE 2UZDA 4IBMA 1V1KA 2UW9A 3FJQE 4CT1A 3PWYA 4I6BA 5HESA 2P33A 5CVFA 3MJ1A 4O21A 3ATSA 4NM3A 2BROA 1YI3A 4HZSA 3Q6UA 4WBOA 1YDRE 2UUEA 3LMHA 3FDNA 4Z3VA 3W10A 1M7QA 5IG1A 2C6DA 4UX9A 1A48A 3OWJA 3QX4A 3I5ZA 4B0GA 2BAQA 1ZYLA 4E3CA 3PVGA 1ZYSA 4V05A 4EK6A 2VRXA 3OROA 4DN5A 4CZYB 4A7CA 4U5JA 2W4KA 3LCKA 3SC1A 4RZWA 2DQ7X 4U79A 5J5TA 2IVVA 4QQCA 2ETRA 3VUGA 4DEIA 2UW4A 5I3OA 2Z7QA 3UODA 5F95A 2QLQA 1VR2A 4BDEA 3NCZA 2UZEA 2C69A 5IQEA 3C4CA 2WFYA 4CZTA 4ZTLA 5HE0A 4I92A 3QTQA 5AP0A 4DEBA 2XH5A 4ZJIA 2CKOA 2C47A 2ZV8A 4YHFA 5ANGA 4F6UA 5C4LA 3S95A 4YPDA 3MESA 3FPQA 1CM8A 2WIPA 2OF2A 4L68A 4ZSAA 4O27B 3EN7A 2I0EA 3MVMA 4K18A 5ACKA 4BTKA 3CR0A 4IAYA 4DF3A 3EN4A 3OXZA 4UV0A 5E90A 3FSKA 3O8UA 4PNIA 4F99A 4QP6A 5M44A 4NL0A 4QMZA 4RQKA 1MRUA 2C3KA 2J51A 3FZ1A 4G3DA 4C58A 4A4LA 4F9AA 4E6QA 1UKIA 1IAJA 5DHJA 5DR2A 2J0IA 5DVRA 2VTTA 1K3AA 3PA4A 3UE4A 3CQWA 5HG9A 3KVWA 2XVDA 4RJ3A 3FMEA 1U54B 5FTQA 5GJGA 3O7LB 4FGBA 4X3FB 2OIQA 3GC7A 1ZOGA 4JBOA 4UWYA 5HCXA 3F5PA 4C4FA 3PJ3A 3PIZA 4A4XA 4OTFA 4X2GA 2IO6A 3QX2A 3VS6A 5IQDA 3A7IA 5CSPA 3R9HA 4BCGA 4F7SA 1XHAA 5CENA 2PVFA 4EC8A 4CFNA 2QODA 5TF9A 4F7JA 2QG5A 4HW7A 3CY2A 4FEXA 2WEIA 2HAKA 3QQJA 1SVHA 2CPKE 3NX8A 3ODYX 4FKQA 4CFMA 1SMHA 2YA9A 2GS2A 2R64A 5AIRA 3W33A 2WQOA 2BZKB 2BTSA 2NP8A 1GZNA 5CF8A 4FTIA 2W7XA 5DN3A 4EOOA 3U54A 2CHLA 4ANLA 1KSWA 4ZTRA 3NLBA 4YC3A 4CFFA 3ZEWA 5ANDA 1R78A 3OY3A 5ETCA 3U6HA 4O7ZA 1JSTA 4YJPA 3LQ8A 4L42A 3IOPA 4IB1A 4L8MA 1JSVA 2PK9A 2XJ0A 4LI5A 3ITZA 2J4ZA 4E7WA 3OXIA 4ITJA 2VWBA 4ACMA 2BILB 4ZP5A 3W18A 3R21A 3VC4A 4GEOA 1OGUA 5CEMA 1OIRA 4R7HA 4QMQA 4BIDA 5CI6A 2B9IA 3DK7A 3E3PA 2ONLC 5AP2A 4C2VA 5KHWA 2XYNA 2WPAA 3KY2A 4YJNA 4FTKA 3KK8A 4KIKB 3DA6A 4IZ7A 2PYWA 2X6EA 5AADA 3SOAA 5A9UA 3DKCA 4L45A 5LOHA 1J7UA 4FOBA 2VTJA 4HGSA 1E1VA 2J5FA 4DH5A 1LPUA 3WIKA 5IA3A 3DJ7A 2RG5A 4DH1A 4RJ4A 2I6LA 4RWJA 4R1YA 4AG8A 4AP7A 3O17A 2BTRA 2E2BA 4O1PA 3LMGA 2WMXA 2ZV9A 5HG8A 3W2OA 4IH8A 2WTKC 5AA9A 4ID7A 3BCEA 3RM6A 4AW0A 4DGGA 5GZAA 1W84A 4MXAA 3LQ3A 1J1BA 5JEBA 4DITA 5IKWA 4LFIA 3UGCA 3BEGA 3CJFA 3ZYAA 3I7BA 3JYAA 3KN5A 1OBGA 2DWBA 3HMOA 4AA5A 4X7QA 5IEXA 4IACA 1W83A 3ORNA 3MY5A 4AE9A 3A8WA 3D0EA 5L2QA 1IR3A 4FYNA 3HECA 4FYOA 1ZARA 3SG9A 2FSMX 3NYOA 2W05A 5DR6A 5DT4A 4RIXA 5HE1A 5BVDA 3DT1A 5JK3A 1TQMA 5ANIA 4G3CA 4BBMA 3H3CA 4EONA 5L6PA 4WNKA 2DYLA 4C0TA 4FA2A 4XV2A 4JLCA 3IS5A 3OMVA 3FI4A 3LOKA 3LMIA 5KZ0A 4YNOA 3VIDA 4IAFA 4WHZA 3R7OA 4EYMA 2PE2A 3EFLA 4AOIA 1PY5A 5J87A 2BDFA 2PUUA 3GU5A 3ULIA 3EQCA 2C6MA 4MXZA 2RKUA 3POZA 4P5QA 4XUFA 1MQBA 4ZY5A 3GCPA 4UYNA 3R04A 3PIYA 2F57A 3KU2A 4JAIA 4EORA 1W82A 4F1OA 2Y4IB 3VS4A 3BE9A 4CFWA 1W98A 4C35A 5L8JA 4O0RA 3GOKA 3EKKA 4KBAA 3U87A 4Q9SA 5IH5A 3DBFA 3FMHA 2RFEA 3P86A 4LYNA 4BDIA 2VTIA 2XNPA 1P5EA 3ZSIA 4DEDA 4BDGA 3EQPA 5CAPA 2GDOA 4TRLA 4OTHA 5FEEA 3N4VA 4BY9E 4FT7A 3KF7A 5C1QB 3GNIB 4G34A 2RF9A 4HGEA 4IQ6A 3GUBA 4K77A 4U7ZA 1GNGA 4C38A 4CFXA 3I0QA 5KUPA 3GEQA 3THBA 5BPYA 2EB3A 4AA4A 3EN9A 3AD6A 2JEDA 1X8BA 3ORXA 4MNEA 3VS1A 4EJ7A 1XH6A 3BRBA 3M1SA 3QWJA 4Y8DA 3OT3A 3TV4A 3R02A 5FWKK 3QQUA 2BCJA 5HVYA 4Y72A 3R1QA 4CEGA 5J9YA 4IZYA 1DI9A 3I6UA 5D7VA 4GH2A 4QMMA 2ESMA 2PUPA 4ALWA 5EOLA 4XMOA 1YHWA 3UVRA 2BRGA 5LCKA 4LQMA 3LJ0A 4I21A 1GAGA 3LXKA 4EUTA 4R7BA 1WBNA 5I9YA 4BYJA 2QO7A 3R28A 5LVNA 3GU8A 4M67A 2EXMA 5BVEA 4DFZE 5KNJA 3CD8A 4DGNA 1M2QA 4DEAA 2BPMA 3LHJA 3AC1A 3EQHA 3DY7A 2R3FA 3IW7A 3MPTA 3BELA 2BFYA 3FBVA 3WI6A 3LFCA 4KNBA 5DEWA 4BWKA 2PMLX 3R00A 2NRUA 3C4XA 2FH9A 4JAJA 2GTNA 3C4EA 4RJ5A 4C8BA 4PY1A 1IEPA 3QKMA 4RJ7A 3AT2A 4U3YA 3UIMA 4EH4A 5E8XA 4DT9A 4FIJA 2FO0A 2X2MA 2C0IA 3LIJA 4YJUA 1HOWA 4CRLA 3AC4A 3OUKA 2JGZA 4Y46A 2WU6A 4RX7A 3WF8A 4DYMA 4EH8A 3QAME 4E4XA 4IVBA 2ETMA 4E4LA 3FLSA 3ZUVA 4CMOA 2QO9A 2ZJWA 5CI7A 2WTIA 4N0SA 3QQGA 2QURA 5A46A 5IDNA 5JGAA 1P4OA 4TW9A 5L2WA 2BZIB 4OTQA 2OBJA 3ZLWA 1URCA 2KTYA 3MH2A 3GFWA 4II5A 4R3CA 4XRLA 3UIUA 5AP3A 4ZLYA 4QOXA 1OPKA 1H24A 2XIZA 3KKVA 4AS0A 3SA0A 3LFBA 4AA0A 2UZNA 4EC9A 4LGGA 4YJOA 4TYHA 3D7TB 2E9OA 4FSWA 4O6LA 5J9LA 3Q9WA 3NR9A 3E93A 5IEVA 3MH1A 3BHUA 2B53A 4YPSA 4QTBA 3PSDA 5EDQA 4V01A 1DAWA 4F08A 3K3IA 5CQUA 2R3RA 4USEA 4K0YA 3ENMA 4IFCA 3NMUF 4UBAA 2CN8A 2OJJA 3MH0A 4M84A 5C03A 4PMMA 3F88A 3OT8A 5EM5A 1KV2A 3FMNA 3DPKA 4YHTA 2XBJA 4FKTA 3RBWA 3EHAA 3QKLA 4A4OA 5IH4A 2IG7A 4L00A 3RVGA 2CSNA 2QU5A 2FSTX 2AUHA 4O0UA 1R1WA 2JBPA 3QRJA 4CKJA 1IA8A 3W2QA 5KX8A 4XG8A 1ZYJA 2OXDA 3G9NA 4ORKA 3IK3A 1BMKA 2O2UA 4IZAA 5T68A 1CKIA 2JD5A 1U5QA 2PMIA 5L2SA 2GQSA 1OZ1A 3QQLA 4K2RA 1OITA 2C6EA 2RGPA 2VTHA 3NYNA 4CQEA 2OJFE 2W17A 3NYVA 4ZMEA 2ZDUA 4QP2A 2PU8A 1YKRA 2JDRA 3FMMA 4FTOA 4RVMA 3TZ8A 4AUAA 3L8XA 3Q6WA 3L8PA 4FIFA 4AZEA 3H9RA 3EQDA 3FL4A 5FXSA 4A9TA 4HCUA 5HICA 3RTPA 3Q9XA 2YWVA 4FG8A 4JRNA 3ORPA 3CY3A 3Q9ZA 5JGDA 2O5KA 5K4IA 5HLPA 1OB3A 2LAVA 3CTHA 4GVAA 2CKPA 4ZTQA 2F49A 1JVPP 3ULZA 5HHWA 2XRWA 5FDXA 3E5AA 1MRYA 2PSQA 4HYUA 3OOMA 3ZDUA 3MA6A 3FZRA 3P7AA 3OCBA 4YO6A 4B4LA 5J1VA 5M06A 1G8SA 3V5LA 4FSNA 2PPQA 5M07A 3NEWA 3NIEA 1RDQE 4RIOA 4C02A 4OAUC 5KBQA 4GRBA 4DH7A 4K6ZA 3G6GA 4ZSLA 3FXZA 5AV0A 4CXAA 4MCVA 3V51A 2OH4A 4I4EA 1XWSA 5I9UA 4B8MA 4TWOA 3GENA 3PXFA 5KCVA 4MK0A 3VUHA 4DEEA 3BX5A 4MYGA 4CFVA 4YLLA 4LMUA 1BKXA 3R8MA 4UMUA 2QOLA 2W1IA 3GP0A 5M08A 3JVSA 5LARA 1CKJA 3KXZA 4EL9A 2G15A 2XA4A 2OKRA 4HPTE 5HE3A 1G8AA 4EQMA 2IPXA 4GVJA 5A4CA 1FGIA 4MH7A 3LXNA 3BU6A 1PYEA 5L4QA 5C8KA 4FIEA 3A7JA 4JDIA 4QTEA 3ROYA 3H0ZA 2JAMA 3D2KA 5CYIA 4FTUA 2B9JA 5ITAA 5EHLA 3CBLA 5B0XA 2HELA 4O1OA 4DG3E 4APPA 4GYGA 5LCJA 5KO1A 3KCFA 3S1HA 1YXVA 3UG2A 2OSCA 2PHKA 2XNNA 4PP7A 2X8IA 3D7ZA 4DH8A 4FK3A 3O2MA 4F9BA 3PDTA 3ZONA 3FV8A 2KULA 2UZLA 5J8IA 1AD5A 3A8XA 4B99A 3Q4UA 4X3FC 4AZTA 4BZDA 2REIA 4ANMA 4P7EA 2GS6A 4YZ9A 3B2TA 4QQJA 4IWQA 3AMYA 4S31A 2X1NA 4W4WA 4L6QA 5LQFA 5M56A 1VYZA 1JNKA 3KRWA 3QC9A 4DEHA 3FQHA 4PDYA 2W1HA 3E88A 2WAJA 4Q2AA 1OKWA 2VGOA 2JLDA 5EQYA 4J99A 4C3FA 3C0GA 1Q8YA 4NUSA 4QP4A 1H27A 3ZO4A 4MKCA 3RAHA 1GZ8A 4GT5A 2YDIA 3PVUA 5FBOA 1U4DA 4XV9A 2BIYA 2R7IA 5CVHA 1CDKA 2JIIA 4RA4A 2J50A 4IDVA 2DS1A 3TL8A 3JR1A 1MRVA 4ZS0A 4AE6A 3T9TA 4BHNA 1SM2A 5FLFA 5AUZA 3MFSA 3IPHA 3UO4A 5EW8A 5K0XA 3BLRA 4PDSA 4GV1A 3QUPA 4IAIA 1AQ1A 5JSMA 5TT7A 5IMXA 1LUFA 3FMDA 4XP0A 3DNDA 3HRCA 4FNZA 4G9CA 1YW2A 4CVAA 1Q97A 2ITOA 3NS9A 4ZJJA 2WKMA 3Q53A 1H07A 4PMPA 3TWJA 2FYSA 3BI6A 4OT5A 4QMXA 5IQIA 3UVQA 2UZWE 1H28A 2CN5A 5HVKA 4GG7A 2IN6A 4D2VA 3ZFMA 4O2ZA 3AC2A 2X4ZA 2GQGA 2VWXA 4PL5A 5I5ZA 4QP9A 2QD9A 5JMSA 4GUBA 5AP5A 3CXWA 4Q9ZA 2YIWA 4CG9A 4M8TA 3PA3A 4FZFB 1HCLA 4LG4A 4YZBA 2B54A 4QPMA 4C4GA 3GC9A 3VUIA 5E8WA 1YOLA 2R3HA 3QALE 3E7VA 3V01A 4EOSA 4EOPA 4I0SA 2ERZE 3KXGA 4KIQA 4ITHA 3O8PA 4WKQA 3U4WA 1XO2B 4LRMA 5EQEA 3PJCA 5IA2A 4KSQA 5H8GA 5I0BA 5AR5A 3UQGA 2YEXA 2Z7RA 4M69B 1BI8A 5HU9A 4EK8A 2WTDA 1XBCA 4FGRA 4YUQA 5HTCA 4BDFA 3PJ8A 5KHXA 2O3PA 4QMVA 4WRSA 4QYHA 4RIWB 4F7LA 2C5XA 3DFCB 4M13A 4Q5HA 3HP2A 4J97A 4YZCA 3GCUA 1GY3A 2OW3A 3M42A 5TOZA 4O0YA 4USDA 4JIKA 1OM1A 4AZWA 2C6KA 4LL5A 5TO8A 4CYJA 2W1DA 4FTLA 3QD0A 3RZBA 2XK9A 2YCSA 3FHRA 3QGWA 4HVDA 3HAMA 3RALA 4BCKA 3D5VA 4YR8A 5IQGA 4TT7A 2A0CX 4FEWA 3PY0A 3FI8A 2YHVA 5A4TA 3FZSA 5L2IA 4ERWA 4IX5A 5D10A 3V5JA 4U9AA 2Q0BA 4O82A 3BHYA 3LFAA 2YAKA 1PKGA 3RP9A 1IASA 3B8QA 2Y4IC 4J7BA 4DFNA 2H8HA 3P78A 3UP7A 5AJQA 3QF9A 1SVEA 3L9MA 4L3LA 3ZSHA 4O6EA 2R2PA 3COIA 1YOJA 2V5QA 4CV9A 2AC5A 1VZOA 5I3RA 4XX9A 4NCTC 4OBPA 4I20A 3ENHA 3UG1A 2VO0A 2AYPA 1W7HA 1ZWSA 2VWYA 3POOA 3VS2A 4BI2A 4C33A 3FYKX 3GU7A 4ERKA 3HKOA 4DFXE 4RWIA 3NNXA 4JJRA 3BKBA 5FEDA 3NW6A 4EKKA 4EH5A 2BFXA 3E63A 2W06A 3MIYA 2QCSA 3LVPA 1YI4A 4F63A 3VF8A 1GOLA 1TQIA 2IZSA 3MN3A 3VWAA 4BF2A 2YM7A 5IEYA 1KOBA 3WARA 3LLAA 4HCTA 3O96A 4IHPA 4KRCA 2W1ZA 4QTDA 4FZAB 2O64A 3OFMA 4ZSGA 3KMMA 3RCDA 2C6LA 3AOXA 3V5QA 2V55A 4CRSA 1Y8GA 2GU8A 4IZ5A 5CQWA 3VUTA 3F5XA 3WZDA 2YM6A 4FZ6A 5CLPA 5LVLA 3AT3A 4FKJA 5JH6A 3FMJA 3UBDA 5BVOA 1APME 5EDPA 1Y8YA 4APCA 4QMOA 1OL2A 2W1EA 3H4JA 4MD8E 4I6FA 4EEVA 4FSZA 3R8UA 4D58A 3HDNA 4XBUA 3QTRA 3KMUA 3I0OA 4YNEA 3VS3A 4GU6A 4XS2A 3WZUA 1H0WA 3JUHA 5JRQA 2WMTA 4BCNA 1RQQA 2XM9A 3ZEPA 2HWOA 5GZ9A 3NUUA 3Q4ZA 4GT4A 3NIZA 2XNOA 4YZDA 1IG1A 3BU3A 3TXOA 4KINA 2XP2A 1CMKE 1YHVA 2OZAB 2FUMA 3PE1A 4H36A 5KMKA 3BGZA 4FL3A 5GHVA 3DGKA 4X3JA 4IB5A 3KULA 2G01A 1XH9A 4RVTA 3OCTA 2VNWA 4TYIA 4FKWA 4XCUA 3TM0A 1OUYA 2X7GA 3LE6A 4QQTA 4FBXA 4E4NA 4PDOA 2QOKA 4M97A 4FVPA 4ZLZA 2VX0A 3TUDA 5CF4A 4FEQA 3UOHA 1MP8A 5G1XA 3PWDA 2JKKA 2WTJA 4WG4A 5CXHA 5C27A 4ZEGA 2QR7A 3UOLA 2PVYA 3COMA 4H3QA 4ITIA 3D15A 4RMZA 3W55A 2YDJA 1XH8A 4MXCA 5CU6A 4TZRA 4FSMA 3RKBA 1U59A 3CSVA 5GNKA 3CC6A 4WG5A 3Q04A 4MD7E 4NCTA 5AUXA 3SXSA 5A6OA 1T46A 1YDTE 3EIDA 3F82A 4EKLA 3KMWA 4ANBA 5JFXA 3HUCA 5I9VA 3ZFXA 4U80A 2X4FA 4HPUE 5IA1A 2JFMA 3D9VA 3LFQA 2BZJA 4UMRA 4YU2A 3ORKA 3PSCA 5HNBA 4H3BA 4I0TA 5CZIA 3G33A 2UW7A 3ZS5A 2E9NA 4G6OA 4AQCA 2B9HA 5FGKA 3COKA 3VBWA 4AF3A 5H9BA 2BAJA 3EYGA 4LOPA 3W1FA 4FKPA 5M4IA 5BVFA 3IW4A 5AWMA 5JN2A 4XEYA 4NTSA 3BWFA 2HW7A 1P4FA 2G2IA 1PMUA 2XK7A 4F0FA 5C26A 3BBWA 3VAPA 2Q0NA 4YTHA 3ZRMA 4RX8A 1FMOE 2JBOA 4EK4A 5FDPA 4NM0A 4TNBA 2G9XA 3DJ6A 4ZY6A 3RPRA 2PZ5A 4FR4A 3FXXA 2YM8A 1UU9A 4GJ2A 4FTQA 5IMEA 3HP5A 3QD2B 2VUWA 5A3XA 3AXWA 3CIKA 5BVWA 4M7IA 3UZTA 1YRPA 3MYGA 4R8QA 5AM7A 4ZIMA 3RPSA 3TN8A 5JFSA 4EOJA 2XK8A 3BBTB 2QOQA 1TKIA 2R3PA 2VTMA 4TYJA 1YOMA 2JDOA 1GZKA 3FL5A 4M0ZA 4E93A 4MQ1A 1WVXA 2O63A 3NGAA 3QGYA 4OTDA 3OHTA 2FVDA 2ITWA 1JAMA 3KN6A 3PVBA 4BDAA 3LAUA 4YLJA 3LXLA 2UW3A 4AAAA 4LMNA 4N4SA 4LL0A 3K5VA 3RWQA 1H1PA 2C1BA 4NWMA 3T8OA 3ZTXA 3V5TA 3S2PA 3QUDA 2W0JA 2PMOX 5EI8A 3D83A 3GI3A 5CU2A 4C4EA 3E8DA 1PMVA 3QQFA 1GIHA 1ERKA 4OTRA 3DBCA 4RBLA 5AV2A 2CGUA 4LV8A 4AX8A 4FT3A 1GJOA 2VTRA 4BFMA 2A4LA 2GTMA 2XKFA 1Z9XA 3K54A 1Q24A 3FSFA 3VS5A 1J7IA 3BQRA 4OR5A 2YZAA 4AZVA 4D2PA 5CT7A 3ZC5A 2GHGA 5BVKA 4B6LA 4ZSEA 2XKEA 1UNLA 4JS8A 4L52A 2GHLA 3RGFA 3VW6A 2R4BA 1H26A 5CNNA 2WELA 3C9WA 3MBLA 4QMWA 3ZLSA 5IISA 5J5SA 3JY0A 4HNIA 3VS7A 2WGJA 3DAJA 4I41A 3UNJA 3R7IA 4FKVA 3V8SA 1OKYA 1BL7A 4HOKA 3NDMA 4UZDA 3FAAA 4ASZA 4WRGA 3P5KA 2P3GX 4I5HA 5LVMA 4JX7A 3QHRA 4RC2A 3VULA 4ALVA 5IDPA 2UV2A 3A61A 4JG7A 2CLXA 3PE2A 3K3JA 4S34A 4XBRA 3DTCA 3NUSA 3KQ7A 3Q60A 4EHGA 5FXQA 4O0WA 4O7NA 3DAEA 2WIHA 2PZRA 3RNIA 1QPJA 4J8MA 2C3LA 4E73A 4CFUA 4AWIA 4J1RA 4NW6A 3R7YA 3F2NA 4RSSA 1H1SA 2YFXA 4YGAA 3GOPA 5KZIA 4YBKA 3NVMB 4BBFA 3EH9A 2J0LA 5EW9A 4ZMFA 3WF9A 5HTBA 3TKHA 4H1MA 4KSPA 2YITA 4UXQA 1UWJA 1H0VA 3DB6A 1XBBA 4N57A 3V8WA 3DDQA 2RFSA 3NUXA 4RLLA 1UWHA 3U51A 3FKLA 3BHVA 4FNYA 3UIBA 4ZZOA 3O23A 4I5PA 4EJNA 3P1AA 4JX3A 4WUAA 5AIKA 4UMPA 4PPBA 5E9EA 2W1GA 4BZNA 3P7BA 4KD1A 3KXHA 4AOJA 2Z7SA 4A9YA 5LXMA 4O7SA 2UW8A 4F0IA 4FICA 3AC3A 2OIBA 2C6IA 2R0IA 2VTSA 1Q41A 4DG2E 1UA2A 3HV3A 1H1WA 3LJ1A 3A7HA 5JQ5A 3LJ2A 5AR7A 3FPMA 4XG3A 3WE8A 3U6IA 2WMVA 1TQPA 4ANNA 4FE2A 2ITZA 5CS6A 3WZKA 4TY1A 3LFFA 4YP8A 3Q9YA 3LFEA 2W1CA 1BL6A 2PZIA 4CT2A 4EH6A 2OFVA 3QFVA 2C3JA 3UPXA 3FLYA 2GMXA 3L9PA 1BX6A 2O0UA 1KE5A 2FB8A 3E87A 2CGWA 4IXPA 2X6DA 3TTIA 4TPTA 4PWNA 2IVTA 4PP9A 1FBNA 4FV9A 4RC4A 1JWHA 4OTWA 3AC5A 3QA8A 3RPYA 4CD0A 4DFBA 3PY3A 3ROCA 1NVSA 3WILA 3WZJA 1Q8TA 5IQHA 4NH1A 4K33A 3CTJA 1UVRA 1P2AA 2QU6A 2XCHA 2XK6A 3MFRA 5IA0A 4IANA 2CGXA 4O2PA 4B8LA 2GFSA 4FVQA 3WF7A 2QNJA 3QKKA 3NAXA 4MD9E 4C57A 5AA8A 4FZ7A 2EU9A 2IZTA 2VTNA 3UDBA 4C36A 2PULA 3KF4A 3KEXA 4K8AA 3PYYA 4BGHA 4Z16A 3UNKA 3EL7A 3HMNA 4RA5A 5E7RA 4FMQA 4S30A 5AAFA 2PTKA 4BTJA 3OY1A 4PX6A 4E8AA 3OBGA 3K2LA 5HBJA 4V0GA 4Y5HA 4DFLA 3IOKA 4RJ6A 5K0KA 2G1TA 3RNYA 4KBKA 4K9YA 3UOKA 4BI1A 4CNHA 4DLIA 3QZGA 5JGBA 4UZHA 3ETAA 3C4ZA 4RG0A 3EYHA 4ENYA 1WCCA 3FMLA 4JG6A 3DS6A 4IVDA 3DK6A 3QU0A 3LZBA 4KWPA 4EHEA 5HBEA 4XOYA 3UC3A 4ZS4A 4O0TA 2WMAA 5HG7A 5H3QA 2UVXA 2PE0A 3I60A 3TEIA 3FY2A 3KC3A 2UZOA 4PMTA 2GNHA 4F9YA 3C4FA 3MTLA 2ZMDA 1YHSA 2CCHA 3NAYA 1WBSA 4FV1A 1ZXEA 4GIIA 5J9ZA 2VWUA 3TT0A 2I1MA 2WMWA 3ZRKA 4FT5A 4LUEA 5HI2A 4RX9A 4EZ5A 5CAUA 4QT1A 2X7FA 4HYHA 4FTMA 2Y4PA 2Y6MA 2QHMA 3DQWA 3OD6X 5D1JA 5AP7A 3FZOA 3AGMA 3VHEA 1M7NA 1ZYCA 2BRBA 3R2YA 2PVMA 3MFUA 1XBAA 4PMSA 1PMEA 2VZ6A 5HX8A 4CCUA 2XMYA 4XV1A 3F3UA 5DEYA 2WTCA 3GC8A 2I7QA 4AFJA 5IUGA 2X0GA 2CLQA 4BCQA 2B52A 1Q8ZA 4UB7A 3EQRA 4XP3A 5EDRA 4G5JA 5HKMA 4IVAA 4C61A 5BNJA 4I24A 4X6QC 4DFUA 4G16A 3C0IA 3I79A 5F20A 4NIFA 2W5AA 3UVPA 3I1AA 5HEZA 2JDSA 2VAGA 3OTVA 4CSVA 1ZAOA 4Y73A 2YZLA 4BTMA 4XH6A 3ORLA 4DTKA 1I09A 3Q96A 2G2HA 3KCKA 5H8BA 4MBIA 2JDVA 3IDPA 1FPUA 3V8TA 3HA6A 2BKKA 1UU3A 4UN0C 3QRKA 4IX4A 3SAYA 2VN9A 4RPVA 5HVJA 3EMGA 3NNVA 4BRXA 3ACJA 3OG7A 2GHMA 4AW5A 3CLYA 5IA4A 4FV4A 2JITA 2PE1A 2GNFA 2YCFA 3CE3A 4UY9A 4G3FA 4RIYA 3SX9A 3RINA 5E1EA 3R9OA 1FVRA 4AN9A 4MXOA 3LM5A 4YTFA 4ZLOA 4OTIA 2ONLA 4WNPA 5DI1A 2EB2A 2ITPA 3F3WA 2H96A 5CNOA 5FEQA 1OVEA 2F2CB 2IW9A 1PF8A 3DAKA 3OEFX 2XIXA 1G3NA 4G3GA 5C01A 2WZJA 1M2PA 4HNFA 4TNDA 4C37A 3CD3A 4IJPA 3D94A 3FE3A 2BAKA 4C4HA 4N6ZA 4PPAA 4EH2A 4CTCA 5BYLA 1O6KA 2I0HA 4BCPA 1ND4A 2ZMCA 3PPJA 5AUYA 5EK7A 4HVHA 4UYAA 5BMMA 4O84A 1Y6AA 3SRVA 3V5WA 2J6MA 4ACCA 3PXZA 1PJKA 1H1RA 4RIXB 3LCTA 4X2NA 1PW2A 1KWPA 2ITUA 4ANOA 4AZFA 5GJDA 4AN3A 4D1SA 3IONA 4LOOA 5BUJA 4W4VA 3CGOA 2HWPA 3DKGA 3FC2A 3LKMA 3FMKA 3GCSA 4X2JA 4JI9A 1JPAA 2XS0A 2PVJA 2VD5A 4YBJA 3Q4CA 2I0VA 1I44A 3SXRA 3GQLA 4YURA 4RQVA 5TR6A 3QTSA 3NSZA 2HW6A 4LUDA 4L7FA 1O9UA 5C8MA 4FV2A 4YO4A 3EJ1A 4CZUA 4F0GA 4GFOA 2AC3A 3PPKA 5M51A 3ZXZA 2VTPA 5DG5A 4EOKA 2W1FA 3H9FA 3TNHA 4CG8A 3BYOA 3BLQA 3DXNA 4J8NA 4YJQA 2YAAA 2XNEA 2VWWA 3FZPA 1J7LA 4RWKA 3CEKA 4BGGA 3A60A 2SRCA 4O7TA 3V3VA 4ZTMA 3RK9A 4QNAA 2GCDA 4YJTA 3L9LA 3DCVA 2XCKA 3RAKA 3QYWA 1JKKA 4BL1A 3WE4A 3GVUA 3A4OX 2VWVA 3AD5A 2R3IA 1GIJA 3N9XA 2C5YA 2XYUA 4JDKA 4ASXA 2OIDA 1R0PA 2VTOA 3QCQA 1J3HA 3P0MA 5T3QA 3MGYA 3TNQB 4BCMA 4DH3A 4IJ9A 1JQHA 5HO8A 5A4EA 4IX3A 4KABA 4TTHB 5A6NA 4L01A 3OOGA 4MNEB 4QMYA 3UO5A 3S00A 4X21A 2RSVA 3S0OA 3U8WA 4JL9A 3ATTA 3TNPC 1W8CA 4X6RA 4NJDA 4YZMA 3ZLXA 2ITXA 4XRJA 4YSMA 2G2FA 3KK9A 3AMAA 4G5PA 4MAOA 4H1JA 3PJ2A 4W9XA 3CCNA 3V5PA 4NKAA 4AT5A 1PXIA 4KS7A 4Z7HA 3A2CA 3D4QA 5JZNA 3QRTA 4I5CA 2RFNA 3BV3A 2JFLA 4BB4A 4FV5A 2OJIA 5CTPA 3T3VA 5I9ZA 4F9CA 2F4JA 5DLSA 1WBVA 3A99A 1BUHA 2BUJA 1OIYA 4EOIA 4O7WA 3R0TA 4O0SA 5L3AA 3RMFA 3ZCLA 4AGUA 4IM0A 1Q99A 5CSHA 3A4PA 5CSVA 3QTWA 1B38A 4NU1A 1OI9A 1ZZLA 2X2LA 5DT3A 2YACA 4RFZA 3AGLA 3KVXA 3II5A 3AG9A 4BICA 3V04A 4XJ0A 4FV3A 2W4JA 4O83A 4TXCA 4NSTA 1YXSA 2PVHA 3R01A 2NPQA 4HGTA 3VVHA 5LMKC 1H1QA 3NUYA 1ZOEA 2V0DA 4IMYA 3VN9A 2DUVA 4NIFB 5AM6A 3MV5A 4PNKA 4DFYA 4RC3A 1PHKA 2YIYA 3R1NA 4CKIA 1WAKA 4OLIA 5HIEA 3G5DA 4YZNA 2W9FB 3NUPA 3PP1A 4MVFA 3MY1A 5E8YA 2YJRA 2EVAA 3VNTA 2Z60A 4W8DA 3PPZA 4XP2A 4UMQA 5DNRA 4PL4A 5T6KA 2RIOA 1WBTA 3R2BA 3W2SA 5CASA 4GYIA 5A54A 2OZOA 4NEUA 1UNHA 2OG8A 4IC7A 3R83A 4FKOA 4I5MA 3SLSA 1Q61A 4R5YA 4DLJA 3BEAA 4ALUA 4EOQA 3OUNB 4XNEA 4QTAA 4TYHB 2R3LA 2O8YA 3FQSA 2HZNA 2PL0A 1Q4LA 3ORIA 5EM6A 2BMCA 1LP4A 3F2AA 4E5AX 5K3YA 2CKEA 2QKWB 4PPCA 3ZOSA 1CSNA 2VO3A 3LFNA 4E6CA 4QMSA 1DM2A 2A1AB 4BCOA 2JAVA 2QOBA 2QQ7A 1Q3DA 3QQHA 3MPMA 3H30A 2VGPA 4Z55A 4C2WA 2XF0A 5ETFA 3R9NA 4M3QA 2HYYA 2WU7A 4EZ7A 2XRUA 3QXOA 4R77A 1KE6A 1ZRZA 4Y5QA 4A9UA 2V7OA 3ZO2A 3VF9A 3VUKA 2LGCA 4MF0A 5DR9A 3PXKA 4C4JA 1Q3WA 5C9CA 5KMMA 5FP6A 5JKGA 2YIRA 2YLFA 4KRDA 1B39A 4ENXA 1JLUE 5F94A 2JKOA 3GCQA 1LR4A 5HG5A 3R73A 2C0OA 2QONA 3FI3A 4Y95A 3SVVA 4BDHA 5HNGA 4PUZA 2EWAA 4ANSA 3AT4A 3QLGA 4S32A 3VBYA 3UOJA 2QC6A 3BZ3A 4GUEA 5E92A 5CAOA 3C51A 4DTBA 2ACXA 2YABA 3GB2A 4QO9A 5TKDA 3QD3A 1DI8A 2VV9A 4WUNA 4O86A 3BYMA 4OTGA 3QRUA 4NK9A 4X0MA 4XG9A 5F1ZA 4HJOA 5HCZA 3OVVA 3NRMA 5LWMA 1JOWB 3PXYA 4ACHA 5CAVA 2RFDA 1DS5A 5K4JA 4ZJVA 5HNIX 1PXJA 1A06A 5KKRB 2GNLA 1MQ4A 5EYDA 5KE0A 3BYUA 3NUAA 1PXNA 4YC6A 1Q5KA 3M11A 1BI7A 3UPZA 3IGGA 4JRVA 2YM3A 1ZMUA 4QMUA 5DPVA 3ZO3A 4O0VA 4YSJA 2CMWA 5IQCA 3G0FA 5L6WL 4U45A 4FI1A 4QMNA 3LCOA 2VTQA 2UW0A 1WBPA 4RJ8A 4S33A 1WVYA 3ZLYA 4FIGA 3QXPA 1H01A 3PG3A 3NYXA 4U42A 5GINE 2WB8A 3R71A 4LM5A 4DAWA 1J91A 5BQ0A 2WQEA 5EM8A 2OFUA 3KRXA 4MTAA 5IUHA 1S9IA 2UZVA 2VO6A 4FG9A 1XJDA 3EQGA 1WBWA 5HIBA 1Y6BA 3F5UA 3RI1A 3D5XA 4D55A 3VRYA 2VNYA 4LRKA 5AP4A 3SW4A 2PZPA 4BDDA 3DJ5A 4IM3A 3BU5A 2QOOA 3DK3A 4EZ3A 3N4UA 3RPVA 2UZBA 1M14A 2PVRA 4CLJA 3HV5A 3E92A 3CKXA 3LQ5A 5JT2A 4S2ZA 3LLTA 3M2WA 3LCDA 3CJGA 2HXQA 2WMUA 1JKSA 5CWZA 1PXOA 3PJ1A 3QTXA 4XOZA 3QWKA 4FV0A 2ZM4A 5IQFA 2PWLA 4GK3A 3UP2A 3SHEA 1PXMA 5AAGA 4O22A 4FSYA 4XHKB 1IAHA 3DQXA 4EBWA 1U54A 4UWCA 4L7SA 3T9IA 4X3FA 4CMUA 4BIEA 1F3MC 4JVGA 3FLNC 4BGQA 4CYIA 3DBDA 3HUBA 4FSRA 4OUCA 4IWDA 4BKJA 4JOAA 3E8NA 4NFNA 1LEWA 3SXFA 1FVVA 1FMKA 3C1XA 5B2LA 3WIGA 3HA8A 4H58A 4ONAA 3HX4A 3QCYA 3RAWA 3ALOA 2I40A 2ZYBA 3QD4A 5DT0A 4LGDA 4D28A 5HD4A 2GQRA 3I6WA 3Q32A 2H6DA 1G5SA 2YLEA 3F69A 2WMSA 1RW8A 4WG3A 3EWHA 3KFAA 4I6QA 2R0UA 1U5RA 5CZHA 5ANEA 5E91A 3BYVA 5GIOE 4FEVA 2R5TA 4BBEA 4QYGA 3OC1A 4C3PA 5CY3A 1QPDA 4R7IA 3UNZA 4F6SA 3WYYA 1V0PA 5H2UA 4C34A 5AR3A 5M57A 4F65A 5EKNA 4I93A 4GKIA 1H08A 2X7OA 5EI2A 3AMBA 2GNJA 2J90A 3BYSA 3R7VA 5AR4A 4GKHA 4L3JA 4DHFA 5CSXA 4IAZA 5ETAA 3LPBA 3NUNA 4FODA 5HO7A 1PRYA 5AFVA 4L3PA 1ATPE 5HE2A 1PXKA 4KUJA 5FP5A 1JSUA 2R3QA 1L8TA 3DFAA 1OL1A 4L46A 2C5OA 3TV7A 3MDYA 2HY0A 4PQNA 4EHVA 2YIQA 2B7AA 1WBOA 2HZIA 4KIKA 4E6AA 3TZ9A 3ANQA 4AGWA 4FSQA 2BIKB 2XJ1A 5DMZA 5HLNA 3EQIA 3N51A 2E9VA 3RPOA 5HTIA 5DIAA 3OS3A 4M0YA 4WOVA 3R7EA 2C68A 3QA0A 3BGQA 3BGPA 3QCSA 2BZHB 3C50A 3FWQA 3NWWA 1GIIA 2J0JA 3FXWA 3OTUA 2HOGA 2XEYA 4D0WA 5L2TA 4O7LA 4YTCA 2R3JA 2C3IB 1M52A 1QCFA 3PUPA 2YISA 3PXRA 5FRIA 3UMXA 1XH5A 2F7EE 3OW3A 5D7AA 2GNIA 2WQMA 3QZIA 3IW8A 4I0RA 1YVJA 5EFQA 5AP1A 4ZTHA 3JVRA 5J95A 3T3UA 4I4FA 4EH9A 4YHJA 4HYSA 4YMJA 3BLHA 3MIAA 4IDTA 4QPSA 4R1VA 5CSWA 3TIYA 3R30A 3G51A 2UZTA 3C13A 2VU3A 3Q4TA 5ANKA 2EUFB 2YDKA 4DGMA 5BYYA 2Z2WA 5IU2A 3TDWA 2QKRA 4A9RA 5JFWA 3DOGA 1SYKA 4OBQA 3GFEA 5M55A 5EKOA 3HGKA 4EWHA 3MI9A 2QO2A 2X8EA 4G17A 1ZLTA 4NTTA 4R78A 4O7RA 4K11A 3TUCA 3O50A 4I1ZA 3WOWA 2XNGA 5CALA 5HLWA 2NNWB 1YI6A 1ZZ2A 4AW1A 4J95A 4FC0A 4I3ZA 5JFVA 4D0XA 3Q2MA 4P5ZA 4U8ZA 2GNGA 1OIUA 3P08A 1RE8A 2Z8CA 3RK7A 2YIXA 2XZSA 2BRHA 1UNGA 3R9DA 4U40A 1YWRA 2X8DA 2H9VA 5CU3A 5JZJA 3H0YA 2YERA 3MS9A 3TKUA 2W96B 2HIWA 4R6VA 3ORTA 4X2FA 3CGFA 4UMTA 2CGVA 4QPAA 2XM8A 4FEUA 4J98A 5AX9A 2HCKA 3G9LX 4WSQA 5AUWA 3FHIA 4IVCA 3S3IA 4ACDA 3ZM9A 2GS7A 3MB7A 3BHHA 3ZBFA 2XK4A 5DFPA 5DOSA 4Z9LA 4C62A 4D4YA 4BIBA 3C5IA 3W2PA 2WMQA 4CCBA 4XLVA 4O38A 3ZH8A 4FIHA 3RHXA 3ODZX 2C30A 2ZVAA 3VUMA 3QC4A 4XG6A 2FSOX 3D5UA 3QHWA 4PL3A 1STCE 5AP6A 3VHKA 3ZDIA 3LXPA 5DRDA 4C7TA 4DINA 3KXNA 3TUBA 1U46A 4D2WA 4BDBA 2R3OA 2PUNA 2UW6A 4IADA 3F6XA 1F5QA 4PDPA 2OF4A 1URWA 2J7TA 3FQEA 3IDCA 5FTGA 1V0BA 3PXQA 4G9RA 3E7OA 3A62A 3GCVA 3ZXTA 3A7FA 1K2PA 5IZFA 2PVNA 1WFCA 4AFEA 5EM7A 2IZUA 1WVWA 3G2FA 3NPCA 3MSSA 4FTJA 4IAAA 4WBBB 2PZYA 2XBAA 3PZHA 4U44A 3QRIA 1Q62A 2BHEA 4JDHA 4ZK5A 3L1SA 4I23A 4W4YA 4EQCA 4UXLA 4FV7A 1UV5A 3KULB 4MWHA 4YJSA 2BVAA 4ZTNA 2ZV2A 1XH4A 1XKKA 4NJ3A 5M4UA 2VWIA 3ZUUA 4KKHA 2OJGA 3O8TA 3RJCA 5GIPE 4I6HA 5IH6A 1WMKA 3ZFYA 4D9TA 3IDBA 1NT2A 1NY3A 2WO6A 4XG4A 4DBXA 1JKTA 3HRBA 4KAOA 5EQPA 4PV0A 1YXTA 5IQAA 4NW5A 2WXVA 2OH0E 3C0HA 4RFMA 2JIUA 2VTLA 3ID6C 5GZ8A 1CTPE 4FZDB 3I7CA 1UKHA 2P2IA 4GFMA 4BDCA 2BALA 3NNUA 3OP5A 3F3ZA 2EXEA 1H25A 5CEIA 4F4PA 1TVOA 2R3GA 3QZFA 3TKIA 3UMWA 4UALA 4WIHA 2F2UA 5AAEA 3DLSA 3VBVA 3DV3A 2OGVA 3ERKA 3QUEA 5CT0A 1FGKA 1F0QA 3RZFA 3VJOA 4BWPA 3P79A 4JNWA 3JXWA 4PTCA 3KRRA 1RJBA 2J5EA 3PTGA 3AQVA 3BWJA 3C4WA 4N70A 5AV4A 2JC6A 2B1PA 2XNBA 3HDMA 4D2TA 1BYGA 3TCPA 3KA0A 4FV8A 5HQ0A 3D7TA 3EOCA 2BRMA 4JR7A 3W8LA 4DE4A 1QPCA 1R0EA 3BV2A 3EZVA 4OGRA 4GK4A 4IX6A 3OWKA 3GC0A 3HL7A 4FUYA 5KMIA 4D2SA 4O7VA 4QQ5A 2R7BA 2OJ9A 2IVSA 2OWBA 3ALNA 3PFQA 3H10A 3KRJA 3QTIA 4W4XA 4XV3A 4N6YA 3TV6A 3ZC6A 2BDWA 5EH0A 3VO3A 4G6LA 4IE9A 4MF1A 4XYFA 1UU7A 2WMBA 5CU4A 3ZHPC 5EYMA 5IPJA 3EFKA 4LV5A 4FL2A 5J1WA 4NZWB 1OBDA 5JQ8A 3SQQA 5CF6A 4CMTA 2HY81 4D4SA 5IF1A 3R8PA 3BIZA 3UZPA 2YWPA 4E5WA 5AUTA 5J79A 4D1ZA 5K9IA 4W9WA 4ANQA 4DGOA 2ERKA 4GMYA 5AUUA 4KS8A 4F70A 3IQ7A 2F7ZE 4F64A 5AEPA 2QOFA 4F7NA 5KKRC 4GU9A 4E5BA 4AN2A 2NRYA 3V6RA 3JS2A 4FUXA 4L43A 4FK6A 4QMPA 2PVLA 2ZM1A 2I0YA 4I22A 4WNOA 5DYJA 2J0KA 5TE0A 2GPHA 4CTBA 3SW7A 3CQUA 1KE8A 2P55A 2JDTA 4HYIA 4MHAA 2OXXA 4YJVA 3PRIA 3RWPA 4PTEA 2PUIA 3KGAA 5EHOA 4WSYA 3H9OA 2YM5A 4EOLA 3B2WA 4G6NA 3TI1A 3NVKI 2QLUA 2IWIA 2WEVA 5AMNA 2CKQA 3OEZA 5CEQA 4V04A 2XB7A 4HGLA 3KREA 5A4LA 1JKLA 1PXLA 2C6TA 4BI0A 4GS6A 4D4RA 3E64A 3ANRA 4EWQA 5I9XA 5DBXA 4C3RA 5L8KA 4EBVA 4FF8A 4FVRA 5HORA 5AX3A 3R7GA 4U6RA 1VYWA 1V0OA 3Q2JA 2HZ0A 3R1YA 2XKCA 1YXUA 5HOAA 4NFMA 4BCJA 2JKQA 3L8SA 1XQZA 3CPBA 1PXPA 1OPJA 2A2AA 3P7CA 2HZ4A 4FTRA 3R8LA 3C7QA 3O71A 3MTFA 4O7YA 4D5HA 3KB7A 3QLFA 4CLIA 1ZMWA 4F1MA 3VW8A 3HZTA 4F9WA 4IWOA 3OW4A 3FZTA 3U4UA 2CNQA 4UEUA 4BZOA 4DBNA 5DA3A 5M4FA 4HCVA 3COHA 3F5GA 5FXRA 5CU0A 5CEPA 1GZOA 2PMNX 4MNFA 3VBQA 1B6CB 2ZOQA 3FKOA 2XUUA 3TG1A 3F66A 4TN6A 3MJ2A 3R8VA 3UIXA 1QPEA 2B9FA 3D2IA 2UVZA 3EQBA 4F09A 1R39A 5EYKA 2X9EA 3BQCA 1FOTA 4AGCA 2Q83A 3UO6A 3ZZWA 4QYFA 3MA3A 4TWCA 2A27A 3TZMA 3FEGA 1ZYDA 4KKGA 2WTWA 1O6LA 3GU4A 2FA2A 4BYIA 3Q5ZA 4DC2A 2WHBA 1PYXA 4O81A 3DZQA 5CEOA 3DTWA 2JKMA 3FY0A 4FKRA 3DLZA 3EN5A 3R6XA 4KIPA 2W5BA 2E9UA 5G6VA 4WD5A 5D9HA 1SZMA 4XLIA 4U3ZA 3UJGA 4GCJA 2E9PA 5L6OA 2CNUA 4YLKA 4P90A 3R22A 4U43A 4TWNA 4XG7A 3DBEA 4HVSA 5L8LA 5IQBA 3Q3BA 3ZO1A 1VEBA 2J0MB 2WMRA 1MUOA 4YTIA 3TJDA 4QNYA 2X39A 4NKSA 5HBHA 1YXXA 4GIHA 3PG1A 1WZYA 4ASDA 2Y9QA 3TNIA 4PF4A 2XK3A 4OTPA 4QYYA 3OF0A 2OO8X 4MBJA 1CKPA 1SNUA 3GU6A 3KRLA 5DGZA 2BHHA 4FT9A 4BDJA 4QYEA 3U9CA 4BC6A 3VUDA 3HAVA 2VWZA 4QP1A 4JBVA 2W9ZB 3WBLA 5B2KA 4ZSJA 5IA5A 3C5UA 3CKWA 5KMLA 3WF6A 3QCXA 4IW0A 4KA3A 3RAIA 3VBXA 3WZEA 4JG8A 4IB3A 5HGIA 4D9UA 3QL8A 3MVHA 4ACGA 4GSBA 3ZUTA 1NA7A 2B0QA 5E4HA 2XKDA 1XH7A 2YCRA 4AT4A 4BVUA 4ZZNA 4M69A 1EH4A 3DXQA 3MPAA 1XR1A 2R3MA 4IAKA 4RIWA 4TL0A 3Q5IA 2C0TA 4RWLA 4HVIA 4F6WA 5K5NA 3FUPA 3CP9A 5LVPA 3FLWA 4BWXA 4V0GB 1IRKA 4U97A 3UYSA 3NNWA 4EHZA 2R3NA 3HNGA 3V6SA 4C59A 5GJFA 3B8RA 2OI4X 2BDJA 3VQHA 3R1SA 4FTCA 3SD0A 3JY9A 2NO3A 5FUTA 4C4IA 2Y8OA 2F7XE 4EQUA 4WO5A 3CTQA 4DGLC 1PMNA 3SOCA 5LMBA 3UQFA 5FD2A 5BUEA 2GSFA 3I81A 3MW1A 2ITVA 3NW5A 1SNXA 2Y7JA 3D5WA 2X9FA 3DDPA 4GJ3A 5DE2A 1K9AA 3PZEA 3HMIA 2J2IB 4B9DA 5KMNA 4FKLA 4DT8A 1OL7A 1KV1A 4HVGA 1S9JA 5CANA 5E1SA 2O65A 1YDSE 3UYTA 2ZM3A 4LRJA 3F2RA 4MQ2A 3CQEA 2A19B 1OL6A 1ZOHA 4JQ7A 4IM2A 4PRJA 3RM7A 4H39A 3W2CA 1YQJA 4CGAA 3EQFA 2XNMA 5HIDA 3KXXA 4TYEA 3UC4A 3AC8A 2Y6OA 2HXLA 2F9GA 3ORMA 5KMJA 3DKOA 5M53A 5I4NA 3ET7A 3PA5A 4HZRA 5M4CA 3SG8A 3F3TA 5ETIA 3VBTA 1NW1A 1BLXA 3DBQA 4FNXA 5C8NA 5KMOA 4I94A 1YWNA 4ZZMA 3SKCA 3IKAA 1ZY5A 2PVKA 3FLQA 4PTGA 4AZSA 4RFYA 1LEZA 4MEDA 4YJRA 3PY1A 3PP0A 3W16A 4EOMA 5BUIA 2C4GA 4J52A 2RL5A 4NM5A 4RLKA 1ZMVA 5LJJA 2ITQA 4USFA 4DCEA 2X2KA 4Z7GA 4FSTA 4OW8A 3HLLA 4BCFA 3DXPA 2J9MA 3NZ0A 4DA5A 4AT3A 3IG7A 3GXLA 3U9NA 2QOHA 4BCHA 3FYJX 4R5SA 1OKZA 3GBZA 4BDKA 1OKVA 4BCIA 4RZVA 3W32A 4GW8A 4EH3A 4J53A 3QZHA 5E8ZA 4B7TA 4BKYA 2R3KA 3BPRA 1KUTA 2IVUA 5BX0A 1JBPE 5B7VA 4IWPA 5EW3A 5LVOA 5HU3A 4ZAUA 2YJSA 4G3EA 1KOAA 3L8VA 4GK2A 2XJ2A 3IW6A 5HD7A 4KBCA 4GFGA 1O6YA 2P0CA 3D14A 5B2MA 2UW5A 3HMPA 2VX3A 3OZ6A 1OL5A 4TYGA 5EOBA 3E3BX 4F1TA 4RIYB 2QOIA 4XG2A 3LFDA 4FKGA 4G2FA 3MH3A 2OZAA 1H4LA 1HCKA 1SVGA 3IW5A 3OCSA 3PRFA 4IFGA 3R9RA 2QOCA 2W5HA 3OWLA 3O7LD 4IB0A 1Q8UA 4JQEA 1KE7A 4FSUA 3MB6A 3O51A 3QQKA 4AU8A 2OXYA 5AV3A 3PLAE 3F7ZA 2QG7A 5A14A 4ZTSA 5KBRA 1A9UA 3ZSGA 5J7HA 4KIOA 3R63A 3E8CA 5BVNA 5M09A 4JBQA 3LCSA 4EI4A 3EN6A 4JXFA
chains in the Genus database with same CATH superfamily
2ZB0A 4A06A 4U41A 3GT8A 1E1XA 2HENA 1W0XC 4ZXTA 4K1BA 4FTAA 3EKNA 2IJMA 3SDJA 4R3RA 3HYHA 2WTKB 3HEGA 2FSLX 3OXTA 4D1XA 2FGIA 3SRVB 2CJMA 4FX3A 4GG5A 4FOCA 5AV1A 3U55A 5AR8A 3G90X 5BYZA 5D12A 2WNTA 4OAVB 2P2HA 3RHKA 1YWVA 2ZAZA 5CEKA 3CPCA 3WF5A 4QP8A 4BJJA 3VS0A 4M15A 3RK5A 4QP3A 4ZOGA 5ACBC 4Q5EA 4IIRA 5HZNA 4RVKA 2P4IA 4EUUA 5J7BA 2OICA 3G15A 5E8VA 3TJCA 3E8EA 3P4KA 5BMSA 3ORZA 1W2DA 4X2KA 4DEGA 5EYCA 1OPLA 5JRSA 4FIIA 2W99B 4YC8A 3KXMA 1Z5MA 3OWPA 4MXXA 2R9SA 4M14A 3UZRA 2XIKA 3P23A 3LW0A 4WNMA 3HV4A 2OLCA 3QYZA 3PSBA 1J1CA 1OMWA 2C1AA 4DCAA 1OIQA 4FKUA 4RRVA 4P4CA 3ELJA 3IO7A 4GL9A 4CV8A 3HV7A 4ARKA 2ITNA 1REKA 3E62A 4GT3A 5EHYA 2ZB1A 3FLZA 3PLSA 1OECA 3LM0A 3HVCA 4KB8A 2C6OA 2CCIA 4U0IA 2QHNA 3JPVA 4TKSA 2B4SB 5FG8A 1AGWA 2YM4A 3K5UA 4I6LA 3W0SA 2BKZA 4M68A 2OU7A 2XIYA 3QTZA 3F3VA 4RGJA 4NT4A 2WQNA 2WTVA 3F7WA 3G6HA 4RT7A 4TWPA 3ZMMA 3GGFA 3QTUA 4H05A 5ANJA 4G1WA 1DAYA 4A9SA 2BR1A 4FG7A 1E9HA 2UZUE 1UU8A 4JDJA 5FBNC 3UQCA 4BR3A 3FI2A 4JR3A 3PUFC 2Z7LA 3DZOA 3UTOA 1R3CA 5I9WA 5FM2A 2B55A 3GQIA 2Y0AA 3PFYA 3F9NA 4BKZA 2V62A 4O96A 4UWBA 2EXCX 3NFGB 3AD4A 2XEZA 4ASEA 3DU8A 4MWIA 3VQUA 4D4VA 4O91A 4AW2A 4WA9A 3QBNA 4DTAA 5AUVA 3WYXA 2PY3A 4JQ8A 4H3PA 4QD6A 3PVWA 4E1ZA 1NVRA 3FC1X 4W8EA 4EYJA 3G0EA 5H8EA 3EFWA 4FTNA 4M66A 3TNWA 4E20A 2CNVA 4E26A 3CS9A 4OT6A 1VJYA 4M12A 4JBPA 3VRZA 3RCJA 5CAQA 5CXZA 4J96A 5EI6A 5E8TA 3O0GA 5ANOA 4WT6A 5FQDC 1M17A 1FVTA 1M2RA 3Q52A 2X81A 3ML1A 2QR8A 2VTAA 2WOUA 3EL8A 4DHJA 3MFTA 4U81A 2CDZA 2V22A 5IUIA 3AKJA 3N4TA 2OK1A 3NCGA 1KE9A 5DWRA 1H8FA 3I4BA 4O4FA 3MWUA 3MVLA 3TDVA 5F9EA 1H00A 4NYEA 3LFSA 4D5KA 4EK3A 4FL1A 5AR2A 4RX5A 1IA9A 3TACA 3EB0A 4A07A 2WQBA 1PKDA 4EK5A 3L9NA 2YN8A 4FTTA 5F4NA 3ZM4A 3ZRLA 3ZZEA 2IW6A 4CQGA 3IGOA 5LMKA 2UVYA 1FQ1B 1P14A 3VJNA 4D2RA 3DKFA 4KKEA 2XIRA 1QL6A 4L9IA 2VX1A 3REPA 3R8ZA 1QMZA 4R3PA 2ITTA 3R7UA 2W4OA 4FT0A 4BHZA 4E6DA 2ZDTA 3DB8A 1ST4A 1FINA 4MXYA 5CF5A 5D11A 3P9JA 1Y57A 3HV6A 5FM3A 2JIVA 1NVQA 1ZY4A 3BHTA 2V7AA 2C5VA 4Y83A 4EH7A 3NW7A 4QRCA 2Z02A 3DNEA 3W2RA 3W8QA 3TIZA 4L44A 4RVLA 3SV0A 3KL8A 4MX9A 4O0XA 5A4QA 2ITYA 2YCQA 3ZBXA 3HRFA 4QP7A 1Z57A 4FKIA 3EZRA 4MBLA 5HCYA 4ZY4A 5EG3A 5K5XA 1NXKA 2RG6A 4AGDA 5D41A 3A7GA 4JIAA 4L67A 2WOTA 3I5NA 5DRBA 4E4MA 2XAMA 4J71A 5E8UA 4AXAA 3S4QA 2ZV7A 3U6JA 1OUKA 2ZFYA 4AACA 3F61A 5HX6A 3OBJA 4QTCA 2GFCA 4FNWA 4QMLA 3ACKA 3TTJA 4IEBA 5FTOA 4LOQA 4L53A 2QVSE 4JT3A 1REJA 3BE2A 4OBOA 5CVGA 3HMMA 3PIXA 4CKRA 3MY0A 3SGCA 4BJJB 3FKNA 5ICPA 4NM7A 4FV6A 2C5NA 3TZ7A 1Q8WA 2H34A 5CX9A 3EFJA 5HO6A 3ZU7A 4AOTA 5LWNA 2VO7A 5DH3A 2BRNA 4P2KA 4FRFA 4QMTA 5C4KA 2ETKA 5LMAA 2HK5A 1Y91A 2QI8A 4IC8A 4Y85A 4BTFA 1T45A 2WD1A 3MVJA 5E8SA 2IZRA 4DG0E 4LGHA 2IW8A 4BN1A 3OCGA 3IECA 4FKSA 4G31A 1L3RE 2UZDA 4IBMA 1V1KA 2UW9A 3FJQE 4CT1A 3PWYA 4I6BA 5HESA 2P33A 5CVFA 3MJ1A 4O4EA 4O21A 3ATSA 4NM3A 2BROA 1YI3A 4HZSA 3Q6UA 4WBOA 1YDRE 2UUEA 3LMHA 3FDNA 4Z3VA 3W10A 1M7QA 5IG1A 2C6DA 4UX9A 1A48A 3OWJA 3QX4A 3I5ZA 4B0GA 2BAQA 1ZYLA 4E3CA 3PVGA 1ZYSA 4V05A 4EK6A 2VRXA 3OROA 4DN5A 4CZYB 4A7CA 4U5JA 2W4KA 3LCKA 3SC1A 4RZWA 2DQ7X 4U79A 5J5TA 2IVVA 4QQCA 2ETRA 3VUGA 4DEIA 2UW4A 5I3OA 2Z7QA 3UODA 5F95A 2QLQA 1VR2A 4BDEA 3NCZA 2UZEA 2C69A 4QDEA 3C4CA 5IQEA 2WFYA 4CZTA 4ZTLA 5HE0A 4I92A 3QTQA 5AP0A 4DEBA 2XH5A 4ZJIA 2CKOA 2C47A 2ZV8A 4YHFA 5ANGA 4F6UA 5C4LA 3S95A 4YPDA 3MESA 3FPQA 1CM8A 2WIPA 2OF2A 4L68A 3KIOC 4ZSAA 4O27B 3EN7A 2I0EA 3UDTA 3MVMA 4K18A 5ACKA 4BTKA 3CR0A 4IAYA 4DF3A 3EN4A 3OXZA 4UV0A 5E90A 3FSKA 3O8UA 4PNIA 4F99A 4QP6A 5M44A 4NL0A 4QMZA 4RQKA 1MRUA 2C3KA 2J51A 3FZ1A 4G3DA 4C58A 4A4LA 4F9AA 4E6QA 1UKIA 1IAJA 5DHJA 5DR2A 2J0IA 5DVRA 2VTTA 1K3AA 3PA4A 3UE4A 3CQWA 5HG9A 3KVWA 2XVDA 4RJ3A 3FMEA 1U54B 5FTQA 5GJGA 3O7LB 4FGBA 4X3FB 2OIQA 3GC7A 1ZOGA 4JBOA 4UWYA 5HCXA 3F5PA 4C4FA 3PJ3A 3PIZA 4A4XA 4OTFA 4X2GA 2IO6A 3QX2A 3VS6A 3W0MA 5IQDA 3A7IA 5CSPA 3R9HA 4BCGA 4F7SA 1XHAA 5CENA 2PVFA 4EC8A 4CFNA 2QODA 5TF9A 4F7JA 2QG5A 4HW7A 3CY2A 4FEXA 2WEIA 2HAKA 3QQJA 1SVHA 2CPKE 3NX8A 3ODYX 4FKQA 4CFMA 1SMHA 2YA9A 2GS2A 2R64A 5AIRA 3W33A 2WQOA 2BZKB 2BTSA 2NP8A 1GZNA 5CF8A 4FTIA 2W7XA 5DN3A 4EOOA 3U54A 2CHLA 4ANLA 1KSWA 4ZTRA 3NLBA 4YC3A 4CFFA 3ZEWA 5ANDA 1R78A 3OY3A 5ETCA 3U6HA 4O7ZA 1JSTA 4YJPA 3LQ8A 4L42A 3IOPA 4IB1A 4L8MA 1JSVA 2PK9A 2A98A 2XJ0A 4LI5A 3ITZA 2J4ZA 4E7WA 3OXIA 4ITJA 2VWBA 4ACMA 2BILB 4ZP5A 3W18A 3R21A 3VC4A 4GEOA 1OGUA 5CEMA 1OIRA 4R7HA 4QMQA 4BIDA 5CI6A 2B9IA 3DK7A 3E3PA 2ONLC 5AP2A 4C2VA 5KHWA 2XYNA 2WPAA 3KY2A 4YJNA 4FTKA 3KK8A 4KIKB 3DA6A 4IZ7A 2PYWA 2X6EA 5AADA 3SOAA 5A9UA 3DKCA 4L45A 5LOHA 1J7UA 4FOBA 2VTJA 4HGSA 1E1VA 2J5FA 4DH5A 1LPUA 3WIKA 5IA3A 3DJ7A 2RG5A 4DH1A 4RJ4A 2I6LA 4RWJA 4R1YA 4AG8A 4AP7A 3O17A 2BTRA 2E2BA 4O1PA 3LMGA 2WMXA 2ZV9A 5HG8A 3W2OA 4IH8A 2WTKC 5AA9A 4ID7A 3BCEA 3RM6A 4AW0A 4DGGA 5GZAA 1W84A 4MXAA 3LQ3A 1J1BA 5JEBA 4DITA 5IKWA 4LFIA 3UGCA 3BEGA 3CJFA 3ZYAA 3I7BA 3JYAA 3KN5A 1OBGA 2DWBA 3HMOA 4AA5A 4X7QA 5IEXA 4IACA 1W83A 3ORNA 3MY5A 4AE9A 3A8WA 3D0EA 5L2QA 1IR3A 4FYNA 3HECA 4FYOA 1ZARA 3SG9A 2FSMX 3NYOA 2W05A 5DR6A 5DT4A 4RIXA 5HE1A 5BVDA 3DT1A 5JK3A 1TQMA 5ANIA 4G3CA 4BBMA 3H3CA 4EONA 5L6PA 4WNKA 2DYLA 4C0TA 4FA2A 4XV2A 4JLCA 3IS5A 3OMVA 3FI4A 3LOKA 3LMIA 5KZ0A 4YNOA 3VIDA 4IAFA 4WHZA 3R7OA 4EYMA 2PE2A 3EFLA 4AOIA 1PY5A 5J87A 2BDFA 2PUUA 3GU5A 3ULIA 3EQCA 2C6MA 4MXZA 2RKUA 3POZA 4P5QA 4XUFA 1MQBA 4ZY5A 3GCPA 4UYNA 3R04A 3PIYA 2F57A 3KU2A 4JAIA 4EORA 1W82A 4F1OA 2Y4IB 3VS4A 3BE9A 4CFWA 1W98A 4C35A 5L8JA 4O0RA 3GOKA 3EKKA 4KBAA 3U87A 4Q9SA 5IH5A 3DBFA 3FMHA 2RFEA 3P86A 4LYNA 4BDIA 2VTIA 2XNPA 1P5EA 3ZSIA 4DEDA 4BDGA 3EQPA 5CAPA 2GDOA 4TRLA 4OTHA 5FEEA 3N4VA 4BY9E 4FT7A 3KF7A 5C1QB 3GNIB 4G34A 2RF9A 4HGEA 4IQ6A 3GUBA 4K77A 4U7ZA 1GNGA 4C38A 4CFXA 3I0QA 5KUPA 3GEQA 3THBA 5BPYA 2EB3A 4AA4A 3EN9A 3AD6A 2JEDA 1X8BA 3ORXA 4MNEA 3VS1A 4EJ7A 1XH6A 3BRBA 3M1SA 3QWJA 4Y8DA 3OT3A 3TV4A 3R02A 1OGYA 5FWKK 3QQUA 2BCJA 5HVYA 4Y72A 3R1QA 4CEGA 1TZDA 4IZYA 1DI9A 3I6UA 5D7VA 4GH2A 4QMMA 2ESMA 5J9YA 4ALWA 5EOLA 4XMOA 1YHWA 3UVRA 2BRGA 5LCKA 4LQMA 3LJ0A 4I21A 1GAGA 3LXKA 4EUTA 4R7BA 1WBNA 5I9YA 4BYJA 2QO7A 3R28A 5LVNA 3GU8A 4M67A 2EXMA 5BVEA 4DFZE 5KNJA 3CD8A 4DGNA 1M2QA 4DEAA 2BPMA 3LHJA 3AC1A 3EQHA 3DY7A 2R3FA 3IW7A 3MPTA 3BELA 2BFYA 3FBVA 3WI6A 3LFCA 4KNBA 5DEWA 4BWKA 2PMLX 3R00A 2NRUA 3C4XA 2FH9A 4JAJA 2GTNA 3C4EA 4RJ5A 4C8BA 4PY1A 1IEPA 3QKMA 4RJ7A 3AT2A 4U3YA 3UIMA 4EH4A 5E8XA 4DT9A 4FIJA 2FO0A 2X2MA 2C0IA 3LIJA 4YJUA 1HOWA 4CRLA 3AC4A 3OUKA 2JGZA 4Y46A 2WU6A 4RX7A 3WF8A 4DYMA 4EH8A 3QAME 4E4XA 4IVBA 2ETMA 4E4LA 3FLSA 3ZUVA 4CMOA 2QO9A 2ZJWA 5CI7A 2WTIA 4N0SA 3QQGA 2QURA 5A46A 5IDNA 5JGAA 1P4OA 4TW9A 5L2WA 2BZIB 4OTQA 2OBJA 3ZLWA 1URCA 2KTYA 3MH2A 3GFWA 4II5A 4R3CA 4XRLA 3UIUA 5AP3A 4ZLYA 4QOXA 1OPKA 1H24A 2XIZA 3KKVA 4AS0A 3SA0A 3LFBA 4AA0A 2UZNA 4EC9A 4LGGA 4YJOA 4TYHA 3D7TB 2E9OA 4FSWA 4O6LA 5J9LA 3Q9WA 3NR9A 3E93A 5IEVA 3MH1A 3BHUA 2B53A 4YPSA 4QTBA 3PSDA 5EDQA 4V01A 1DAWA 4F08A 3K3IA 5CQUA 2R3RA 4USEA 4K0YA 3ENMA 4IFCA 3NMUF 4UBAA 2CN8A 2OJJA 3MH0A 4M84A 5C03A 4PMMA 3F88A 3OT8A 5EM5A 1KV2A 3FMNA 3DPKA 4YHTA 2XBJA 4FKTA 3RBWA 3EHAA 3QKLA 4A4OA 5IH4A 2IG7A 4L00A 3RVGA 2CSNA 2QU5A 2FSTX 2AUHA 4O0UA 1R1WA 2JBPA 3QRJA 4CKJA 1IA8A 3W2QA 5KX8A 4XG8A 1ZYJA 2OXDA 3G9NA 4ORKA 3IK3A 1BMKA 2O2UA 4IZAA 5T68A 1CKIA 2JD5A 1U5QA 2PMIA 5L2SA 2GQSA 1OZ1A 3QQLA 4K2RA 1OITA 2C6EA 2RGPA 2VTHA 3NYNA 4CQEA 2OJFE 2W17A 3NYVA 4ZMEA 2ZDUA 4QP2A 2PU8A 1YKRA 2JDRA 3FMMA 4FTOA 4RVMA 3TZ8A 4AUAA 3L8XA 3Q6WA 3L8PA 4FIFA 4AZEA 3H9RA 3EQDA 3FL4A 5FXSA 4A9TA 4HCUA 5HICA 3RTPA 3Q9XA 2YWVA 4FG8A 4JRNA 3ORPA 3CY3A 3Q9ZA 5JGDA 2O5KA 5K4IA 5HLPA 1OB3A 2LAVA 3CTHA 4GVAA 2CKPA 4ZTQA 2F49A 1JVPP 3ULZA 5HHWA 2XRWA 5FDXA 3E5AA 1MRYA 2PSQA 4HYUA 3OOMA 3ZDUA 3MA6A 3FZRA 3P7AA 3OCBA 4YO6A 4B4LA 5J1VA 5M06A 1G8SA 3V5LA 4FSNA 2PPQA 5M07A 3NEWA 3NIEA 1RDQE 4RIOA 4C02A 4OAUC 5KBQA 4GRBA 4DH7A 4K6ZA 3G6GA 4ZSLA 3FXZA 5AV0A 4CXAA 4MCVA 3V51A 2OH4A 4I4EA 1XWSA 1G8KA 5I9UA 4B8MA 4TWOA 3GENA 3PXFA 5KCVA 4MK0A 3VUHA 4DEEA 3BX5A 4MYGA 4CFVA 4YLLA 4LMUA 1BKXA 3R8MA 4UMUA 2QOLA 2W1IA 3GP0A 5M08A 3JVSA 5LARA 1CKJA 3KXZA 4EL9A 2G15A 2XA4A 2OKRA 4HPTE 5HE3A 1G8AA 4EQMA 2IPXA 4GVJA 5A4CA 1FGIA 4MH7A 3LXNA 3BU6A 1PYEA 5L4QA 5C8KA 4FIEA 3A7JA 4JDIA 4QTEA 3ROYA 3H0ZA 2JAMA 3D2KA 5CYIA 4FTUA 2B9JA 5ITAA 5EHLA 3CBLA 5B0XA 2HELA 4O1OA 4DG3E 4APPA 4GYGA 5LCJA 5KO1A 3KCFA 3S1HA 1YXVA 3UG2A 2OSCA 2PHKA 2XNNA 4PP7A 2X8IA 3D7ZA 4DH8A 4FK3A 3O2MA 4F9BA 3PDTA 3ZONA 3FV8A 2KULA 2UZLA 5J8IA 1AD5A 3A8XA 4B99A 3Q4UA 4X3FC 4AZTA 4BZDA 2REIA 4ANMA 4P7EA 2GS6A 4YZ9A 3B2TA 4QQJA 4IWQA 3AMYA 4S31A 2X1NA 4W4WA 4L6QA 5LQFA 5M56A 1VYZA 1JNKA 3KRWA 3QC9A 4DEHA 3FQHA 4PDYA 2W1HA 1ST0A 3E88A 2WAJA 4Q2AA 1OKWA 2VGOA 2JLDA 5EQYA 4J99A 4C3FA 3C0GA 1Q8YA 4NUSA 4QP4A 1H27A 3ZO4A 4MKCA 3RAHA 1GZ8A 4GT5A 2YDIA 3PVUA 5FBOA 1U4DA 4XV9A 2BIYA 2R7IA 5CVHA 1CDKA 2JIIA 4RA4A 2J50A 4IDVA 2DS1A 3TL8A 3JR1A 3TYKA 1MRVA 4ZS0A 4AE6A 3T9TA 4BHNA 1SM2A 5FLFA 5AUZA 3MFSA 3IPHA 3UO4A 5EW8A 5K0XA 3BLRA 4PDSA 4GV1A 3QUPA 4IAIA 1AQ1A 5JSMA 2NYAA 5TT7A 1W2CA 5IMXA 1LUFA 3FMDA 4XP0A 3DNDA 3HRCA 4FNZA 4G9CA 1YW2A 4CVAA 1Q97A 2ITOA 3NS9A 4ZJJA 2WKMA 3Q53A 1H07A 4PMPA 3TWJA 2FYSA 3BI6A 4OT5A 4QMXA 5IQIA 3UVQA 2UZWE 1H28A 2CN5A 5HVKA 4GG7A 2IN6A 4D2VA 3ZFMA 4O2ZA 3AC2A 2X4ZA 2GQGA 2VWXA 4PL5A 5I5ZA 4QP9A 2QD9A 5JMSA 4GUBA 5AP5A 3CXWA 4Q9ZA 2YIWA 4CG9A 4M8TA 3PA3A 4FZFB 1HCLA 4LG4A 4YZBA 2B54A 4QPMA 4C4GA 3GC9A 3VUIA 5E8WA 1YOLA 2R3HA 3QALE 3E7VA 3V01A 4EOSA 4EOPA 4I0SA 2ERZE 3KXGA 4KIQA 4ITHA 3O8PA 4WKQA 3U4WA 1XO2B 4LRMA 5EQEA 3PJCA 5IA2A 4KSQA 5H8GA 5I0BA 5AR5A 3UQGA 2YEXA 2Z7RA 4M69B 1BI8A 5HU9A 4EK8A 2WTDA 1XBCA 4FGRA 4YUQA 5HTCA 4BDFA 3PJ8A 5KHXA 2O3PA 4QMVA 4WRSA 4QYHA 4RIWB 4F7LA 2C5XA 3DFCB 4M13A 4Q5HA 3HP2A 4J97A 4YZCA 3GCUA 1GY3A 2OW3A 3M42A 5TOZA 4O0YA 4USDA 4JIKA 1OM1A 4AZWA 2C6KA 4LL5A 5TO8A 4CYJA 2W1DA 4FTLA 3QD0A 3RZBA 2XK9A 2YCSA 3FHRA 3QGWA 4HVDA 3HAMA 3RALA 4BCKA 3D5VA 4YR8A 5IQGA 4TT7A 2A0CX 4FEWA 3PY0A 3FI8A 2YHVA 5A4TA 3FZSA 5L2IA 4ERWA 4IX5A 5D10A 3V5JA 4U9AA 2Q0BA 4O82A 3BHYA 3LFAA 2YAKA 1PKGA 3RP9A 1IASA 2X0PA 2Y4IC 3B8QA 4J7BA 2H8HA 3P78A 4DFNA 3UP7A 5AJQA 3QF9A 1SVEA 3L9MA 4L3LA 3ZSHA 4O6EA 2R2PA 3COIA 1YOJA 2V5QA 4CV9A 2AC5A 1VZOA 4F78A 5I3RA 4XX9A 4NCTC 4OBPA 4I20A 3ENHA 3UG1A 2VO0A 2AYPA 1W7HA 1ZWSA 2VWYA 3POOA 3VS2A 4BI2A 4C33A 3FYKX 3GU7A 4ERKA 3HKOA 4DFXE 4RWIA 3NNXA 4JJRA 3BKBA 5FEDA 3NW6A 4EKKA 2X0OA 4EH5A 2BFXA 3E63A 2W06A 3MIYA 2QCSA 3LVPA 1YI4A 4F63A 3VF8A 1GOLA 1TQIA 2IZSA 3MN3A 3VWAA 4BF2A 2YM7A 5IEYA 1KOBA 3WARA 3LLAA 4HCTA 3O96A 4IHPA 4KRCA 2W1ZA 4QTDA 4FZAB 2O64A 3OFMA 4ZSGA 3KMMA 3RCDA 2C6LA 3AOXA 3V5QA 2V55A 4CRSA 4AXFA 1Y8GA 2GU8A 4IZ5A 5CQWA 3VUTA 3F5XA 3WZDA 2YM6A 4FZ6A 5CLPA 5LVLA 3AT3A 4FKJA 5JH6A 3FMJA 3UBDA 5BVOA 2PUPA 1APME 5EDPA 1Y8YA 4APCA 4QMOA 1OL2A 2W1EA 3H4JA 4MD8E 4I6FA 4EEVA 4FSZA 3R8UA 4D58A 3HDNA 4XBUA 4QDVA 3QTRA 3KMUA 3I0OA 4YNEA 3VS3A 4GU6A 4XS2A 3WZUA 1H0WA 3JUHA 5JRQA 2WMTA 4BCNA 1RQQA 2XM9A 3ZEPA 2HWOA 5GZ9A 3NUUA 3Q4ZA 4GT4A 3NIZA 2XNOA 4YZDA 1IG1A 3BU3A 3TXOA 4KINA 2XP2A 1CMKE 1YHVA 2OZAB 2FUMA 3PE1A 4H36A 5KMKA 3BGZA 4FL3A 5GHVA 3DGKA 4X3JA 4IB5A 3KULA 2G01A 1XH9A 4RVTA 3OCTA 2VNWA 4TYIA 4FKWA 4XCUA 3O5AA 4MUQA 3TM0A 1OUYA 1W2FA 2X7GA 3LE6A 4QQTA 4FBXA 4E4NA 4PDOA 2QOKA 4M97A 4FVPA 4ZLZA 2VX0A 3TUDA 5CF4A 4FEQA 3UOHA 1MP8A 5G1XA 3PWDA 2JKKA 2WTJA 4WG4A 5CXHA 5C27A 4ZEGA 2QR7A 3UOLA 2PVYA 3COMA 4H3QA 4ITIA 3D15A 4RMZA 3W55A 2YDJA 1XH8A 4MXCA 5CU6A 4TZRA 4FSMA 3RKBA 1U59A 3CSVA 5GNKA 3CC6A 4WG5A 3Q04A 4MD7E 4NCTA 5AUXA 3SXSA 5A6OA 1T46A 1YDTE 3EIDA 3F82A 4EKLA 3KMWA 4ANBA 5JFXA 3HUCA 5I9VA 3ZFXA 4U80A 2X4FA 4HPUE 5IA1A 2JFMA 3D9VA 3LFQA 2BZJA 4UMRA 4YU2A 3ORKA 3PSCA 5HNBA 4H3BA 4I0TA 5CZIA 2IEWA 3G33A 2UW7A 3ZS5A 2E9NA 4G6OA 4AQCA 2B9HA 5FGKA 3COKA 3VBWA 4AF3A 5H9BA 2BAJA 3EYGA 4LOPA 4O4DA 3W1FA 4FKPA 5M4IA 5BVFA 3IW4A 5AWMA 5JN2A 4XEYA 4NTSA 3BWFA 2HW7A 1P4FA 2G2IA 1PMUA 2XK7A 4F0FA 5C26A 3BBWA 3VAPA 2Q0NA 4YTHA 3ZRMA 4RX8A 1FMOE 2JBOA 4EK4A 5FDPA 4NM0A 4TNBA 2G9XA 3DJ6A 4ZY6A 3RPRA 2PZ5A 4FR4A 3FXXA 2YM8A 1UU9A 4GJ2A 4FTQA 5IMEA 3HP5A 3QD2B 2VUWA 5A3XA 3AXWA 3CIKA 5BVWA 4M7IA 3UZTA 1YRPA 3MYGA 4R8QA 5AM7A 4ZIMA 3RPSA 3TN8A 5JFSA 4EOJA 2XK8A 3BBTB 2QOQA 1TKIA 2R3PA 2VTMA 4TYJA 1YOMA 2JDOA 1GZKA 3FL5A 4M0ZA 4E93A 4MQ1A 1WVXA 2O63A 3NGAA 3QGYA 4OTDA 3OHTA 2FVDA 2ITWA 1JAMA 3KN6A 3PVBA 4BDAA 3LAUA 4YLJA 3LXLA 2UW3A 4AAAA 4LMNA 4N4SA 4LL0A 3K5VA 3RWQA 1H1PA 2C1BA 4NWMA 3T8OA 3ZTXA 3V5TA 3S2PA 3QUDA 2W0JA 2PMOX 5EI8A 3D83A 3UDSA 3GI3A 5CU2A 4C4EA 3E8DA 1PMVA 3QQFA 1GIHA 1ERKA 4OTRA 3DBCA 4RBLA 5AV2A 2CGUA 4LV8A 4AX8A 4FT3A 1GJOA 2VTRA 4BFMA 2A4LA 2GTMA 2XKFA 1Z9XA 3K54A 1Q24A 3FSFA 3VS5A 1J7IA 3BQRA 4OR5A 2YZAA 4AZVA 4D2PA 5CT7A 3ZC5A 2GHGA 5BVKA 4B6LA 4ZSEA 2XKEA 1UNLA 4JS8A 4L52A 2GHLA 3RGFA 3VW6A 2R4BA 1H26A 5CNNA 2WELA 3C9WA 3MBLA 4QMWA 3ZLSA 5IISA 5J5SA 3JY0A 4HNIA 3VS7A 2WGJA 3DAJA 4I41A 3UNJA 3R7IA 4FKVA 3V8SA 1OKYA 1BL7A 4HOKA 3NDMA 4UZDA 3FAAA 4ASZA 4WRGA 3P5KA 2P3GX 4I5HA 5LVMA 4JX7A 3QHRA 4RC2A 3VULA 4ALVA 5IDPA 2UV2A 3A61A 4JG7A 2CLXA 3PE2A 3K3JA 4S34A 4XBRA 3DTCA 3NUSA 3KQ7A 3Q60A 4EHGA 5FXQA 4O0WA 4O7NA 3DAEA 2WIHA 2PZRA 3RNIA 1QPJA 4J8MA 2C3LA 4E73A 4CFUA 4AWIA 4J1RA 4NW6A 3R7YA 3F2NA 4RSSA 1H1SA 2YFXA 4YGAA 3GOPA 5KZIA 4YBKA 3NVMB 4BBFA 3EH9A 2J0LA 5EW9A 4ZMFA 3WF9A 5HTBA 3TKHA 4H1MA 4KSPA 2YITA 4UXQA 1UWJA 1H0VA 3DB6A 1XBBA 4N57A 3V8WA 3DDQA 2RFSA 3NUXA 4RLLA 1UWHA 3U51A 3FKLA 3BHVA 4FNYA 3UIBA 4ZZOA 3O23A 3AKKA 4I5PA 4EJNA 3P1AA 4JX3A 4WUAA 5AIKA 4UMPA 4PPBA 5E9EA 2W1GA 4BZNA 3P7BA 4KD1A 3KXHA 4AOJA 2Z7SA 4A9YA 5LXMA 4O7SA 2UW8A 4F0IA 4FICA 3AC3A