3HRFA

Crystal structure of human pdk1 kinase domain in complex with an allosteric activator bound to the pif-pocket
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
285
structure length
284
Chain Sequence
RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Structure and allosteric effects of low-molecular-weight activators on the protein kinase PDK1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 284
sequence length 285
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hrfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hrfA01
2NNWB 4KAOA 4EZ3A 1WBNA 1CKIA 2PMOX 2RFSA 5J79A 5TE0A 4F70A 3PXQA 5IEXA 4W8DA 1Q97A 4C59A 3GCVA 3FMLA 5BVDA 2ZB0A 1KSWA 2QO9A 3FSKA 4AW0A 3EKKA 1PY5A 4EOQA 3AC3A 4BTMA 4AOJA 1IAHA 4AZWA 3P08A 4BCFA 2P4IA 3LFEA 2PVMA 3LXLA 3O7LB 4FKLA 3ZDIA 3OW3A 4FKWA 1OMWA 3DDQA 3CLYA 3F5PA 3FLYA 5DG5A 5DR9A 4F0FA 3UIBA 4M68A 4YUQA 4GFMA 3K5UA 4FV9A 1OKWA 4IWPA 3AGMA 3DBDA 4IVDA 1FQ1B 1PXLA 4TYHB 3QTIA 4AZTA 5J8IA 4CLJA 3DLSA 4Y46A 4ZMEA 5AWMA 4BKJA 2J0KA 4BDGA 3Q5IA 4L68A 1JBPE 3ERKA 3UNJA 5KNJA 2CGXA 3ULIA 3VW6A 4BCPA 4EH6A 1M2RA 2BKZA 4D9UA 4ENYA 5HX8A 2R5TA 4YTFA 4PDOA 4OGRA 3PRFA 2XKDA 5ANKA 1SM2A 1UKHA 2W4JA 4TY1A 4F6UA 2EXMA 5DGZA 4RZVA 3LKMA 4FTJA 4WNKA 1H00A 3AD4A 5GIOE 3SLSA 4WSYA 3IOPA 1W8CA 3L8VA 5IQAA 2Z7SA 3QKMA 3DBQA 4QMNA 4O0XA 5CU4A 4YURA 1JSVA 3EQCA 2B1PA 3Q52A 3V01A 4BGQA 4NM0A 5L6OA 5LVPA 3R9OA 5IH5A 3NYXA 2CDZA 4O21A 3MH3A 5HO6A 2UZDA 4QO9A 5A4TA 5JGAA 3LQ5A 2R3KA 3Q9YA 4G34A 2ITTA 2YN8A 3WILA 3ZUVA 5BUIA 2CGWA 2W1EA 3MN3A 1CKPA 3LJ0A 2E9NA 4PNIA 4ANSA 3GCUA 4D2WA 1R39A 4G6LA 1Q41A 4ORKA 4BKYA 4DFXE 4IZ5A 4U9AA 4BWXA 2JD5A 4ZSLA 3HMPA 2O0UA 4MXZA 1G5SA 4BDHA 4DEDA 4ZLOA 1PKDA 2E9UA 3KK9A 3ENHA 3D15A 3ZH8A 5DMZA 5F9EA 4S31A 4KKEA 3LFNA 5KUPA 4A7CA 1H1PA 3VW8A 4ALUA 3PVWA 3KCFA 4KIKB 4IX5A 3KKVA 2WQEA 3MA3A 4KB8A 4LMNA 5A4CA 3TNHA 1CSNA 4A9SA 3E7VA 4BYIA 1VYZA 5AUYA 4O86A 2GMXA 2B53A 3VS7A 3P4KA 1YOLA 2Z2WA 3MY1A 4JX3A 5ACKA 4O1PA 3CQUA 5EM5A 3WZJA 4CFFA 3RPSA 3C5IA 2C0TA 5D41A 3BE2A 3R71A 3U4WA 4ZMFA 4HGTA 1OIRA 3VS1A 2QVSE 3SXFA 4U44A 5FRIA 1NVRA 3CTJA 4MHAA 3P79A 1H28A 2ZB1A 3CQWA 1SYKA 1R78A 4B0GA 2H34A 4FNZA 4EWQA 5T3QA 4HCVA 5DA3A 4CRSA 4J8NA 4HVHA 4R5YA 4HYUA 3DKCA 3LFCA 4L01A 3C0GA 4DFYA 5AM7A 5DN3A 3PWDA 4P7EA 4CT2A 4QD6A 5IU2A 2V55A 3AQVA 3R1YA 5CF5A 3FDNA 1RDQE 5HD4A 3PE1A 2QQ7A 5I4NA 4XOYA 2PWLA 5CTPA 3DNDA 3E62A 3OVVA 2WMRA 3E3PA 4IB5A 4TN6A 1OKZA 1OUKA 2J90A 2UW4A 2C47A 5DOSA 3AC2A 4LGDA 2ZYBA 3FWQA 4G16A 4RJ7A 1Q24A 4A4OA 4E6DA 1P14A 1WBWA 1WBPA 4RIXA 4YZDA 3I7BA 4WHZA 2RKUA 1H24A 2ETMA 3LMIA 3OCSA 4D28A 4M69A 4YC6A 2R7IA 3OWKA 3U55A 3QQUA 3ENMA 4EK4A 3IQ7A 2A0CX 3R0TA 3Q6UA 4FSQA 2RFEA 3HP2A 4ITJA 5DWRA 5CNOA 3V5TA 3BEAA 4LRJA 4K18A 3VS4A 3NR9A 4LGHA 4F6SA 1REKA 2OIBA 3GC9A 4GIIA 1RJBA 4RIYA 3CEKA 3SRVB 4HZRA 3ATTA 4NW6A 3FAAA 5KKRB 3G9NA 4NL0A 2YISA 2W99B 3RGFA 3FKLA 3IW7A 4DHFA 2YCQA 3GU6A 2RSVA 3G51A 3C13A 3KEXA 3KRJA 4B7TA 4F0GA 5GIPE 1ZYLA 3MPTA 5EHLA 4FTQA 3WOWA 5E8UA 3R9RA 3R8PA 4FSYA 3O7LD 4RT7A 3AD5A 3ZRKA 3QL8A 4OW8A 3UO6A 5C8MA 5CYIA 5A4EA 3QALE 4I3ZA 5AMNA 1WMKA 4NW5A 1WBTA 4TW9A 2AUHA 3VJNA 4NKSA 2VWYA 4I20A 4C2VA 2VZ6A 1OUYA 1ERKA 3OG7A 1RQQA 1FBNA 3EQIA 5A6NA 3QCXA 2GHLA 4CFMA 1VYWA 3LFBA 3FUPA 3NNWA 3QA8A 4FL1A 2W05A 5FTOA 2CHLA 5ANEA 1EH4A 2R0UA 4I93A 4MQ2A 2CNVA 5C4KA 2PYWA 5CSXA 4O7WA 4Y83A 5JFVA 3PVBA 1TQMA 3LM0A 4J53A 3O51A 3OMVA 4EUTA 3PUPA 2F4JA 3ORPA 3PXFA 5EQEA 4O7ZA 2CCHA 3POOA 3HUBA 1R0PA 2HZIA 3DS6A 2F9GA 5J5SA 4FODA 2GFSA 3KC3A 3Q60A 4NCTA 4ANLA 2JIUA 5IA2A 5H2UA 4B8MA 3KGAA 3HECA 4ACHA 5HIBA 3U9NA 2YM5A 3CJFA 5M56A 4CZTA 5EDQA 5AUUA 2R3RA 2E9PA 3PIYA 4GH2A 5EYDA 3RPYA 4EH2A 3RI1A 3PJ2A 3RPVA 5BVOA 3D9VA 3EQHA 4WG3A 3PPJA 3PSCA 1BI7A 2CLXA 2IW6A 1SNUA 3E5AA 2BR1A 4RVTA 2WGJA 4R1YA 5AR2A 2PZPA 2FSMX 3GFWA 4FSMA 4YNEA 1OVEA 4JQEA 4CG9A 2GHMA 3LXNA 5KZIA 5K0XA 2BPMA 1T45A 3COIA 2PUIA 2ETRA 4ONAA 4TTHB 2PULA 2KTYA 5AP5A 4CVAA 4ACMA 2I0EA 4YJVA 5H8GA 3TNPC 3ODYX 3D14A 4OTPA 1FPUA 4PDPA 4U81A 4CFWA 3EN7A 4JG6A 3LW0A 3AC4A 3QCSA 3VF9A 2CMWA 5CU6A 4JQ7A 2X6EA 4XG3A 3OXTA 5KMJA 3DQWA 4QMWA 1UNGA 4KD1A 4RLLA 3ALOA 3K2LA 4FIEA 5E8XA 1O6LA 2W7XA 1H8FA 4GG5A 4FTIA 4BIDA 4ANOA 4LQMA 4EORA 3SDJA 3R8VA 3R00A 3M11A 2ZJWA 1GIJA 3HDNA 2QONA 4WIHA 3OCGA 2CJMA 5K5XA 5JK3A 4GKIA 3DAKA 5GHVA 4FV6A 3C0HA 4ASDA 4EOOA 4NKAA 4RLKA 3HUCA 4GFGA 3L8SA 5LWNA 4YHFA 5FLFA 3AC1A 1ND4A 3F5GA 4FOCA 5M08A 2Q0NA 3O17A 2YLEA 4BZNA 2VTNA 1S9JA 4QTCA 2GS2A 4FNWA 2REIA 1DAYA 3R21A 2C5OA 4YZ9A 1ATPE 4FMQA 3CGFA 4ACGA 2CN8A 5K9IA 3A7FA 4OTRA 4HYHA 3S00A 4EHGA 4ZXTA 3T3UA 2VAGA 4WG5A 5G6VA 3LM5A 4TYGA 4TRLA 3RMFA 2UZOA 4IZ7A 2VU3A 3K3JA 5CAVA 1YW2A 3VS0A 4PX6A 5AR7A 4DFUA 3KULA 3FC2A 3TV4A 2XVDA 3PSBA 4ZSAA 5EG3A 3GU8A 4BDCA 3PY0A 5F95A 4E6CA 5L8LA 4IWQA 4LRKA 3WI6A 2OXXA 1YWVA 5C27A 2VWZA 2VO0A 3ORZA 1R3CA 5I9UA 3OS3A 1XH9A 2BTRA 4MBJA 4V0GA 2YIXA 1W98A 2XJ0A 3SD0A 3NDMA 1JLUE 2XNNA 2OSCA 2C5YA 3CTHA 4FVRA 3E88A 4O2PA 5A14A 3R7OA 3DOGA 4WUAA 5HBHA 3Q04A 5AV4A 3FQSA 3Q5ZA 4BFMA 4HZSA 4BI1A 1YOMA 3U8WA 4QP6A 4DGMA 4BDDA 1Z5MA 1H08A 3F3UA 3ZLSA 4DFBA 3QTQA 3OY1A 5DNRA 3RBWA 2R3HA 3G90X 3GT8A 5K5NA 2XK6A 2Y6MA 3RWQA 4DYMA 2I0VA 2OICA 3HMOA 1DAWA 3BPRA 4HPTE 5KHXA 4ZSJA 3UG2A 3UNZA 5ETAA 1OGUA 5F1ZA 3POZA 4L45A 2WAJA 4TWCA 2JDTA 3D7TA 4CFVA 4RFMA 3ZC5A 3Q4ZA 3TKHA 2OI4X 3QHWA 3RCDA 3DBFA 3W2SA 1Q62A 4YZBA 3R8ZA 3DAJA 4XYFA 3RP9A 4MXCA 1OPKA 3R1QA 4X2FA 4D4VA 1IASA 4E73A 3FQEA 4IACA 3HMMA 5LARA 4AN9A 2CSNA 3MYGA 4P5QA 3FMNA 1W7HA 4GU9A 5KZ0A 5HNBA 4FTMA 2UUEA 4UBAA 4OT5A 1Y91A 2C68A 4FZFB 4PPBA 3NCGA 2Y0AA 3DK3A 3E8NA 4M84A 5I9XA 5EDPA 4WD5A 5IISA 4OTHA 2CGUA 2OZAB 2C1AA 1U46A 5JFSA 3D94A 4K9YA 4XV9A 3GEQA 5HCXA 3W2RA 5JGBA 3ZU7A 4TYEA 4K33A 5IQDA 4JNWA 4C02A 4P90A 4CCUA 4PMPA 4U45A 5CEIA 3DXPA 1RE8A 4NM5A 3RHKA 1NVQA 2Z7LA 4O96A 4AE9A 2ZV7A 3QU0A 4DAWA 3NUUA 2ITZA 2I1MA 3NW5A 3ZO4A 4Z7HA 4QOXA 2JEDA 4TNBA 2R7BA 4HYIA 4GCJA 4QQCA 4WA9A 5CANA 4XHKB 4XUFA 2X9FA 3W1FA 5IDNA 5EFQA 2O8YA 2Y4PA 2IW8A 3NNVA 4WSQA 3TXOA 3SHEA 2NPQA 3GC0A 5HO8A 3MWUA 4D2VA 1F0QA 3GVUA 5HIDA 2VWIA 2X4ZA 3OD6X 3A99A 4GT5A 3VHEA 2DYLA 1BLXA 5LOHA 4ZOGA 2HW7A 3C4ZA 3PDTA 3QQKA 4JG7A 4G9CA 5AEPA 1O9UA 3NW7A 3UTOA 4DLJA 1A9UA 2WMXA 5JMSA 4IX6A 1JNKA 4W9WA 2WTCA 4MXAA 4XG2A 3C4XA 2QOCA 2YEXA 4HCTA 3W8LA 4BDIA 4EYMA 3H10A 4MEDA 3ZM4A 2W4OA 2X7GA 4FTUA 4KBAA 3QTUA 3NYOA 3P0MA 3OW4A 1SVEA 2YIYA 4LI5A 5HGIA 2VN9A 3E64A 2YLFA 3MFRA 4LV5A 5LWMA 3U6HA 2JIIA 2VGOA 4F0IA 3O8PA 4GS6A 1Y8GA 2VWVA 5HLPA 4FKJA 4II5A 2PE0A 4XMOA 2JITA 3FV8A 3QXOA 1L3RE 3VUMA 5HVKA 4FT7A 4YHTA 3F69A 2OXYA 3BHHA 1XBBA 5BVNA 2YWPA 4JDHA 1XH8A 4G1WA 3QUDA 3WIKA 5FQDC 2PUUA 2A2AA 2C0OA 4PDSA 4D0WA 3F5XA 4EEVA 3R2BA 5JH6A 2IWIA 1OL5A 1MRYA 3H0ZA 2EB2A 3SKCA 3BLRA 4XG8A 4GT4A 4ZSEA 2G01A 4NH1A 4ZZNA 3MGYA 1NA7A 4GKHA 3PJ8A 3ZDUA 4KIKA 2NRYA 1ZYJA 3RZBA 4FR4A 4LUDA 4U80A 1PXOA 3NAXA 4DTBA 4GYIA 3PY3A 2PL0A 4IEBA 5HU3A 3E3BX 4I0TA 1RW8A 3N4TA 3V8WA 3Q4UA 2XNPA 4JR3A 2EXCX 2Y8OA 4DBNA 3EQPA 5HTBA 2XM9A 1Y6AA 5HKMA 3FXZA 4BL1A 1ZOGA 4FVQA 4QYYA 5IEVA 3OTVA 3D83A 5BMSA 3ZUUA 4Z9LA 4JOAA 4JDKA 4I4EA 5TT7A 3DQXA 1YKRA 3P7BA 2W1CA 4QMVA 1J7UA 4DCEA 1YWRA 4ID7A 5JQ8A 2GQRA 4O7YA 5GINE 3D5XA 3HV3A 3QRUA 3MFSA 5JKGA 3TV7A 1ZOHA 3IG7A 4WG4A 3PYYA 4BGHA 3G2FA 1J7LA 3FI8A 3ZTXA 3OROA 3ZBFA 3C0IA 2DS1A 4UYNA 4BCKA 4ALWA 4EQCA 2XNGA 3LVPA 5DVRA 2VX1A 3VUTA 3N51A 4EOMA 5BUEA 4IB3A 4CKRA 4AFEA 5E8YA 2BHHA 5J9LA 4U7ZA 4DFZE 3KCKA 1MQBA 4AP7A 2OKRA 3MVLA 5LMBA 5AJQA 4USDA 4E4NA 2OO8X 5E8SA 3I4BA 4NWMA 3JS2A 2CKEA 3FY2A 3MBLA 4PF4A 4OBPA 3TCPA 5CVGA 4O7NA 3AG9A 1AGWA 2PPQA 4K6ZA 4YHJA 4GV1A 1BMKA 2WQOA 3OBGA 1UU7A 3CPCA 4JBPA 4N6ZA 3F2NA 5DYJA 3FPMA 1B39A 3D7ZA 4M7IA 2VO3A 5HOAA 3UP7A 3O96A 2PVLA 4KSQA 4XRJA 3VIDA 3UO5A 4IC8A 3OEZA 1ZMUA 3GP0A 3R7GA 3AT3A 3CTQA 4MBIA 5LVOA 2OFVA 1QPDA 2BILB 2UZNA 3ODZX 2C1BA 4TNDA 1MRVA 2XKCA 4J96A 5HU9A 3Q53A 3KRWA 2V7OA 5CSPA 5JZJA 5CF6A 3VBTA 2IPXA 4D1SA 4RSSA 4GU6A 3DJ5A 4F63A 3MJ1A 3E92A 4CD0A 2UZVA 3DTCA 4O0TA 5DT3A 3D5VA 3G9LX 2VX3A 1XR1A 4C62A 4AA0A 4ITHA 4EBWA 5M09A 4RMZA 5BYYA 5KBQA 3CQEA 1G8SA 1PYXA 3PVUA 3VVHA 2W1HA 4QP8A 4W8EA 2RFNA 3CIKA 4G5PA 4HOKA 4DEHA 4FV5A 4GT3A 4BZOA 3SOAA 4F9WA 2B52A 2IJMA 4U40A 3ETAA 1ZOEA 3HL7A 1Q4LA 4LOOA 4C33A 4C4HA 2PVFA 2G9XA 1WBVA 5EDRA 3T3VA 4Y8DA 3UVPA 2HY0A 4RVLA 5IKWA 4YGAA 3FBVA 3UBDA 3QZGA 4YPDA 2Z8CA 4OT6A 4EK5A 3DFAA 4QNYA 3HDMA 1GZOA 4A9TA 1JKTA 4FE2A 1QCFA 4WKQA 1UA2A 1MUOA 4QP1A 2BZKB 3QRKA 1ZZLA 4LL5A 3EYHA 3BQRA 4NM7A 3QX2A 1H26A 5ETIA 3RZFA 4DA5A 3QBNA 3G0FA 3SX9A 3C50A 2PVJA 3A62A 3RINA 2X6DA 3DFCB 3OHTA 2QU5A 4HVGA 2YFXA 5CT0A 4BGGA 3BGPA 3WF9A 1GY3A 5IQBA 1OKVA 4NFNA 4AX8A 1XBAA 5M4CA 5EM7A 4RIWB 4ZJJA 4KRCA 4HGSA 2V62A 4XX9A 2UW8A 4MYGA 3PIZA 4G5JA 4Q5HA 4BZDA 5LQFA 4X2NA 3U54A 1VJYA 3LFQA 4RJ8A 2QLUA 3WE4A 3MFUA 5KMLA 5JFXA 1YHVA 4O38A 3ORXA 5DR2A 4A07A 3E63A 4O7TA 5EI6A 2DWBA 2YIRA 2XK4A 4RA5A 5TKDA 4C35A 1OPLA 3O50A 3H9FA 3TIZA 3ITZA 4G6NA 3FLWA 2PZIA 5LVMA 4L7SA 1KE9A 4PP9A 4PNKA 3N9XA 5DPVA 2XCKA 4IWOA 2V0DA 4L00A 4YPSA 3VBYA 4AZEA 1BX6A 3OT8A 4FKOA 4XLVA 4CXAA 5KBRA 5FEDA 2WNTA 5TR6A 2YERA 5BYLA 4UEUA 3WF5A 5BVEA 3KRLA 3R9NA 2PE1A 3FPQA 2C6MA 5DLSA 3TKUA 3CKWA 3ET7A 3FMEA 3G6GA 4IZAA 3TUDA 4M97A 4X3FA 5AFVA 1YDTE 4CEGA 2Y4IC 3SW7A 3UIMA 4UZDA 4IAKA 4AG8A 2WD1A 2OLCA 3KL8A 3NGAA 3VBVA 2W96B 4DT9A 3F6XA 3EQGA 1OL7A 1GIIA 3A61A 4D1XA 3PA5A 5D9HA 2OG8A 2PSQA 4EZ5A 4D55A 3KY2A 3QD0A 3TIYA 4L52A 4YBKA 3LIJA 4UMUA 5BUJA 4K77A 1WVYA 3KMMA 3RK5A 3NCZA 3W2CA 3UC4A 4IFCA 1ZYDA 1VEBA 4B6LA 1PMNA 5FM3A 4EOJA 4FT5A 4NTSA 5L2SA 2XK8A 3BYSA 2WZJA 2Y9QA 2J50A 5IPJA 4A9UA 3AMYA 4XG4A 2R3NA 4M15A 4QMMA 4MD7E 5FWKK 3U9CA 3PPZA 5HIEA 1FVTA 4GSBA 2JKQA 2C6LA 5C01A 1REJA 4D2SA 2WMVA 3GQLA 5JZNA 4BCOA 5HICA 4HVSA 3LMHA 4RFZA 4XS2A 3Q96A 3CSVA 4Y73A 2CN5A 4ENXA 3A7JA 5E7RA 1V0PA 3V5LA 4YZCA 3E8CA 3HAMA 2ZM4A 3AT2A 4RX5A 4HNFA 1IA9A 2X9EA 2YM6A 2ZOQA 4QQTA 4OTIA 1LUFA 4EWHA 2F7EE 3MDYA 4TYIA 3ID6C 4J98A 3WYYA 4UMRA 5BQ0A 1LEZA 4YJOA 4YSJA 4FSRA 4KBCA 4C4FA 2XIKA 5C9CA 5IDPA 5IMXA 2WTIA 3PWYA 3BLHA 3CPBA 2YWVA 4O0UA 5AAFA 3ORMA 4FV4A 5J7HA 3MIYA 4R6VA 3A7HA 2WO6A 3QTWA 3UYTA 2HXLA 2X0GA 4F65A 1ZMWA 4QTBA 2PUPA 4D2TA 2QOIA 3EJ1A 1U54B 2Q0BA 5DRBA 4ZS4A 5E8VA 4ZY5A 4F09A 3THBA 2F7ZE 3IKAA 3IONA 2PVYA 3R04A 2ITQA 4WNPA 5IG1A 2F7XE 2FYSA 4S34A 3F82A 2BUJA 3BV2A 3R6XA 4GK4A 3PLSA 5BMMA 2GU8A 4UB7A 3ZO3A 2OZAA 3DCVA 3MH0A 4U8ZA 2IVTA 2BCJA 4A9YA 4CQGA 4D5HA 3QTXA 4M0ZA 3IW4A 4C0TA 5EKNA 3LFFA 4RJ3A 3GCQA 5A4QA 3T9IA 4DH7A 5J9YA 3UOKA 1TQIA 4D1ZA 3HV4A 4DEGA 1OITA 4QQ5A 3QWKA 1FVRA 2IG7A 1GJOA 5D1JA 5DI1A 4I6FA 3ZO1A 3O8TA 4NIFB 4U41A 4O82A 3DXQA 4BTFA 2FH9A 3V5JA 4L42A 3EIDA 3Q3BA 4NCTC 4ZLYA 3JYAA 2UW7A 4FSZA 5KMOA 3L9PA 3O23A 3R9DA 5DT4A 3OCTA 3GU7A 4QYHA 1WBSA 4FTOA 4QPSA 2BZJA 2YHVA 2Z7RA 2YDJA 3EFLA 1NY3A 4MTAA 4TWOA 3R8UA 4CNHA 4J97A 3SAYA 5GZ8A 2IZTA 2JC6A 3C4WA 4QMOA 4N0SA 2CPKE 1XQZA 2DUVA 3IS5A 4IC7A 4J71A 3E7OA 2RFDA 3QCQA 4J99A 5GZ9A 2WTKB 4PL4A 3BYUA 4QMTA 5HNGA 2WIPA 2YAKA 4XNEA 3ANQA 5EK7A 4BHNA 4DE4A 5AP3A 3JPVA 4O6LA 4G9RA 5DBXA 4O91A 5FEEA 4O1OA 2QOKA 5ETFA 5DFPA 2WHBA 5M55A 2PZRA 4F7NA 4X6QC 3TL8A 2GSFA 2NO3A 3NW6A 3PXKA 3NRMA 1SVGA 2VNWA 3QA0A 3QHRA 5DEWA 5DIAA 5HBEA 5AR8A 3UIUA 4DTKA 3UOJA 1SMHA 4H58A 4UYAA 2XF0A 5L6WL 4NSTA 3U6JA 4E3CA 3MVHA 1WVXA 4GIHA 5FEQA 4HPUE 4BF2A 1HCLA 5KCVA 3BWJA 3KMWA 3BYOA 3MB7A 3PG1A 5CU3A 3S1HA 3QZIA 3C5UA 1URCA 2WKMA 4GUBA 5M4UA 4DITA 2HOGA 2WEIA 4OTGA 5CX9A 1T46A 2X2KA 3AC8A 3KVWA 3PJ3A 4EJNA 3FL4A 1YRPA 5IQGA 3DJ6A 3VBQA 2VNYA 5AP2A 3ZONA 4C38A 2QG7A 3TV6A 5LMKA 3GC7A 4CTBA 3NUSA 3JR1A 4NM3A 1KV1A 4KA3A 3ZZWA 1OL1A 4DEIA 2XYUA 4NJDA 2J0MB 5E8TA 4F1TA 4HGLA 2C3IB 2OFUA 3TJCA 4Z55A 3VS5A 2CCIA 3ZFMA 4AT3A 4U3ZA 3OBJA 3MVMA 3LFAA 2A27A 3VBXA 1PXMA 1XKKA 1H1QA 4XEYA 2B7AA 2PVNA 3FLZA 3R63A 4E5AX 4EHZA 2VTIA 2GNIA 5AP7A 1SVHA 5HBJA 5E1EA 1JKLA 4V04A 2R4BA 5CAQA 5CVFA 4NTTA 4IIRA 2BDJA 4MD9E 5AP4A 4BYJA 1M7NA 4F08A 1Y6BA 4PRJA 2QKRA 4H1MA 4EZ7A 4Q9ZA 4U6RA 2HZ4A 5M51A 5AA9A 5H9BA 4FKUA 4CMOA 3LCOA 5HQ0A 2H9VA 4BCQA 5AADA 1J7IA 2ITYA 5FD2A 4BHZA 3ZBXA 3I6WA 4N70A 2R0IA 2QD9A 3COMA 2CNQA 4FX3A 4C57A 3KXNA 3S3IA 3C7QA 5L3AA 4WOVA 2OBJA 2IZSA 2DQ7X 3VRZA 5HNIX 3L1SA 3FZRA 3LCKA 4RWKA 4YTCA 3AMAA 4NK9A 3BU3A 4FA2A 3F7ZA 5KE0A 5B7VA 1YVJA 5CY3A 4D4SA 3WE8A 4HVIA 3OXIA 5CAOA 4U5JA 3F3WA 4EK8A 4F7SA 5M44A 1TKIA 3DB6A 3JUHA 1FMOE 1H25A 3QC9A 5AUXA 1H0WA 3I81A 4CLIA 3WZEA 3IK3A 3NEWA 3FYJX 4BTJA 5JGDA 2ITVA 3R8LA 2OJJA 3BEGA 3QUEA 4MNEB 1GZ8A 5EW3A 5IQHA 4UZHA 4DFNA 2B54A 5HORA 5IA4A 3TUCA 4P5ZA 2R3JA 2J4ZA 1IAJA 4FV3A 3HRCA 4IVCA 5EH0A 4R7BA 1P5EA 3SC1A 3AT4A 3TT0A 3LLAA 5J87A 4I22A 1JKSA 2WMBA 3LE6A 2CGVA 3TN8A 4L44A 4FI1A 4U79A 4ZS0A 1KE5A 2JKOA 3FLSA 3CJGA 4JVGA 2OH4A 4IX3A 3MJ2A 1J1BA 4J52A 4L43A 3QGWA 5FGKA 4PP7A 1XH7A 2J0JA 3K5VA 4GK2A 4G3FA 3KRXA 3DK7A 3EQFA 5E8WA 3ZRMA 3I5ZA 3Q2MA 3NPCA 3P7CA 4XH6A 2B4SB 2VTSA 4WNOA 1BL7A 3H0YA 3O71A 3F3VA 3GFEA 2UW6A 2XNOA 2BALA 3SXRA 1G8AA 3HV7A 4YJSA 3PZEA 3BBTB 2P3GX 3F3TA 2WU6A 3JY9A 4EH9A 2JKKA 2WMSA 4UALA 3VQHA 4AXAA 2EU9A 1BI8A 3MFTA 4ZIMA 1S9IA 4R7HA 4WUNA 1W84A 3KXXA 3NUXA 4FKVA 1PF8A 3QTSA 4ZZOA 1OBGA 3ZM9A 4A06A 3F61A 4PV0A 5L2TA 4RWLA 4R7IA 2YA9A 2WMAA 4FC0A 5CSWA 2CLQA 3VUIA 2OF2A 2XB7A 4LOQA 4ARKA 3ZSHA 5HVJA 2XKEA 3Q9ZA 1UVRA 4LOPA 4O0WA 5FP6A 3MW1A 1Q8YA 4EC8A 2HXQA 4M13A 3EFKA 1ZLTA 3EB0A 3JXWA 3FZSA 4GJ3A 1GZKA 3QC4A 4M3QA 3V5QA 3FLQA 5AIRA 4W9XA 1MQ4A 5GNKA 1FINA 4IZYA 3R01A 1CM8A 2XBJA 2GS7A 3AGLA 5E92A 4CYIA 4KBKA 5AV2A 5KHWA 1ZYCA 3ACJA 2B9IA 3EOCA 4MQ1A 2P33A 3U6IA 4M8TA 5ANGA 2QOBA 2YITA 3DPKA 5HVYA 5AX3A 1YHSA 2BKKA 3ZOSA 3QQFA 1DI9A 3OP5A 3TTIA 4CRLA 4UN0C 2Y6OA 3BRBA 1NXKA 3HV5A 4EH4A 2UZEA 4UV0A 2PVRA 2VTTA 2QU6A 3I6UA 3VRYA 3W2QA 5JT2A 3LCSA 3BV3A 4GG7A 1H4LA 2HAKA 3SQQA 3R7IA 1OB3A 3FXXA 3QFVA 3ZCLA 3TEIA 3NVMB 4R1VA 2G2HA 4QMXA 5IEYA 3CE3A 4FVPA 3FL5A 4PWNA 3PVGA 2QURA 3P23A 3PG3A 4E4MA 2VUWA 4GW8A 3VBWA 4AU8A 1M14A 4Y5HA 4YLKA 4G3CA 4JXFA 2WTJA 4XP2A 3KQ7A 2XIYA 3S4QA 2HIWA 2WMQA 4V01A 5IA5A 3MS9A 3F9NA 3LXPA 4APCA 2YIQA 4AZVA 5ITAA 4D58A 4IM2A 2W9FB 3PP1A 3EHAA 2PZ5A 4PPCA 1J3HA 5AV1A 1YWNA 3JVSA 3LOKA 5HE3A 4EOKA 2ITXA 4CG8A 3UZRA 4ERKA 5L2IA 3RTPA 1PXIA 2PZYA 3PXYA 4JG8A 5AP0A 4FG9A 4QTAA 4EONA 3IDPA 5CLPA 4F99A 5HLNA 2BROA 3KF7A 4YJUA 4AQCA 4BDBA 1H01A 1W0XC 2JBOA 2R3FA 3FC1X 4S2ZA 4AW5A 4C8BA 2WEVA 1V0BA 3VO3A 1Q5KA 5FDXA 3ORIA 4QTDA 2FA2A 5EHOA 5CF8A 1X8BA 2C6OA 4E5BA 5GJGA 4PMTA 4TYHA 3FZPA 3OOGA 3PA3A 4YZNA 3UVQA 1KE7A 3MIAA 3OXZA 2WMTA 5DR6A 4OTWA 3QWJA 3W55A 1Z57A 1CMKE 5T6KA 3ZLWA 1ZY5A 3BGZA 1KE6A 4WNMA 4HGEA 5M07A 1WZYA 4B9DA 4M14A 1PXKA 3BCEA 4PQNA 2XK7A 1A48A 5ETCA 4FG8A 2Y4IB 4EBVA 4JIAA 3HA8A 3QGYA 3UMWA 4GRBA 4XG7A 2JGZA 3B8QA 2C6IA 1VZOA 2R3PA 2GNLA 3QAME 1NW1A 2LGCA 3F5UA 4DG0E 5CZIA 3BU6A 4AAAA 2WOUA 1XWSA 3OY3A 5L6PA 5LVLA 1OIUA 5G1XA 3WYXA 5FBOA 3ROCA 1H0VA 3NNXA 5AUVA 5H3QA 1QMZA 2XP2A 1U5RA 2QCSA 4YJTA 5ANDA 3H3CA 1YI4A 4TPTA 3EYGA 3QRIA 3SOCA 4RX9A 5EYCA 1STCE 5I3RA 5CU0A 1I09A 2ONLA 5AV3A 2J6MA 5C8NA 4AT5A 4C3FA 5KKRC 4I5CA 3KN5A 4IANA 2VV9A 3QTRA 3NUYA 4QT1A 2RG5A 4MH7A 3UQGA 2WTDA 3HNGA 2P55A 1ZY4A 3TM0A 5AM6A 2EXEA 4W4WA 1B38A 3QLFA 2XUUA 3LQ3A 2VX0A 1PXNA 4FGRA 1U54A 4FGBA 3EL7A 4IM3A 4AT4A 1SZMA 3ZFYA 1LEWA 4BY9E 4RIXB 3E87A 4FG7A 4KRDA 1NVSA 3UZTA 5FTGA 2QODA 3GXLA 4FSTA 3AOXA 1MRUA 4YTHA 5A46A 2I0YA 4XCUA 3CKXA 2BDWA 2WB8A 4JI9A 2JDVA 3NYNA 4AS0A 4E8AA 4LUEA 3UZPA 4EUUA 4H3BA 2A4LA 2FSTX 2W1GA 3CP9A 4OTFA 3DKOA 4JLCA 4MAOA 4RIYB 3R9HA 3HYHA 4AGDA 3R73A 4CYJA 4ANQA 1PW2A 4OBOA 1JVPP 2HWOA 5CEMA 4NIFA 3GGFA 3IDBA 3ZZEA 5A9UA 5IH6A 2O64A 3WF7A 2BIKB 2H8HA 3UODA 2W1ZA 3DA6A 2UZWE 3IGOA 3PXZA 3V8TA 4ZSGA 4AW2A 3TZ9A 2XEZA 5KMMA 4Y5QA 5EOLA 4DGGA 4E20A 4PDYA 4PL3A 3DKFA 3DY7A 3HX4A 4RBLA 5HE1A 4BI0A 4C61A 4F6WA 3TDWA 1Q3DA 2OF4A 3BLQA 3A60A 2WQMA 3BE9A 1E9HA 4ANBA 2PMLX 4FKQA 1OKYA 4AGWA 1Z9XA 1KUTA 2X8IA 1K9AA 1Q8TA 3SW4A 2OZOA 3IDCA 2C3KA 3QCYA 5D7AA 4AGCA 4F9YA 3MA6A 1QPJA 4E1ZA 2W5AA 2R64A 4LG4A 4O7VA 2OH0E 5HD7A 4C36A 4KKHA 3D0EA 4I1ZA 3H9OA 4ITIA 4DN5A 2V22A 3QZHA 4AUAA 3ZSGA 2IZUA 3OTUA 5TOZA 2F2UA 2HELA 2VRXA 2XCHA 3NWWA 3VN9A 2W1FA 5EQPA 4DCAA 3FQHA 4L7FA 4NJ3A 2W0JA 5GZAA 4OUCA 3AC5A 1APME 1XO2B 4C58A 4ZTQA 3PLAE 3D5WA 4YC8A 4PTGA 3EL8A 4ANNA 3CS9A 5AR5A 2O65A 1PHKA 4FEUA 2AYPA 2XRWA 2PHKA 5HEZA 3ZUTA 3W2PA 5FXRA 3VS6A 4BCHA 3SRVA 2KULA 2HWPA 5IQCA 3MESA 4FOBA 4K2RA 4I94A 2OK1A 4J1RA 1WCCA 1ZARA 2J0LA 4RJ6A 3W16A 4HVDA 1BYGA 4BDEA 1H27A 2VO6A 4OR5A 3VC4A 2YABA 4S30A 2UW0A 2GNJA 4ZY4A 4FTTA 2H96A 2B55A 2QI8A 5HZNA 5M57A 4J7BA 1PRYA 4UXQA 2ITPA 5HG7A 3ZSIA 4RVMA 4MK0A 4RG0A 2X1NA 3UPZA 4FV0A 2OWBA 3EWHA 2R3OA 4G6OA 5CU2A 4Y85A 2PTKA 3PJCA 5A3XA 4FUYA 3FXWA 3CD3A 3VAPA 4ZTMA 2I0HA 1H1RA 4X3FC 4QP9A 3B2WA 2XA4A 5LCJA 3Q9XA 1Q8UA 1WAKA 4DH5A 4BTKA 5J1WA 2BRBA 4FYOA 4BN1A 3V5PA 2QOFA 3A4OX 2JDSA 3PFQA 4QMQA 2JFMA 3KF4A 2YJRA 3LLTA 3HA6A 4FUXA 4HJOA 2J51A 1JQHA 2GDOA 3I0QA 3GU4A 4C4JA 4BCJA 1AQ1A 1R0EA 4MVFA 4I4FA 4C4EA 2XIXA 4TZRA 5ANIA 4YP8A 3ZXTA 3ROYA 2H6DA 3JY0A 2PK9A 3EH9A 3HZTA 4L9IA 5FP5A 4LFIA 1W83A 4BBFA 4PTCA 3PE2A 4PUZA 4UWCA 2WFYA 2BAKA 5CNNA 5HG8A 4EH8A 4XBUA 1PJKA 3OEFX 3VF8A 4CMUA 3QQGA 4QMPA 1G3NA 4L3JA 4KIQA 5H8BA 4CFNA 1J1CA 3R7EA 1QPEA 3TTJA 3W10A 5AA8A 4RC2A 3HMIA 4XV3A 3QKLA 4P2KA 3BHTA 2VD5A 3KB7A 4FKTA 3II5A 1JKKA 2UVXA 3ZLXA 2HZ0A 3AXWA 4E6QA 4ERWA 4BDAA 2W06A 2BRHA 5DRDA 1UU8A 2EVAA 2HW6A 4MWHA 4G3GA 3FHRA 4DTAA 3FMJA 3KULB 4YU2A 4FTCA 4IAIA 4IVBA 3LJ1A 2ZAZA 3HAVA 3P7AA 2VTMA 2ZVAA 4FSWA 1U5QA 2B0QA 1UV5A 3TI1A 3WF6A 3UPXA 4EOIA 3QX4A 3Q9WA 1QL6A 1H07A 3OOMA 4MXXA 3DZQA 3D2IA 5K0KA 2FO0A 3E8EA 2XS0A 5K4JA 2CKOA 3QUPA 3L9NA 4BC6A 1URWA 4DH3A 2GFCA 4RRVA 2R3IA 1Q8ZA 4L67A 2VTOA 4V0GB 2ZMCA 3FSFA 2WELA 4FZ6A 2BHEA 5E8ZA 1UWHA 3G5DA 4FKSA 4FZAB 2QHNA 3RCJA 5KO1A 3E8DA 2XMYA 4R78A 4AA5A 2WOTA 3ORLA 4YTIA 4FEXA 4GMYA 2UW5A 1A06A 2X4FA 4AFJA 3R2YA 3UQFA 3LCTA 4WRSA 1OIQA 3QRTA 5B0XA 2QO7A 3QRJA 4DH1A 4JBOA 4CKJA 3KXZA 4QYFA 2JDRA 5DEYA 3SV0A 1GIHA 3Q32A 2JAMA 4H3PA 4FF8A 4CFUA 1OECA 2JFLA 3MH2A 3MI9A 4XOZA 2WQNA 3D7TB 3QYWA 4RQVA 2XBAA 3VQUA 4KUJA 3FMKA 3H30A 4KIPA 4M12A 4EC9A 3CC6A 3G15A 5T68A 4MXOA 2YDKA 3RKBA 3TNQB 3Q2JA 2VTLA 4APPA 4O7LA 5HO7A 4PPAA 1PMVA 2WTVA 2R3MA 3DDPA 4UMQA 4O0YA 2C3JA 1ZXEA 3FHIA 5EW9A 3VHKA 2O3PA 3LCDA 3PP0A 4GK3A 4XBRA 5E4HA 3L8PA 4CSVA 3ZS5A 4NU1A 5DT0A 5IA0A 4KKGA 5IQFA 4LGGA 5HTIA 2X7OA 4AE6A 3ZLYA 2FUMA 2C3LA 1ZZ2A 3V3VA 4Z16A 4YLLA 1OI9A 2BZHB 2ITUA 3BIZA 2ZM3A 3FE3A 4ZZMA 3P5KA 4I6HA 4IJPA 4C3RA 4I5PA 4FV1A 4Z3VA 3NIEA 4DLIA 5AUZA 2C6DA 3FJQE 3ULZA 4I0SA 2R9SA 3CY2A 3ORKA 5DH3A 2G15A 4PTEA 4RQKA 3TDVA 5HCZA 2F2CB 2ITOA 4EQUA 1O6YA 3HGKA 2BDFA 2QOLA 3EQBA 4AZSA 4RFYA 1NT2A 5CI6A 1GZNA 4AA4A 3W2OA 4FEQA 2FSOX 2QC6A 4KIOA 4XP3A 4X6RA 3WIGA 4FICA 4E4XA 2GNHA 4W4XA 4MKCA 4CV9A 2BTSA 4O84A 3RAKA 2GPHA 2FB8A 4DG2E 1W82A 2C30A 2R3LA 4K11A 3V6RA 3F7WA 4D0XA 3PJ1A 4BBEA 2ETKA 4QP7A 1OPJA 5J5TA 3FI3A 4M67A 3CD8A 3ZXZA 5TF9A 2OIQA 2X39A 1UNHA 4IXPA 2GQSA 2WXVA 1XH4A 4X2JA 3EZRA 4IAYA 5A6OA 3EQRA 2OU7A 3IW5A 4DBXA 3KU2A 3VUGA 2UZBA 4I41A 4JDIA 1UU9A 1E1XA 3BQCA 3HRBA 4NFMA 2YAAA 1M7QA 4EHEA 2J0IA 5JEBA 3R7YA 5EI8A 2VTAA 3Q6WA 4J95A 5LMKC 3D4QA 3CXWA 1FGIA 3QXPA 3GOKA 4TWNA 3VJOA 2OXDA 4FKIA 4L6QA 4BR3A 2AC5A 3FMHA 4F7JA 1WBOA 4FIIA 3FZOA 3OUKA 2EB3A 3PTGA 3LAUA 4IE9A 5TO8A 5J7BA 3MPAA 5C03A 4CKIA 4EKLA 1LPUA 2W1IA 3GCPA 2HYYA 3CBLA 1IEPA 4ASXA 4MNFA 4JJRA 2W1DA 4FV8A 4O7RA 3FMMA 1XH5A 2FSLX 2C0IA 3Q4CA 2XKFA 4O0VA 4ZJVA 5FUTA 3OWPA 4R3CA 1DS5A 1Q61A 4USFA 1FGKA 3KFAA 3P78A 5CSVA 4ACCA 2J5EA 3A4PA 4JDJA 1B6CB 3TWJA 1K2PA 5L2QA 2R3QA 4BB4A 4Y95A 5IA3A 4FIHA 4JS8A 4RA4A 4PL5A 1ZMVA 1BL6A 2BVAA 5CF4A 2R2PA 4RIOA 5C8KA 1XHAA 4IDTA 1E1VA 4FK6A 3NYVA 3LZBA 1VR2A 5I9YA 4FKGA 1U59A 5M4IA 3MY0A 4DINA 4BCMA 4FTKA 4QPMA 4ZJIA 4FSNA 4KWPA 4LV8A 3KRRA 3NX8A 3LXKA 5D7VA 3ELJA 5M53A 4GJ2A 3EKNA 4CV8A 4DGOA 2GHGA 4H36A 1XJDA 2C5XA 3NS9A 4O2ZA 3RNIA 4X21A 4ACDA 2J7TA 4E6AA 2Q83A 3RALA 2PMNX 4IB0A 5AP6A 4S32A 4GUEA 1UWJA 5IZFA 3KVXA 5KMKA 5FXQA 2X81A 4FTNA 4IFGA 5AR3A 4L8MA 1YXVA 2QKWB 3QD3A 4OAVB 2FGIA 5E9EA 3BGQA 3FI2A 2QG5A 2GTNA 3FMDA 3M1SA 1JOWB 2HENA 1OL6A 2C5VA 2YM8A 4XJ0A 4Q9SA 4E4LA 3NLBA 3GI3A 4FIGA 4IAAA 5CXHA 2JDOA 4IJ9A 3HVCA 3IPHA 4NUSA 5BYZA 3UG1A 4DG3E 1XH6A 2AC3A 2OJIA 5CXZA 3S2PA 3I1AA 3VUKA 3V8SA 3TZ8A 2XNBA 4XP0A 1ZRZA 3OFMA 5D10A 4QP2A 2PY3A 1IR3A 2UV2A 5ACBC 3BWFA 4ZEGA 2I6LA 4O81A 4AN2A 5B2LA 4IDVA 2C4GA 3R7UA 5LMAA 3L8XA 3Q4TA 2GTMA 4IBMA 4F1OA 2QR8A 3EFWA 4UWBA 4MCVA 4EL9A 5E1SA 4JRVA 1KV2A 5CWZA 5GJFA 3RJCA 3UMXA 4RJ5A 2X2MA 2VTJA 2V7AA 2PU8A 4EOSA 3FLNC 3IECA 3SGCA 3C51A 5HG9A 2NP8A 3LHJA 4AW1A 3OUNB 4P4CA 4FV7A 5JRSA 3TG1A 2J2IB 4D4RA 3V6SA 2Z7QA 5BNJA 2SRCA 1UU3A 3ANRA 3GENA 1LP4A 3MPMA 3UDBA 3HP5A 5I9ZA 5I9VA 2J9MA 3BU5A 4FT0A 1QPCA 5ANJA 3NAYA 4FIFA 4EK6A 3HV6A 1YXTA 4RWJA 5DHJA 2GNGA 2I40A 1PMUA 4ALVA 4DEAA 2IVVA 3W18A 4E7WA 4EH7A 2VTPA 2XJ2A 4XG9A 1GOLA 2ZDUA 1UNLA 4R8QA 3B2TA 3JVRA 4GL9A 3OT3A 3EN6A 3UE4A 4IMYA 4H3QA 1YXXA 3C4EA 2BRNA 2Z60A 3MB6A 5I5ZA 4MWIA 4BCIA 3DAEA 3PY1A 4JL9A 3KA0A 4YJPA 4C4GA 3BBWA 4YNOA 3S95A 3R7VA 4FNXA 4ZTRA 4MF0A 4L53A 3SVVA 4KS7A 4QMUA 4EJ7A 3WZKA 3PIXA 5JN2A 4IADA 5I3OA 4RVKA 4FYNA 3WARA 2PUNA 5L8JA 2XIRA 3HEGA 4YJNA 5EOBA 4QTEA 3GQIA 1U4DA 3ALNA 2OGVA 3I60A 2XM8A 3LMGA 5HESA 3H4JA 3R1SA 4ANMA 4RGJA 5EW8A 1J91A 4MBLA 4OLIA 1OM1A 3O0GA 5AIKA 1M2QA 1YHWA 4F64A 3OZ6A 4RX7A 5HX6A 3R02A 2YZAA 5EYMA 2QOHA 3VNTA 5EI2A 3DBEA 5ANOA 2YACA 3NNUA 3RWPA 4F7LA 4I6BA 3R8MA 4JRNA 4XRLA 3QTZA 3CGOA 2ESMA 3C1XA 1CDKA 3F2AA 4BRXA 2XNMA 3TZMA 3E93A 3F3ZA 4A4LA 4B4LA 3GOPA 4D2RA 5GJDA 1YQJA 4LYNA 3DT1A 5CI7A 4YC3A 3VUDA 4C37A 1PXPA 2VTRA 3KXHA 4F9AA 4NZWB 1Q99A 1DM2A 1V1KA 3I0OA 3LQ8A 3KMUA 5AP1A 4BWKA 4YZMA 3ORNA 4I24A 5FXSA 4DEBA 5I9WA 4DEEA 1H1WA 3RM6A 3LJ2A 1MP8A 4Z7GA 2QOQA 3H9RA 5EHYA 1FMKA 3BHYA 3O2MA 4BI2A 1YI6A 4I92A 4CQEA 4KABA 4TWPA 1I44A 1OBDA 2WTWA 4CZUA 1R1WA 3FZTA 4ZY6A 4Y72A 3HMNA 4EQMA 4AZFA 4XG6A 4YR8A 2IN6A 2W4KA 4FT9A 2ERZE 4IH8A 3BYVA 3WBLA 4JT3A 3ZYAA 5BX0A 5J9ZA 5L4QA 3QZFA 2HZNA 3EN9A 4X3FB 2WPAA 4RX8A 4ZTHA 5E91A 3ZEPA 4E5WA 2RGPA 4EKKA 1YXUA 3PA4A 5HCYA 3D2KA 3RPOA 1O6KA 4WBBB 2F49A 3F66A 4FK3A 4HNIA 3COKA 3DK6A 4AOIA 5KX8A 2FVDA 4C3PA 2ZV9A 4RC3A 3FY0A 4PMMA 5FDPA 3KXMA 4RIWA 2HK5A 4EHVA 3NSZA 2R3GA 3F88A 3ACKA 3FKOA 2EUFB 4WRGA 4F9BA 1KWPA 2IVSA 5CENA 4TL0A 4QMSA 2O63A 2OJ9A 3UNKA 2QOOA 3FZ1A 3PZHA 2BMCA 3T8OA 2UW9A 3NUNA 5CZHA 5BPYA 2IVUA 2ONLC 3LFDA 4K0YA 3WZUA 2CNUA 4JBVA 4GEOA 3UP2A 3SA0A 1P4FA 3UQCA 1IRKA 4IAZA 5D11A 4FZ7A 5AAGA 4FSUA 4QRCA 4W4YA 3M2WA 2B9FA 5L2WA 3G33A 2B9JA 5AV0A 3RNYA 2W17A 2XIZA 3D5UA 4AACA 4U42A 2P2HA 4ZK5A 3IW6A 4LM5A 5BVFA 4ZTNA 2X8DA 4FKRA 3ZFXA 2JAVA 3C9WA 3DKGA 3BX5A 4FL3A 4X7QA 2P2IA 5F20A 5FG8A 4IX4A 3V51A 4ZAUA 3BHUA 4USEA 3TNIA 5IF1A 3FYKX 4C4IA 5LJJA 5C4LA 4GYGA 2BZIB 2X7FA 3A2CA 4N4SA 4G3DA 4EOLA 5IH4A 4LRMA 3AMBA 3QF9A 2VTHA 5M06A 4IVAA 3OF0A 3RHXA 5AR4A 3I7CA 3KK8A 4QP4A 1JSUA 4QPAA 4ZTLA 4ZLZA 2I7QA 3T9TA 5FM2A 2YDIA 2YCSA 3UC3A 4JIKA 3HKOA 5CAUA 3ZC6A 4I21A 4E26A 5KMNA 2PVKA 2YJSA 3BYMA 3IW8A 3TZ7A 1GNGA 4MX9A 3DB8A 2YCFA 4AWIA 3PSDA 3QD2B 2UW3A 5F94A 1TQPA 4YLJA 1ZAOA 5A4LA 2Y7JA 3CR0A 2W9ZB 4JAJA 4L46A 3ZMMA 2C6EA 4DH8A 3V04A 2A1AB 2JKMA 2WQBA 3MH1A 3PRIA 1IA8A 2O5KA 1JPAA 1H1SA 2ITNA 2UZLA 2X2LA 3SXSA 4HCUA 3QQJA 3RM7A 3VS2A 2CKPA 3P9JA 2WMWA 2WTKC 3O8UA 3NUAA 4NEUA 4FNYA 2B9HA 2XYNA 3QD4A 4X2GA 3UGCA 3HRFA 4A4XA 4N6YA 4QYEA 3TKIA 3R83A 1YI3A 2QLQA 4O6EA 4G2FA 3NZ0A 4U97A 5AX9A 3NVKI 4W4VA 5CQWA 4CT1A 4WT6A 4CCBA 3LPBA 4M0YA 3A8WA 4I23A 3GC8A 5IA1A 4UMPA 1OL2A 4D2PA 2LAVA 3PPKA 4FBXA 4O27B 4O0SA 1P2AA 3L9LA 4PMSA 4QP3A 1GAGA 3HLLA 4JAIA 4N57A 4LMUA 1M52A 2ZV2A 1PKGA 1PMEA 4G17A 3MVJA 3IOKA 4H39A 2YIWA 4H05A 3IO7A 4R5SA 3U87A 4O0RA 4BIBA 3BELA 1YOJA 3K3IA 4MF1A 4ZTSA 4ASEA 5AUTA 1PYEA 4BIEA 4TKSA 5E90A 4I6QA 2OIDA 2PVHA 4IQ6A 2QHMA 3NUPA 4OTQA 2C6KA 3FKNA 3GCSA 5C26A 4MXYA 1WFCA 5EQYA 2ERKA 3GNIB 2GQGA 4WBOA 4O7SA 4O83A 1FOTA 3C4CA 4YBJA 3EN4A 2ACXA 3A7GA 2C5NA 4UY9A 4BWPA 3F2RA 4QQJA 4M69B 3KN6A 5M4FA 5IQIA 3QKKA 4DGLC 3NMUF 2C69A 2X8EA 4X3JA 5IUIA 4IHPA 2BAQA 2Z02A 4UXLA 2UZUE 4TT7A 5EKOA 4C34A 3FEGA 2W5HA 1TVOA 3DU8A 3I5NA 2XH5A 3OWLA 4Q2AA 5J1VA 4AN3A 5HE0A 2WU7A 3RAIA 3VS3A 4FTAA 5JRQA 3RK9A 3KXGA 5D12A 4OBQA 3W8QA 3GU5A 5HI2A 3QQHA 3P86A 2GNFA 4FKPA 4X0MA 4BDFA 5CVHA 4H1JA 4JBQA 5B2MA 2XRUA 3TJDA 3MTLA 4UWYA 4D4YA 4Q5EA 2QR7A 4FTRA 3A8XA 4WO5A 3S0OA 5H8EA 3U51A 3COHA 5CEOA 4HYSA 2C6TA 2PMIA 2ITWA 3R30A 3VULA 5J95A 3DXNA 1F5QA 3RAWA 2ZV8A 4DT8A 3A7IA 2RL5A 4L3PA 5CAPA 3V5WA 3BI6A 4QYGA 4E93A 4BDKA 2HCKA 4DC2A 2JBPA 3KREA 2JIVA 1BKXA 3U4UA 1K3AA 1Q3WA 2OJFE 3C4FA 2IO6A 2E2BA 2GS6A 2XZSA 3PXRA 4FT3A 3TNWA 2NRUA 2RG6A 3GUBA 4AOTA 4U3YA 3DTWA 2VWUA 3QQLA 5CT7A 3ZO2A 4R3PA 2G1TA 4A9RA 3N4VA 2VTQA 3DNEA 4BDJA 5JFWA 2VO7A 3RVGA 4YJQA 1L8TA 5C1QB 2BFYA 2XJ1A 1YDSE 3FI4A 3W33A 3ZEWA 4NT4A 2QNJA 1Y57A 2UVZA 4FIJA 2IZRA 3CCNA 4YMJA 3UOHA 2UVYA 4C2WA 4EH3A 3BKBA 1JSTA 3VWAA 4AF3A 3ATSA 1JWHA 3I79A 4RWIA 4D5KA 4DFLA 2GCDA 3SG9A 2G2IA 2BRGA 4K8AA 4FEWA 4FZDB 3AD6A 1PXJA 3M42A 3MTFA 5CEPA 4R3RA 2EWAA 1SNXA 1V0OA 2P0CA 3ORTA 5EM8A 4BICA 3GB2A 5DE2A 2J5FA 3OCBA 1KE8A 4KS8A 3W32A 4J8MA 2XK9A 3BHVA 5F4NA 4BVUA 5HLWA 4JR7A 4HW7A 4XV2A 5CQUA 3UJGA 4YO6A 2VWXA 3DBCA 2YM7A 4K1BA 2VWWA 4YJRA 2XK3A 3R22A 1HCKA 3UOLA 4CFXA 1YDRE 3SG8A 1YXSA 4XLIA 3UYSA 5LCKA 3IGGA 5HG5A 4UX9A 2PE2A 5BVKA 4F4PA 3DV3A 4S33A 5K4IA 2E9VA 4IW0A 3VUHA 2UZTA 4GVAA 2HY81 4DGNA 1XBCA 4KINA 5AUWA 4IWDA 4PY1A 1OIYA 2ZM1A 2BFXA 5AAEA 2XEYA 5IUGA 4FEVA 4U43A 4CTCA 5B2KA 3RPRA 1Y8YA 2BIYA 3TACA 4CMTA 2IW9A 3QYZA 3WF8A 2ZDTA 4FL2A 3ZHPC 1JAMA 4IAFA 1ZYSA 4TXCA 4KNBA 4V05A 3UIXA 3MY5A 4F1MA 1Q8WA 4I5MA 4F9CA 3R28A 5CALA 3P1AA 5KMIA 2OJGA 1CTPE 4EOPA 3L9MA 5EYKA 4I0RA 4EYJA 2O2UA 4AGUA 1IG1A 4OTDA 3OWJA 3REPA 3G0EA 3CY3A 4IM0A 4BCNA 5L8KA 4MD8E 4QMZA 1M17A 4X2KA 2WIHA 1LR4A 5CEKA 2CKQA 4GFOA 4FV2A 5HE2A 4BCGA 2A19B 4RZWA 4B8LA 2F57A 3TUBA 4QMYA 3ZRLA 2BRMA 3DGKA 1HOWA 4UMTA 1UKIA 2BAJA 3EQDA 1DI8A 5CEQA 5A54A 2E9OA 4I5HA 5CSHA 3MV5A 3BZ3A 4B99A 1OZ1A 5FTQA 3MSSA 5IMEA 1P4OA 3WZDA 4FTLA 1ZWSA 1CKJA 2WMUA 3EZVA 4MNEA 4BKZA 4TYJA 5BVWA 5HTCA 5I0BA 3RK7A 2YM3A 3EFJA 5LVNA 4RPVA 3DZOA 3G6HA 4D9TA 3DJ7A 4L3LA 4KSPA 5CS6A 2YM4A 4EK3A 3QLGA 4QMLA 5JQ5A 3RAHA 4M66A 4XV1A 3B8RA 4IB1A 4QNAA 4U0IA 1KOBA 5FBNC 5JSMA 2OW3A 2G2FA 3EN5A 4YO4A 3DLZA 3K54A 5IQEA 1M2PA 4YSMA 4G3EA 4LL0A 4EH5A 4C7TA 4CGAA 5K3YA 4O22A 2V5QA 4R77A 4RJ4A 4JQ8A 3UVRA 1F3MC 4EI4A 3GBZA 2YZLA 3LFSA 5HHWA 5ICPA 2JLDA 1BUHA 4JX7A 2QO2A 1WVWA 1AD5A 5LXMA 3UO4A 4G31A 2VWBA 5EM6A 2RF9A 5CASA 4DF3A 3R1NA 3EMGA 1FVVA 2RIOA 2YCRA 2ZMDA 3OC1A 4GVJA 4NYEA 4OAUC 2W5BA 1KOAA 3N4UA 4ZP5A 2VGPA 3NIZA 4RC4A 4BBMA 4CZYB 5IUHA 4ASZA 2XNEA
chains in the Genus database with same CATH superfamily
2NNWB 4KAOA 4EZ3A 1WBNA 1CKIA 2PMOX 2RFSA 5J79A 5TE0A 4F70A 3PXQA 5IEXA 4W8DA 1Q97A 4C59A 3GCVA 3FMLA 5BVDA 2ZB0A 1KSWA 2QO9A 3FSKA 4AW0A 3EKKA 1PY5A 4EOQA 3AC3A 4BTMA 4AOJA 1IAHA 4AZWA 3P08A 4BCFA 2P4IA 3LFEA 2PVMA 3LXLA 3O7LB 4FKLA 3ZDIA 3OW3A 4FKWA 1OMWA 3DDQA 3CLYA 3F5PA 3FLYA 5DG5A 5DR9A 4F0FA 3UIBA 4M68A 4YUQA 4GFMA 3K5UA 4FV9A 1OKWA 4IWPA 3AGMA 3DBDA 4IVDA 1FQ1B 1PXLA 4TYHB 3QTIA 4AZTA 5J8IA 4CLJA 3DLSA 4Y46A 4ZMEA 5AWMA 4BKJA 2J0KA 4BDGA 3Q5IA 4L68A 1XMLA 1JBPE 3ERKA 3UNJA 5KNJA 2CGXA 3ULIA 3VW6A 4BCPA 4EH6A 1M2RA 2BKZA 4D9UA 4ENYA 5HX8A 2R5TA 4YTFA 4PDOA 4OGRA 3PRFA 2XKDA 5ANKA 1SM2A 1UKHA 2W4JA 4TY1A 4F6UA 2EXMA 5DGZA 4RZVA 3LKMA 4FTJA 4WNKA 1H00A 3AD4A 5GIOE 3SLSA 4WSYA 3IOPA 1W8CA 3L8VA 5IQAA 2Z7SA 3QKMA 3DBQA 4QMNA 4O0XA 5CU4A 4YURA 1JSVA 3EQCA 2B1PA 3Q52A 3V01A 4BGQA 4NM0A 5L6OA 5LVPA 3R9OA 5IH5A 3NYXA 2CDZA 4O21A 3MH3A 5HO6A 2UZDA 4QO9A 5A4TA 5JGAA 3LQ5A 2R3KA 3Q9YA 4G34A 2ITTA 2YN8A 3WILA 3ZUVA 5BUIA 2CGWA 2W1EA 3MN3A 1CKPA 3LJ0A 2E9NA 4PNIA 4ANSA 3GCUA 4D2WA 1R39A 4G6LA 1Q41A 4ORKA 4BKYA 4DFXE 4IZ5A 4U9AA 4BWXA 2JD5A 4ZSLA 3HMPA 2O0UA 4MXZA 1G5SA 4BDHA 4DEDA 4ZLOA 1PKDA 2E9UA 3KK9A 3ENHA 3D15A 3ZH8A 5DMZA 5F9EA 4S31A 4KKEA 3LFNA 5KUPA 4A7CA 1H1PA 3VW8A 4ALUA 3PVWA 3KCFA 4KIKB 4IX5A 3KKVA 2WQEA 3MA3A 3W0PA 4KB8A 4LMNA 5A4CA 3TNHA 1CSNA 4A9SA 3E7VA 4BYIA 1VYZA 5AUYA 4O86A 2GMXA 2B53A 3VS7A 3P4KA 1YOLA 2Z2WA 3MY1A 4JX3A 5ACKA 4O1PA 3CQUA 5EM5A 3WZJA 4CFFA 3RPSA 3C5IA 2C0TA 5D41A 3BE2A 3R71A 3U4WA 4ZMFA 3TYKA 4HGTA 1OIRA 3VS1A 2QVSE 3SXFA 4U44A 5FRIA 1NVRA 3CTJA 4MHAA 3UDTA 3P79A 1H28A 2ZB1A 3CQWA 1SYKA 1R78A 4B0GA 2H34A 4FNZA 4EWQA 3AKJA 5T3QA 4HCVA 5DA3A 4CRSA 4J8NA 4HVHA 4R5YA 4HYUA 3DKCA 3LFCA 4L01A 3C0GA 4DFYA 5AM7A 5DN3A 3PWDA 4P7EA 4CT2A 4QD6A 5IU2A 2V55A 3AQVA 3R1YA 5CF5A 3FDNA 1RDQE 5HD4A 3PE1A 2QQ7A 5I4NA 4XOYA 2AEGA 2PWLA 5CTPA 3DNDA 3E62A 3OVVA 2WMRA 3E3PA 4IB5A 4TN6A 1OKZA 1OUKA 2J90A 2UW4A 2C47A 5DOSA 3AC2A 4LGDA 2ZYBA 3FWQA 4G16A 4RJ7A 1Q24A 4A4OA 4E6DA 1P14A 1WBWA 1WBPA 4RIXA 4YZDA 3I7BA 4WHZA 2RKUA 1H24A 2ETMA 3LMIA 3OCSA 4D28A 4M69A 4YC6A 2R7IA 3OWKA 3U55A 3QQUA 3ENMA 4EK4A 3IQ7A 2A0CX 3R0TA 3Q6UA 4FSQA 2RFEA 3HP2A 4ITJA 5DWRA 5CNOA 3V5TA 3BEAA 4LRJA 4K18A 3VS4A 3NR9A 4LGHA 4F6SA 1REKA 2OIBA 3GC9A 4GIIA 1RJBA 4RIYA 3CEKA 3SRVB 4HZRA 3ATTA 4NW6A 3FAAA 5KKRB 3G9NA 4NL0A 2YISA 2W99B 3RGFA 3FKLA 3IW7A 4DHFA 2YCQA 3GU6A 2RSVA 3G51A 3C13A 3KEXA 3KRJA 4B7TA 4F0GA 5GIPE 1ZYLA 3MPTA 5EHLA 4FTQA 3WOWA 5E8UA 3R9RA 3R8PA 4FSYA 3O7LD 4RT7A 3AD5A 3ZRKA 3QL8A 4OW8A 3UO6A 5C8MA 5CYIA 5A4EA 3QALE 4I3ZA 5AMNA 1WMKA 4NW5A 1WBTA 4TW9A 2AUHA 3VJNA 4NKSA 2VWYA 4I20A 4C2VA 2VZ6A 1OUYA 1ERKA 3OG7A 1RQQA 1FBNA 3EQIA 5A6NA 3QCXA 2GHLA 4CFMA 1VYWA 3LFBA 3FUPA 3NNWA 3QA8A 4FL1A 2W05A 5FTOA 4QEBA 2CHLA 5ANEA 1EH4A 2R0UA 4I93A 4MQ2A 2CNVA 5C4KA 2PYWA 5CSXA 4O7WA 4Y83A 5JFVA 3PVBA 1TQMA 3LM0A 1OGYA 4J53A 3O51A 3OMVA 4EUTA 3PUPA 2F4JA 3ORPA 3PXFA 5EQEA 4O7ZA 2CCHA 3POOA 3BL7A 3HUBA 1R0PA 2HZIA 3DS6A 4BJJA 2F9GA 5J5SA 1G8KA 4FODA 2GFSA 3KC3A 3Q60A 4NCTA 4ANLA 2JIUA 5IA2A 5H2UA 4B8MA 3KGAA 3HECA 4ACHA 5HIBA 3U9NA 2YM5A 3CJFA 5M56A 4CZTA 5EDQA 5AUUA 2R3RA 2E9PA 3PIYA 4GH2A 5EYDA 3RPYA 4EH2A 3RI1A 3PJ2A 3RPVA 5BVOA 3D9VA 3EQHA 4WG3A 3PPJA 3PSCA 1BI7A 2CLXA 2IW6A 1SNUA 3E5AA 2BR1A 4RVTA 2WGJA 4R1YA 5AR2A 2PZPA 1ST4A 2FSMX 3GFWA 4FSMA 4YNEA 1OVEA 4JQEA 4DHJA 2GHMA 3LXNA 5KZIA 4CG9A 5K0XA 2BPMA 1T45A 3COIA 2PUIA 2ETRA 4ONAA 4TTHB 2PULA 2KTYA 5AP5A 4CVAA 4ACMA 2I0EA 4YJVA 5H8GA 3TNPC 3ODYX 3D14A 4OTPA 1FPUA 4PDPA 4U81A 4CFWA 3EN7A 4JG6A 3LW0A 3AC4A 3QCSA 3VF9A 2CMWA 5CU6A 4JQ7A 2X6EA 4XG3A 3OXTA 5KMJA 3DQWA 4QMWA 1UNGA 4KD1A 4RLLA 3ALOA 3K2LA 4FIEA 5E8XA 1O6LA 2W7XA 1H8FA 4GG5A 4FTIA 4BIDA 4ANOA 4LQMA 4EORA 3SDJA 3R8VA 3R00A 3M11A 2ZJWA 1GIJA 3HDNA 1VLRA 2QONA 4WIHA 3OCGA 2CJMA 5K5XA 5JK3A 4GKIA 3DAKA 5GHVA 4QDEA 4FV6A 3C0HA 4ASDA 4EOOA 4NKAA 4RLKA 3HUCA 4GFGA 3L8SA 5LWNA 3W0OA 4YHFA 5FLFA 3AC1A 1ND4A 3F5GA 4FOCA 5M08A 2Q0NA 3O17A 2YLEA 4BZNA 2VTNA 1S9JA 4QTCA 2GS2A 4FNWA 2REIA 1DAYA 3R21A 2C5OA 4YZ9A 1ATPE 4FMQA 3CGFA 4ACGA 2CN8A 5K9IA 3A7FA 4OTRA 4HYHA 3S00A 4EHGA 4ZXTA 3T3UA 2VAGA 4WG5A 5G6VA 3LM5A 4TYGA 4TRLA 3RMFA 2UZOA 4IZ7A 2VU3A 3K3JA 5CAVA 1YW2A 3VS0A 4PX6A 5AR7A 3KIOC 3KULA 3FC2A 3TV4A 4DFUA 2XVDA 3PSBA 4ZSAA 5EG3A 3GU8A 4BDCA 3PY0A 5F95A 4E6CA 5L8LA 4DHIB 4IWQA 4LRKA 3WI6A 2OXXA 1YWVA 5C27A 2VWZA 2VO0A 3ORZA 1R3CA 5I9UA 3OS3A 1XH9A 2BTRA 4MBJA 4V0GA 2YIXA 1W98A 2XJ0A 3SD0A 3NDMA 1JLUE 2XNNA 2OSCA 2C5YA 3CTHA 4FVRA 3E88A 4O2PA 5A14A 3R7OA 3DOGA 4WUAA 5HBHA 3Q04A 5AV4A 3FQSA 3Q5ZA 4BFMA 4HZSA 4BI1A 1YOMA 2XANA 3U8WA 4QP6A 4DGMA 4BDDA 1Z5MA 1ST0A 1H08A 3F3UA 3ZLSA 4DFBA 3QTQA 3OY1A 5DNRA 3RBWA 2R3HA 3G90X 3GT8A 5K5NA 2XK6A 2Y6MA 3RWQA 4DYMA 2I0VA 2OICA 3HMOA 1DAWA 3BPRA 4HPTE 5KHXA 4ZSJA 3UG2A 3UNZA 5ETAA 1OGUA 5F1ZA 3POZA 4L45A 2WAJA 4TWCA 2JDTA 3D7TA 4CFVA 4RFMA 3ZC5A 3Q4ZA 3TKHA 2OI4X 3QHWA 3RCDA 3DBFA 3W2SA 1Q62A 4YZBA 3R8ZA 3DAJA 4XYFA 3RP9A 4MXCA 1OPKA 3R1QA 4X2FA 4D4VA 1IASA 4E73A 3FQEA 4IACA 3HMMA 5LARA 4AN9A 2CSNA 3MYGA 4P5QA 3FMNA 1W7HA 4GU9A 5KZ0A 5HNBA 4FTMA 2UUEA 4UBAA 4OT5A 1Y91A 2C68A 4FZFB 4PPBA 3NCGA 2Y0AA 3DK3A 3E8NA 4M84A 5I9XA 5EDPA 4WD5A 5IISA 4OTHA 2CGUA 2OZAB 2C1AA 1U46A 5JFSA 3D94A 4K9YA 4XV9A 3GEQA 5HCXA 3W2RA 5JGBA 3ZU7A 4TYEA 4K33A 5IQDA 4JNWA 4C02A 4P90A 4CCUA 4PMPA 4U45A 5CEIA 3DXPA 1RE8A 4NM5A 3RHKA 1NVQA 2Z7LA 4O96A 4AE9A 2ZV7A 3QU0A 4DAWA 3NUUA 2ITZA 2I1MA 3NW5A 3ZO4A 4Z7HA 4QOXA 2JEDA 4TNBA 2R7BA 4HYIA 4GCJA 4QQCA 4WA9A 5CANA 4XHKB 4XUFA 2X9FA 3W1FA 5IDNA 5EFQA 2O8YA 2Y4PA 2IW8A 3NNVA 4WSQA 3TXOA 3SHEA 2NPQA 3GC0A 5HO8A 3MWUA 4D2VA 1F0QA 3GVUA 5HIDA 2VWIA 2X4ZA 3OD6X 3A99A 4GT5A 3VHEA 2DYLA 4AQKA 1BLXA 5LOHA 4ZOGA 2HW7A 3C4ZA 3PDTA 3QQKA 4JG7A 4G9CA 5AEPA 1O9UA 3NW7A 3UTOA 4DLJA 1A9UA 2WMXA 5JMSA 4IX6A 1JNKA 4W9WA 2WTCA 4MXAA 4XG2A 3C4XA 2QOCA 2YEXA 4HCTA 3W8LA 4BDIA 4EYMA 3H10A 4MEDA 3ZM4A 2W4OA 2X7GA 4FTUA 4KBAA 3QTUA 3NYOA 3P0MA 3OW4A 1SVEA 2YIYA 4LI5A 5HGIA 2VN9A 3E64A 2YLFA 3MFRA 4LV5A 5LWMA 3U6HA 2JIIA 2VGOA 4F0IA 3O8PA 4GS6A 1Y8GA 2VWVA 5HLPA 4FKJA 4II5A 2PE0A 4XMOA 2JITA 3FV8A 3QXOA 1L3RE 3VUMA 5HVKA 4FT7A 4YHTA 3F69A 2OXYA 3BHHA 1XBBA 5BVNA 2YWPA 4JDHA 1XH8A 4G1WA 3QUDA 3WIKA 5FQDC 2PUUA 2A2AA 2C0OA 4PDSA 4D0WA 3F5XA 4EEVA 3R2BA 5JH6A 2IWIA 1OL5A 1MRYA 3H0ZA 2EB2A 3SKCA 3BLRA 4XG8A 4GT4A 4ZSEA 2G01A 4NH1A 4ZZNA 3MGYA 1NA7A 4GKHA 3PJ8A 3ZDUA 4KIKA 2NRYA 1ZYJA 3RZBA 4FR4A 4LUDA 4U80A 2IF8A 1PXOA 3NAXA 4DTBA 4GYIA 3PY3A 2PL0A 4IEBA 5HU3A 3E3BX 4I0TA 1RW8A 3N4TA 3V8WA 3Q4UA 2XNPA 4JR3A 2EXCX 2Y8OA 4DBNA 3EQPA 5HTBA 2XM9A 1Y6AA 5HKMA 3FXZA 4BL1A 1ZOGA 4FVQA 4QYYA 5IEVA 3OTVA 3D83A 5BMSA 3ZUUA 4Z9LA 4JOAA 4JDKA 4I4EA 5TT7A 3DQXA 1YKRA 3P7BA 2W1CA 4QMVA 1J7UA 4DCEA 1YWRA 4ID7A 5JQ8A 2GQRA 4O7YA 5GINE 3D5XA 3HV3A 3QRUA 3MFSA 5JKGA 3TV7A 1ZOHA 3IG7A 4WG4A 3PYYA 4BGHA 3G2FA 1J7LA 3FI8A 3ZTXA 3OROA 3ZBFA 3C0IA 2DS1A 4UYNA 4BCKA 4ALWA 4EQCA 2XNGA 3LVPA 5DVRA 2VX1A 3VUTA 3N51A 4EOMA 5BUEA 4IB3A 4CKRA 4AFEA 5E8YA 2BHHA 5J9LA 4U7ZA 4DFZE 3KCKA 1MQBA 3UDSA 4AP7A 2OKRA 3MVLA 5LMBA 5AJQA 4USDA 4E4NA 2OO8X 5E8SA 3I4BA 4NWMA 3JS2A 2CKEA 3FY2A 3MBLA 4PF4A 4OBPA 3TCPA 5CVGA 4O7NA 3AG9A 1AGWA 2PPQA 4K6ZA 4YHJA 4GV1A 1BMKA 2WQOA 2X0QA 3OBGA 1UU7A 3CPCA 4JBPA 4N6ZA 3F2NA 5DYJA 3FPMA 1B39A 3D7ZA 4M7IA 2VO3A 5HOAA 3UP7A 3O96A 1W2FA 2PVLA 4KSQA 4XRJA 3VIDA 3UO5A 4IC8A 3OEZA 1ZMUA 3GP0A 3R7GA 3AT3A 3CTQA 4MBIA 5LVOA 2OFVA 1QPDA 2BILB 2UZNA 3ODZX 2C1BA 4TNDA 1MRVA 2XKCA 4J96A 5HU9A 3Q53A 3KRWA 2V7OA 5CSPA 5JZJA 5CF6A 3VBTA 2IPXA 4D1SA 4RSSA 4GU6A 3DJ5A 4F63A 3MJ1A 3E92A 4CD0A 2UZVA 3DTCA 4O0TA 3PUFC 5DT3A 3D5VA 3G9LX 2VX3A 1XR1A 4C62A 4AA0A 4ITHA 4EBWA 5M09A 4RMZA 5BYYA 5KBQA 3CQEA 1G8SA 1PYXA 3PVUA 3VVHA 2W1HA 4QP8A 4W8EA 2RFNA 3CIKA 4G5PA 4HOKA 4DEHA 4FV5A 4GT3A 4BZOA 3SOAA 4F9WA 2B52A 2IJMA 4U40A 3ETAA 1ZOEA 3HL7A 1Q4LA 4LOOA 4C33A 4C4HA 2PVFA 2G9XA 1WBVA 5EDRA 3T3VA 4Y8DA 3UVPA 2HY0A 4RVLA 5IKWA 4DDIA 4YGAA 3FBVA 3UBDA 3QZGA 4YPDA 2Z8CA 4OT6A 4EK5A 3DFAA 4QNYA 3HDMA 1GZOA 4A9TA 1JKTA 4FE2A 1QCFA 4WKQA 1UA2A 1MUOA 4QP1A 2BZKB 3QRKA 1ZZLA 4LL5A 3EYHA 3BQRA 4NM7A 3QX2A 1H26A 5ETIA 3RZFA 2XAMA 4DA5A 3QBNA 3G0FA 3SX9A 3C50A 2PVJA 3A62A 3RINA 2X6DA 3DFCB 3OHTA 2QU5A 4HVGA 2YFXA 5CT0A 4BGGA 3BGPA 3WF9A 1GY3A 5IQBA 1OKVA 4NFNA 4AX8A 1XBAA 5M4CA 5EM7A 4RIWB 4ZJJA 4KRCA 4HGSA 2V62A 4XX9A 2UW8A 4MYGA 3PIZA 4G5JA 4Q5HA 4BZDA 5LQFA 4X2NA 3U54A 1VJYA 3LFQA 4RJ8A 2QLUA 3WE4A 3MFUA 5KMLA 5JFXA 1YHVA 4O38A 3ORXA 5DR2A 4A07A 3E63A 4O7TA 5EI6A 2DWBA 2YIRA 2XK4A 4RA5A 5TKDA 4C35A 1OPLA 3O50A 3H9FA 3TIZA 3ITZA 1XMMA 4G6NA 3FLWA 2PZIA 5LVMA 4L7SA 1KE9A 4PP9A 4PNKA 3N9XA 5DPVA 2XCKA 4IWOA 2V0DA 4L00A 4YPSA 3VBYA 3VONA 4AZEA 1BX6A 3OT8A 4FKOA 4XLVA 4CXAA 5KBRA 5FEDA 2WNTA 5TR6A 2YERA 5BYLA 4UEUA 3WF5A 5BVEA 3KRLA 3R9NA 2PE1A 3FPQA 2C6MA 5DLSA 3TKUA 3CKWA 3ET7A 3FMEA 3G6GA 4IZAA 3TUDA 4M97A 4X3FA 5AFVA 1YDTE 4CEGA 2Y4IC 3SW7A 3UIMA 4UZDA 4IAKA 4AG8A 2WD1A 2OLCA 3KL8A 3NGAA 3VBVA 2W96B 4DT9A 3F6XA 3EQGA 1OL7A 1GIIA 3A61A 4D1XA 1TZDA 3PA5A 5D9HA 2OG8A 2PSQA 4EZ5A 4D55A 3KY2A 3QD0A 3TIYA 4L52A 4YBKA 3LIJA 4UMUA 5BUJA 4K77A 1WVYA 3KMMA 3RK5A 3NCZA 3W2CA 3UC4A 4IFCA 1ZYDA 1VEBA 4B6LA 1PMNA 5FM3A 4EOJA 4FT5A 4NTSA 5L2SA 2XK8A 3BYSA 2WZJA 2Y9QA 2J50A 5IPJA 4A9UA 3AMYA 4XG4A 2R3NA 4M15A 4QMMA 4MD7E 5FWKK 3U9CA 3PPZA 5HIEA 1FVTA 4GSBA 2JKQA 2C6LA 5C01A 1REJA 4D2SA 2WMVA 3GQLA 5JZNA 4BCOA 5HICA 4HVSA 3LMHA 4RFZA 4XS2A 3Q96A 3CSVA 4Y73A 2CN5A 4ENXA 3A7JA 5E7RA 1V0PA 3V5LA 4YZCA 3E8CA 3HAMA 2ZM4A 3AT2A 4RX5A 4HNFA 1IA9A 2X9EA 2YM6A 2ZOQA 4QQTA 4OTIA 1LUFA 4EWHA 2F7EE 3MDYA 4TYIA 3ID6C 4J98A 3WYYA 4UMRA 5BQ0A 1LEZA 4YJOA 4YSJA 4FSRA 4KBCA 4C4FA 2XIKA 5C9CA 5IDPA 5IMXA 2WTIA 3PWYA 3BLHA 3CPBA 2YWVA 4O0UA 4O4DA 5AAFA 3ORMA 4FV4A 5J7HA 3MIYA 3PFYA 4R6VA 3A7HA 2WO6A 3QTWA 3AKKA 3UYTA 2HXLA 2X0GA 4F65A 1ZMWA 4QTBA 2PUPA 4D2TA 2QOIA 3EJ1A 1U54B 2Q0BA 5DRBA 4ZS4A 5E8VA 4ZY5A 4F09A 3THBA 2F7ZE 3IKAA 3IONA 2PVYA 3R04A 2ITQA 4WNPA 5IG1A 2F7XE 2FYSA 4S34A 3F82A 2BUJA 3BV2A 3R6XA 4GK4A 3PLSA 5BMMA 2GU8A 4UB7A 3ZO3A 2OZAA 3DCVA 3MH0A 4U8ZA 2IVTA 2BCJA 4A9YA 4CQGA 4D5HA 3QTXA 4M0ZA 3IW4A 4C0TA 5EKNA 3LFFA 4RJ3A 3GCQA 5A4QA 3T9IA 4DH7A 5J9YA 3UOKA 1TQIA 4D1ZA 3HV4A 4DEGA 1OITA 4QQ5A 3QWKA 1FVRA 2IG7A 1GJOA 5D1JA 5DI1A 4I6FA 3ZO1A 3O8TA 4NIFB 4U41A 4O82A 3DXQA 4BTFA 2FH9A 3V5JA 4L42A 3EIDA 3Q3BA 4NCTC 4ZLYA 3JYAA 2UW7A 4FSZA 5KMOA 3L9PA 3O23A 3R9DA 5DT4A 3OCTA 3GU7A 4QYHA 1WBSA 4FTOA 4QPSA 2BZJA 2YHVA 2Z7RA 2YDJA 3EFLA 1NY3A 4MTAA 4TWOA 3R8UA 4CNHA 4J97A 3SAYA 5GZ8A 2IZTA 2JC6A 3C4WA 4QMOA 2X0PA 4N0SA 2CPKE 1XQZA 2DUVA 3IS5A 4IC7A 4J71A 3E7OA 2RFDA 3QCQA 4J99A 5GZ9A 2WTKB 4PL4A 3BYUA 4QMTA 5HNGA 2WIPA 2YAKA 4XNEA 3ANQA 5EK7A 4BHNA 4DE4A 5AP3A 3JPVA 4O6LA 4G9RA 5DBXA 4O91A 5FEEA 4O1OA 2QOKA 5ETFA 5DFPA 2WHBA 5M55A 2PZRA 4F7NA 4FRFA 4X6QC 3TL8A 2GSFA 2NO3A 3NW6A 3PXKA 3NRMA 1SVGA 2VNWA 3QA0A 3QHRA 5DEWA 5DIAA 5HBEA 5AR8A 3UIUA 4DTKA 3UOJA 1SMHA 4H58A 4UYAA 2XF0A 5L6WL 4NSTA 4O4FA 3U6JA 4E3CA 3MVHA 1WVXA 4GIHA 5FEQA 4HPUE 4BF2A 1HCLA 5KCVA 3BWJA 3KMWA 3BYOA 3MB7A 3PG1A 5CU3A 3S1HA 3QZIA 3C5UA 1URCA 2WKMA 4GUBA 5M4UA 4DITA 2HOGA 2WEIA 4OTGA 5CX9A 1T46A 2X2KA 3AC8A 3KVWA 3PJ3A 4EJNA 3FL4A 1YRPA 5IQGA 3DJ6A 3VBQA 2VNYA 5AP2A 3ZONA 4C38A 2QG7A 3TV6A 5LMKA 3GC7A 4CTBA 3NUSA 3JR1A 4NM3A 1KV1A 4KA3A 3ZZWA 1OL1A 4DEIA 2XYUA 4NJDA 2J0MB 5E8TA 4F1TA 4HGLA 2C3IB 2OFUA 3TJCA 4Z55A 3VS5A 2CCIA 3ZFMA 4AT3A 4U3ZA 3OBJA 3MVMA 3LFAA 2A27A 3VBXA 1PXMA 1XKKA 1H1QA 4XEYA 2B7AA 2PVNA 3FLZA 3R63A 4E5AX 4EHZA 2VTIA 2GNIA 5AP7A 1SVHA 5HBJA 5E1EA 1JKLA 4V04A 2R4BA 5CAQA 5CVFA 4NTTA 4IIRA 2BDJA 4MD9E 5AP4A 4BYJA 1M7NA 4F08A 1Y6BA 4PRJA 2QKRA 4H1MA 4EZ7A 4Q9ZA 4U6RA 2HZ4A 5M51A 5AA9A 5H9BA 4FKUA 4CMOA 3LCOA 5HQ0A 2H9VA 4BCQA 5AADA 1J7IA 2ITYA 5FD2A 4BHZA 3ZBXA 3I6WA 4N70A 2R0IA 2QD9A 3COMA 2CNQA 3AKLA 4FX3A 4C57A 3KXNA 3S3IA 3C7QA 5L3AA 4WOVA 2OBJA 2IZSA 2DQ7X 3VRZA 5HNIX 3L1SA 3FZRA 3LCKA 4RWKA 4YTCA 3AMAA 4NK9A 3BU3A 4FA2A 3F7ZA 5KE0A 5B7VA 1YVJA 5CY3A 4D4SA 3WE8A 4HVIA 3OXIA 5CAOA 4U5JA 3F3WA 4EK8A 4F7SA 5M44A 1TKIA 3DB6A 3ML1A 3JUHA 1FMOE 1H25A 3QC9A 5AUXA 1H0WA 3I81A 4CLIA 3WZEA 3IK3A 3NEWA 3FYJX 4BTJA 5JGDA 2ITVA 3R8LA 2OJJA 3BEGA 3QUEA 4MNEB 1GZ8A 5EW3A 5IQHA 4UZHA 4DFNA 2B54A 5HORA 5IA4A 3TUCA 4P5ZA 2R3JA 2J4ZA 1IAJA 4FV3A 3HRCA 4IVCA 5EH0A 4R7BA 1P5EA 3SC1A 3AT4A 3TT0A 3LLAA 5J87A 4I22A 1JKSA 2WMBA 3LE6A 2CGVA 3TN8A 4L44A 4FI1A 4U79A 4ZS0A 1KE5A 2JKOA 3FLSA 3CJGA 4JVGA 2OH4A 4IX3A 3MJ2A 1J1BA 4J52A 4L43A 3QGWA 5FGKA 4PP7A 1XH7A 2J0JA 3K5VA 4GK2A 4G3FA 3KRXA 3DK7A 3EQFA 5E8WA 3ZRMA 3I5ZA 3Q2MA 3NPCA 3P7CA 4XH6A 2B4SB 2VTSA 4WNOA 1BL7A 3H0YA 3O71A 3F3VA 3GFEA 2UW6A 2XNOA 2BALA 3SXRA 3NFGB 1G8AA 3HV7A 4YJSA 3PZEA 3BBTB 2P3GX 3F3TA 2WU6A 3JY9A 4EH9A 2JKKA 2WMSA 4UALA 3VQHA 4AXAA 2EU9A 1BI8A 3MFTA 4ZIMA 1S9IA 4R7HA 4WUNA 1W84A 3KXXA 3NUXA 4FKVA 1PF8A 3QTSA 4ZZOA 1OBGA 3ZM9A 4A06A 3F61A 4PV0A 5L2TA 4RWLA 4R7IA 2YA9A 2WMAA 4FC0A 5CSWA 2CLQA 3VUIA 2OF2A 2XB7A 4LOQA 4ARKA 3ZSHA 5HVJA 2XKEA 3Q9ZA 1UVRA 4LOPA 4O0WA 5FP6A 3MW1A 1Q8YA 4EC8A 2HXQA 3TMOA 4M13A 3EFKA 1ZLTA 3EB0A 3JXWA 3FZSA 4GJ3A 1GZKA 3QC4A 4M3QA 3V5QA 3FLQA 5AIRA 4W9XA 1MQ4A 5GNKA 1FINA 4IZYA 3R01A 1CM8A 2XBJA 2GS7A 3AGLA 5E92A 4CYIA 4KBKA 5AV2A 5KHWA 4DHZA 1ZYCA 3ACJA 2B9IA 3EOCA 4MQ1A 2P33A 3U6IA 4M8TA 5ANGA 2QOBA 2YITA 3DPKA 5HVYA 5AX3A 1YHSA 2BKKA 3ZOSA 3QQFA 1DI9A 3OP5A 3TTIA 4CRLA 4UN0C 2Y6OA 3BRBA 1NXKA 3HV5A 4EH4A 2UZEA 4UV0A 2PVRA 2VTTA 2QU6A 3I6UA 3VRYA 3W2QA 5JT2A 3LCSA 3BV3A 4GG7A 1H4LA 2HAKA 3SQQA 3R7IA 1OB3A 3FXXA 3QFVA 3ZCLA 3TEIA 3NVMB 4R1VA 2G2HA 4QMXA 5IEYA 3W0SA 3NFFB 3CE3A 4FVPA 3FL5A 4PWNA