3IO7A

2-aminopyrazolo[1,5-a]pyrimidines as potent and selective inhibitors of jak2
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
289
structure length
282
Chain Sequence
TQFEERHLKFLQQLGKGGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase JAK2
publication title 2-Aminopyrazolo[1,5-a]pyrimidines as potent and selective inhibitors of JAK2.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 282
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3io7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3io7A01
3POOA 3QZFA 4I20A 4WNKA 1R3CA 4KIKA 4MYGA 2JDSA 1EH4A 1G3NA 2WZJA 1ZY5A 3DQWA 4IWPA 2WTWA 4MEDA 1PF8A 2H9VA 3KA0A 4M68A 3QWJA 2BKKA 4GS6A 2F4JA 2X2LA 4EKLA 3PSCA 4NCTC 4XMOA 3A8XA 2XZSA 3ZCLA 5JK3A 1ZXEA 3HDMA 4AP7A 3VUTA 2RGPA 3A7JA 4GG7A 2C6DA 4D1XA 2RFEA 4TN6A 4O0YA 4X6QC 4EOMA 3RMFA 4DH7A 4YNOA 4O91A 4W4VA 2HW7A 2BKZA 1LPUA 4RX8A 2CHLA 3N51A 3R83A 3R7IA 5I0BA 4J8NA 4FL3A 5M07A 4QNYA 3N4VA 3REPA 5BQ0A 2BAQA 4MXOA 1OPLA 4L44A 3QA0A 3CY2A 3VN9A 1Q8TA 3ZXZA 2XMYA 3EN5A 4UY9A 5CANA 4Q5EA 4RVTA 3BX5A 4C4EA 1SVHA 2BPMA 2H6DA 2JKMA 5G6VA 4EOQA 3VULA 3UYTA 3A8WA 4BN1A 5HX8A 1PRYA 3G90X 4MWIA 3GU8A 5D10A 5JT2A 1SMHA 4E6AA 4R3PA 3C4CA 3W55A 3W8QA 2FSLX 3UP7A 3TUCA 5AWMA 1OIQA 2QOBA 3R1QA 3SAYA 4FKWA 2O65A 2BDFA 2Z60A 2BVAA 3QHRA 4HNFA 5HTIA 3E7VA 4V04A 5IQIA 4AU8A 3QZHA 1IA9A 4CNHA 2YABA 1K2PA 2A2AA 4ZTSA 1WVXA 2Z02A 5E8SA 3W2SA 5DEYA 2WTCA 4GT3A 4S31A 2PUPA 4PUZA 5KO1A 4LGHA 2FYSA 5CZHA 5BYLA 3OUNB 4FTTA 3KK8A 3FSFA 1Y6BA 4FG9A 1BKXA 4FNXA 4WHZA 5EHLA 4CKJA 2DS1A 3HDNA 2G9XA 1MQBA 2B7AA 1GNGA 1HOWA 2O64A 2C47A 2R0IA 2WTVA 4OW8A 4QNAA 5FP5A 3ZYAA 1PKDA 1JSUA 1XH5A 5AX3A 3FYJX 4DH8A 2YAKA 1DS5A 2PY3A 4E93A 4L68A 5IUGA 4A4LA 4JLCA 3CTQA 4K33A 4JI9A 4XV1A 4LL0A 4AT3A 2VO7A 4IB3A 4A9TA 4JIAA 2R3LA 1R0PA 1PMVA 3Q4TA 3ZRMA 4ZXTA 3U9NA 3R9DA 1BMKA 2ZVAA 4X2KA 3OY1A 2LGCA 3PTGA 1JVPP 4FZFB 3RPRA 4FE2A 4M14A 3QF9A 3ORLA 4QMXA 2PVKA 4AW5A 3U6JA 2WTJA 3P86A 1ZMWA 1ZYDA 4DT9A 1M2RA 2BRNA 5HNGA 2C6KA 2NP8A 2YWPA 2V55A 4XG3A 4YTFA 3GCUA 3KMUA 4AZVA 4B7TA 2GTNA 3K5VA 3R22A 4IE9A 2B52A 2BTRA 3KB7A 3VHKA 3QAME 3ZHPC 1YHWA 1H27A 2PSQA 2ZV8A 3C1XA 4X7QA 4ZY6A 3V3VA 4EUUA 3A7HA 2JDTA 3V5JA 3OVVA 3D7TB 2CCHA 3OMVA 3JR1A 4MXYA 3MFUA 4RVKA 4G3DA 4K1BA 4RX9A 4OTRA 4U45A 2XNPA 4XS2A 3H9OA 4IADA 4LYNA 4XBUA 1Q3WA 3L8SA 3NCZA 1V0OA 1YHSA 1RQQA 4FEXA 4CCBA 3IQ7A 3E64A 1YI6A 2A0CX 2XJ1A 3G5DA 3HMPA 1KUTA 2VTJA 4JBPA 4EQUA 4FC0A 4RA4A 4AZWA 3QGYA 4DA5A 3E93A 1E9HA 3GCPA 5DLSA 5AR7A 2PVNA 5D41A 4QTEA 3B2TA 1HCLA 4B4LA 2PMIA 4YBJA 5BMSA 5JGAA 1O9UA 2QOFA 3ENHA 4IB0A 4I6BA 3BV2A 4KBCA 5M53A 4KRDA 4CEGA 4RIWA 3BQRA 2VTAA 4O0WA 2ZM3A 2O2UA 4BTFA 2QI8A 1FVTA 2GNIA 3CD3A 2BAJA 4AXAA 1PXIA 2VWIA 3BV3A 5H3QA 1ZOGA 4W4WA 3PIYA 4AOJA 1S9IA 3CS9A 4ZJIA 5JRQA 2FSTX 5IUIA 4V0GA 2Z2WA 3F66A 2GCDA 4IACA 4FSYA 2JITA 1M7NA 2VO0A 4ACCA 2J4ZA 4GIIA 4A9UA 3TIZA 5M06A 2VN9A 3QD0A 3TCPA 2XK7A 2OW3A 3QRTA 4TWPA 4EWHA 2UZNA 4U80A 2YM7A 1Q8WA 4XG9A 3HECA 4NKAA 2GS7A 1P14A 1B38A 1PY5A 3PZHA 4Y73A 3UIUA 4APCA 4E5WA 2W7XA 4YLJA 5HE1A 3R8VA 3DBQA 1ATPE 4WNMA 3C9WA 4ID7A 1YW2A 4N6ZA 1ZRZA 3EN6A 3QKKA 4IX6A 3UNKA 5IA5A 3BU5A 4N70A 3EN9A 1PMEA 4GEOA 3BGZA 3B8QA 4D9TA 3VW6A 4WO5A 4X21A 4EH7A 3MA6A 2R3IA 2YFXA 1IR3A 4FVQA 5EM7A 3WBLA 5HIEA 4FKVA 4AOTA 3UC3A 3KN5A 2RL5A 4RC2A 3OEFX 5FTOA 4YPDA 3UVPA 4CXAA 2XP2A 3S00A 4BGHA 3I7BA 4NCTA 3TNPC 5HNBA 3NYVA 4CFMA 5FXRA 4UWCA 4D4VA 3LCTA 4BCJA 5C9CA 4NW6A 4F7LA 3WZKA 3NEWA 2EVAA 3AD5A 3KFAA 1M7QA 2YM8A 4RA5A 4TYHA 5KNJA 2QKWB 2CGVA 5AP3A 5CU4A 4C8BA 2OBJA 4DC2A 2C4GA 1PXLA 2PVLA 4FKLA 3VUMA 4O7LA 2WEVA 4RQKA 2UZEA 1CMKE 2NRYA 2ITXA 1WBTA 2EUFB 3AC4A 3R0TA 4P5ZA 5BUIA 2OIDA 3E92A 1JKLA 1U46A 3LFAA 5J95A 4BKJA 2IW6A 1H1WA 1PW2A 5T6KA 4FIIA 3JYAA 1WAKA 5DNRA 1W84A 3FI8A 5HG5A 4AWIA 3VS3A 4IZAA 4GJ3A 5HNIX 3TDVA 2YM3A 4IC7A 4JQEA 4JX7A 4I41A 4F1TA 4EI4A 4O1PA 4YZCA 4FSTA 3JVRA 4NM5A 3CKWA 3WE4A 4C37A 1H28A 2GFSA 4I21A 5CT7A 2YERA 2J0LA 3E8CA 4DG0E 1MP8A 4GL9A 4R7HA 4XLIA 3PA3A 3EH9A 5HLPA 3QQKA 2UZBA 4PRJA 3K54A 3RGFA 1P2AA 2WTKC 5BUEA 4ZOGA 2AC3A 4HYIA 4FKTA 4FV8A 3IW5A 3F6XA 4RJ7A 1JAMA 1WFCA 5J5TA 2X4ZA 5CQWA 5EW8A 2GNGA 4ZTLA 3VW8A 5EYDA 3KKVA 2PMNX 3QTIA 5L3AA 3GCQA 2PMOX 3I79A 2XKFA 4F70A 4DFXE 3ZFXA 4J99A 4QYGA 4ZMFA 4MD9E 4IX5A 3DDPA 5KUPA 3BLHA 3LXKA 3VRZA 4DF3A 1YXSA 4OLIA 1XH7A 4KKGA 4DEHA 1M52A 5DH3A 4NZWB 2Y6MA 4ACHA 5M57A 4EOJA 4K77A 3R73A 4Z9LA 4TNDA 5J7HA 4OTFA 1OKWA 1PYXA 2DUVA 2JIUA 3F2NA 3PY1A 3Q9YA 4DINA 5H9BA 1Q5KA 1KE7A 4ZY4A 3QTWA 5JFWA 2O3PA 4C61A 5EQYA 2QOCA 3LFCA 3DXQA 3MB6A 1NY3A 3OCSA 1OPKA 4FYNA 4DFNA 4YBKA 5HORA 1R39A 4JRNA 5KKRB 1XR1A 2C5OA 5EH0A 5CSPA 3RHKA 4D28A 3NW7A 4BDBA 4IAIA 3TV6A 4C4JA 2W05A 4LMNA 3GI3A 1YXUA 3LOKA 5FP6A 3IDCA 4JG6A 3I6UA 4NIFB 4NTSA 5EM5A 3TJDA 3C4XA 3Q60A 3L1SA 5K0KA 1WBOA 5KMOA 2QCSA 1G5SA 4FT9A 4G31A 4L3PA 1TKIA 3ORTA 5CX9A 5IQBA 2OJIA 1KWPA 4H05A 1FGKA 4BR3A 1IAHA 4UEUA 2PVRA 4O0TA 4ACMA 3FMJA 3IONA 4NSTA 2WU6A 4IB5A 3WZEA 4XV2A 4BZNA 2QHNA 3OD6X 4M84A 3DLSA 4QMOA 2QR8A 4TWNA 5HCYA 2JGZA 3THBA 4CFUA 4EC8A 4HVGA 2QO2A 2HW6A 5CF5A 2VWZA 3C4WA 2UW6A 4O82A 4M69A 4B99A 2OZOA 4RPVA 1W8CA 3UNJA 4TYEA 5ACKA 5IQEA 2OH0E 3MA3A 3RK9A 3TNQB 4BB4A 4PNKA 5HHWA 5CXZA 1K9AA 5KBQA 2J0MB 3G51A 4TTHB 3MFSA 4ANBA 2NO3A 2XYUA 3PUPA 4EEVA 4EWQA 1URCA 4FTQA 3ZZWA 4NFMA 4ARKA 4D55A 2RIOA 3PVBA 5CEPA 3TT0A 4WT6A 2R3GA 1O6YA 2H96A 3KRWA 3VJNA 1WZYA 2JFMA 3HGKA 5L2TA 3O2MA 5AR5A 3MPMA 4G3GA 4ZK5A 4O7TA 2WNTA 4BGQA 2GNJA 5AUZA 4DG2E 2Q83A 5A4TA 4H3QA 4QYEA 4NTTA 3FMMA 4IX3A 4XG2A 4L46A 3WF5A 4B9DA 3PJCA 4DN5A 4PMPA 4WRGA 4UN0C 4ITJA 5L6OA 3FDNA 4CSVA 3A2CA 4BDCA 2W06A 4D0WA 2NPQA 4EK5A 2W9ZB 1BYGA 3MVJA 3VIDA 3UG2A 4FTKA 2W1ZA 2WKMA 3PVWA 1OKZA 3VC4A 2C6TA 3UTOA 3LZBA 1A06A 1UU9A 5KZ0A 3ZRKA 3NUXA 4V01A 4YJRA 1CSNA 2XRUA 1SZMA 3P78A 3UO6A 3MWUA 4EOSA 2OJGA 4ZSGA 2UZTA 3GQLA 4JRVA 3W8LA 5BVFA 4FEUA 2PZ5A 1J7LA 3P7BA 4KABA 1BLXA 4TT7A 2Y9QA 2ITQA 2BRHA 4GSBA 3WOWA 4H58A 4EH9A 4D1SA 3CQWA 3LFBA 1K3AA 4B6LA 4ZY5A 3DU8A 2YN8A 3C4EA 5BX0A 2E9OA 5EI8A 4F6WA 2WOUA 5KHWA 4RIWB 4QMQA 5B0XA 5M56A 2UW3A 1YOJA 2VTIA 4AT4A 3F7ZA 3GC0A 4UV0A 3VVHA 1UKHA 2DWBA 3BYMA 4S32A 5IA4A 1UWJA 3NUAA 2ZDUA 3UQGA 4ASXA 2WMRA 4XOYA 2Y4PA 2YJSA 2W4KA 5C8MA 3ALOA 3QC4A 4X3FA 4V0GB 4AZFA 2HWPA 3FLQA 2IO6A 2HZIA 3UIMA 1APME 4CG9A 2IJMA 4DAWA 3PPJA 4MXZA 4UMRA 3QUDA 2RG6A 2W0JA 3A99A 4R3CA 2Y4IC 3R7OA 3R9HA 5LVLA 4EH4A 4DCAA 3R7GA 5C4LA 3BU6A 2FA2A 4BDFA 5IQCA 5DGZA 4KNBA 3VBQA 3HYHA 3NW5A 4IHPA 4EOPA 3TKUA 1Q8ZA 3P1AA 3Q32A 4ERKA 1JSTA 4O38A 4CFWA 4EJ7A 3ZM9A 2WD1A 2WB8A 1Y8YA 4UB7A 3MVHA 3UOLA 4BDGA 3I81A 3R2YA 3DTCA 4Z7GA 3BLQA 2Z7RA 3C5UA 2YIWA 2ITWA 4U9AA 1Q24A 4GUEA 1PMNA 3P79A 2OXYA 4L8MA 2OFUA 4DTAA 5AUVA 1UA2A 4O83A 2O63A 4EH8A 5E1EA 4FGRA 5GIPE 3QXPA 3JS2A 2ITZA 4Y5QA 3PE2A 3VQUA 2BRGA 4DEDA 2ESMA 4R1VA 4XP2A 3CJGA 3IW4A 4BI2A 1OBGA 3DBDA 1SNXA 4DH3A 3CGOA 4RFMA 1MRYA 3BHHA 3QZGA 3G0FA 2C68A 4IZ5A 4D2SA 2QONA 4YU2A 3AGLA 5A6OA 2YAAA 3O51A 3UO4A 5B7VA 5IEVA 2YCFA 3CIKA 2KTYA 3PXYA 4C59A 3K3JA 2C6EA 4NM7A 4KD1A 1H24A 4G2FA 1H1QA 4IH8A 4MQ2A 2GU8A 4D4SA 2PHKA 2YM4A 3LQ8A 4YJOA 3RWPA 5LWMA 3ZLSA 4BCMA 4BF2A 2FSOX 4MBLA 5I9ZA 3K3IA 4TPTA 4GYIA 2UW9A 4F63A 2JKQA 2YDJA 2VTLA 5HLNA 2FVDA 3GNIB 4JDKA 3QD3A 4K8AA 4BI0A 4EHVA 4YNEA 2R4BA 5CAQA 4GFGA 2PWLA 3TNWA 5IMEA 5IMXA 5K5NA 4BY9E 2YLFA 4H3BA 5K9IA 2C6LA 4CG8A 2W5HA 2GFCA 3BYUA 5TO8A 3DB6A 4W8DA 3BEAA 3V6SA 4FR4A 1PYEA 2C5NA 5AX9A 4ORKA 4FK6A 4RLKA 3FXWA 1CTPE 4XJ0A 3OOGA 3BWJA 4O0VA 5T3QA 4A07A 5CWZA 2C3LA 4QMSA 4EK6A 4LV5A 3BELA 2IN6A 2OZAB 2PUNA 5CF6A 3WF7A 2OFVA 3ZFYA 4YSMA 2ITUA 3NCGA 4R8QA 4RWLA 3SW4A 4QTCA 3Q3BA 3ZDUA 1XBCA 5A4LA 1Y57A 3ZBFA 3P5KA 3U54A 4FK3A 3FLYA 5DI1A 3ZLWA 4OTPA 2PVJA 4DH1A 5CENA 4QMPA 3SKCA 2HY0A 2ETMA 3VS1A 5BVOA 4C35A 2I0YA 3FI2A 4WG4A 4CFVA 1P4OA 3MVLA 2IWIA 3Q4ZA 3FE3A 3ROYA 3T3VA 4ASEA 5EDPA 4FTUA 4LRJA 4X2JA 4XV9A 3FMLA 4A4OA 4F6SA 2JD5A 2PE0A 4QMNA 4FKJA 2R3KA 4PTGA 3A7IA 3AMYA 3AOXA 3QCSA 4ITIA 2C5XA 3IO7A 5M44A 4QRCA 1ZMVA 2BFYA 3EQGA 3R8PA 3RP9A 3LPBA 4FTCA 2PUUA 4RIOA 4JDIA 4WNOA 4CV9A 2WQOA 2XJ2A 3ETAA 3KN6A 4RVLA 1PMUA 4USFA 5IA0A 3SVVA 2XF0A 1PXNA 1ZWSA 2JDOA 4ZLZA 3F82A 3PJ1A 4ZJVA 1DI8A 5AUTA 2FSMX 4LG4A 3Q5ZA 4FF8A 3VBVA 4EH6A 4PMTA 3FMKA 2ERKA 5AR8A 2XNOA 2I0VA 3L9PA 1WBNA 5IEYA 4PNIA 4XUFA 1SVGA 2J0JA 2XB7A 2Y0AA 2J6MA 4KB8A 3VUGA 5B2LA 2XNNA 1NT2A 2VGOA 1OUYA 4N4SA 2UZLA 3WF9A 4E20A 3UNZA 3BHVA 2XA4A 1QCFA 3IG7A 4C36A 3E88A 3Q6WA 2XYNA 2IZSA 4DEBA 3U6HA 4BHNA 3FZSA 3HEGA 2YDKA 3EJ1A 2Z7LA 4WG5A 2YIQA 3CGFA 4M3QA 5DT4A 4ZTHA 5L4QA 3NMUF 4FIGA 4LUDA 4X2FA 5EKOA 4M69B 2PK9A 3KK9A 2WQEA 1YXXA 3AG9A 4IXPA 5HIBA 2W99B 4UXLA 5L8JA 2WXVA 4A9SA 5IDPA 2GQRA 1G8AA 1H0VA 2BDWA 4OBOA 3FXXA 4L9IA 2YZLA 3OEZA 3EKNA 2JIVA 4U7ZA 4D9UA 4N57A 3Q4CA 4NEUA 3DFCB 5HEZA 3A7GA 1R1WA 2PPQA 3ZS5A 3MW1A 5HBHA 2XEZA 5CAPA 3ID6C 3BE2A 3LXNA 4BCFA 5AA8A 3V5TA 1OECA 3SW7A 3QL8A 4FV2A 3IGGA 1OBDA 3FC1X 3O71A 4MKCA 4O7SA 3IKAA 2O0UA 4PTCA 4XX9A 3ZEPA 4AE6A 1P4FA 3LVPA 2RKUA 4FT5A 3UBDA 3DGKA 3F2AA 3VWAA 4C62A 3MIYA 4LM5A 4YTHA 1OMWA 2X7OA 3A4OX 2GQGA 4PDOA 1NA7A 3QRKA 4UYAA 3WILA 4AZEA 2OF4A 5HVKA 5FG8A 3RK7A 5K4JA 3ZC6A 3RTPA 4S33A 2G2HA 1Z9XA 3ORXA 2W5BA 3OBJA 2E9NA 3WYXA 1XBBA 3UP2A 4WSQA 4EOLA 4FV4A 5CAUA 2V62A 3G33A 3FKOA 3MY5A 4FIEA 2VTSA 4YPSA 5CY3A 3S4QA 1QPCA 3LM5A 4O7NA 4HYSA 2YA9A 3IW8A 3NVMB 3VHEA 3MH3A 4ANNA 3BZ3A 2HXLA 3QTUA 1ZY4A 4FKUA 2XM9A 2BZHB 4AA5A 1JWHA 2R5TA 4CT2A 5GJFA 3RCJA 3Q9WA 5CXHA 2UUEA 3WF6A 3GGFA 5LQFA 3KCKA 5HI2A 5BYZA 4JQ7A 3FV8A 4AOIA 1L8TA 3V04A 4XH6A 3D15A 2CLXA 3EQHA 3NIZA 4WA9A 5IU2A 4QYHA 2B0QA 2C1BA 4E4NA 3MV5A 4I23A 4QD6A 3C5IA 1OKVA 3CPCA 4X3FB 3GB2A 3ZO1A 5EOBA 5CNNA 4ZAUA 4R77A 4ENXA 4BWXA 3PXFA 4JIKA 4TNBA 4YHFA 4FVPA 5EYMA 4PP7A 3LLTA 4YJNA 5HICA 4EYMA 4YP8A 4USEA 2GSFA 5K0XA 2HY81 1PXKA 4FIFA 3UZTA 5M08A 4PPBA 1I44A 3OTUA 5E8WA 4ZSLA 3M2WA 5HD4A 3GVUA 2XCKA 1Q61A 4X6RA 3ZU7A 3VBXA 4EONA 3ULZA 2CKQA 2PVHA 5GNKA 3NPCA 4U43A 4GRBA 1OGUA 4RWJA 3GC7A 5LVOA 2ACXA 3VS4A 3IK3A 3W18A 4BCPA 4G16A 1UNHA 5JH6A 4RJ5A 4NK9A 1XH6A 2ZB1A 3ACKA 4L3LA 3HUCA 4XLVA 4M13A 4Z55A 1XJDA 3SDJA 4XP0A 3TTJA 4M8TA 4BCKA 3MB7A 5GZ8A 3EMGA 4UMPA 3NYOA 5AAFA 4RIYA 3DPKA 3LMHA 3FC2A 4RRVA 4D2TA 1U59A 3BRBA 5IG1A 4CGAA 1B6CB 1A48A 4IJ9A 5LJJA 1LEWA 3MGYA 4TWCA 3LXLA 3DZOA 4E6QA 3IGOA 3CC6A 3LXPA 3PPKA 2ITPA 3KMMA 3F3WA 4FGBA 3LHJA 4YLKA 3LFEA 3E3PA 2B9HA 3P9JA 3VBWA 2EXMA 5TF9A 4O7YA 2R3MA 5HKMA 2BFXA 3D9VA 4MH7A 1OKYA 3ZONA 4BICA 3Q2JA 4UBAA 1JLUE 3FLZA 4HVIA 3KXMA 4U81A 4C2WA 4LGDA 4YJPA 4F7NA 3TUBA 4LV8A 2VWWA 4DGMA 5HZNA 3EL8A 1UU3A 2XK6A 2ZDTA 3PP0A 4RMZA 4CRLA 4Z7HA 5CALA 4GYGA 3RAKA 4AG8A 5HBJA 5H8GA 4OT6A 3DXPA 4NWMA 3AC2A 3ATTA 3MYGA 4PDSA 3F88A 3FXZA 2FH9A 3Q6UA 3PDTA 4RQVA 1U5RA 3JVSA 3PWYA 5AV0A 2VWBA 4AGDA 3QUEA 4JS8A 4KS8A 3EWHA 2FO0A 3H0ZA 5FTGA 4CCUA 4MBIA 4BZOA 3H0YA 4KBAA 3UVQA 1BL7A 4IVBA 4AW2A 2F49A 4P5QA 2X6EA 1YDSE 2OU7A 3DCVA 4KIPA 4WD5A 5ANEA 5FM2A 5FXSA 3ZSGA 2CSNA 4FKIA 3JY9A 3CLYA 1XHAA 5JMSA 5L6WL 4N0SA 3VS0A 3FI4A 5CT0A 5EDRA 2E9VA 5J9ZA 2VO6A 4IWDA 3GC8A 3GU7A 4YZDA 2EWAA 2IPXA 3Q9ZA 2XUUA 4C4FA 4FYOA 3UODA 3KXZA 5A54A 2J51A 3QZIA 4QTBA 5CU2A 4AACA 3PSBA 3R02A 1UU7A 3QD4A 4QMWA 3OS3A 3TEIA 3BYOA 3MJ1A 4QO9A 3NUYA 3R00A 2XNBA 2WMXA 5M51A 3MS9A 3HLLA 3OWKA 2W1EA 4ANSA 2ZM4A 1TVOA 4I5MA 4NM3A 2XRWA 2IVUA 3HAVA 2WMAA 4KBKA 4BWPA 3GCSA 3ITZA 3ORZA 4H39A 4PPCA 4TYGA 4A9YA 5EFQA 5FBOA 1RW8A 2QQ7A 5HLWA 2C0TA 2JDRA 3MPAA 1F5QA 2J50A 4W8EA 3GU5A 4YHJA 4EK3A 3ET7A 2OH4A 5IA1A 3FYKX 1ZZLA 3MY1A 2JEDA 2UW7A 4HYHA 4BFMA 3TTIA 5IEXA 3KRRA 2X7GA 3RJCA 4F7JA 2EXCX 2FGIA 3P0MA 5LCKA 5CU0A 3FMHA 3PVUA 4RJ8A 2ZMCA 2J5FA 5ANKA 2PTKA 3HV5A 3NUSA 5IF1A 3F5GA 1H08A 1CKJA 5DHJA 2XK3A 4NYEA 3JUHA 2V7AA 3TZMA 5IISA 2J90A 2YIRA 5ANJA 3G15A 2QODA 3RINA 2Z7QA 3CE3A 3D5UA 1LR4A 3PXKA 4OT5A 4AT5A 5CU6A 5E1SA 2YZAA 4F0GA 4BZDA 3OWPA 3P7CA 1GZNA 4TKSA 2AC5A 4RZWA 4H36A 3V5QA 3HV4A 2HZ0A 1A9UA 3QCQA 4IEBA 3MESA 3H10A 3P23A 3AC1A 4GFOA 4O7RA 4FKSA 1TQIA 2R3FA 4HGLA 1SYKA 3ORKA 4OTQA 4EYJA 3GCVA 3WYYA 4NJDA 4XHKB 4R5YA 5BVDA 1GZ8A 4MNEA 2WO6A 1WVYA 3VUKA 4YJUA 3NLBA 4YC8A 2P2IA 5AP2A 3NNUA 4EKKA 5B2MA 3CBLA 5EHYA 3VBTA 3UOHA 2JBOA 2V5QA 3FZOA 4NJ3A 2X2KA 3BLRA 5DVRA 4IDVA 1JQHA 4IBMA 4LGGA 2ZYBA 4JT3A 3TZ8A 3WI6A 3RAWA 3ORIA 3AMAA 2W1DA 3ODZX 5D7VA 5CAOA 3OF0A 2PE1A 2F57A 4R5SA 2AYPA 4R1YA 3OOMA 5HIDA 2BDJA 2OXDA 1RE8A 3IDBA 3NAXA 4YJTA 3RAIA 5BVEA 4ACDA 4E1ZA 1MQ4A 1R78A 3GU6A 5A6NA 2F2UA 2YEXA 3DNDA 3HNGA 5M09A 5H8EA 5J8IA 5IA2A 3MI9A 4UMQA 2CNUA 4KIKB 4CZYB 4GK4A 2BALA 3RKBA 3T8OA 3W32A 3LMGA 3DK7A 2B4SB 4G34A 3BI6A 3U87A 3PLAE 3W16A 5CTPA 4PDYA 5DE2A 2C30A 4NFNA 4LL5A 3UE4A 3CTJA 2VD5A 3QTXA 2X1NA 4AA4A 4AA0A 3OW4A 3PRIA 3VS5A 1V0PA 2PVMA 3MSSA 4KSQA 5FGKA 4GW8A 3R9RA 3Q5IA 1KE5A 5JFVA 4K6ZA 5CSVA 5CU3A 3R21A 3PA5A 1YI3A 4WOVA 4XG8A 3RNIA 1TQMA 2Z7SA 4XV3A 4HJOA 3UC4A 3V6RA 4DYMA 5IH6A 3S95A 3Q96A 2C0IA 4RLLA 3PZEA 3D2IA 2BZIB 2A1AB 3RVGA 1ZYJA 4JQ8A 4MD8E 3RZBA 4PL3A 4HVSA 3R2BA 2EB2A 4S30A 4W9XA 5HVYA 4P7EA 1ZZ2A 2CMWA 4J53A 5EG3A 3TNHA 4RBLA 1Q97A 1GIJA 4I3ZA 4WSYA 4ZTRA 3ZUVA 1UU8A 3E8NA 4IC8A 4ACGA 1WBSA 3PIZA 2XBAA 3CY3A 4I5PA 1YOMA 4FIHA 3GEQA 4OR5A 5DRBA 4FZ6A 4K11A 4I6FA 4OGRA 2C6OA 5F4NA 3NUPA 4FZDB 4NKSA 2P3GX 3KQ7A 4YJSA 3O7LB 5AJQA 5ETCA 5HO8A 3CXWA 3QTSA 3M1SA 1IG1A 3DAEA 4M7IA 3DBEA 4MAOA 3QX4A 2YLEA 4IM3A 1OVEA 5L2WA 4I4FA 5CVFA 4EH2A 3D2KA 4ZZOA 5HTBA 3IDPA 4OTHA 2XH5A 1M2PA 2QURA 2B54A 2UW8A 2OI4X 1BI8A 4OTDA 3KF4A 3EN4A 2VZ6A 3F2RA 1UNGA 2I0HA 2VAGA 4OBQA 3SHEA 3ZUUA 4RJ4A 2CLQA 4HW7A 5J79A 1Q4LA 3ENMA 2ZMDA 4F64A 2XM8A 3NGAA 4ANQA 4EHGA 1QPJA 3I4BA 3FLWA 3HL7A 4C33A 5J9LA 3EFLA 5J87A 4BCNA 1OB3A 4DEIA 4I1ZA 5GZ9A 4QP6A 2C1AA 5HX6A 5ACBC 4F65A 5JSMA 2BIKB 3GU4A 1FVVA 4QQJA 3IOPA 3NNVA 4CLIA 2KULA 4JNWA 1GOLA 4E4MA 4TZRA 3AD6A 1FMKA 2JAMA 4RIYB 1L3RE 1W7HA 4TWOA 5AR2A 1NVRA 3VO3A 4LFIA 3DS6A 1OITA 4G6LA 4IAKA 3POZA 1ND4A 3A62A 3EQRA 4J52A 5CEQA 5L8KA 1BX6A 4IAZA 4EHEA 2X9EA 3U4UA 3D5VA 4DH5A 4ANMA 2BILB 2WMQA 5LCJA 4QMMA 3H3CA 3G6HA 3JXWA 5H2UA 3PWDA 4XNEA 4OTWA 5FXQA 2HIWA 2E9UA 3OCGA 2X2MA 1VYWA 3EQPA 1H8FA 3FL4A 2IZUA 4G3CA 4IW0A 5DWRA 3QU0A 4IVDA 1Q3DA 4KUJA 4IM0A 5M4UA 3WZJA 3A4PA 2QOHA 3FHRA 3TZ9A 4LOQA 5TOZA 2BTSA 2WMTA 3R28A 4GV1A 3PVGA 5CI6A 4DGLC 4DLIA 5BYYA 2VTRA 4DLJA 3MVMA 4BDKA 4C7TA 5GZAA 3TI1A 3W2RA 4QMZA 5LXMA 3R01A 1WBPA 4UWBA 3OTVA 3TIYA 3CQEA 3U9CA 5E92A 4ZEGA 4GT5A 2B55A 4E7WA 4B8LA 4DEAA 3UQFA 2P33A 5BVNA 3DNEA 4RJ6A 3VQHA 2PVYA 5IH5A 4R6VA 4QP2A 2P0CA 3W10A 5C26A 4PY1A 1ERKA 5BMMA 4F1OA 2XKEA 4U97A 2XNEA 4LRKA 4QTDA 3R8ZA 2Z8CA 5HTCA 5I9VA 3UOJA 5D7AA 2QU6A 1J7UA 4EH3A 4G5JA 4FEVA 5D11A 5E91A 3HRCA 4FG7A 4ZSEA 4F9CA 5E8VA 2C6IA 3BE9A 2WMSA 4G6OA 4RT7A 5AA9A 2R2PA 3TV4A 1XBAA 5E8ZA 1AD5A 3AGMA 3MTFA 3ATSA 4NL0A 4MVFA 2W4JA 4IJPA 5BPYA 1V1KA 4I24A 3QFVA 3U55A 2VTTA 4CQEA 1OM1A 4FTIA 4QPMA 5D12A 1ZYCA 3EN7A 3GT8A 3HP2A 2G15A 4E4XA 4CVAA 2E2BA 3SC1A 3JPVA 2VU3A 2VTNA 2WHBA 3K2LA 5EOLA 3QQFA 4JJRA 4ZZNA 3F3ZA 2X39A 3E8DA 4BCHA 2QOIA 2VGPA 3NZ0A 1YDRE 2R3JA 2WOTA 3HMOA 4FV9A 4XG4A 4UYNA 2ONLC 1OL2A 2QLQA 3BHYA 1H25A 4LQMA 4CYJA 4F0FA 3D83A 1MRVA 2VWUA 4DGGA 1Y91A 4MX9A 3S3IA 3QYWA 3RPYA 4PQNA 2X8EA 5IH4A 2YJRA 4BRXA 1I09A 2ZV9A 3QTZA 3ZM4A 5CLPA 3ZLYA 3BBTB 3G9LX 3KRLA 5TE0A 4HPTE 3DA6A 5EHOA 4XYFA 3R7VA 4W9WA 1V0BA 4PP9A 2W1CA 4BBMA 5HE3A 3R63A 3NX8A 2J0KA 4D0XA 3R04A 4Z3VA 2GS6A 1Q99A 4RWKA 3MH2A 5E8TA 4D58A 4X3JA 3B8RA 4JVGA 4WKQA 2WTIA 4HCVA 4MWHA 3QQUA 1KE8A 5F1ZA 3LQ3A 1KOAA 3RWQA 4C02A 3AT2A 1YHVA 2J5EA 1Z5MA 3OCTA 3QQHA 4L3JA 5AUUA 3S0OA 1SM2A 2VRXA 4D2VA 1YI4A 3C51A 4YZNA 3ORPA 5FTQA 4DGNA 4EQCA 4FL1A 4EBVA 4X0MA 4I0RA 5CZIA 4FSZA 4M0ZA 4PMMA 5DRDA 3ELJA 5JN2A 3DLZA 4O1OA 5JZNA 1T46A 4C4IA 1OL1A 4XCUA 4YZ9A 4S2ZA 4FA2A 2QG7A 2PE2A 3V8TA 3QBNA 5DT0A 3ZSIA 4TYHB 3I5NA 4TL0A 1JBPE 2W5AA 3DBCA 4O6LA 2BCJA 5CVGA 4QP9A 5AP0A 3C4FA 4F1MA 2ZB0A 5DN3A 3SRVA 4FV5A 1LP4A 3KXHA 4I94A 4C3RA 1PKGA 3LE6A 4EK4A 4CT1A 4DFUA 2B53A 4KS7A 3DK6A 4C0TA 3SOAA 3EQIA 4IM2A 3V5LA 4BBFA 5KKRC 2XEYA 4X2NA 3FZ1A 4PDPA 3A61A 3HVCA 3LFDA 3PY3A 3SXSA 5JFXA 4GG5A 1AQ1A 4O2PA 3N9XA 4YMJA 2I1MA 3OZ6A 3E5AA 3HP5A 5CSHA 2GMXA 3AT4A 3F3UA 1FVRA 3NSZA 3QCYA 4U41A 1PHKA 4DEEA 3RPOA 2R9SA 3UIXA 4LOPA 5I4NA 3EYHA 3IECA 3U4WA 5ETAA 5E90A 3SG9A 4CZTA 1WMKA 5AEPA 3L8XA 3KC3A 2RFNA 3ZXTA 3NVKI 4AGUA 1CKPA 5CSXA 3QA8A 4QTAA 3FZTA 4BVUA 3H4JA 4FT0A 2RFDA 1ZYSA 3LFNA 4QYFA 3GP0A 3QD2B 3BYVA 3JY0A 2GNFA 3ACJA 4GVJA 5FM3A 4UMUA 4IAFA 4JAJA 2BROA 4JR3A 3FPQA 3TL8A 4U42A 1G8SA 2OLCA 4CKRA 3QUPA 1O6KA 1B39A 1Q8YA 4CV8A 3FBVA 2F7XE 3PIXA 4TY1A 3BPRA 4BCOA 5F95A 2HOGA 4FMQA 4L45A 3F61A 1T45A 3DV3A 4HPUE 3PJ3A 4MD7E 4U6RA 2JFLA 4U3ZA 3VNTA 4RC4A 4AGCA 4UZHA 2UW0A 4AZTA 2PUIA 4BWKA 4P2KA 3RNYA 5M4FA 4O7ZA 3KY2A 1H1SA 2YCRA 2OJJA 2VX0A 4IFGA 5KE0A 3D4QA 3EIDA 3DKFA 1XQZA 5JFSA 4FOBA 4PPAA 4QP8A 3TKHA 4ASZA 4PX6A 3MBLA 5K5XA 4CLJA 2CJMA 5E7RA 5FEQA 4FEQA 4D5HA 5JEBA 3UZRA 3O8UA 5EM6A 1Z57A 4LI5A 4FSWA 5FEDA 2WMBA 4FKRA 4BKYA 1YDTE 4LOOA 2J7TA 5GINE 4RVMA 3GOKA 3FL5A 2I40A 4AE9A 4AFEA 4CRSA 3ALNA 4GVAA 2Y7JA 3FPMA 4AX8A 4JBVA 4YO6A 4FT7A 4YUQA 4M15A 2F9GA 2F7EE 2R3RA 3AMBA 3TG1A 4W4YA 4B0GA 1KV1A 3QLFA 2IZRA 4I93A 5DIAA 2OJ9A 1XKKA 3FZPA 2YDIA 4ERWA 1YVJA 3V5WA 2C5YA 2W4OA 5FBNC 4FV6A 3I6WA 3I0QA 4I0TA 5J7BA 1H00A 3UGCA 4DG3E 2SRCA 2WTDA 4ZP5A 3ANRA 4KRCA 4U79A 3OW3A 2J0IA 4Y72A 4EZ3A 4FSRA 4O96A 4FV3A 4H1MA 4OBPA 5I9YA 3B2WA 2QVSE 2R3QA 4XG7A 4WG3A 2VWXA 3IPHA 3KXNA 2HWOA 3KL8A 5C27A 4BI1A 4DFZE 2VTHA 2YHVA 3KU2A 4K2RA 2GNHA 3L9MA 4F7SA 2QOKA 1VEBA 1VZOA 3NR9A 4FZ7A 3PPZA 4RC3A 1F3MC 1WBWA 4BYJA 2X9FA 1RDQE 4Y83A 5C8KA 3QRIA 3UYSA 3ZRLA 5I9XA 3GQIA 5J9YA 2PVFA 4BHZA 2HCKA 3AC5A 2VTQA 2OSCA 3LIJA 3H9FA 4L67A 3ZFMA 1JNKA 3RAHA 2OXXA 3EFJA 3KRXA 4UXQA 4FZAB 4EUTA 3OXZA 4FSMA 3BWFA 4TRLA 1UWHA 3DFAA 5EK7A 2WEIA 5FD2A 2UZWE 3C4ZA 3W2QA 4PWNA 4HCTA 2WMVA 5HGIA 4KINA 5FUTA 4ZS4A 4AW0A 5L6PA 4TW9A 2Q0NA 4FOCA 5HBEA 2WAJA 4J95A 3DK3A 4C34A 3VS6A 1KE9A 3FZRA 5ITAA 3KVXA 2VWVA 3RM7A 5ANOA 4G17A 3RZFA 4JDJA 4TYIA 4C38A 1FMOE 5ANGA 5HG9A 2V0DA 4J7BA 1ZMUA 4WBBB 3ERKA 3WZUA 5EKNA 3R1NA 3RALA 4WIHA 5CS6A 3AT3A 2IVTA 4FTNA 3PXRA 2GTMA 4Q9ZA 2VO3A 5JQ5A 2YITA 1M2QA 4IANA 2VTOA 3FEGA 4JL9A 5LMKC 2PYWA 1VYZA 4G9CA 3DAJA 3F5UA 3FMEA 3MIAA 4HYUA 4OTIA 4EQMA 3ZBXA 3HA6A 2OIBA 4IIRA 3VS2A 4Z16A 2WELA 4U44A 4D2WA 3DXNA 4JX3A 1DAWA 1XWSA 1P5EA 5IDNA 1VJYA 3ROCA 4ZS0A 4MF0A 5FDXA 3LCKA 1QPEA 4HNIA 3QALE 5J1VA 3RCDA 4KSPA 2G1TA 2IZTA 2UZVA 3I60A 4CFFA 3RBWA 5C4KA 2VX3A 1JPAA 4BYIA 4A7CA 3G6GA 4Y5HA 3ZSHA 2B9IA 4BDEA 4YR8A 4E3CA 5M4CA 4H1JA 5C03A 3TNIA 4FTMA 4OAVB 4F9AA 1REKA 5LMAA 2DQ7X 3OBGA 4JBOA 3ZMMA 3ZLXA 4FSUA 4IVAA 2ETRA 4KIQA 4DFLA 2WGJA 4GU9A 2I7QA 1OIYA 1BUHA 2A4LA 2HXQA 3L8VA 4NW5A 4NU1A 1FINA 2GHMA 3EKKA 2R7IA 5M4IA 4IAYA 4DE4A 5TKDA 4QPAA 3R6XA 5C1QB 5ETFA 3C13A 3WIGA 4EBWA 4GCJA 2IG7A 5F9EA 4MNFA 5E8XA 4U5JA 2PZPA 5HE2A 5HE0A 1PXMA 2QOLA 2Y6OA 5IQDA 4L42A 4BIEA 3DB8A 4XRJA 3EFKA 3PFQA 5AP5A 2E9PA 3G2FA 5KBRA 2OIQA 3BKBA 1SNUA 3QTQA 2JC6A 4JR7A 3RPVA 5L8LA 3EZRA 2VX1A 4NIFA 2QD9A 3SLSA 2WIPA 3FMNA 3V8SA 4KKEA 1STCE 2X8DA 3R7EA 5AV2A 3SXRA 4EK8A 2X6DA 3AXWA 3LJ2A 4JG7A 1AGWA 5GIOE 2X81A 3RPSA 3LQ5A 2RSVA 1H26A 1PJKA 5AAGA 3R9NA 2UZOA 1BI7A 4DCEA 4GMYA 5EW3A 3VF8A 3BYSA 3LKMA 4JAIA 2ZOQA 3OG7A 3WARA 3Q4UA 2QOOA 4GUBA 4QMLA 4RJ3A 3H30A 1ZOHA 4FTLA 3V01A 3ZTXA 4O7VA 3TXOA 2YWVA 1QL6A 2WTKB 4QP4A 3R8MA 2H34A 2ZJWA 3BGPA 2QC6A 4ZTQA 5TR6A 5ICPA 3PSDA 2HYYA 4U0IA 2C3KA 4E73A 4FTRA 4LMUA 5KCVA 3C0HA 3W2CA 3SRVB 4AN9A 3COIA 3NUUA 5IUHA 4YJQA 5E8YA 4O81A 5EYKA 3UVRA 4EOOA 3OHTA 3UDBA 3NDMA 5C01A 2R3PA 2CDZA 4TXCA 2BR1A 3V51A 3MY0A 4ALVA 3LLAA 3F69A 3VJOA 3TUDA 2GHLA 2JIIA 1YWRA 2XCHA 3T9TA 3V8WA 5HG7A 4DBNA 5EQPA 5D1JA 2PL0A 2VTMA 3PJ8A 1VR2A 3KXGA 4KIOA 1FGIA 4E5BA 4GH2A 2REIA 4QOXA 3PG3A 3CQUA 3EQDA 4MXXA 2BRMA 3PG1A 2A19B 4F08A 5DEWA 5FDPA 2F2CB 2Q0BA 4UWYA 5AMNA 2P55A 1OI9A 2OG8A 4ZSJA 3CTHA 5BVWA 2YCQA 3U8WA 5IQGA 5AP4A 4M12A 3HAMA 5IQFA 4KWPA 1H1PA 2GQSA 3EQBA 4C2VA 2ITVA 3WE8A 4BTKA 3FSKA 4RWIA 1PXOA 2JBPA 4LRMA 3KF7A 4OUCA 3BHUA 5HO6A 2PZRA 3E63A 4JOAA 4U40A 3EHAA 4IX4A 1ZOEA 1BL6A 4GK3A 3O50A 1U54A 4HZSA 3H9RA 4I22A 3AC3A 3PXZA 1CDKA 3EOCA 4FV7A 1GIHA 3DJ7A 3SD0A 2ERZE 4YURA 2UVZA 1JKSA 4F9YA 4RX5A 5GJDA 3MN3A 3NIEA 4BCGA 1QMZA 5KMKA 2R0UA 4FX3A 3DKGA 5KX8A 5I3RA 3W33A 3UJGA 4D4YA 5AADA 1KSWA 1FQ1B 1H4LA 3V5PA 4ALUA 5CEKA 3TM0A 2OGVA 4APPA 4BDJA 5TT7A 3UZPA 3GC9A 1Y8GA 3FWQA 3N4TA 3PY0A 5AV1A 2H8HA 3VUHA 3LFSA 5DBXA 3DBFA 4L6QA 3UQCA 4YZBA 2OICA 2JKOA 4Y8DA 4C58A 1W82A 1YKRA 3FMDA 4YHTA 5HOAA 1Q41A 4FSQA 4YZMA 2V7OA 1JKKA 3FJQE 3IOKA 4NT4A 3ZO3A 2YIXA 3R30A 4II5A 4BCIA 4M66A 2YCSA 4HCUA 5CSWA 4PV0A 1H1RA 1O6LA 4NH1A 5CEIA 5DT3A 4BIDA 3W2OA 1OL7A 4RFZA 4BBEA 1UKIA 3NAYA 4O86A 4GK2A 5IZFA 3D5WA 5IQAA 1E1XA 4MCVA 4O22A 3VBYA 3IW6A 1RJBA 4QQCA 2XKCA 4L52A 2UW4A 1J1CA 3L9LA 1QPDA 3N4UA 1JOWB 3ORMA 3D14A 3KRJA 5AIKA 4UZDA 2HENA 4QMYA 5AP1A 4AAAA 2CGXA 4FG8A 4CTBA 5G1XA 3GUBA 3FQSA 4I0SA 3M11A 2ITNA 5JGBA 4C4HA 3ZDIA 5LVNA 4E26A 5LVPA 3SGCA 2CGUA 3T9IA 3FLSA 3PYYA 3QRUA 2XK8A 1DI9A 2ZV7A 4FNZA 2O8YA 5DFPA 4CFNA 4OTGA 5HQ0A 4XG6A 5F20A 4USDA 4X3FC 4FV0A 5ANDA 5AFVA 5LMKA 4G3FA 3VS7A 3R8UA 3O17A 3HA8A 4HZRA 2CN8A 4EH5A 1LEZA 3SA0A 4LUEA 4Q9SA 5FWKK 1HCKA 5HVJA 4HVDA 4MBJA 3OT8A 3WIKA 4AUAA 3F5PA 4QP3A 3LMIA 3HZTA 4HVHA 4UALA 4FUXA 4AN3A 3EFWA 4L43A 2WIHA 4U3YA 4DTKA 3BGQA 1YRPA 3II5A 3P7AA 3COKA 3SV0A 5LVMA 2HELA 4A4XA 2QU5A 1W98A 4ANLA 5CVHA 1Q8UA 4EOIA 1W0XC 1JKTA 2YACA 4F4PA 3UO5A 5EYCA 3Q04A 4XBRA 3BHTA 2QOQA 4HGTA 3ZO2A 2Y4IB 3TDWA 2UV2A 2WMWA 4R78A 4FI1A 4KA3A 3LM0A 2YIYA 5KZIA 2QNJA 4D4RA 4CMUA 4AF3A 4EHZA 4FKQA 2G01A 3QGWA 4H3PA 3NYNA 2W1HA 3DY7A 4YC3A 3Q9XA 5A4EA 2CNQA 1GY3A 3EZVA 2C0OA 2OWBA 4N6YA 4F6UA 3VUIA 1MRUA 4O6EA 4O84A 5CEOA 3KEXA 2ZM1A 3MFTA 2IVSA 3HRBA 3OY3A 3UMWA 4GT4A 2OZAA 4ENYA 5CASA 1KE6A 4G6NA 5KMMA 5CF4A 3C0IA 2GDOA 3W2PA 2I6LA 3BIZA 3OXTA 1URWA 3EQFA 3OWLA 4TYJA 1CM8A 2XBJA 5JKGA 4O0UA 5A9UA 2BHHA 2C3IB 5EW9A 5AUWA 3TJCA 1OIUA 2BZJA 3DJ6A 4FKOA 4O27B 3WZDA 3TZ7A 4V05A 5DR9A 3KULA 4M97A 5HCXA 3QCXA 2B9FA 1OPJA 4ZLYA 2JDVA 5I9UA 4BDAA 3ODYX 3AD4A 1UV5A 2YM6A 3BU3A 1J91A 1IASA 5CNOA 3HMMA 4P90A 1PXPA 1YOLA 4EJNA 2XIKA 4AQCA 2QKRA 1GJOA 5ANIA 4XOZA 4IZYA 5JQ8A 1YXVA 4Q2AA 4E4LA 3LCOA 3GENA 1PXJA 3ZC5A 2VNYA 3OXIA 2UZUE 5LARA 4AFJA 3MPTA 3DJ5A 4HOKA 2OK1A 1Q62A 3I1AA 5AV4A 2CKOA 3O96A 1WVWA 3A60A 4E6CA 3FKNA 4HGEA 1OL6A 3OUKA 4AW1A 3LCSA 4C3PA 2W9FB 4PL5A 2J9MA 1U4DA 4MXCA 3VAPA 3OP5A 3RI1A 4DFYA 2XK4A 5CEMA 5FLFA 5T68A 1KOBA 2RG5A 4XEYA 5E8UA 2QHMA 2UVYA 4J98A 4MHAA 3ZO4A 4WUNA 1OUKA 4O21A 3UPZA 5CQUA 3LJ1A 2CKPA 4R3RA 3OROA 3CJFA 1U5QA 2IVVA 3WF8A 4L7SA 4RIXA 4A06A 4FTAA 1H01A 1OZ1A 3DAKA 3P08A 3TN8A 4DFBA 3KVWA 3IW7A 4WRSA 2BAKA 2VWYA 4I5CA 4AGWA 1X8BA 3MTLA 2PZYA 2GHGA 4RFYA 4XP3A 4QQTA 4C4GA 4F0IA 4PTEA 5CF8A 3F9NA 3DT1A 4ZTMA 2BZKB 4U8ZA 3OC1A 3LFFA 3F3TA 3QQGA 5DA3A 2VNWA 4BDDA 4YJVA 4E6DA 5JZJA 4CQGA 1XH9A 4CFXA 2PU8A 3QKLA 2G2IA 2XNGA 3PA4A 1IRKA 3HV3A 3FUPA 3QTRA 2YISA 1F0QA 4DGOA 2GPHA 4FUYA 3D5XA 4QMVA 5AM7A 3P4KA 2XIZA 3R9OA 3CSVA 4FV1A 1FPUA 5FEEA 3C50A 2CN5A 4I92A 2BRBA 3U6IA 2C6MA 1J7IA 2X4FA 2OJFE 2B9JA 2FB8A 4ZMEA 2IW8A 4ONAA 2C3JA 5EI6A 5DG5A 2X7FA 4UX9A 4FTJA 4ZSAA 3KCFA 3DOGA 3R7YA 4E8AA 4EORA 5GHVA 3OFMA 2V22A 4Y85A 4HGSA 5HU3A 4J96A 1Y6AA 4YC6A 5H8BA 5JRSA 2XIRA 4QQ5A 2C69A 3RHXA 4MQ1A 2QR7A 1LUFA 5IQHA 4IQ6A 1XH8A 2ZV2A 4O0SA 3MDYA 1IAJA 4DBXA 5LOHA 3BCEA 3EB0A 4QT1A 5HD7A 4GKHA 3S1HA 3UPXA 4DITA 1ZARA 3QC9A 4XRLA 3LW0A 1DAYA 2QO7A 4C57A 2WU7A 1J3HA 1FBNA 4FICA 4CMTA 3C7QA 1GIIA 1U54B 2W96B 2R3OA 1WCCA 2X8IA 3E7OA 4G9RA 4G1WA 5AIRA 5DOSA 1CKIA 2VTPA 3HV7A 4F9BA 2QG5A 3CD8A 3FHIA 3S2PA 3A7FA 3NWWA 3NW6A 2W1IA 2P4IA 3CP9A 3IS5A 4J71A 4EC9A 4GFMA 3HKOA 4FKPA 3BBWA 5A3XA 3FQEA 2P2HA 3R1YA 4Y46A 4MXAA 3SQQA 4BCQA 4ZZMA 4D2RA 2W1GA 4YO4A 3TV7A 2LAVA 2AUHA 1WBVA 3QRJA 2OF2A 2XJ0A 3QKMA 2GS2A 2B1PA 5K3YA 5BUJA 5HESA 4FT3A 5JGDA 5KMLA 4O0RA 4AN2A 5HCZA 4IWOA 3DZQA 3KMWA 4JBQA 4AZSA 4DHFA 1W83A 3ZOSA 4EL9A 2UW5A 4ANOA 4F09A 3KGAA 5HG8A 4RGJA 1FOTA 3MH0A 4AS0A 4K18A 3DKCA 3O8TA 4BTMA 3QQLA 1TQPA 3OCBA 4QMUA 2WQNA 3PJ2A 1GZOA 4FNYA 1OL5A 2IW9A 3ULIA 3ZH8A 4F9WA 2ITOA 1YWVA 2I0EA 2VUWA 3BQCA 3NRMA 5ETIA 3TACA 4FVRA 5KMJA 5DPVA 5E4HA 3MH1A 3HUBA 4EZ7A 3EQCA 3CCNA 5LMBA 4QPSA 2VV9A 1YWNA 4M0YA 4QYYA 2BIYA 3COHA 5I5ZA 5EQEA 4IZ7A 3W1FA 4FTOA 2ZAZA 4FIJA 2QLUA 4C3FA 3SOCA 4MNEB 4Y95A 1IEPA 5KHXA 4OAUC 3DDQA 4YLLA 5KMNA 2XKDA 1ZLTA 3DKOA 4CYIA 2JLDA 3F7WA 2CKEA 3M42A 4EOKA 4G3EA 3F5XA 5CYIA 5K4IA 3G9NA 5I3OA 2WMUA 3FKLA 3NNXA 2RFSA 4FODA 2CNVA 4S34A 2XK9A 3DTWA 3EYGA 5M55A 4J8MA 4O2ZA 1MUOA 4GKIA 5DYJA 2UVXA 3E8EA 4D5KA 2GNLA 3SG8A 1SVEA 3CKXA 4ITHA 4MK0A 4W4XA 3OWJA 2R64A 2PMLX 1E1VA 4GJ2A 4K9YA 3TWJA 2CGWA 2WFYA 3HMNA 5AUYA 4KKHA 3HRFA 4JDHA 3QWKA 2R3NA 4GIHA 5AV3A 5FQDC 2WQBA 2PZIA 3VRYA 1YQJA 5IKWA 2XNMA 3SX9A 3LJ0A 3I5ZA 5FRIA 2WPAA 2EB3A 3ZZEA 2F7ZE 1OIRA 3ANQA 4G5PA 1XO2B 2HAKA 3ZUTA 2A27A 2ETKA 5J1WA 3CR0A 5DR6A 2C5VA 3PP1A 3CEKA 5B2KA 4D1ZA 5L2SA 4DEGA 3O7LD 5CAVA 4CZUA 3MFRA 5AR3A 3D7ZA 3GXLA 3VUDA 1IA8A 2J2IB 4YTCA 2HZ4A 4FKGA 3QHWA 4P4CA 1JSVA 1ZYLA 3BEGA 4BGGA 4BKZA 2YM5A 5J5SA 3D7TA 4CMOA 3GFEA 5AR4A 1GAGA 3E3BX 3E62A 4IFCA 5L2QA 3EL7A 3GFWA 3UIBA 3KREA 1H07A 3HV6A 4I6HA 1REJA 3Q53A 4FNWA 4MTAA 2CPKE 3FQHA 5AM6A 5A4CA 3D0EA 1UNLA 4BDIA 4E5AX 4IWQA 1M17A 4ZTNA 1NW1A 2QO9A 4J97A 3I0OA 4IB1A 3FAAA 3OT3A 3UOKA 5AAEA 4KAOA 3AQVA 4IDTA 4UMTA 4O7WA 5GJGA 2OKRA 4I6QA 4PF4A 5IPJA 3U51A 4PMSA 4ALWA 2HZNA 2W17A 4J1RA 3ZEWA 2O5KA 4ZIMA 4A9RA 5C8NA 2BMCA 3FLNC 3DQXA 3ORNA 2JKKA 4RX7A 4RZVA 3L9NA 2XIXA 3I7CA 4MF1A 4B8MA 2W1FA 4WNPA 4ZLOA 5BNJA 2NNWB 2Y8OA 4NM0A 5EM8A 2CCIA 1R0EA 4JG8A 3KULB 4JXFA 4K0YA 4D2PA 4QMTA 4QP7A 4I5HA 4L53A 3E87A 3R1SA 4WUAA 1H0WA 3NNWA 3F3VA 4WBOA 3FY2A 3HX4A 4ASDA 3QYZA 2X0GA 2NRUA 3GOPA 1NVSA 4PL4A 5DR2A 2BHEA 3VF9A 3FI3A 3Q52A 3PLSA 2JAVA 3KXXA 3LCDA 2WQMA 4L00A 2XS0A 2ITTA 3QX2A 2UZDA 2FUMA 3LFQA 5HO7A 3K5UA 1DM2A 1GZKA 4F99A 2HK5A 4Q5HA 5A14A 5AP6A 1UVRA 2OO8X 5A46A 5I9WA 4EZ5A 2XVDA 4FL2A 4RSSA 5AP7A 3O8PA 5IA3A 4FSNA 4R7BA 3UMXA 3R71A 4BC6A 3G0EA 2EU9A 3O23A 5L2IA 2RF9A 4M67A 5E9EA 3HMIA 1J1BA 3QQJA 4I4EA 2DYLA 3O0GA 3R8LA 2EXEA 1M14A 2R7BA 4RIXB 5A4QA 3FY0A 5LWNA 4IAAA 3RK5A 5AUXA 4CD0A 2R3HA 1KV2A 4BTJA 5CI7A 5D9HA 2PULA 3NYXA 4IMYA 3PXQA 3TKIA 4DTBA 3D94A 3Q2MA 3PE1A 3NS9A 3COMA 2XIYA 4RG0A 5DMZA 3NUNA 3T3UA 3R7UA 4BIBA 3CPBA 3GBZA 3L8PA 1NVQA 4FEWA 2BUJA 4FBXA 3UG1A 5EDQA 4O0XA 4CKIA 4ZJJA 1YXTA 4GU6A 3SXFA 4BDHA 4L7FA 4R7IA 2ITYA 3RM6A 4L01A 4YGAA 4NUSA 3AC8A 4BL1A 4IVCA 5KMIA 1NXKA 5F94A 3LAUA 4YSJA 3PRFA 5EI2A 3C0GA 4QP1A 4YTIA 2ONLA 4CTCA 1S9JA 4DT8A 3QLGA 5HU9A 1XH4A 2G2FA 1ZAOA 3MJ2A 4X2GA 5BVKA 3QXOA
chains in the Genus database with same CATH superfamily
3POOA 3QZFA 4I20A 4WNKA 1R3CA 4KIKA 4MYGA 2JDSA 1EH4A 3W0NA 1G3NA 2WZJA 1ZY5A 3DQWA 4IWPA 2WTWA 4MEDA 1PF8A 2H9VA 3KA0A 4M68A 3QWJA 2BKKA 4GS6A 2F4JA 2X2LA 4EKLA 3PSCA 4NCTC 4XMOA 3A8XA 2XZSA 3ZCLA 5JK3A 1ZXEA 3HDMA 4AP7A 3VUTA 2RGPA 3A7JA 4GG7A 2C6DA 3AKJA 4D1XA 2RFEA 4TN6A 4O0YA 4X6QC 4EOMA 3RMFA 4DH7A 4YNOA 4O91A 4W4VA 2HW7A 2BKZA 1LPUA 4RX8A 2CHLA 3N51A 3R83A 3R7IA 5I0BA 4J8NA 4FL3A 5M07A 4QNYA 3N4VA 3REPA 5BQ0A 2BAQA 4MXOA 1OPLA 4L44A 3QA0A 3CY2A 3VN9A 1Q8TA 3ZXZA 2XMYA 3EN5A 4UY9A 5CANA 4Q5EA 4RVTA 3BX5A 4C4EA 1SVHA 2BPMA 2H6DA 2JKMA 5G6VA 4EOQA 3VULA 3UYTA 3A8WA 4BN1A 5HX8A 1PRYA 3G90X 4MWIA 3GU8A 5D10A 5JT2A 1SMHA 4E6AA 4R3PA 3C4CA 3W55A 3W8QA 2FSLX 3UP7A 3TUCA 5AWMA 1OIQA 2QOBA 3R1QA 3SAYA 4FKWA 2O65A 2BDFA 2Z60A 2BVAA 3QHRA 4HNFA 5HTIA 3E7VA 4V04A 5IQIA 4AU8A 3QZHA 1IA9A 4CNHA 2YABA 1K2PA 2A2AA 4ZTSA 1WVXA 2Z02A 5E8SA 3W2SA 5DEYA 2WTCA 4GT3A 4S31A 2PUPA 4PUZA 5KO1A 4LGHA 2FYSA 5CZHA 5BYLA 3OUNB 4FTTA 3KK8A 3FSFA 1Y6BA 4FG9A 1BKXA 4FNXA 4WHZA 5EHLA 4CKJA 2DS1A 3HDNA 2G9XA 1MQBA 2B7AA 1GNGA 1HOWA 2O64A 2C47A 2R0IA 2WTVA 4OW8A 4QNAA 5FP5A 3ZYAA 1PKDA 1JSUA 1XH5A 5AX3A 3FYJX 4DH8A 2YAKA 1DS5A 2PY3A 4E93A 4L68A 5IUGA 4A4LA 4JLCA 3CTQA 4K33A 4JI9A 4XV1A 4LL0A 4AT3A 2VO7A 4IB3A 4A9TA 4JIAA 2R3LA 1R0PA 1PMVA 3Q4TA 3ZRMA 4ZXTA 3U9NA 3R9DA 1BMKA 2ZVAA 4X2KA 3OY1A 2LGCA 3PTGA 1JVPP 4FZFB 3RPRA 4FE2A 4M14A 4I6LA 3QF9A 3ORLA 4QMXA 2PVKA 4AW5A 3U6JA 2WTJA 3P86A 1ZMWA 1ZYDA 4DT9A 1M2RA 2BRNA 5HNGA 2C6KA 2IEWA 2NP8A 2YWPA 2V55A 4XG3A 4YTFA 3GCUA 3KMUA 4AZVA 3UDZA 4B7TA 2GTNA 3K5VA 3R22A 4IE9A 2B52A 2BTRA 3KB7A 3VHKA 3QAME 3ZHPC 1YHWA 1H27A 2PSQA 2ZV8A 3C1XA 4X7QA 4ZY6A 3V3VA 4EUUA 3A7HA 2JDTA 3V5JA 3OVVA 3D7TB 2CCHA 3OMVA 3JR1A 4MXYA 3MFUA 4RVKA 4G3DA 4K1BA 4RX9A 4OTRA 4U45A 2XNPA 4XS2A 3H9OA 4IADA 4LYNA 4XBUA 1Q3WA 2X0PA 3L8SA 3NCZA 1V0OA 1YHSA 1RQQA 4FRFA 4FEXA 4CCBA 3IQ7A 3E64A 1YI6A 2A0CX 2XJ1A 3G5DA 3HMPA 1KUTA 2VTJA 4JBPA 4EQUA 4FC0A 4RA4A 4AZWA 3QGYA 4DA5A 3E93A 1E9HA 3GCPA 5DLSA 5AR7A 2PVNA 5D41A 4QTEA 3B2TA 2AEGA 1HCLA 4B4LA 2PMIA 4YBJA 5BMSA 5JGAA 1O9UA 2QOFA 3ENHA 4IB0A 4I6BA 3BV2A 4KBCA 5M53A 4KRDA 4CEGA 4RIWA 3BQRA 2VTAA 4O0WA 2ZM3A 2O2UA 4BTFA 2QI8A 1FVTA 2GNIA 3CD3A 2BAJA 4AXAA 3AKLA 1PXIA 2VWIA 3BV3A 5H3QA 1ZOGA 4W4WA 3PIYA 4AOJA 1S9IA 3CS9A 4ZJIA 5JRQA 2FSTX 5IUIA 4V0GA 2Z2WA 3F66A 2GCDA 4IACA 4FSYA 2JITA 1M7NA 2VO0A 4ACCA 2J4ZA 4GIIA 4A9UA 3TIZA 5M06A 2VN9A 3QD0A 3TCPA 2XK7A 2OW3A 3QRTA 4TWPA 4EWHA 2UZNA 4U80A 2YM7A 1Q8WA 4XG9A 3HECA 4NKAA 2GS7A 1P14A 1B38A 1PY5A 3PZHA 4Y73A 3UIUA 4APCA 4E5WA 2W7XA 4YLJA 5HE1A 3R8VA 3DBQA 1ATPE 4WNMA 3C9WA 4ID7A 1YW2A 4N6ZA 1ZRZA 3EN6A 3QKKA 4IX6A 3UNKA 5IA5A 3BU5A 4N70A 3EN9A 1PMEA 4GEOA 3BGZA 3B8QA 4MUQA 4D9TA 3VW6A 4WO5A 4X21A 4EH7A 3MA6A 2R3IA 2YFXA 1IR3A 4FVQA 5EM7A 3WBLA 5HIEA 4FKVA 4AOTA 3UC3A 3KN5A 2RL5A 4RC2A 3OEFX 5FTOA 4YPDA 3UVPA 4CXAA 2XP2A 3S00A 4BGHA 3I7BA 4NCTA 3TNPC 5HNBA 3NYVA 4CFMA 5FXRA 4UWCA 4D4VA 3LCTA 1ST0A 4BCJA 5C9CA 4NW6A 4F7LA 3WZKA 3NEWA 2EVAA 3AD5A 3KFAA 1M7QA 2YM8A 4RA5A 4TYHA 5KNJA 2QKWB 2CGVA 5AP3A 5CU4A 4C8BA 2OBJA 4DC2A 2C4GA 1PXLA 2PVLA 4FKLA 3VUMA 4O7LA 2WEVA 4RQKA 2UZEA 1CMKE 2NRYA 2ITXA 1WBTA 2EUFB 3AC4A 3R0TA 4P5ZA 5BUIA 2OIDA 3E92A 1JKLA 1U46A 3LFAA 5J95A 4BKJA 2IW6A 1H1WA 1PW2A 5T6KA 4FIIA 3JYAA 1WAKA 5DNRA 1W84A 3FI8A 5HG5A 4AWIA 3VS3A 4IZAA 4GJ3A 5HNIX 3TDVA 2YM3A 4IC7A 4JQEA 4JX7A 4I41A 4F1TA 4EI4A 4O1PA 4YZCA 4FSTA 3JVRA 4NM5A 3CKWA 3WE4A 4C37A 1H28A 2GFSA 4I21A 5CT7A 2YERA 2J0LA 3E8CA 4DG0E 1MP8A 4GL9A 4R7HA 4XLIA 3PA3A 3EH9A 5HLPA 3QQKA 2UZBA 4PRJA 3K54A 3RGFA 1P2AA 2WTKC 5BUEA 4ZOGA 2AC3A 4HYIA 4FKTA 4FV8A 3IW5A 3F6XA 4RJ7A 1JAMA 1WFCA 5J5TA 2X4ZA 5CQWA 5EW8A 2GNGA 4ZTLA 3VW8A 5EYDA 3KKVA 2PMNX 3QTIA 5L3AA 3GCQA 2PMOX 3I79A 2XKFA 4F70A 4DFXE 3W0PA 3ZFXA 4J99A 4QYGA 4ZMFA 4MD9E 4IX5A 3DDPA 5KUPA 3BLHA 3LXKA 3VRZA 4DF3A 1YXSA 4OLIA 1XH7A 4KKGA 4DEHA 1M52A 5DH3A 4NZWB 2Y6MA 4ACHA 5M57A 4EOJA 4K77A 3R73A 4Z9LA 4F78A 4TNDA 5J7HA 4OTFA 1OKWA 1PYXA 2DUVA 2JIUA 3F2NA 3PY1A 3Q9YA 4DINA 5H9BA 1Q5KA 1KE7A 4ZY4A 3QTWA 5JFWA 2O3PA 4C61A 5EQYA 2QOCA 3LFCA 3DXQA 3MB6A 1NY3A 3OCSA 1OPKA 4FYNA 4DFNA 4YBKA 5HORA 1R39A 4JRNA 5KKRB 1XR1A 2C5OA 5EH0A 5CSPA 3RHKA 4D28A 3NW7A 4BDBA 4IAIA 3TV6A 4C4JA 2W05A 4LMNA 3GI3A 1YXUA 3LOKA 5FP6A 3IDCA 4JG6A 3I6UA 4NIFB 4NTSA 5EM5A 3TJDA 3C4XA 3Q60A 3L1SA 5K0KA 1WBOA 5KMOA 2QCSA 1G5SA 4FT9A 4G31A 4L3PA 1TKIA 3ORTA 5CX9A 5IQBA 2OJIA 1KWPA 4H05A 1FGKA 4BR3A 1IAHA 4UEUA 2PVRA 4O0TA 4ACMA 3FMJA 3IONA 4NSTA 2WU6A 4IB5A 3WZEA 4XV2A 4BZNA 2QHNA 3OD6X 4M84A 3DLSA 4QMOA 2QR8A 4TWNA 5HCYA 2JGZA 3THBA 4CFUA 4EC8A 4HVGA 2QO2A 2HW6A 5CF5A 2VWZA 3C4WA 2UW6A 4O82A 4M69A 4B99A 2OZOA 4RPVA 1W8CA 3UNJA 4TYEA 5ACKA 5IQEA 2OH0E 3MA3A 3RK9A 3TNQB 4BB4A 4PNKA 5HHWA 4AXDA 5CXZA 1K9AA 5KBQA 2J0MB 3G51A 4TTHB 3MFSA 4ANBA 2NO3A 2XYUA 3PUPA 4EEVA 4EWQA 1URCA 4FTQA 3ZZWA 4NFMA 4ARKA 4D55A 2RIOA 3PVBA 5CEPA 3TT0A 4WT6A 2R3GA 1O6YA 2H96A 3KRWA 3VJNA 1WZYA 2JFMA 3HGKA 5L2TA 3O2MA 5AR5A 3MPMA 4G3GA 4ZK5A 4O7TA 2WNTA 4BGQA 2GNJA 5AUZA 4DG2E 2Q83A 5A4TA 4H3QA 4QYEA 4NTTA 3FMMA 4IX3A 4XG2A 4L46A 3WF5A 4B9DA 3PJCA 4DN5A 4PMPA 4WRGA 4UN0C 4ITJA 5L6OA 3FDNA 4CSVA 3A2CA 4BDCA 2W06A 4D0WA 2NPQA 4EK5A 2W9ZB 1BYGA 3MVJA 3VIDA 3UG2A 4FTKA 2W1ZA 2WKMA 3PVWA 1OKZA 3VC4A 2C6TA 3UTOA 3LZBA 1A06A 1UU9A 5KZ0A 3ZRKA 3NUXA 4V01A 4YJRA 1CSNA 2XRUA 1SZMA 3P78A 3UO6A 3MWUA 4EOSA 2OJGA 4ZSGA 2UZTA 3GQLA 4JRVA 3W8LA 5BVFA 4FEUA 2PZ5A 1J7LA 3P7BA 4KABA 1BLXA 4TT7A 2Y9QA 2ITQA 2BRHA 4GSBA 3WOWA 4H58A 4EH9A 4D1SA 3CQWA 3LFBA 1K3AA 4B6LA 4ZY5A 3DU8A 2YN8A 3C4EA 5BX0A 2E9OA 5EI8A 4F6WA 2WOUA 5KHWA 4RIWB 4QMQA 5B0XA 5M56A 2UW3A 1YOJA 2VTIA 2X0QA 3F7ZA 4AT4A 3GC0A 4UV0A 3VVHA 1UKHA 2DWBA 3BYMA 4S32A 5IA4A 1UWJA 3NUAA 2ZDUA 3UQGA 4ASXA 2WMRA 4XOYA 2Y4PA 2YJSA 2W4KA 5C8MA 3ALOA 3QC4A 4X3FA 4V0GB 4AZFA 2HWPA 3FLQA 2IO6A 2HZIA 3UIMA 1APME 4CG9A 2IJMA 4DAWA 3PPJA 4MXZA 4UMRA 3QUDA 2RG6A 2W0JA 3A99A 4R3CA 2Y4IC 3R7OA 3R9HA 5LVLA 4EH4A 3O5AA 3R7GA 4DCAA 5C4LA 3BU6A 2FA2A 4BDFA 5IQCA 5DGZA 4KNBA 3VBQA 3HYHA 3NW5A 4IHPA 4EOPA 3TKUA 1Q8ZA 3P1AA 3Q32A 4ERKA 1JSTA 4O38A 4CFWA 4EJ7A 3ZM9A 2WD1A 2WB8A 1Y8YA 4UB7A 3MVHA 3UOLA 4BDGA 3I81A 3R2YA 3DTCA 4Z7GA 4QDVA 3BLQA 2Z7RA 3C5UA 2YIWA 2ITWA 4U9AA 1Q24A 4GUEA 1PMNA 3P79A 2OXYA 4L8MA 2OFUA 4DTAA 5AUVA 1UA2A 4O83A 2O63A 4EH8A 5E1EA 4FGRA 5GIPE 3QXPA 3JS2A 2ITZA 4Y5QA 3PE2A 3VQUA 2BRGA 4DEDA 2ESMA 4R1VA 4XP2A 3CJGA 3IW4A 4BI2A 1OBGA 3DBDA 1SNXA 4DH3A 3CGOA 4RFMA 1MRYA 3BHHA 3QZGA 3G0FA 2C68A 4IZ5A 4D2SA 2QONA 4YU2A 3AGLA 5A6OA 2YAAA 3O51A 3UO4A 5B7VA 5IEVA 2YCFA 3CIKA 2KTYA 3PXYA 4C59A 3K3JA 2C6EA 4NM7A 4KD1A 1H24A 4G2FA 1H1QA 4IH8A 4MQ2A 2GU8A 4D4SA 2PHKA 2YM4A 3LQ8A 4YJOA 3RWPA 5LWMA 3ZLSA 4BCMA 4BF2A 2FSOX 4MBLA 5I9ZA 3K3IA 4TPTA 4GYIA 2UW9A 4F63A 2JKQA 2YDJA 2VTLA 5HLNA 2FVDA 3GNIB 4JDKA 3QD3A 4K8AA 4BI0A 4EHVA 4YNEA 2R4BA 5CAQA 4GFGA 2PWLA 3TNWA 5IMEA 5IMXA 5K5NA 4BY9E 2YLFA 4H3BA 5K9IA 2C6LA 4CG8A 2W5HA 2GFCA 3BYUA 5TO8A 3DB6A 4W8DA 3BEAA 3V6SA 4FR4A 1PYEA 2C5NA 1TFFA 5AX9A 4ORKA 1OGYA 4FK6A 4RLKA 3FXWA 1CTPE 4XJ0A 3OOGA 3BWJA 4O0VA 5T3QA 4A07A 5CWZA 2C3LA 4QMSA 4EK6A 4LV5A 3BELA 2IN6A 2OZAB 2PUNA 5CF6A 3WF7A 2OFVA 3ZFYA 4YSMA 2ITUA 3NCGA 4R8QA 4RWLA 3SW4A 4QTCA 3Q3BA 3ZDUA 1XBCA 5A4LA 1Y57A 3ZBFA 3P5KA 3U54A 4FK3A 3FLYA 5DI1A 3ZLWA 4OTPA 2PVJA 4DH1A 5CENA 4QMPA 3SKCA 2HY0A 2ETMA 3VS1A 5BVOA 4C35A 2I0YA 3FI2A 4WG4A 4CFVA 1P4OA 3MVLA 2IWIA 3Q4ZA 3FE3A 3ROYA 3T3VA 4ASEA 5EDPA 4FTUA 4LRJA 4X2JA 4XV9A 3FMLA 4A4OA 4F6SA 2JD5A 2PE0A 4QMNA 4FKJA 2R3KA 4PTGA 3A7IA 3AMYA 3AOXA 3QCSA 4ITIA 2C5XA 3IO7A 5M44A 4QRCA 1ZMVA 2BFYA 3EQGA 3R8PA 3RP9A 3LPBA 4FTCA 2PUUA 4RIOA 4JDIA 4WNOA 4CV9A 2WQOA 2XJ2A 3ETAA 3KN6A 4RVLA 1PMUA 4USFA 5IA0A 3SVVA 2XF0A 1PXNA 1ZWSA 2JDOA 4ZLZA 3F82A 3PJ1A 4ZJVA 1DI8A 5AUTA 2FSMX 4LG4A 3Q5ZA 4FF8A 3VBVA 4EH6A 4PMTA 3FMKA 2ERKA 5AR8A 2XNOA 2I0VA 3L9PA 1WBNA 5IEYA 4PNIA 4XUFA 1SVGA 2J0JA 2XB7A 2Y0AA 2J6MA 4KB8A 3VUGA 5B2LA 2XNNA 1NT2A 2VGOA 1OUYA 4N4SA 2UZLA 3WF9A 4E20A 3UNZA 3BHVA 2XA4A 1QCFA 3IG7A 4C36A 3E88A 3Q6WA 2XYNA 2IZSA 4DEBA 3U6HA 4BHNA 3FZSA 3HEGA 2YDKA 3EJ1A 2Z7LA 4WG5A 2YIQA 3CGFA 4M3QA 5DT4A 4ZTHA 5L4QA 3NMUF 4FIGA 4LUDA 4X2FA 5EKOA 4M69B 2PK9A 2ZFYA 3KK9A 2WQEA 1YXXA 3AG9A 4IXPA 5HIBA 2W99B 4UXLA 5L8JA 2WXVA 4A9SA 5IDPA 2GQRA 1G8AA 1H0VA 2BDWA 4OBOA 3FXXA 4L9IA 2YZLA 3OEZA 3EKNA 2JIVA 4U7ZA 4D9UA 4N57A 3Q4CA 4NEUA 3DFCB 5HEZA 3A7GA 3P5JC 1R1WA 2PPQA 3ZS5A 3MW1A 5HBHA 2XEZA 5CAPA 3ID6C 3BE2A 3LXNA 4BCFA 5AA8A 2XAOA 3V5TA 1OECA 3SW7A 3QL8A 4FV2A 3IGGA 1OBDA 3FC1X 3O71A 4MKCA 4O7SA 3IKAA 2O0UA 4PTCA 4XX9A 3ZEPA 4AE6A 2NYAA 1P4FA 3LVPA 2RKUA 4FT5A 3UBDA 3DGKA 3F2AA 3VWAA 4C62A 3MIYA 4LM5A 4YTHA 1OMWA 2X7OA 3A4OX 2GQGA 4PDOA 1NA7A 3QRKA 4UYAA 3WILA 4AZEA 2OF4A 5HVKA 5FG8A 3RK7A 5K4JA 3ZC6A 3RTPA 4S33A 2G2HA 1Z9XA 3ORXA 2W5BA 3OBJA 2E9NA 3WYXA 1XBBA 3UP2A 4WSQA 4EOLA 4FV4A 5CAUA 2V62A 3G33A 3FKOA 3MY5A 4FIEA 2VTSA 4YPSA 5CY3A 3S4QA 1QPCA 3LM5A 4O7NA 4HYSA 2YA9A 3IW8A 3NVMB 3VHEA 3MH3A 4ANNA 3BZ3A 2HXLA 3QTUA 1ZY4A 4FKUA 2XM9A 2BZHB 4AA5A 1JWHA 2R5TA 4CT2A 5GJFA 3RCJA 3Q9WA 5CXHA 2UUEA 3WF6A 3GGFA 5LQFA 3KCKA 5HI2A 5BYZA 4JQ7A 3FV8A 4AOIA 1L8TA 3V04A 4XH6A 3D15A 2CLXA 3EQHA 3NIZA 4WA9A 5IU2A 4QYHA 2B0QA 2C1BA 4E4NA 3MV5A 4I23A 4QD6A 3C5IA 1OKVA 3CPCA 4X3FB 3GB2A 3ZO1A 5EOBA 5CNNA 4ZAUA 4R77A 4ENXA 4BWXA 3PXFA 4JIKA 4TNBA 4YHFA 4FVPA 5EYMA 4PP7A 3LLTA 4YJNA 2XAMA 5HICA 4EYMA 4YP8A 4USEA 2GSFA 5K0XA 2HY81 1PXKA 4FIFA 3UZTA 3W0QA 5M08A 4PPBA 1I44A 3OTUA 5E8WA 4ZSLA 3M2WA 5HD4A 3GVUA 2XCKA 1Q61A 4X6RA 3ZU7A 3VBXA 4EONA 3ULZA 2CKQA 2PVHA 5GNKA 3NPCA 4U43A 4GRBA 1OGUA 4RWJA 3GC7A 5LVOA 2ACXA 3VS4A 3IK3A 3W18A 4BCPA 4G16A 1UNHA 5JH6A 4RJ5A 4NK9A 1XH6A 2ZB1A 3ACKA 4L3LA 3HUCA 4XLVA 4M13A 4Z55A 1XJDA 3SDJA 4XP0A 3TTJA 4M8TA 4BCKA 3MB7A 5GZ8A 3EMGA 4UMPA 3NYOA 5AAFA 4RIYA 3DPKA 3LMHA 3FC2A 4RRVA 4D2TA 1U59A 3BRBA 5IG1A 4CGAA 1B6CB 1A48A 4IJ9A 5LJJA 1LEWA 3MGYA 4TWCA 3LXLA 3DZOA 4E6QA 3IGOA 3CC6A 3LXPA 3PPKA 2ITPA 3KMMA 3F3WA 4FGBA 3LHJA 4YLKA 3LFEA 3E3PA 2B9HA 3P9JA 3VBWA 2EXMA 5TF9A 4O7YA 2R3MA 5HKMA 2BFXA 3D9VA 4MH7A 1OKYA 3ZONA 4BICA 3Q2JA 4UBAA 1JLUE 3FLZA 4HVIA 3KXMA 4U81A 4C2WA 4LGDA 4YJPA 4F7NA 3TUBA 4LV8A 2VWWA 4DGMA 5HZNA 3EL8A 1UU3A 2XK6A 2ZDTA 3PP0A 4RMZA 4CRLA 4Z7HA 5CALA 4GYGA 3RAKA 4AG8A 5HBJA 5H8GA 4OT6A 3DXPA 4NWMA 3AC2A 3ATTA 3MYGA 4PDSA 3F88A 3FXZA 2FH9A 3Q6UA 3PDTA 4RQVA 1U5RA 3JVSA 3PWYA 5AV0A 2VWBA 4AGDA 3QUEA 4JS8A 4KS8A 3EWHA 2FO0A 3H0ZA 5FTGA 4CCUA 4MBIA 4BZOA 3H0YA 4KBAA 3UVQA 1BL7A 4IVBA 4AW2A 2F49A 4P5QA 2X6EA 1YDSE 2OU7A 3DCVA 4KIPA 4WD5A 5ANEA 5FM2A 5FXSA 3ZSGA 2CSNA 4FKIA 3JY9A 3CLYA 1XHAA 5JMSA 5L6WL 4N0SA 3VS0A 3FI4A 5CT0A 5EDRA 2E9VA 5J9ZA 2VO6A 4IWDA 3GC8A 3GU7A 4YZDA 2EWAA 2IPXA 3Q9ZA 2XUUA 4C4FA 4FYOA 3UODA 3KXZA 5A54A 2J51A 3QZIA 1W2FA 4QTBA 5CU2A 4AACA 3PSBA 3R02A 1UU7A 3QD4A 4QMWA 3OS3A 3TEIA 3BYOA 3MJ1A 4QO9A 3NUYA 3R00A 2XNBA 2WMXA 5M51A 3MS9A 3HLLA 3OWKA 2W1EA 2X0OA 4ANSA 2ZM4A 1TVOA 4I5MA 4NM3A 2XRWA 2IVUA 3HAVA 2WMAA 4KBKA 4BWPA 3GCSA 3ITZA 3ORZA 4H39A 4PPCA 4TYGA 4A9YA 5EFQA 5FBOA 1RW8A 2QQ7A 5HLWA 2C0TA 2JDRA 3MPAA 1F5QA 2J50A 4W8EA 3GU5A 4YHJA 4EK3A 3ET7A 2OH4A 5IA1A 3FYKX 1ZZLA 3MY1A 2JEDA 2UW7A 4HYHA 4BFMA 3TTIA 5IEXA 3KRRA 2X7GA 3RJCA 4F7JA 2EXCX 2FGIA 3P0MA 5LCKA 5CU0A 3FMHA 3PVUA 4RJ8A 2ZMCA 2J5FA 5ANKA 2PTKA 3HV5A 3NUSA 5IF1A 3F5GA 1H08A 1CKJA 5DHJA 2XK3A 4NYEA 3JUHA 2V7AA 3TZMA 5IISA 2J90A 2YIRA 5ANJA 3G15A 2QODA 3RINA 2Z7QA 3CE3A 3D5UA 1LR4A 3PXKA 4OT5A 4AT5A 5CU6A 5E1SA 2YZAA 4F0GA 4BZDA 3OWPA 3P7CA 1GZNA 4TKSA 2AC5A 4RZWA 4H36A 3V5QA 3HV4A 2HZ0A 1A9UA 3QCQA 4IEBA 3MESA 3H10A 3P23A 3AC1A 4GFOA 4O7RA 4FKSA 1TQIA 2R3FA 4HGLA 1SYKA 3ORKA 4OTQA 4EYJA 3GCVA 3WYYA 4NJDA 4XHKB 4R5YA 5BVDA 1GZ8A 4MNEA 2WO6A 1WVYA 3VUKA 4YJUA 3NLBA 4YC8A 2P2IA 5AP2A 3NNUA 4EKKA 5B2MA 3CBLA 5EHYA 3VBTA 3UOHA 2JBOA 2V5QA 3FZOA 4NJ3A 2X2KA 3BLRA 5DVRA 4IDVA 1JQHA 4IBMA 4LGGA 2ZYBA 4JT3A 3TZ8A 3WI6A 3RAWA 3ORIA 3AMAA 2W1DA 3ODZX 5D7VA 5CAOA 3OF0A 2PE1A 2F57A 4R5SA 2AYPA 4R1YA 3OOMA 5HIDA 2BDJA 2OXDA 1RE8A 3IDBA 3NAXA 4YJTA 3RAIA 5BVEA 4ACDA 4E1ZA 1MQ4A 1R78A 3GU6A 5A6NA 2F2UA 2YEXA 3DNDA 3HNGA 5M09A 5H8EA 5J8IA 5IA2A 3MI9A 4UMQA 2CNUA 4KIKB 4CZYB 4GK4A 2BALA 3RKBA 3T8OA 3W32A 3LMGA 3DK7A 2B4SB 4G34A 3BI6A 3U87A 3PLAE 3W16A 5CTPA 4PDYA 5DE2A 2C30A 4NFNA 4LL5A 3UE4A 3CTJA 2VD5A 3QTXA 2X1NA 4AA4A 4AA0A 3OW4A 3PRIA 3VS5A 1V0PA 2PVMA 3MSSA 4KSQA 5FGKA 4GW8A 3R9RA 3Q5IA 1KE5A 2IF8A 5JFVA 4K6ZA 5CSVA 5CU3A 3R21A 3PA5A 1YI3A 4AQKA 4WOVA 4XG8A 3RNIA 1TQMA 2Z7SA 4XV3A 4HJOA 3UC4A 3V6RA 4DYMA 5IH6A 3S95A 3W0SA 3Q96A 2C0IA 4RLLA 3PZEA 3D2IA 2BZIB 2A1AB 3RVGA 1ZYJA 4JQ8A 4MD8E 3RZBA 4PL3A 4HVSA 3R2BA 2EB2A 4S30A 4W9XA 5HVYA 4P7EA 1ZZ2A 2CMWA 4J53A 5EG3A 3TNHA 4RBLA 1Q97A 1GIJA 1G8KA 4I3ZA 4WSYA 4ZTRA 3ZUVA 1UU8A 3E8NA 4IC8A 4ACGA 1WBSA 3PIZA 2XBAA 3CY3A 4I5PA 1YOMA 4FIHA 3GEQA 4OR5A 5DRBA 4FZ6A 4K11A 4I6FA 4OGRA 2C6OA 5F4NA 1VLRA 3NUPA 4FZDB 4NKSA 2P3GX 3KQ7A 4YJSA 3O7LB 5AJQA 5ETCA 5HO8A 3CXWA 3QTSA 3M1SA 1IG1A 3DAEA 4M7IA 3DBEA 4MAOA 3QX4A 2YLEA 4IM3A 1OVEA 5L2WA 4I4FA 5CVFA 4EH2A 3D2KA 4ZZOA 5HTBA 3IDPA 4OTHA 2XH5A 1M2PA 2QURA 2B54A 2UW8A 2OI4X 1BI8A 4OTDA 3KF4A 3EN4A 2VZ6A 3F2RA 1UNGA 2I0HA 2VAGA 4OBQA 3SHEA 3ZUUA 4RJ4A 2CLQA 4HW7A 5J79A 1Q4LA 3ENMA 2ZMDA 4F64A 2XM8A 3NGAA 4ANQA 4EHGA 1QPJA 3I4BA 3FLWA 3HL7A 4C33A 5J9LA 3EFLA 5J87A 4BCNA 1OB3A 4DEIA 4I1ZA 5GZ9A 4QP6A 2C1AA 5HX6A 5ACBC 4F65A 5JSMA 2BIKB 3GU4A 1FVVA 4QQJA 3IOPA 3NNVA 4CLIA 2KULA 4JNWA 1GOLA 4E4MA 4TZRA 3AD6A 1FMKA 2JAMA 4RIYB 1L3RE 1W7HA 4TWOA 5AR2A 1NVRA 3VO3A 4LFIA 3DS6A 1OITA 4G6LA 4IAKA 3POZA 1ND4A 3A62A 3EQRA 4J52A 5CEQA 5L8KA 1BX6A 4IAZA 4EHEA 2X9EA 3U4UA 3D5VA 4DH5A 4ANMA 2BILB 2WMQA 5LCJA 4QMMA 3H3CA 3G6HA