3IO7A

2-aminopyrazolo[1,5-a]pyrimidines as potent and selective inhibitors of jak2
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
289
structure length
282
Chain Sequence
TQFEERHLKFLQQLGKGGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title 2-Aminopyrazolo[1,5-a]pyrimidines as potent and selective inhibitors of JAK2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 282
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3io7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3io7A01
3RJCA 3FQHA 4WNPA 2HAKA 3OROA 4PPBA 4E73A 1PXKA 2I0VA 2PZYA 1STCE 3DAKA 3EWHA 1OKVA 4I92A 3TUDA 4CKJA 4N6YA 4W4VA 4RSSA 2AC3A 4TY1A 2CNUA 3FMLA 4CKRA 2WOUA 4M69A 4F6SA 2XNEA 4MWIA 3KXHA 1RDQE 3C9WA 3QGYA 4I20A 3LFDA 3VO3A 3MY1A 4CQGA 4F0FA 5EHLA 4ERWA 1M14A 1KE5A 4ZOGA 3U4WA 3DTWA 4XG2A 3CJFA 3ITZA 3QTWA 3FZRA 4IAYA 5HLPA 2JAVA 3ZSHA 1FGIA 4BBFA 4EUTA 4FEQA 5ICPA 4C38A 4FG8A 4JQ7A 4RX8A 5IG1A 5JFXA 3REPA 2ZV7A 4ZIMA 3NVMB 4EH2A 1XH7A 2R7BA 2BVAA 3KC3A 3W1FA 3WZKA 5TT7A 1FOTA 4MF1A 5M56A 3WF8A 1P4OA 3UNJA 4M13A 1JQHA 1IA9A 1FQ1B 3H0ZA 3NCZA 5C01A 2A19B 3UPXA 4IAFA 3ZFMA 4K18A 3ORIA 3P86A 2OJ9A 3T9TA 4JDHA 3LHJA 3OTVA 2PZIA 4FNXA 4S31A 1P2AA 1YWVA 3AOXA 3OY3A 1M17A 4FZDB 4LYNA 2C0IA 5CY3A 4ZLOA 5AUXA 1KWPA 2WGJA 4R3CA 5TOZA 2QG5A 5IEYA 4MBJA 5CF8A 3O50A 1YOLA 5JEBA 2X81A 3HV7A 5EI8A 1H26A 3GFWA 3O8TA 2JDSA 3F69A 5FBOA 2SRCA 5E1EA 1YDRE 3P23A 4E4LA 5CI7A 1W7HA 4FV8A 3TEIA 4GS6A 4IVCA 3TJDA 4FTQA 3NAXA 3DBQA 2O64A 1AGWA 2VD5A 4GU9A 5CSVA 2XK6A 5A9UA 2QO7A 5H8BA 3ROYA 3WE4A 5EM6A 3TXOA 4D5HA 3FAAA 5EI6A 2VO0A 3FYJX 4QO9A 2BZKB 4BTMA 3EFJA 5LCKA 1VYZA 2JC6A 5M08A 4CFWA 4O1PA 3W2QA 3GU4A 2ZM1A 2OWBA 4DLIA 5F9EA 2OKRA 2XM9A 3FL5A 3KCKA 3W16A 4RIWA 2B54A 2BRHA 2HW7A 2UW0A 4CRLA 4ZY6A 4YURA 3ORZA 3DK6A 3DXQA 4N0SA 3R71A 2C1AA 3FLNC 3PY3A 4FZAB 4D1XA 4E4XA 4PL3A 5CSXA 4EKLA 2RL5A 3I81A 2G2FA 5I0BA 2BZIB 2R3GA 4FIJA 3KL8A 5T6KA 3QXPA 3IDPA 5HI2A 3I60A 5AX9A 4C2WA 3ODZX 5CAUA 5I3RA 4NL0A 3VF8A 4ACCA 4CEGA 2XEYA 4USDA 3R9RA 5M06A 2YA9A 4P90A 4AGCA 2WTCA 2X2KA 1EH4A 4V05A 4DG3E 3THBA 4OT6A 3ID6C 2VX3A 1B38A 3ORNA 4RWKA 5CU2A 1IEPA 3IW5A 2BAJA 2YHVA 4O0VA 3LLTA 4AOIA 3N4TA 4IANA 3ULZA 3V51A 4MXYA 4L01A 3SKCA 4IH8A 4XP2A 5AUUA 3D7ZA 3KVXA 1OVEA 4QTAA 3R30A 3UMXA 5IQGA 3OEZA 3W2SA 4D2TA 2CMWA 4EWQA 4USFA 3KRLA 3ZC6A 3V5TA 2HK5A 2HYYA 1H1PA 4HGSA 2UZBA 1OBGA 3G5DA 3DZQA 4JJRA 5EQEA 3LFSA 5JSMA 5F94A 3KRRA 3VUDA 1XBBA 4G1WA 4LGGA 4FUXA 1VZOA 3BE2A 2OZAA 5GJGA 5TKDA 4U8ZA 3SHEA 4E6CA 3HMNA 5J9ZA 5LWNA 4IB1A 5AIRA 4AS0A 3IKAA 3E63A 5F20A 5HX8A 2XKDA 5HG8A 2ITTA 3R1YA 4MD7E 4BHNA 5AUYA 2JIVA 4DFUA 3FL4A 4L8MA 3ZXZA 4FOBA 4ANBA 3BCEA 5IMXA 3G90X 3R1QA 4GG5A 1M2QA 4RFZA 5ANGA 4J97A 4F63A 2QURA 3R2BA 4Y95A 4CTCA 2HWOA 4U79A 3KFAA 5AV1A 5IZFA 4A06A 3D5UA 4EH4A 5CF4A 2FUMA 1B39A 4WT6A 5ETAA 5FGKA 5AAEA 3ZUUA 2PVYA 4AG8A 5LMKA 3IPHA 3R8MA 4NJDA 3HGKA 1GNGA 2OXYA 4IAAA 3TNIA 4F7NA 5L2IA 1SVEA 3MVLA 2R3JA 2VTAA 2OIDA 4YC6A 5FM3A 4DFBA 3LFEA 2ZJWA 3OT3A 4YPSA 2Y4PA 3PJ2A 3EQDA 4ZTLA 3PE1A 4M68A 2QR8A 2E9NA 3BHVA 1JOWB 3CY3A 2WU6A 1OECA 2ZB0A 5CEPA 1MRYA 1DM2A 4S30A 1V0OA 4ZSLA 4BBEA 4LRKA 5L2WA 4U43A 4HJOA 4UXLA 5AIKA 1LP4A 2BR1A 2RFDA 5HTCA 3QUEA 2PVLA 4TYGA 4IX3A 4FIEA 4O1OA 4S34A 5CU0A 3EH9A 1Q8ZA 3QCXA 4GMYA 4LM5A 5HO6A 4DFLA 5IQDA 4TWPA 1U4DA 3SD0A 3VJOA 3VW6A 3JS2A 3I4BA 4LUEA 5L6OA 5GHVA 3A2CA 4EWHA 1WBVA 2EWAA 2ETMA 2XK8A 4DHFA 3NW6A 1Q24A 3PZEA 4M12A 5ETCA 2IZSA 3COMA 3HL7A 1SMHA 2UZNA 4ALVA 2VN9A 3QZIA 3W2CA 4IX5A 2X39A 4PF4A 4HZSA 4FTCA 1LEZA 4LV5A 3TJCA 3PP1A 4FICA 3OEFX 4UMUA 3IGGA 4RIXB 5KKRC 1W0XC 5AP6A 3GC7A 3UVPA 3ZUVA 2UW3A 3MN3A 4LL5A 4FV9A 4E4MA 4APCA 4X6QC 4CKIA 2WOTA 3GENA 2VWXA 1Q41A 3F5GA 5J8IA 4G31A 4AGDA 3LM5A 1PXPA 1B6CB 2O2UA 5IH6A 4E7WA 3C7QA 4FZ7A 3ETAA 2RIOA 3AMBA 3PRIA 1ZMWA 4IWDA 4M14A 4MKCA 3UC3A 4C3FA 4BDIA 3NIEA 3UJGA 3ZSIA 1XKKA 1ZZLA 5HG7A 4PTGA 4EBWA 3GVUA 2B9FA 4BKJA 5CASA 5KO1A 5ACBC 2B0QA 3QHRA 4O83A 3VBXA 1PF8A 4DH3A 1ERKA 4O0YA 1OPJA 5CEQA 5I5ZA 4FTLA 3MH3A 2QOIA 4DG2E 4NCTA 1H24A 4FT9A 4JOAA 5AEPA 1WVYA 3COKA 3NUAA 4F99A 5IA5A 2UZVA 4PMTA 3R21A 5FEEA 1JKTA 3MH1A 2PZRA 5L2TA 4ANNA 3RZFA 3QRUA 5M09A 4FIGA 3FDNA 2JLDA 3A7GA 5LMAA 2HY0A 4Y83A 4BCKA 4F1TA 4HW7A 5F1ZA 4A9TA 4ZZMA 3HMMA 1LUFA 5HORA 3AMAA 4EOOA 4RJ6A 2BCJA 2IG7A 2ITWA 3ENHA 5EOLA 5IA2A 2OH4A 3JVRA 4FTRA 4CFNA 3OTUA 5IQFA 1IASA 3TNHA 5KKRB 3JYAA 2PSQA 5EDRA 4FK6A 3KCFA 3O96A 2YJRA 4LOOA 4HOKA 4R5YA 4ACDA 3GXLA 3MTFA 5ITAA 4DGGA 2XEZA 5M4FA 2JKOA 2VGOA 5HICA 2RFEA 4DE4A 3CY2A 5FTQA 4DGLC 3QRKA 3LW0A 2R9SA 2ERKA 1YI6A 3PP0A 4IVDA 4C35A 3BEAA 3QTZA 4GFGA 4WNKA 3LJ0A 3QRIA 3AT4A 4G5JA 1UV5A 2X0GA 4BDDA 3NNUA 4LRJA 4EEVA 1CTPE 3RAKA 5B2LA 4L9IA 3KULB 1XH9A 4QP6A 3UP7A 1YHSA 2R0UA 3QUPA 4U5JA 1R1WA 4X6RA 1AQ1A 3OT8A 4FKVA 3ORMA 2W4JA 3GU6A 1XQZA 4V01A 4EK5A 3TL8A 1Y6AA 1ZY5A 3PPKA 3SRVA 4EOPA 4GRBA 5A54A 4RZVA 3LVPA 2B9HA 3PJCA 4Q5EA 2VO3A 3WF6A 5BMMA 4PQNA 2Z8CA 2BROA 3TNWA 3ZU7A 3D15A 5DEYA 4RWJA 4BCPA 4DYMA 3R28A 2OFVA 3AT3A 5E8WA 5L6WL 4BGGA 2RKUA 2Q0BA 3FI8A 2CCIA 2C68A 3HA6A 4MXAA 4KRCA 1JSUA 4QTDA 3VS1A 3ZSGA 2R3RA 3A99A 4RVKA 3ZRLA 4L3JA 4FODA 3V5QA 1W84A 3TG1A 2AC5A 2F2UA 4D58A 3G51A 2JIIA 2WTDA 4F9BA 2W5BA 3HNGA 2OSCA 4L45A 4PPAA 3EYHA 3GCSA 1JVPP 3UOKA 3FC2A 4AX8A 4GCJA 2ZM3A 3Q2JA 3LFBA 3FHRA 3OC1A 2XF0A 4M69B 4P7EA 4ZLZA 3PVUA 4FKJA 2BHHA 4QMLA 1ATPE 3BQRA 4FMQA 1A06A 4FTIA 3U6IA 4ZMFA 4IAKA 4EZ7A 3H9OA 4LMUA 3EQPA 2PZ5A 3WYXA 5AX3A 1WBOA 3RAHA 4MWHA 4MXXA 3I1AA 4PUZA 4ZY5A 4FGBA 2EXCX 2QOOA 2Z7RA 1BUHA 1DS5A 3E8EA 2HZ4A 4HZRA 4L52A 5EI2A 2W1EA 4M7IA 4YTCA 1YI4A 2WTVA 4NW6A 3U55A 3L9NA 2VU3A 3OWKA 1JNKA 1J3HA 2Z60A 3PY1A 2B9IA 4TN6A 4F1OA 4D2PA 1WZYA 1Q3DA 4HGEA 4TWCA 2XYNA 3DB8A 3G6HA 2EXMA 5KZ0A 1J91A 3I5NA 3BWFA 1YWNA 5AWMA 4DGMA 1PXNA 4FT3A 5HIBA 3UTOA 1LEWA 4E8AA 4P2KA 1GOLA 4NFMA 4FKSA 3FZ1A 3EIDA 1E1VA 2ERZE 2R5TA 4I93A 3VBYA 3ZO4A 4E5WA 5KHXA 3UOLA 4D2SA 4XOZA 4WUNA 3V6RA 3E5AA 5CQUA 4EH8A 5K4IA 2XK9A 4Q9ZA 4FIHA 4IX4A 3V8SA 3Q9XA 2WTJA 3MGYA 3L8VA 4CMTA 3DFAA 4OGRA 2IVUA 4ZSGA 3PSBA 4L44A 2IO6A 3C0GA 1ZYCA 2X6DA 1V0PA 4Q9SA 2GU8A 4YO6A 3ULIA 4IFCA 1ZY4A 3G0FA 1GAGA 1OPLA 5IUGA 4O7WA 3EQGA 4H1MA 1XH8A 2X6EA 4C7TA 5E9EA 5AP5A 5AP3A 3LCOA 3R0TA 3D7TA 3GCVA 4O0UA 2J6MA 5LOHA 2WO6A 4Y5HA 5IU2A 4XV2A 2CNVA 3CQUA 2CLQA 4KA3A 2X8EA 4WRSA 4KAOA 4B8LA 4NK9A 2JBOA 4Q2AA 3CTJA 4R8QA 2HELA 4FKLA 2DUVA 4XUFA 3CE3A 3D4QA 2GS7A 4JG8A 2WB8A 1GJOA 3NMUF 4Z7GA 5HX6A 3IOKA 2XJ2A 2P2HA 4FI1A 1TQPA 4QP9A 4TYIA 1UU3A 3MS9A 4G6NA 4TWOA 3T3UA 3P7CA 3ZDUA 2HXQA 2XCKA 2CN5A 3FUPA 2G1TA 3MBLA 4O0RA 4DEIA 4FVRA 4DEGA 3TDWA 1K9AA 2PE0A 1KSWA 1I09A 2CHLA 2PVKA 3R2YA 3S2PA 1M2PA 2ITVA 2X4FA 3QTSA 3MVMA 2PE1A 3R8PA 3PSDA 3DDPA 3FLZA 4QP4A 4CNHA 4EUUA 3SAYA 4FA2A 2O3PA 2RG5A 3R04A 4NM3A 5HG5A 5AR5A 3PLAE 3FXWA 1UNLA 3BIZA 3CP9A 4DFXE 4RX5A 5IEXA 3UO5A 3RNIA 1UVRA 4BDGA 4O7SA 3CEKA 2QU6A 2R0IA 1NA7A 2YIXA 4A9YA 4B9DA 4FZFB 2Y8OA 5CTPA 4C4IA 1YQJA 4KIPA 3VS6A 2VTNA 2CGUA 5JFSA 4NIFB 1MP8A 3V8TA 5IEVA 4GK2A 1OIRA 4DEEA 4AW2A 4DT9A 4EI4A 2GQRA 3ZLWA 3BU6A 5KBRA 2VNWA 2G01A 3CTHA 1V0BA 4QTEA 2BRMA 3EHAA 5AADA 4UB7A 4PX6A 4FV2A 3CD3A 3E3PA 4C02A 3Q5ZA 4F08A 1YKRA 5CALA 4PTCA 4H3BA 3PZHA 3DK7A 4NTSA 3UVQA 4AA4A 5CEIA 2XNMA 3LXNA 4J99A 4AE6A 3O8PA 2Q83A 2C5VA 3E62A 4KRDA 4QOXA 3MJ1A 3O71A 3LCSA 3LE6A 2RFSA 3F3ZA 3PG1A 5CANA 3GU5A 2XIZA 5L8JA 3QALE 2WQMA 4WG3A 1H01A 4FT5A 4E93A 3I7CA 4GKHA 3QD2B 4OTRA 4WG4A 1F3MC 2J0JA 4FKGA 3W2OA 3R73A 1NW1A 1L3RE 3VS2A 4LI5A 3JR1A 1UU9A 3S00A 4I0RA 5J1WA 3FI4A 2R4BA 3HRFA 2FSOX 3FHIA 5EFQA 3C4FA 4RQVA 2C3IB 2PU8A 4K2RA 2V7AA 3PPJA 4FL1A 3DU8A 5L8KA 2H9VA 3IW6A 3QL8A 5KNJA 2X2MA 2J0MB 2W9ZB 5A6NA 1JBPE 4P5ZA 5T68A 4ANQA 2BZJA 4EYMA 4K11A 4PDYA 4M0YA 5HU9A 4IEBA 4BZOA 2GFSA 4IAIA 3FJQE 4C37A 2OJJA 4ALUA 3TZ7A 3PXZA 5JH6A 1ZXEA 2WU7A 3GI3A 5E92A 5HCZA 4C2VA 1CDKA 2B55A 4FSUA 5JT2A 2W1GA 3GC9A 3EB0A 4G3DA 3LXKA 4ITHA 4QMMA 3W8LA 4JG6A 4AP7A 3OMVA 3F6XA 3EKNA 4N6ZA 4AA0A 4ZLYA 2BDJA 2OG8A 4JBPA 3U6JA 4EQUA 1YXVA 4RFYA 4UALA 3ZCLA 4B99A 4I6BA 3ZS5A 4KBAA 1KV1A 1Z9XA 3PWYA 4K0YA 1H8FA 1ZYLA 4K8AA 4ZAUA 1Q99A 2WQNA 3V5WA 1CKIA 5FG8A 5B0XA 5KMIA 2J2IB 3JVSA 5A4CA 3QBNA 3QHWA 4F7JA 4AOTA 3GOPA 2C0TA 4CTBA 2XYUA 4M0ZA 4I21A 1MUOA 3VUKA 2W1HA 1H25A 4I0SA 4AT5A 4FSWA 4AZWA 4NSTA 4QMSA 5JN2A 3F5XA 3QA0A 4FYOA 3LJ1A 4TPTA 3BLHA 4L7SA 5IUHA 2C6DA 3BGQA 4IWPA 4ZSEA 3U9NA 4LGDA 3GP0A 1F5QA 2B52A 3R9OA 4GYGA 3UOHA 3HP5A 4IFGA 5ANJA 5H9BA 4H36A 2BDWA 2PWLA 3SW4A 4ZJJA 4CGAA 5CWZA 1FVRA 3RGFA 3NUUA 3O2MA 4F9WA 5HZNA 3SG8A 1JLUE 4E1ZA 1QPJA 4IAZA 3NLBA 2OLCA 4FSQA 3PE2A 3RHXA 4XG9A 3C51A 3NEWA 4UMQA 4BCIA 1JSVA 2XBJA 3UC4A 3R8LA 4DBXA 2X7GA 4HYIA 4USEA 4RJ4A 4BDKA 2ONLA 3EZRA 3HX4A 2IW6A 1ZAOA 2Z2WA 5EH0A 3RVGA 3NUNA 3V5JA 5HD4A 3S1HA 3LFQA 4AN9A 3ZDIA 4MXZA 3KK9A 4YJTA 1ZARA 5CZHA 4H3QA 1Y8YA 5FXRA 3UOJA 1IAHA 5E91A 1QPCA 5L6PA 2F2CB 4V0GB 5DE2A 2YN8A 4X3JA 2C30A 4DAWA 4FEWA 3C4EA 3PLSA 4RC3A 5HNIX 1UKIA 4IVAA 4CV8A 2OF2A 3R7EA 4C34A 4FV0A 5GIPE 4XP3A 2GNFA 2I40A 5KMLA 4GFMA 3ORTA 2IJMA 3VRYA 5FDPA 3Q4TA 5LWMA 4DN5A 2Z7QA 3HECA 4RIOA 4KWPA 2C3LA 3DNEA 3ZLSA 4C57A 2PPQA 5IA3A 4BVUA 5CQWA 4IZ5A 3WI6A 3E64A 1S9IA 3KXXA 3NYVA 3AG9A 3F66A 5B2KA 3OS3A 2QOHA 2BKKA 5M57A 3F7ZA 2I0EA 4QQJA 4DEDA 4NFNA 1XH4A 3QCSA 5HNGA 2W4OA 4AXAA 5DYJA 5DNRA 3N9XA 3ODYX 4CFVA 5CNNA 1WBWA 5H3QA 4J95A 4G34A 4YZMA 4GT4A 4D55A 5J5TA 3UIXA 2ZV8A 4WD5A 3WILA 2UUEA 4AE9A 4CSVA 4DFZE 5B7VA 1L8TA 2QI8A 2V55A 3RINA 4NKSA 5HTBA 4X7QA 5E90A 4WRGA 2B7AA 3O51A 5FM2A 4MBIA 3W10A 5E8YA 1OB3A 2OIQA 4EHGA 2XUUA 5BUJA 5EKOA 3ZM9A 2YFXA 3DT1A 2BILB 2YLFA 4A4XA 1ZMVA 3FKOA 3PIXA 3R6XA 5IKWA 5CXZA 5FBNC 3SG9A 4JVGA 2XNGA 3QTUA 2XS0A 5DVRA 3K3JA 4ZP5A 3D5VA 3EFLA 3HEGA 3DJ5A 1XH5A 3MFSA 4F4PA 4UBAA 2VWZA 3AC4A 4RQKA 3PTGA 3OY1A 5EQPA 4TNDA 4QMYA 4L46A 1KOBA 1P14A 3KB7A 4A4LA 4C4FA 1NVRA 1JKSA 2R3HA 1PMEA 4RG0A 4A07A 4NM0A 1J7IA 4PDPA 4W8DA 1G8SA 5I9VA 5HE1A 1XO2B 4EK6A 4JIAA 3V01A 2UZLA 3QTXA 4UMPA 4GKIA 2W99B 4QP1A 3CGOA 4UMRA 3B8QA 1PY5A 2GNGA 5I9XA 4IIRA 2IZRA 3NYNA 4ZY4A 2RGPA 3F2NA 4JQEA 3S95A 1JKKA 3TIZA 4HVIA 5FRIA 5AAGA 1KUTA 3DKOA 2H6DA 4LOPA 2I0YA 4I22A 3DDQA 4RX7A 4BKZA 2IW8A 3BLRA 4FUYA 3SXFA 4HVDA 4TYJA 5FQDC 3BPRA 2B53A 5LVOA 3K54A 3QQJA 4JX7A 4CQEA 4F64A 5HEZA 1OGUA 5AR8A 4YTFA 4UWYA 4BWXA 2R3IA 2QLUA 5E4HA 1BI8A 4CRSA 2J90A 2NO3A 2WTIA 3OP5A 4HVHA 3DJ6A 1XBAA 4U3YA 3R8UA 5KMNA 4RVTA 4AWIA 2Z7SA 4R3RA 3WYYA 5HVYA 1YOMA 3FEGA 3Q96A 2J7TA 3VUHA 4AW1A 4D0WA 3I6WA 1H1WA 3VRZA 4BIBA 3W8QA 3A7HA 3CGFA 3NDMA 3QTRA 5AR4A 4DLJA 5C4LA 2A2AA 4OTFA 3R01A 5H2UA 1PXLA 4L53A 4QRCA 4YSMA 4TYHA 4O0WA 1Q8TA 5KMJA 5D12A 2V7OA 3V6SA 3PVGA 2Y4IC 4PP9A 4BL1A 5EYCA 2Q0NA 5CSPA 3CSVA 3ZRMA 3UMWA 3KXGA 4FTOA 3ROCA 3LMHA 5C1QB 3D7TB 2OF4A 2JKKA 4R6VA 3U87A 4EKKA 5HVKA 1PKGA 3PXYA 2PMOX 2CLXA 3UODA 5J7BA 4CG9A 2RFNA 4Z55A 4O82A 4JS8A 1U59A 4MD8E 2XIXA 5EOBA 2KULA 3FQEA 3ZFYA 3TZ8A 1IRKA 3QQKA 2W5HA 5EK7A 2W1FA 1URCA 3VQUA 3RPSA 4D0XA 4KSPA 4NW5A 5B2MA 3KQ7A 4CFXA 1ZZ2A 4OBOA 2VWWA 3WIGA 4I6HA 2WMAA 1RW8A 5FWKK 5BNJA 2ITQA 5HOAA 4G3CA 3TWJA 3R9NA 3Q9YA 4FNWA 3R1NA 3FE3A 5EKNA 4TKSA 2OJFE 4R5SA 5CAPA 2YZLA 2P55A 4Z16A 3GQIA 4EC9A 1Z57A 3SXRA 3UDBA 5AP0A 2BIKB 3O23A 2FH9A 3JPVA 1FBNA 4GK4A 4MQ1A 2YWPA 3QKMA 3N51A 4KABA 5A46A 5I9UA 5C03A 3ZO1A 2NRUA 4RFMA 3LOKA 3L1SA 3CS9A 3QFVA 3HV4A 2PUPA 1PXJA 2R3QA 4HPTE 5KCVA 2VV9A 2E9OA 4AUAA 4GH2A 4MCVA 5JK3A 4ZSJA 3DQXA 1R39A 2HZ0A 4I41A 5DRBA 5GNKA 2VTIA 3SGCA 5IUIA 2Y4IB 5CEMA 1KV2A 5CS6A 4AFJA 4BR3A 3ERKA 4D2VA 3GNIB 4GIHA 2NRYA 3EN6A 2YERA 3PPZA 4FV1A 4DF3A 2C6TA 4XYFA 4BIDA 4U97A 5HG9A 3DY7A 4S2ZA 1PJKA 2E9PA 5CENA 2UVZA 3PA3A 4X2FA 3RCJA 2ZB1A 5CU4A 5L4QA 3OXTA 2UZUE 3GEQA 3IW8A 1GZNA 3GT8A 4R78A 5E8UA 3RPVA 5AP4A 3BBWA 3DKCA 4R1YA 4E26A 3MSSA 3NUXA 3MTLA 1FINA 1JWHA 4G2FA 4XG6A 3W32A 5IQHA 3QGWA 3PA5A 2GNHA 2Y0AA 4EHVA 2PK9A 5AUTA 5M44A 5E1SA 4O7NA 5IH4A 4KS8A 3IONA 3ENMA 5BVWA 5IQCA 2BALA 2VO7A 3L9PA 4QPMA 2WMSA 4MXOA 3NIZA 3EN9A 4O96A 4AA5A 4QQ5A 3DOGA 4N70A 5HE3A 5LVLA 5EW8A 3OZ6A 4LV8A 5HCYA 3T9IA 4BCJA 3RK5A 4DCAA 4F65A 2UW7A 4EH7A 3SVVA 2ITUA 2X8IA 3PY0A 3RMFA 3TKHA 3VULA 3TZ9A 3W2RA 3M11A 5L8LA 3F5UA 3VS4A 4FV4A 1IG1A 4R3PA 4ANMA 2PMNX 4CMUA 1WVWA 1UWJA 2VO6A 3C5UA 3CJGA 1Q5KA 2R2PA 4QMVA 1H27A 2PYWA 1H0VA 2BAKA 1WFCA 2BFXA 5FP6A 5AUVA 4ASDA 4CLIA 2NP8A 4OBQA 3PFQA 4K6ZA 4BI2A 4ZS0A 3R7YA 4XJ0A 3I0OA 4EORA 2WMRA 2GMXA 3MFTA 4EK4A 1PRYA 4AGWA 5D9HA 2C3KA 3P9JA 4H58A 4E20A 3UP2A 4KBKA 3EQHA 3OUNB 5GZ8A 2ITYA 4QMPA 3ZH8A 3BHYA 4ENXA 3QU0A 3Q6WA 4WA9A 4D2WA 3CXWA 4IHPA 4OTWA 5IPJA 2BZHB 2ESMA 4DINA 2QOFA 4NH1A 5A3XA 2G2HA 2GNLA 2XB7A 2OFUA 4RJ7A 3P1AA 3BBTB 3HMPA 3Q5IA 4QYFA 2VTJA 4YHJA 5D11A 2QOCA 4E5BA 5AV3A 3TZMA 5D1JA 1P5EA 2PMIA 4U81A 3DS6A 5F95A 5IH5A 5D7VA 3VAPA 1ZOGA 3C0IA 3FY0A 4JXFA 1OKYA 5AUWA 3EFWA 5TR6A 4FE2A 3KREA 5CZIA 4F7SA 5IQIA 1JSTA 4PV0A 2PUNA 3HUBA 3CC6A 2V22A 3E8DA 3NS9A 2XIYA 4OLIA 2WEIA 4O27B 3FI3A 5DIAA 2VWUA 2WMBA 4MNFA 3VBQA 4PMPA 3AD6A 5DT0A 3CQEA 4NM7A 2PULA 3LFAA 3QWKA 4ACMA 3KF7A 3OFMA 4X2NA 5E8ZA 5I4NA 2BIYA 1PKDA 4AZEA 2W4KA 5BVNA 2IVSA 1Q4LA 2F7ZE 4H3PA 1SM2A 3RTPA 3Q4UA 3BV2A 4D28A 1DI8A 1Q8YA 1GZOA 2DYLA 3PVWA 5EYKA 2X9FA 1UNGA 4QYYA 2QOLA 1QMZA 2CKEA 3O7LB 2BRNA 4RRVA 1BI7A 2O5KA 3NYOA 2W7XA 3F2RA 4YLKA 2XIRA 2XZSA 3F9NA 3QD3A 4D9TA 2F57A 4I4EA 3F3WA 1MQBA 3AGLA 1KE7A 3I6UA 5K3YA 4B8MA 3Q32A 5IQBA 1M7QA 4IC7A 2WXVA 2UW5A 4OT5A 4B7TA 3BWJA 3HZTA 2YIWA 5LQFA 3A7FA 3NAYA 3BE9A 2H96A 3R7VA 5E8SA 5LVPA 3ZZWA 3KMUA 3PWDA 5J5SA 4MK0A 2QG7A 2CKOA 1V1KA 1IAJA 3KRJA 2WELA 2CDZA 4C8BA 2IWIA 3HV6A 3SOAA 4IM2A 3DLSA 3V5LA 2YDJA 5C8NA 4O7ZA 3SV0A 3CBLA 4EYJA 3PXKA 3PJ3A 1BL7A 1KOAA 1SYKA 5GZAA 3OW4A 5LJJA 5EYDA 1U54B 5EHYA 3E3BX 3CR0A 4XLIA 1I44A 4EOLA 3JY9A 2YCSA 2YLEA 4FTAA 3O17A 4DCEA 5JZJA 3D83A 2REIA 4FKPA 4IX6A 4QMTA 3RALA 3RP9A 4AT4A 4QQCA 3C0HA 2ZDUA 3TKIA 1H07A 4JR3A 1M7NA 4JBVA 2R3NA 3Q4ZA 4LQMA 3TV4A 1OL1A 5IA4A 5CAQA 1H28A 1Q8WA 4JG7A 3VS5A 3LAUA 4BICA 3AXWA 4EOQA 4J52A 3KXNA 2GCDA 4MAOA 4QP7A 1OL2A 3ORXA 3D2IA 2ITPA 2HOGA 3BRBA 3VUIA 5ETFA 3Q2MA 5DEWA 3FKLA 4DA5A 5EHOA 3P7BA 2YCRA 1WBNA 4YJRA 1JKLA 3UE4A 3W55A 2JGZA 4XV3A 2NPQA 3FLSA 4QTBA 4W8EA 4EOIA 1OKZA 3BHUA 4L00A 3V5PA 2XKEA 4CMOA 3QRTA 4LUDA 3UG1A 2O0UA 3UNZA 3LLAA 3VS0A 3C4WA 5ANIA 2C47A 4KSQA 3I7BA 4Y72A 5BYZA 2PL0A 4UX9A 2XKFA 1MRVA 2PVRA 4X2JA 2PMLX 3II5A 4XG8A 5AA9A 4FG7A 5HO8A 4FNZA 5BPYA 3KN6A 4FEUA 1BLXA 4IJ9A 3Q3BA 4PTEA 4QNYA 4TWNA 4TW9A 4ANOA 1ZMUA 4ENYA 4ZTQA 3R7UA 3KXMA 1BL6A 4AACA 3PXRA 4ZSAA 4MBLA 4F7LA 2OBJA 3F3UA 3H4JA 5DOSA 1IR3A 3EQRA 4ANSA 5DI1A 3RWQA 4O2PA 1G8AA 4BY9E 3FZOA 2HZNA 4RJ5A 4D4YA 4MD9E 5JFVA 1Y6BA 3FWQA 1OM1A 4AFEA 2UV2A 4XV1A 4O7TA 5TO8A 4JI9A 3D5XA 4LMNA 4QMNA 5FUTA 3EN7A 4TXCA 3PSCA 2XJ1A 4NTTA 4IVBA 1W83A 1DAYA 4YSJA 5M51A 2C6MA 2WQOA 3KEXA 3H10A 2WFYA 5LCJA 1PMNA 2BRGA 4H39A 5E7RA 4DGOA 3FMHA 1YDSE 3T3VA 3WBLA 4HNIA 2LAVA 2GTMA 5HO7A 5IMEA 5M4IA 5AP7A 5HBHA 4YBJA 2F7EE 4PL5A 5KHWA 3WE8A 1YVJA 3QTIA 2CGXA 2QODA 3NUYA 1NVQA 5L2SA 3RKBA 3ATSA 5DGZA 5GJDA 3WOWA 4O7YA 4R7BA 4XG3A 3DBEA 4MVFA 1Y57A 3LFNA 2QVSE 4V04A 4F9CA 4EZ5A 2GDOA 2VTSA 4RIWB 4AQCA 4FTUA 4K1BA 2W17A 4BDBA 1PXMA 2YIRA 5DR9A 4WOVA 4X3FA 5HE0A 4BCHA 4KUJA 4YJQA 4BCQA 3QYWA 4TYHB 2P0CA 4TZRA 3MIYA 4GUBA 4EONA 4GIIA 2BHEA 3UQCA 1OKWA 2YZAA 3DGKA 3OG7A 3IDCA 3UZPA 3A4OX 3ALOA 3ZEWA 3U6HA 3D2KA 4QD6A 4RLLA 5D41A 2DWBA 1A9UA 4G5PA 4YZBA 5AFVA 1R78A 4JDJA 5J95A 4BHZA 1XWSA 5BYLA 1BKXA 2UZDA 2XM8A 3F3TA 3L8SA 3Q6UA 4GJ2A 4BDFA 2GQSA 1WVXA 2XRUA 3DV3A 3HKOA 2H34A 3GOKA 2Y9QA 2VTLA 2QHNA 5LMKC 2YACA 3MY5A 2OJGA 1HOWA 2PZPA 3LCKA 2ACXA 4BTKA 3RM7A 1TQMA 4ZK5A 1HCKA 2A27A 2X4ZA 3L9LA 4RC4A 5A4EA 5LMBA 3BV3A 3R9HA 3V3VA 3ZUTA 2YM8A 2XK7A 2ZAZA 5AM7A 4LFIA 4BWKA 5AV4A 2C5YA 4EH5A 3GFEA 4ITJA 4XRLA 2ZDTA 3G9NA 4M15A 1QCFA 5JQ8A 4UZDA 3ZBXA 3LIJA 5DRDA 3RBWA 4D1SA 4BKYA 5BQ0A 2J51A 5BYYA 2X1NA 2GSFA 4Q5HA 3TACA 4WKQA 2GTNA 3M1SA 2PTKA 4IB0A 5K5NA 2OZAB 4KNBA 1MQ4A 2YEXA 3OW3A 2W5AA 4M3QA 5CYIA 5DPVA 1ND4A 4BFMA 3D9VA 2C5OA 4X2KA 1BYGA 2ETKA 2VTHA 3DNDA 3TV7A 2ZMCA 4FV7A 3VN9A 1SVHA 4IMYA 3AT2A 4I5HA 4MYGA 3RK7A 3ZONA 3AQVA 3UO4A 2OO8X 3DKGA 1E9HA 3C4CA 3EOCA 2CKQA 1K2PA 4O6LA 1H0WA 2JEDA 4IADA 4XG4A 3R9DA 3Q4CA 4G6OA 2JDOA 3R02A 4IE9A 3VUTA 4YC3A 4YZDA 3E93A 2V0DA 2BAQA 5GIOE 4GEOA 4M97A 5EM7A 2QLQA 4N4SA 3Q60A 3AGMA 3MY0A 2CJMA 3BX5A 1Q8UA 4IWQA 4BC6A 5HBJA 5HLWA 2GNJA 5IF1A 5K0XA 1XBCA 4FKOA 3UZTA 4PY1A 5JKGA 2YDKA 5D10A 2XCHA 3UZRA 3CLYA 4D4RA 4IZYA 4BDHA 3M42A 3WF9A 4BDAA 4OAUC 3R63A 2IPXA 5LVNA 4KIQA 4EJ7A 2FA2A 2BDFA 3CPBA 3D14A 4AU8A 1OBDA 4YHTA 3DFCB 4IB3A 4RJ3A 3EN4A 1R3CA 4R7IA 4XV9A 2BPMA 1GIJA 2YDIA 1H4LA 4FV6A 4YTIA 2HENA 3QQGA 3HYHA 4L68A 4MNEA 5JGAA 2HW6A 2E2BA 2ETRA 4OTPA 1H1QA 4IDVA 3RCDA 3U9CA 4NCTC 2X7FA 4BIEA 3C1XA 2J9MA 1OIYA 3FYKX 3KMWA 2XH5A 3PRFA 3UG2A 3OOGA 3PDTA 3MV5A 4FK3A 1Y8GA 3COHA 4BCGA 1KE9A 4X2GA 5C8KA 1YXXA 3MI9A 3OUKA 5KMOA 5LXMA 4RC2A 4RWIA 1PHKA 4PL4A 4FT0A 1UU7A 3ZLYA 3D5WA 3L9MA 4FOCA 4AZSA 4QMUA 4M84A 3I0QA 3BU5A 1U5QA 3KK8A 4Y85A 3F82A 3FZSA 1PXOA 3LM0A 4FSZA 3MFUA 4RIXA 5BVEA 3ZEPA 4C33A 5DBXA 5IISA 3ZO2A 4YJVA 1J7LA 3NWWA 3E88A 3VUGA 3GQLA 4DG0E 2FB8A 4GUEA 3NW5A 1NT2A 4GFOA 5EW9A 4EL9A 2JFLA 2DS1A 2HCKA 4U7ZA 5FD2A 4CZTA 4D2RA 2C0OA 3KA0A 4O0XA 4PWNA 3ZRKA 4U0IA 1FPUA 3NNXA 3WZDA 2XNNA 4FX3A 3FQSA 3AMYA 1ZLTA 1YOJA 2VTQA 3F88A 4A9RA 5JZNA 3QD4A 3QQFA 5DT4A 4BDCA 4CYJA 2XP2A 2BFYA 1REKA 3ACJA 3Q9WA 3VJNA 2JDVA 3CPCA 5CVHA 2Z7LA 4S33A 1TKIA 4YNEA 4WSYA 3GC0A 4FGRA 3F2AA 3UIUA 4NKAA 4ZTRA 2OW3A 2QNJA 4XOYA 4E6AA 3NRMA 2QKWB 4ZZOA 1S9JA 3P5KA 5FTGA 5C26A 4YHFA 4U42A 3PYYA 3FY2A 3K3IA 4O2ZA 5J9LA 3IO7A 2J4ZA 4D9UA 4XS2A 3R8VA 4HYUA 5TF9A 3RZBA 2RG6A 2WIHA 2PHKA 2Y7JA 3QKLA 4FT7A 4L67A 4X21A 2R3FA 2X8DA 2W9FB 3R83A 4EH9A 3A7IA 3K5VA 2WQBA 3NCGA 4FNYA 1O6YA 2OXXA 1O6LA 2UVXA 4MTAA 4RLKA 1KE6A 3BEGA 3ZZEA 4WG5A 3UNKA 3UYSA 1JAMA 3DBFA 4I5PA 3VUMA 4UY9A 3UYTA 1NVSA 3QCYA 4WNOA 3U51A 3VS7A 4CLJA 3PVBA 1Q61A 4BDEA 3ORPA 3HMIA 2GHGA 2W0JA 3ET7A 5I3OA 5L2QA 4GT3A 4OAVB 5TE0A 3OBJA 3OXZA 2YISA 3POZA 1X8BA 2NNWB 3P0MA 3CKWA 2WIPA 4RA4A 1XJDA 3BYMA 4WNMA 5BVOA 4E6QA 4W4YA 4NJ3A 4U6RA 4A7CA 3DCVA 4KS7A 5FEQA 1GY3A 5HBEA 3K5UA 3TM0A 2B4SB 1YW2A 2GPHA 2ITZA 3KULA 4NT4A 5HD7A 4C59A 2WMVA 3EQCA 3PG3A 5J9YA 4JT3A 2Z02A 3KRWA 4J53A 3NSZA 3HUCA 4TRLA 5EDQA 4F9AA 3FMNA 4I6FA 4U9AA 5K4JA 4IZAA 3GCQA 3SRVB 4IJPA 3LKMA 4NZWB 1IA8A 1REJA 1F0QA 1Q97A 4JR7A 3EYGA 2WTKC 3TT0A 3WF5A 4ARKA 2I0HA 5I9WA 3QRJA 4DGNA 5J87A 3GCUA 3B8RA 2EB2A 3OOMA 3OXIA 3FMEA 3WIKA 3G2FA 1UA2A 2RF9A 3O7LD 4XLVA 1FGKA 4TT7A 2CGVA 2GNIA 3MA6A 3MDYA 3R22A 4II5A 3NR9A 2QONA 2WMTA 4L3PA 5GJFA 5CEKA 5E8XA 4Y73A 4ZXTA 4FC0A 5JGBA 4RBLA 4JBOA 4R77A 4KD1A 2P2IA 4C4GA 5DA3A 3NUPA 1J7UA 4O21A 2J0IA 2UZEA 2VWVA 1OMWA 2WPAA 2O8YA 4I94A 4BI1A 3MJ2A 2OU7A 2J0LA 4YLLA 5C9CA 1APME 4C3RA 4CXAA 5AAFA 4UWBA 2OXDA 3LXLA 5CSHA 4XBUA 2QU5A 3BYVA 5AV0A 3N4UA 1OIQA 2VUWA 2Y6MA 4ZZNA 4B6LA 4JNWA 2FGIA 3RM6A 4G17A 4K9YA 4CG8A 4KIKA 5E8TA 1WCCA 2J50A 3QLGA 2JKMA 2XMYA 4YR8A 4X3FC 4HVGA 4M8TA 4YJPA 4DFYA 5JGDA 2YIQA 3EMGA 4OUCA 3AC5A 3C50A 4RIYA 4YNOA 2F4JA 5AR2A 4ZEGA 5AJQA 3CD8A 4O91A 2WTKB 1NXKA 4A9SA 4JLCA 2QOBA 4FSMA 2OGVA 3VC4A 4D4VA 3F61A 1GIIA 3CIKA 3QC4A 4XNEA 4RVMA 5D7AA 5EW3A 4I5CA 3MA3A 3ZM4A 1TQIA 4DH7A 3POOA 2XIKA 4FR4A 4QNAA 1VYWA 2FSTX 2G2IA 5H8GA 1H08A 2YCQA 5AV2A 3C4ZA 5DT3A 4QYGA 3W33A 3DZOA 3FV8A 4YJNA 3VS3A 4CYIA 3DTCA 4ASXA 1OUKA 4BCMA 4CT1A 2YM6A 5FXQA 2C4GA 4ZTHA 3GCPA 4C62A 1YRPA 3LJ2A 5GZ9A 3B2WA 2E9VA 5F4NA 4F6UA 4YMJA 1QPDA 3BYOA 5DMZA 3UVRA 5LVMA 1JPAA 3A8XA 2PVNA 3E87A 1SVGA 1WBTA 4MHAA 5KE0A 3E7VA 4BRXA 2O63A 2XJ0A 3MWUA 4W9XA 3H9RA 2IVTA 2CGWA 5CF6A 3AC8A 2IZTA 2FSLX 3VBTA 3HRCA 1OL5A 4J71A 1H1RA 5CU3A 5AUZA 5M4UA 5C4KA 3LXPA 5DN3A 4RPVA 2YAAA 4J7BA 4MH7A 4X3FB 4YC8A 3R7IA 5G6VA 2XKCA 2YJSA 2IW9A 1FMOE 4HVSA 4JDKA 4EZ3A 2W96B 3MB6A 4ZS4A 2UW4A 2BMCA 4Y46A 3MESA 5HCXA 2YM3A 2X2LA 4FIIA 5DH3A 4CZYB 2P33A 4G16A 3DAEA 2ITOA 4X0MA 5FP5A 1CSNA 5HESA 3PIZA 2YM4A 5ANKA 3QF9A 4AF3A 4ZJVA 2VZ6A 3LQ3A 3I79A 5J7HA 4XH6A 4F09A 4BWPA 5DR2A 3OHTA 4CD0A 3FKNA 4BYJA 4DTKA 4E3CA 3VBWA 4JL9A 2YAKA 4CFUA 4PP7A 2GS6A 3GGFA 1OITA 5AR3A 4ONAA 4QMOA 4QYHA 3UPZA 5HLNA 2IVVA 3D0EA 5HQ0A 1YHWA 4MQ2A 5EDPA 4Y5QA 4EOJA 3KVWA 3QYZA 3O0GA 3DB6A 4GYIA 4FF8A 4RGJA 3KMMA 5AP2A 5EG3A 5EM5A 4FTNA 4IDTA 3TIYA 2AYPA 4ACHA 3AC1A 2ZOQA 4QYEA 4AZTA 4YP8A 3Q04A 4GW8A 3TNPC 5BMSA 3MIAA 4NIFA 3E8NA 3EFKA 4Z3VA 2W06A 4F9YA 2PUIA 1YHVA 5J1VA 4O0SA 5GINE 3QXOA 3V04A 3FMKA 3M2WA 1CKJA 4YLJA 4FTMA 4L7FA 3WF7A 3TCPA 5L3AA 1DAWA 4OTQA 5KZIA 3DBCA 3RPRA 3KGAA 3VIDA 5FTOA 1CM8A 1H00A 4PNIA 4FKIA 3QWJA 2YM5A 2A4LA 2OJIA 3OVVA 4C58A 3U54A 3RI1A 1ZWSA 3COIA 4RX9A 4IZ7A 3FMMA 1YXUA 4K77A 4KBCA 4NUSA 4PMMA 4J8MA 4XG7A 5EYMA 4APPA 5IA0A 3WZJA 2VX0A 4DITA 2OZOA 5BUEA 3R7GA 4BBMA 4DEHA 4EQCA 4BDJA 4EOKA 1YXSA 2BUJA 3DAJA 4RWLA 4YJUA 3VHEA 3C5IA 5DG5A 3BQCA 4OTIA 4AW0A 1O9UA 3MVHA 3BYUA 2EUFB 3LMIA 3ACKA 3Q52A 2C69A 2VTRA 3MPMA 4LG4A 2OICA 5DFPA 3QKKA 2C1BA 3MYGA 3N4VA 3UQGA 1OL6A 4GL9A 3TDVA 4YBKA 4ERKA 2C3JA 3UIBA 4AN3A 2O65A 3SXSA 4EHEA 1QPEA 4PNKA 4OTDA 2WMUA 4JAJA 4UV0A 4WBOA 5K9IA 4MEDA 2YWVA 5M07A 3DPKA 3QCQA 5AR7A 3TI1A 2YIYA 4MNEB 3FPMA 1VJYA 2VGPA 4JIKA 4Z9LA 1OI9A 4UZHA 4YZNA 5EM8A 5KUPA 4C4HA 4FTTA 4I3ZA 2W1IA 1WAKA 5CEOA 2C6KA 3FI2A 3IW7A 3IGOA 5CU6A 2V62A 4FSRA 4ASEA 4BF2A 2QD9A 3R8ZA 2GS2A 1E1XA 3KF4A 4IW0A 4DH5A 4E4NA 4U3ZA 1WMKA 2ONLC 4I24A 4UMTA 3W2PA 3ZLXA 3EQIA 1GZ8A 4LL0A 4NWMA 4O7VA 2ZM4A 4BCNA 4P5QA 2WTWA 5A4QA 1U5RA 2XBAA 3GBZA 3PA4A 2WQEA 3NGAA 4RMZA 3LQ5A 3H30A 3P79A 3WZUA 3VF9A 3HVCA 2CSNA 3BKBA 4HNFA 3PXFA 3L8PA 5HTIA 3BYSA 5I9YA 1Q62A 2B1PA 1DI9A 5HVJA 3IDBA 4O22A 1G3NA 3V8WA 2H8HA 3NX8A 4UXQA 5BX0A 2RSVA 4O86A 3OCTA 3VBVA 3ZMMA 3ZO3A 4O7RA 4AN2A 4GVAA 2GHLA 1MRUA 4GSBA 2JD5A 1VR2A 2EXEA 2YITA 5HKMA 5BVDA 3FC1X 4HPUE 4K33A 4U44A 1OL7A 4WHZA 1W98A 3EKKA 3MVJA 4ITIA 4PRJA 4EQMA 2UZTA 4HCUA 1PW2A 4JRNA 5FEDA 4U40A 4DEAA 3EJ1A 1RQQA 1HCLA 3FBVA 3UO6A 5HNBA 2Y6OA 4GV1A 3MB7A 3FMDA 3UGCA 4DH8A 2XRWA 2WNTA 3DLZA 3ORLA 1OZ1A 2UW6A 3A4PA 4GG7A 5ANEA 3VQHA 4J8NA 4FEVA 4F0GA 4AAAA 4O6EA 2OIBA 1QL6A 3ZBFA 4YZ9A 5IQEA 4BZDA 4XBRA 2IZUA 5DHJA 5A4LA 4H05A 1XH6A 2JIUA 2CN8A 4U80A 4PDOA 4ANLA 3JUHA 4RA5A 3OD6X 3KXZA 3FPQA 4ID7A 4V0GA 2R3LA 3IW4A 3PJ8A 4YZCA 4OBPA 4I4FA 4ORKA 5K5XA 2V5QA 3ZHPC 4JRVA 3HV3A 2HIWA 5CI6A 3FSFA 4UN0C 2YM7A 1W82A 5T3QA 1SNXA 2VX1A 4P4CA 2FVDA 4OTGA 1GIHA 1LPUA 3A7JA 4OW8A 3ELJA 5ETIA 3BGPA 2QQ7A 3ALNA 3Q9ZA 2VAGA 3SX9A 4YU2A 2J0KA 3T8OA 3QX2A 4IWOA 4IB5A 4UWCA 3NVKI 3ZTXA 4D1ZA 3DXNA 1OIUA 1XR1A 3NNVA 5IDPA 2P4IA 4IXPA 2HXLA 1UNHA 2WMWA 3MH0A 3TNQB 3G33A 4NEUA 5ANDA 5C27A 4TL0A 4BGHA 1KE8A 4QP3A 4XHKB 5A14A 2ZV9A 4QMQA 3P08A 4F70A 1P4FA 3KKVA 4M66A 3UBDA 4C4JA 2JITA 3IS5A 4O81A 2QOQA 4KIOA 1SNUA 4AZVA 2PVHA 1BMKA 4QMWA 3HDNA 4JX3A 4KB8A 2PUUA 4E5AX 3FLQA 3ANQA 5IDNA 4JBQA 4L43A 3ZC5A 2CNQA 3LPBA 4YJOA 3VHKA 4BCFA 2WMQA 3BHHA 4AGUA 3EQFA 2G9XA 4WSQA 3ORKA 3VW8A 4BN1A 4I0TA 4L3LA 1RE8A 3QD0A 1M52A 3KN5A 4I1ZA 3EN5A 4FKUA 4YO4A 5A4TA 3BHTA 2BTSA 3P7AA 1YXTA 2C5XA 4YGAA 3ZFXA 2BRBA 3NPCA 2EU9A 2R64A 3GU8A 4FZ6A 3LMGA 4EOMA 4WIHA 4CVAA 2I7QA 3BLQA 3D94A 4FKQA 2CCHA 4G3EA 4YTHA 1K3AA 2JFMA 3CTQA 4C0TA 5JQ5A 3PXQA 3IECA 3KRXA 2OK1A 4JDIA 3S4QA 3SQQA 1ZRZA 4FEXA 2C6IA 2KTYA 3AD5A 3NW7A 4L42A 2W1CA 3CKXA 4EH3A 3KY2A 4HGTA 4AT3A 4KIKB 3UQFA 3EL8A 4ACGA 3BI6A 4CFFA 3FXZA 3DKFA 4KKEA 2C6LA 3RAIA 5M53A 3A61A 3FZPA 2C5NA 3QQUA 4OTHA 4BTJA 5CAOA 4W4WA 4GK3A 2VNYA 4RIYB 2XVDA 3WARA 4BB4A 3G9LX 4RJ8A 1PMVA 3F3VA 2ZMDA 3QZFA 4A9UA 4O84A 2XK4A 3FLYA 2W1DA 3IQ7A 5HHWA 4BTFA 4PMSA 3GB2A 4EH6A 1AD5A 3NNWA 3PJ1A 3W18A 2VTPA 4F1MA 1CKPA 3HAVA 1W8CA 1H1SA 5E8VA 2QO2A 4XMOA 5BVKA 3EZVA 2ZV2A 2W05A 4WO5A 5CAVA 3BGZA 5CVFA 1PXIA 2HZIA 1GZKA 4F6WA 2YABA 4PDSA 2QKRA 4XEYA 3VWAA 3OCSA 3S0OA 3GUBA 4ZMEA 4GU6A 4EJNA 3LFFA 1FVTA 3BU3A 4IM0A 5JRQA 2DQ7X 4NM5A 5KX8A 3RK9A 3JXWA 4AOJA 4QT1A 3SOCA 2GHMA 2WMXA 1ZYDA 1WBPA 4QP8A 4FL2A 4ZJIA 1T46A 2R7IA 5HIDA 4RZWA 4L6QA 4YJSA 1UWHA 3C4XA 2R3PA 3HLLA 5CVGA 4BYIA 5BUIA 2AUHA 3DJ7A 2VWYA 1XHAA 3AD4A 4IC8A 5CF5A 4B4LA 2XNPA 2ITXA 1ZOEA 2HWPA 3NYXA 3R1SA 3U8WA 5CNOA 3BZ3A 4IBMA 1WBSA 2IN6A 4FSTA 4FYNA 2QR7A 3HP2A 4R7HA 3MFRA 4BGQA 2FSMX 2GFCA 3GC8A 4FBXA 2XK3A 5K0KA 3FXXA 2WAJA 3RPYA 2VWBA 2R3OA 4UYAA 3VNTA 3GU7A 4J96A 1PYXA 4CZUA 2FYSA 3A8WA 4QTCA 3LZBA 3LFCA 4G3GA 2CPKE 3E92A 4EC8A 4H1JA 2A0CX 2WD1A 5ANOA 5KMMA 4EHZA 5DLSA 3H3CA 4TNBA 2VTMA 4B0GA 1URWA 5IQAA 3I5ZA 4FL3A 4D5KA 3G6GA 1ZYSA 3LCDA 3QAME 2ITNA 3OWLA 3OBGA 4Z7HA 3HMOA 3ZYAA 3IOPA 1ZOHA 4FKRA 4XRJA 5AMNA 3K2LA 3AC3A 1VEBA 3P4KA 4A4OA 4RT7A 5DR6A 3QX4A 5CXHA 5I9ZA 1YDTE 4YPDA 3TUCA 2BKZA 4FV3A 4EK8A 4DT8A 1FVVA 5KBQA 1YI3A 3ZOSA 3TUBA 2FO0A 4XP0A 4S32A 5M4CA 2WZJA 3G15A 3G0EA 4U45A 3TV6A 1FMKA 5CSWA 4ASZA 2UVYA 4DH1A 4W9WA 3A60A 4G9RA 3OCBA 2R3MA 4M67A 4G3FA 4AW5A 5JFWA 3CCNA 4PPCA 2C6EA 1SZMA 2F7XE 2VTOA 3IK3A 4GJ3A 5JMSA 1ZYJA 3B2TA 2YCFA 1Q3WA 3SLSA 3RPOA 2GQGA 3PIYA 5EQYA 3PUPA 4QMZA 2G15A 2ZVAA 3MW1A 1YWRA 4FV5A 4ZTNA 3QQHA 2EVAA 3VVHA 4BZNA 4DFNA 2X7OA 3HDMA 4QMXA 4J98A 2CKPA 2UZWE 2I6LA 4MX9A 4AZFA 3F5PA 1RJBA 3CQWA 4FIFA 4IACA 5DWRA 2R3KA 3AC2A 4FG9A 4I5MA 4DEBA 5J79A 4NYEA 4ALWA 3JY0A 2XNOA 2F49A 3IG7A 4RVLA 5HGIA 5HE2A 2P3GX 1CMKE 4C4EA 2B9JA 5CT0A 3NUSA 4BCOA 2E9UA 4I6QA 2QHMA 3MH2A 4JQ8A 3SDJA 1G5SA 4YUQA 4ZTMA 5A6OA 1UU8A 3WZEA 2QOKA 3NZ0A 3RWPA 4E6DA 4DTBA 2OH0E 3KU2A 1PMUA 4U41A 3R7OA 2QCSA 4GT5A 3HAMA 4FTKA 4DTAA 2ZYBA 3E7OA 4O38A 5FXSA 4CT2A 3RAWA 5HIEA 4FSYA 2A1AB 4C36A 5IA1A 3OWPA 2QC6A 3DA6A 4CV9A 4KINA 3H9FA 3Q53A 4O0TA 3QC9A 3TTJA 3ZXTA 3QTQA 2JDTA 1BX6A 3SA0A 3DXPA 3RNYA 1NY3A 2PE2A 4LGHA 2PVFA 2F9GA 4HGLA 2OI4X 4KKGA 2JBPA 5M55A 4FTJA 3DBDA 3SC1A 1Z5MA 2UW8A 4HYHA 4TTHB 3HA8A 3OCGA 2UZOA 3QZHA 4WBBB 1OUYA 3EQBA 3HV5A 3QUDA 4GVJA 3RHKA 1Y91A 3LQ8A 4O7LA 3HRBA 5KMKA 4CCBA 1OPKA 2VWIA 3ANRA 4UEUA 5AM6A 2QO9A 4OR5A 4FKWA 3MPAA 3S3IA 4W4XA 3OWJA 3TKUA 3U4UA 3A62A 2XNBA 4NU1A 3QZGA 5AP1A 4N57A 4KKHA 4FVPA 5BVFA 3QLFA 3H0YA 4D4SA 4CCUA 2WEVA 3BELA 3FMJA 4CFMA 2J5FA 2PVJA 1M2RA 4F0IA 1R0EA 3FZTA 4UYNA 1T45A 4XX9A 3FLWA 4C61A 3P78A 4HCVA 4J1RA 5C8MA 5G1XA 2VTTA 1UKHA 3EL7A 2UW9A 2BTRA 4WUAA 3QA8A 2JDRA 5FLFA 4FVQA 4LOQA 2VRXA 2XA4A 3DK3A 3DQWA 3OF0A 1LR4A 3QQLA 3TN8A 4EOSA 4HYSA 1J1BA 3C13A 5CT7A 4TYEA 3R00A 3UIMA 2I1MA 3F7WA 3MPTA 3LCTA 4C3PA 4DBNA 2EB3A 3FSKA 1J1CA 4IQ6A 4FKTA 4BI0A 1TVOA 4G6LA 1U54A 2WHBA 5CX9A 3E8CA 4MF0A 2HY81 4G9CA 4XCUA 5JRSA 4R1VA 4Y8DA 2JAMA 1O6KA 2PY3A 5AA8A 2J5EA 3ATTA 4QPSA 5ACKA 4QPAA 3TTIA 5HU3A 4LRMA 1PYEA 5FDXA 4FSNA 4IM3A 1U46A 3L8XA 5CLPA 4EBVA 4QP2A 4MXCA 1A48A 3O8UA 4ZTSA 2X9EA 2WKMA 2LGCA 5LARA 2PVMA 4HCTA 5H8EA 4I23A 1R0PA 4DC2A 4EK3A 3SW7A 4JAIA 4QQTA 2W1ZA 2C6OA 2JKQA
chains in the Genus database with same CATH superfamily
3RJCA 3FQHA 4WNPA 2HAKA 3OROA 4PPBA 4E73A 1PXKA 2I0VA 2PZYA 1STCE 3DAKA 3EWHA 1OKVA 4I92A 3TUDA 4CKJA 4N6YA 4W4VA 4RSSA 2AC3A 4TY1A 2CNUA 3FMLA 4CKRA 2WOUA 4M69A 4F6SA 2XNEA 4MWIA 3KXHA 1RDQE 3C9WA 3QGYA 4I20A 3LFDA 3VO3A 3MY1A 4CQGA 4F0FA 5EHLA 2X0OA 1M14A 1KE5A 4ZOGA 3U4WA 3DTWA 4XG2A 3CJFA 3ITZA 3QTWA 3FZRA 4IAYA 5HLPA 2JAVA 3ZSHA 1FGIA 4BBFA 4EUTA 4FEQA 5ICPA 4C38A 4FG8A 4JQ7A 4RX8A 5IG1A 5JFXA 1XMLA 3REPA 2ZV7A 4ZIMA 3NVMB 4EH2A 1XH7A 2R7BA 2BVAA 3KC3A 3W1FA 3WZKA 5TT7A 1FOTA 4MF1A 5M56A 3WF8A 1P4OA 4AXDA 3UNJA 4M13A 1JQHA 1IA9A 1FQ1B 3H0ZA 3NCZA 5C01A 2A19B 3UPXA 4IAFA 3ZFMA 4K18A 3ORIA 3P86A 2OJ9A 3T9TA 4JDHA 3LHJA 3OTVA 2PZIA 4FNXA 4S31A 1P2AA 1YWVA 3AOXA 3OY3A 1M17A 4FZDB 4LYNA 2C0IA 5CY3A 4ZLOA 5AUXA 1KWPA 2WGJA 4R3CA 5TOZA 2QG5A 5IEYA 4MBJA 5CF8A 1XMMA 3O50A 1YOLA 5JEBA 2X81A 3HV7A 5EI8A 1H26A 3GFWA 3O8TA 2JDSA 3F69A 5FBOA 2SRCA 5E1EA 1YDRE 3P23A 4E4LA 3ML1A 5CI7A 1W7HA 4FV8A 3TEIA 4GS6A 4IVCA 3TJDA 4FTQA 3NAXA 3DBQA 2O64A 1AGWA 2VD5A 4GU9A 5CSVA 2XK6A 5A9UA 2QO7A 5H8BA 3ROYA 3WE4A 5EM6A 3TXOA 4D5HA 3FAAA 5EI6A 2VO0A 3FYJX 4QO9A 2BZKB 4BTMA 3EFJA 5LCKA 1VYZA 2JC6A 5M08A 4CFWA 4O1PA 3W2QA 3GU4A 2ZM1A 2OWBA 4DLIA 5F9EA 2OKRA 2XM9A 3FL5A 3KCKA 3W16A 4RIWA 2B54A 2BRHA 2HW7A 2UW0A 4CRLA 4ZY6A 4YURA 3ORZA 3DK6A 3DXQA 4N0SA 3R71A 2C1AA 3FLNC 3PY3A 4FZAB 4D1XA 4E4XA 4PL3A 5CSXA 4EKLA 2RL5A 3I81A 2G2FA 5I0BA 2BZIB 2R3GA 4FIJA 3KL8A 5T6KA 3QXPA 3IDPA 5HI2A 3I60A 5AX9A 4C2WA 3ODZX 5CAUA 5I3RA 4NL0A 3VF8A 4ACCA 4CEGA 2XEYA 4USDA 3R9RA 5M06A 2YA9A 4P90A 4AGCA 2WTCA 2X2KA 1EH4A 4V05A 4DG3E 3THBA 4OT6A 3ID6C 2VX3A 1B38A 3ORNA 4RWKA 5CU2A 1IEPA 3IW5A 2BAJA 2YHVA 4O0VA 3LLTA 3O5AA 4AOIA 3N4TA 4IANA 3ULZA 3V51A 4MXYA 4L01A 3SKCA 4IH8A 4XP2A 5AUUA 3D7ZA 3KVXA 1OVEA 4QTAA 3R30A 3UMXA 5IQGA 3OEZA 3W2SA 4BJJB 4D2TA 2CMWA 4EWQA 4USFA 3KRLA 3ZC6A 3V5TA 2HK5A 2HYYA 1H1PA 4HGSA 2UZBA 1OBGA 3G5DA 3DZQA 4JJRA 5EQEA 3LFSA 5JSMA 5F94A 3KRRA 3VUDA 1XBBA 4G1WA 4LGGA 4FUXA 1VZOA 3BE2A 2OZAA 5GJGA 5TKDA 4U8ZA 3SHEA 4E6CA 3BLAA 3HMNA 5J9ZA 5LWNA 4IB1A 5AIRA 4AS0A 3IKAA 3E63A 5F20A 5HX8A 2XKDA 5HG8A 2ITTA 3R1YA 4MD7E 4BHNA 5AUYA 2JIVA 4DFUA 3FL4A 4L8MA 3ZXZA 4FOBA 4ANBA 3BCEA 5IMXA 3G90X 3R1QA 4GG5A 1M2QA 4RFZA 5ANGA 4J97A 4F63A 2QURA 3R2BA 4Y95A 4CTCA 2HWOA 4U79A 3KFAA 5AV1A 5IZFA 4A06A 3D5UA 4EH4A 5CF4A 2FUMA 1B39A 4WT6A 5ETAA 5FGKA 5AAEA 3ZUUA 2PVYA 4AG8A 5LMKA 3IPHA 3R8MA 4NJDA 3HGKA 1GNGA 2OXYA 4IAAA 3TNIA 4F7NA 5L2IA 1SVEA 3MVLA 2R3JA 2VTAA 2OIDA 4YC6A 5FM3A 4DFBA 3LFEA 2ZJWA 3OT3A 4YPSA 2Y4PA 3PJ2A 3EQDA 4ZTLA 3PE1A 4M68A 2QR8A 2E9NA 3BHVA 1JOWB 3CY3A 2WU6A 1OECA 2ZB0A 5CEPA 1MRYA 1DM2A 4S30A 1V0OA 4ZSLA 4BBEA 4LRKA 5L2WA 4U43A 4HJOA 4UXLA 5AIKA 1LP4A 2BR1A 2RFDA 5HTCA 3QUEA 2PVLA 4TYGA 4IX3A 4FIEA 4O1OA 4S34A 5CU0A 3EH9A 1Q8ZA 3QCXA 4GMYA 4LM5A 5HO6A 4DFLA 5IQDA 4TWPA 1U4DA 3SD0A 3VJOA 3VW6A 3JS2A 3I4BA 4LUEA 5L6OA 2XAOA 5GHVA 3A2CA 4EWHA 1WBVA 2EWAA 2ETMA 2XANA 2XK8A 4DHFA 3NW6A 1Q24A 3PZEA 4M12A 5ETCA 2IZSA 3COMA 3HL7A 1SMHA 2UZNA 4ALVA 2VN9A 3QZIA 3W2CA 4IX5A 2X39A 4PF4A 4HZSA 4FTCA 1LEZA 4LV5A 3TJCA 3PP1A 4FICA 3OEFX 4UMUA 3IGGA 4RIXB 5KKRC 1W0XC 5AP6A 3GC7A 3UVPA 3ZUVA 2UW3A 3MN3A 4LL5A 4FV9A 4E4MA 4APCA 4X6QC 4CKIA 2WOTA 3TMOA 3GENA 2VWXA 1Q41A 3F5GA 5J8IA 4G31A 4AGDA 3LM5A 1PXPA 1B6CB 2O2UA 5IH6A 4E7WA 3C7QA 4FZ7A 3ETAA 2RIOA 3AMBA 3PRIA 1ZMWA 4IWDA 4M14A 4MKCA 3UC3A 4C3FA 4BDIA 3NIEA 3UJGA 3ZSIA 1XKKA 1ZZLA 5HG7A 4PTGA 4EBWA 3GVUA 2B9FA 4BKJA 5CASA 5KO1A 5ACBC 2B0QA 3QHRA 4QEBA 4O83A 3VBXA 1PF8A 4DH3A 1ERKA 4O0YA 1OPJA 5CEQA 5I5ZA 4FTLA 3MH3A 2QOIA 4DG2E 4NCTA 1H24A 4FT9A 4JOAA 5AEPA 1WVYA 3COKA 3NUAA 4F99A 5IA5A 2UZVA 4PMTA 3R21A 5FEEA 1JKTA 3MH1A 2PZRA 5L2TA 4ANNA 3RZFA 3QRUA 5M09A 4FIGA 3FDNA 2JLDA 3A7GA 5LMAA 2HY0A 4Y83A 4BCKA 4F1TA 4HW7A 5F1ZA 4A9TA 4ZZMA 3HMMA 1LUFA 5HORA 3AMAA 4EOOA 4RJ6A 2BCJA 2IG7A 2ITWA 3ENHA 5EOLA 5IA2A 2OH4A 3JVRA 4FTRA 4CFNA 3OTUA 5IQFA 1IASA 3TNHA 5KKRB 3JYAA 2PSQA 5EDRA 4FK6A 3KCFA 3O96A 2YJRA 4LOOA 4HOKA 4R5YA 4ACDA 3GXLA 3MTFA 5ITAA 4DGGA 2XEZA 5M4FA 2JKOA 2VGOA 5HICA 2RFEA 4DE4A 3CY2A 5FTQA 4DGLC 3QRKA 3LW0A 2R9SA 2ERKA 1YI6A 3PP0A 4IVDA 4C35A 3BEAA 3QTZA 4GFGA 4WNKA 3LJ0A 3QRIA 3AT4A 4G5JA 1UV5A 2X0GA 4BDDA 3NNUA 4LRJA 4EEVA 1CTPE 3RAKA 5B2LA 4L9IA 3KULB 1XH9A 4QP6A 3UP7A 1YHSA 2R0UA 3QUPA 4U5JA 1R1WA 4X6RA 1AQ1A 3OT8A 4FKVA 3ORMA 2W4JA 3GU6A 1XQZA 4V01A 4EK5A 3TL8A 1Y6AA 1ZY5A 3PPKA 3SRVA 4EOPA 4GRBA 5A54A 3AKLA 1W2CA 4RZVA 3LVPA 2B9HA 3PJCA 4Q5EA 2VO3A 3WF6A 5BMMA 4PQNA 2Z8CA 2BROA 3TNWA 3ZU7A 3D15A 5DEYA 4RWJA 4BCPA 4DYMA 3R28A 2OFVA 3AT3A 5E8WA 5L6WL 4BGGA 2RKUA 2Q0BA 3FI8A 2CCIA 4AXEA 2C68A 3HA6A 4MXAA 4KRCA 1JSUA 4QTDA 3VS1A 3ZSGA 2R3RA 3A99A 4RVKA 3ZRLA 4L3JA 4FODA 3V5QA 1W84A 3TG1A 2AC5A 2F2UA 4D58A 3G51A 2JIIA 2WTDA 4F9BA 2W5BA 3HNGA 4MUQA 2OSCA 4L45A 4PPAA 3EYHA 4AQKA 3GCSA 1JVPP 3UOKA 3FC2A 4AX8A 4GCJA 2ZM3A 3Q2JA 3LFBA 3FHRA 3OC1A 2XF0A 4M69B 4P7EA 4ZLZA 3PVUA 4FKJA 2BHHA 4QMLA 1ATPE 3BQRA 4FMQA 1A06A 4FTIA 3U6IA 4ZMFA 4IAKA 4EZ7A 3H9OA 4LMUA 3EQPA 2PZ5A 4O4DA 4O4BB 5AX3A 1WBOA 3WYXA 3RAHA 4MWHA 4MXXA 4DHZA 3I1AA 4PUZA 4ZY5A 4FGBA 2EXCX 2QOOA 2Z7RA 1BUHA 1DS5A 3E8EA 2HZ4A 4HZRA 4L52A 5EI2A 2W1EA 4M7IA 4YTCA 1YI4A 2WTVA 4NW6A 3U55A 3L9NA 2VU3A 3OWKA 1JNKA 1J3HA 2Z60A 3PY1A 2B9IA 4TN6A 4F1OA 4D2PA 1WZYA 1Q3DA 4HGEA 4TWCA 2XYNA 3DB8A 3G6HA 2EXMA 5KZ0A 1J91A 3I5NA 3BWFA 1YWNA 5AWMA 4DGMA 1PXNA 4FT3A 5HIBA 3UTOA 1LEWA 4E8AA 4P2KA 1GOLA 4NFMA 4FKSA 3FZ1A 3EIDA 1E1VA 2ERZE 2R5TA 4I93A 3VBYA 3ZO4A 4E5WA 5KHXA 3UOLA 4D2SA 4XOZA 4WUNA 3V6RA 3E5AA 5CQUA 4EH8A 5K4IA 2XK9A 4Q9ZA 4FIHA 4IX4A 3V8SA 3W0SA 3Q9XA 2WTJA 3MGYA 3L8VA 4CMTA 3DFAA 4OGRA 2IVUA 4ZSGA 3PSBA 4L44A 2IO6A 3C0GA 1ZYCA 2X6DA 1V0PA 4Q9SA 2GU8A 4YO6A 3ULIA 4IFCA 1ZY4A 3G0FA 1GAGA 1OPLA 5IUGA 4O7WA 3EQGA 4H1MA 1XH8A 2X6EA 4C7TA 5E9EA 5AP5A 5AP3A 3LCOA 3R0TA 3D7TA 3GCVA 4O0UA 2J6MA 5LOHA 2WO6A 4Y5HA 5IU2A 4XV2A 2CNVA 3CQUA 2CLQA 3AKKA 4KA3A 2X8EA 3NFFB 4WRSA 4KAOA 4B8LA 4NK9A 2JBOA 4Q2AA 3CTJA 4R8QA 2HELA 4FKLA 2DUVA 4XUFA 3CE3A 3D4QA 2GS7A 4JG8A 2WB8A 1GJOA 3NMUF 4Z7GA 5HX6A 3IOKA 3PUFC 2XJ2A 2P2HA 4FI1A 1TQPA 4QP9A 4TYIA 1UU3A 3MS9A 4G6NA 4TWOA 3T3UA 3P7CA 3ZDUA 2HXQA 2XCKA 2CN5A 3FUPA 2G1TA 3MBLA 4O0RA 4DEIA 4FVRA 4DEGA 3TDWA 1K9AA 2PE0A 1KSWA 1I09A 2CHLA 2PVKA 3R2YA 3S2PA 1M2PA 2ITVA 4ERWA 2X4FA 3QTSA 3MVMA 2PE1A 3R8PA 3PSDA 3DDPA 3FLZA 4QP4A 4CNHA 4EUUA 3SAYA 4FA2A 2O3PA 2RG5A 3R04A 4NM3A 5HG5A 5AR5A 3PLAE 3FXWA 1UNLA 3BIZA 3CP9A 4DFXE 4RX5A 5IEXA 3UO5A 3RNIA 1UVRA 4BDGA 4O7SA 3CEKA 2QU6A 2R0IA 1NA7A 2YIXA 4A9YA 4B9DA 4FZFB 2Y8OA 5CTPA 4C4IA 1YQJA 4KIPA 3VS6A 2VTNA 2CGUA 5JFSA 4NIFB 1MP8A 3V8TA 5IEVA 4GK2A 1OIRA 4DEEA 4AW2A 4DT9A 4EI4A 2GQRA 3ZLWA 3BU6A 5KBRA 2VNWA 2G01A 3CTHA 1V0BA 4QTEA 2BRMA 3EHAA 5AADA 4UB7A 4PX6A 4FV2A 3CD3A 3E3PA 4C02A 3Q5ZA 4F08A 1YKRA 5CALA 4PTCA 4H3BA 3PZHA 3DK7A 4NTSA 3UVQA 4AA4A 5CEIA 2XNMA 3LXNA 4J99A 4AE6A 3O8PA 2Q83A 2C5VA 3E62A 4KRDA 4QOXA 3MJ1A 3O71A 3LCSA 3LE6A 2RFSA 3F3ZA 3PG1A 5CANA 3GU5A 2XIZA 5L8JA 3QALE 2WQMA 4WG3A 1H01A 4FT5A 4E93A 3I7CA 4GKHA 3QD2B 4DDIA 4OTRA 4WG4A 1F3MC 2J0JA 4FKGA 3W2OA 3R73A 1NW1A 1L3RE 3VS2A 4LI5A 3JR1A 4I6LA 1UU9A 3S00A 4I0RA 5J1WA 3FI4A 2R4BA 3HRFA 2FSOX 3FHIA 5EFQA 3C4FA 4RQVA 2C3IB 2PU8A 4K2RA 2V7AA 3PPJA 3W0QA 4FL1A 3DU8A 5L8KA 2H9VA 3IW6A 3QL8A 5KNJA 2X2MA 2J0MB 2W9ZB 5A6NA 1JBPE 4P5ZA 5T68A 4ANQA 2BZJA 4EYMA 4K11A 4PDYA 4M0YA 5HU9A 4IEBA 4BZOA 2GFSA 4IAIA 3FJQE 4C37A 2OJJA 4ALUA 3TZ7A 3PXZA 5JH6A 1ZXEA 2WU7A 3GI3A 5E92A 5HCZA 4C2VA 1CDKA 2B55A 2IEWA 4FSUA 5JT2A 2W1GA 3GC9A 3EB0A 4G3DA 3LXKA 4ITHA 4QMMA 3W8LA 4JG6A 4AP7A 3OMVA 3F6XA 3EKNA 4N6ZA 4AA0A 4ZLYA 2BDJA 2OG8A 4JBPA 3U6JA 4EQUA 1YXVA 4RFYA 4UALA 3ZCLA 4B99A 4I6BA 3ZS5A 4KBAA 1KV1A 1Z9XA 3PWYA 4K0YA 1H8FA 1ZYLA 4K8AA 4ZAUA 1Q99A 2WQNA 3V5WA 1CKIA 5FG8A 5B0XA 5KMIA 2J2IB 3JVSA 5A4CA 3QBNA 3QHWA 4F7JA 4AOTA 3GOPA 2C0TA 4CTBA 2XYUA 4M0ZA 4I21A 1MUOA 3VUKA 2W1HA 1H25A 4I0SA 4AT5A 4FSWA 4AZWA 4NSTA 4QMSA 5JN2A 3F5XA 3QA0A 4FYOA 3LJ1A 4TPTA 3BLHA 4O4CA 4L7SA 5IUHA 2C6DA 3BGQA 4IWPA 4ZSEA 3U9NA 4LGDA 3GP0A 1F5QA 2B52A 3R9OA 4GYGA 3UOHA 3HP5A 4IFGA 5ANJA 5H9BA 4H36A 2BDWA 2PWLA 3SW4A 4ZJJA 4CGAA 5CWZA 1FVRA 3RGFA 3NUUA 3O2MA 4F9WA 5HZNA 3SG8A 1JLUE 4E1ZA 1QPJA 4IAZA 3NLBA 2OLCA 4FSQA 3PE2A 3RHXA 4XG9A 3C51A 3NEWA 4UMQA 4BCIA 1JSVA 2XBJA 3UC4A 3R8LA 4DBXA 2X7GA 4HYIA 4USEA 4RJ4A 4BDKA 2ONLA 3EZRA 3HX4A 2IW6A 1ZAOA 2Z2WA 5EH0A 3RVGA 3NUNA 3V5JA 5HD4A 3S1HA 3LFQA 4AN9A 3ZDIA 4MXZA 3KK9A 4YJTA 4LDTA 1ZARA 5CZHA 4H3QA 1Y8YA 5FXRA 3UOJA 1IAHA 5E91A 1QPCA 5L6PA 2F2CB 4V0GB 5DE2A 2YN8A 4X3JA 2C30A 4DAWA 4FEWA 3C4EA 3PLSA 4RC3A 5HNIX 1UKIA 4IVAA 4CV8A 2OF2A 3R7EA 4C34A 4FV0A 5GIPE 4XP3A 2GNFA 2I40A 5KMLA 4GFMA 3ORTA 2IJMA 3VRYA 5FDPA 3Q4TA 4DHJA 5LWMA 4DN5A 2Z7QA 3HECA 4RIOA 4KWPA 2C3LA 3DNEA 3ZLSA 4C57A 2PPQA 5IA3A 4BVUA 5CQWA 4IZ5A 3WI6A 3E64A 1S9IA 3KXXA 3NYVA 3AG9A 3F66A 5B2KA 3OS3A 2QOHA 2BKKA 5M57A 3F7ZA 4O4EA 2I0EA 4QQJA 4DEDA 4NFNA 1XH4A 3QCSA 5HNGA 2W4OA 4AXAA 5DYJA 5DNRA 3N9XA 3ODYX 4CFVA 5CNNA 1WBWA 5H3QA 4J95A 4G34A 4YZMA 4GT4A 4D55A 5J5TA 3UIXA 2ZV8A 4WD5A 3WILA 2UUEA 4AE9A 4CSVA 4DFZE 5B7VA 1L8TA 2QI8A 2V55A 3RINA 4NKSA 1VLRA 5HTBA 4X7QA 5E90A 4WRGA 2B7AA 3O51A 5FM2A 4MBIA 3W10A 5E8YA 1OB3A 2OIQA 4EHGA 2XUUA 5BUJA 5EKOA 3ZM9A 2YFXA 3DT1A 2BILB 2YLFA 4A4XA 1ZMVA 3FKOA 3PIXA 3R6XA 5IKWA 5CXZA 5FBNC 3SG9A 4JVGA 2XNGA 3QTUA 2XS0A 5DVRA 3AKJA 3K3JA 4ZP5A 3D5VA 3EFLA 3HEGA 3DJ5A 1XH5A 3MFSA 4F4PA 4UBAA 2VWZA 3AC4A 4RQKA 3PTGA 3OY1A 5EQPA 4TNDA 4QMYA 4L46A 1KOBA 1P14A 3KB7A 4A4LA 4C4FA 1NVRA 1JKSA 2R3HA 1PMEA 4RG0A 4A07A 4NM0A 1J7IA 4PDPA 4W8DA 1G8SA 5I9VA 5HE1A 1XO2B 4EK6A 4JIAA 3V01A 2UZLA 3QTXA 4UMPA 4GKIA 2W99B 4QP1A 3CGOA 4UMRA 3B8QA 1PY5A 2GNGA 5I9XA 4IIRA 2IZRA 3NYNA 4ZY4A 2RGPA 3F2NA 4JQEA 3S95A 1JKKA 3TIZA 4HVIA 5FRIA 5AAGA 1KUTA 3DKOA 2H6DA 4LOPA 2I0YA 4I22A 3DDQA 4RX7A 4BKZA 2IW8A 3BLRA 4FUYA 3SXFA 4HVDA 4TYJA 5FQDC 3BPRA 2B53A 5LVOA 3K54A 3QQJA 4JX7A 4CQEA 4F64A 5HEZA 1OGUA 5AR8A 4YTFA 4UWYA 4BWXA 2R3IA 2QLUA 5E4HA 1BI8A 4CRSA 2J90A 2NO3A 2WTIA 3OP5A 1W2DA 4HVHA 3DJ6A 1XBAA 4U3YA 3R8UA 5KMNA 4RVTA 4AWIA 2Z7SA 4R3RA 3WYYA 5HVYA 1YOMA 3FEGA 2X0PA 4AXCA 3Q96A 2J7TA 3VUHA 4AW1A 4D0WA 3I6WA 1H1WA 3VRZA 4BIBA 3W8QA 3A7HA 3CGFA 3NDMA 3QTRA 5AR4A 4DLJA 5C4LA 2A2AA 4OTFA 1ST4A 3R01A 5H2UA 1PXLA 4L53A 4QRCA 4YSMA 4TYHA 4O0WA 1Q8TA 5KMJA 5D12A 2V7OA 3V6SA 4JMQA 3PVGA 2Y4IC 4PP9A 4BL1A 5EYCA 2Q0NA 5CSPA 3CSVA 3ZRMA 3UMWA 3KXGA 4FTOA 3ROCA 3LMHA 5C1QB 3D7TB 2OF4A 2JKKA 4R6VA 3U87A 4EKKA 5HVKA 1PKGA 3PXYA 2PMOX 2CLXA 3UODA 5J7BA 4CG9A 2RFNA 4Z55A 4O82A 4JS8A 1U59A 4MD8E 2XIXA 5EOBA 2KULA 3FQEA 3ZFYA 3TZ8A 1IRKA 3QQKA 2W5HA 5EK7A 2W1FA 1URCA 3VQUA 3RPSA 4D0XA 4KSPA 4NW5A 5B2MA 3KQ7A 4CFXA 1ZZ2A 4OBOA 2VWWA 3WIGA 4I6HA 2WMAA 1RW8A 5FWKK 5BNJA 2ITQA 5HOAA 4G3CA 3TWJA 3R9NA 3Q9YA 4FNWA 3R1NA 3FE3A 5EKNA 4TKSA 2OJFE 4R5SA 5CAPA 3UDZA 2YZLA 2P55A 4Z16A 3GQIA 4EC9A 1Z57A 3SXRA 3UDBA 5AP0A 2BIKB 3O23A 2FH9A 3JPVA 1FBNA 4GK4A 4MQ1A 2YWPA 3QKMA 3N51A 4KABA 5A46A 5I9UA 5C03A 3ZO1A 2NRUA 4RFMA 3LOKA 3L1SA 3CS9A 3QFVA 3HV4A 2PUPA 1PXJA 2R3QA 4HPTE 5KCVA 2VV9A 2E9OA 4AUAA 4GH2A 4MCVA 5JK3A 4ZSJA 3DQXA 1R39A 2HZ0A 4I41A 5DRBA 5GNKA 2VTIA 3SGCA 5IUIA 2Y4IB 5CEMA 1KV2A 5CS6A 4AFJA 4BR3A 3ERKA 4D2VA 3GNIB 4GIHA 2NRYA 3EN6A 2YERA 3PPZA 4FV1A 4DF3A 2C6TA 4XYFA 4BIDA 4U97A 5HG9A 3DY7A 4S2ZA 1PJKA 2E9PA 5CENA 2UVZA 3PA3A 4X2FA 3RCJA 2ZB1A 5CU4A 3TYKA 5L4QA 3OXTA 2UZUE 3GEQA 3IW8A 1GZNA 3GT8A 4R78A 5E8UA 3RPVA 5AP4A 3BBWA 3DKCA 4R1YA 4E26A 3MSSA 3NUXA 3MTLA 1FINA 1JWHA 4G2FA 4XG6A 3W32A 5IQHA 3QGWA 3PA5A 2GNHA 2Y0AA 4EHVA 2PK9A 5AUTA 5M44A 5E1SA 4O7NA 5IH4A 4KS8A 3IONA 3ENMA 5BVWA 5IQCA 2BALA 2VO7A 3L9PA 4QPMA 2WMSA 4MXOA 3NIZA 3EN9A 4O96A 4AA5A 4QQ5A 3DOGA 4N70A 5HE3A 5LVLA 5EW8A 3OZ6A 4LV8A 5HCYA 3T9IA 4BCJA 3RK5A 4DCAA 4F65A 2UW7A 4EH7A 3SVVA 2ITUA 2X8IA 3PY0A 3RMFA 3TKHA 3VULA 3TZ9A 3W2RA 3M11A 5L8LA 3F5UA 3VS4A 4FV4A 1IG1A 4R3PA 4ANMA 2PMNX 4CMUA 1WVWA 1UWJA 2VO6A 3C5UA 3CJGA 1Q5KA 2R2PA 4QMVA 1H27A 2PYWA 1H0VA 2BAKA 1WFCA 2BFXA 5FP6A 5AUVA 4ASDA 4CLIA 2NP8A 4OBQA 3PFQA 4K6ZA 4BI2A 4ZS0A 3R7YA 4XJ0A 3I0OA 4EORA 2WMRA 2GMXA 3MFTA 4EK4A 1PRYA 4AGWA 5D9HA 2C3KA 3P9JA 4H58A 4E20A 3UP2A 4KBKA 3EQHA 3OUNB 5GZ8A 2ITYA 4QMPA 3ZH8A 3BHYA 4ENXA 3QU0A 3Q6WA 4WA9A 4D2WA 3CXWA 4IHPA 4OTWA 5IPJA 2BZHB 2ESMA 4DINA 2QOFA 4NH1A 5A3XA 2G2HA 2GNLA 2XB7A 2OFUA 4RJ7A 3P1AA 3BBTB 3HMPA 3Q5IA 4QYFA 2VTJA 4YHJA 5D11A 2QOCA 4E5BA 5AV3A 3TZMA 5D1JA 3P5JC 1P5EA 2PMIA 4U81A 3DS6A 5F95A 5IH5A 5D7VA 3VAPA 1ZOGA 3C0IA 3FY0A 4JXFA 1OKYA 5AUWA 3EFWA 5TR6A 4FE2A 3KREA 5CZIA 4F7SA 5IQIA 1JSTA 4PV0A 2PUNA 3HUBA 3CC6A 2V22A 3E8DA 3NS9A 2XIYA 4OLIA 2WEIA 4O27B 3FI3A 5DIAA 2VWUA 2WMBA 4MNFA 3VBQA 4PMPA 3AD6A 5DT0A 3CQEA 4NM7A 2PULA 3LFAA 3QWKA 4ACMA 3KF7A 3OFMA 4X2NA 5E8ZA 5I4NA 2BIYA 1PKDA 4AZEA 2W4KA 5BVNA 2IVSA 1Q4LA 2F7ZE 4H3PA 1SM2A 3RTPA 3Q4UA 3BV2A 4D28A 1DI8A 1Q8YA 1GZOA 2DYLA 3PVWA 5EYKA 2X9FA 1UNGA 4QYYA 2QOLA 1QMZA 2CKEA 3O7LB 2BRNA 4RRVA 1BI7A 2O5KA 3NYOA 2W7XA 3F2RA 4YLKA 2XIRA 2XZSA 3F9NA 3QD3A 4D9TA 2F57A 4I4EA 3F3WA 1MQBA 3AGLA 1KE7A 3I6UA 5K3YA 4B8MA 3Q32A 5IQBA 1M7QA 4IC7A 2WXVA 2UW5A 4OT5A 4B7TA 3BWJA 3HZTA 2YIWA 5LQFA 3A7FA 3NAYA 3BE9A 2H96A 3R7VA 5E8SA 5LVPA 3ZZWA 3KMUA 3PWDA 1ST0A 5J5SA 4MK0A 2QG7A 2CKOA 1V1KA 1IAJA 3KRJA 2WELA 2CDZA 4C8BA 2IWIA 3HV6A 3SOAA 4IM2A 3DLSA 3V5LA 2YDJA 5C8NA 4O7ZA 3SV0A 3CBLA 4EYJA 3PXKA 3PJ3A 4LV7A 1BL7A 1KOAA 1SYKA 5GZAA 3OW4A 5LJJA 5EYDA 1U54B 5EHYA 3E3BX 3CR0A 4XLIA 1I44A 4EOLA 3JY9A 2YCSA 2YLEA 4FTAA 3O17A 4DCEA 5JZJA 3D83A 2REIA 4FKPA 4IX6A 4QMTA 3RALA 3RP9A 4AT4A 4QQCA 3C0HA 2ZDUA 3TKIA 1H07A 4JR3A 1M7NA 4JBVA 2R3NA 3Q4ZA 4LQMA 3TV4A 1OL1A 5IA4A 5CAQA 1H28A 1Q8WA 4JG7A 3VS5A 3LAUA