3IO7A

2-aminopyrazolo[1,5-a]pyrimidines as potent and selective inhibitors of jak2
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
289
structure length
282
Chain Sequence
b'TQFEERHLKFLQQLGKGGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title 2-Aminopyrazolo[1,5-a]pyrimidines as potent and selective inhibitors of JAK2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 282
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3io7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3io7A01
4LL5A 4FK3A 3VS7A 2YJSA 4O27B 3WE4A 4WA9A 1SYKA 5CT7A 1OIYA 5TKDA 4AZVA 5DGZA 3C4ZA 4RMZA 4JBQA 4LUDA 4RJ4A 4GKIA 4HCTA 1E1XA 4L3JA 1S9JA 3QCQA 4CV8A 5IH6A 4RPVA 2BZJA 5KMLA 1YHVA 3DTWA 4JQ7A 4UALA 4WIHA 5LMAA 5J5SA 4C3RA 3ID6C 2QC6A 3PA4A 5L6WL 3BE2A 1WFCA 4O91A 4GUEA 4FYNA 4YJRA 3W2RA 2VTPA 2QHNA 3C4EA 3FPMA 3REPA 5M4CA 3D0EA 4UZHA 4AGDA 2BFXA 2I0HA 4AN3A 2CGUA 5L4QA 4GEOA 4OTQA 1OIUA 4UYAA 2YEXA 3DQXA 4QD6A 3IOKA 2O64A 4XRLA 3H0ZA 3KXGA 3SQQA 3DXPA 3NYXA 3GC0A 3ZBXA 4PMMA 2PVLA 4UMRA 2X4FA 4XG3A 3UYTA 3FI8A 3FL5A 3TNHA 3QALE 3F3VA 3LFBA 2R3LA 4TT7A 3Q60A 4FVQA 4TPTA 4C4IA 3S00A 3VBYA 4EK8A 3WE8A 1ZZ2A 2XK4A 3RGFA 1PMEA 4V05A 4IX5A 4A9UA 3KEXA 3RAIA 3N4VA 1WBPA 3E3BX 2EUFB 2GMXA 3HL7A 4OT5A 4TNDA 3DDPA 3UOJA 5KE0A 5EW3A 3ZUTA 4QQ5A 4BTFA 3UODA 4F64A 2FA2A 4W4VA 2Q0BA 3AC2A 4H3BA 2QKWB 5T6KA 4GV1A 4EOIA 3P86A 3QRTA 4OTWA 1GIHA 1IA8A 3NRMA 2AC5A 4UXLA 4D0XA 3MVJA 1NW1A 1F5QA 1YI3A 3GGFA 3C1XA 1IEPA 3PIZA 2WMQA 4NM3A 4FG7A 4ACDA 1REKA 4B99A 4V0GB 3E87A 3R21A 1Q8UA 4AT3A 4YSJA 4R3PA 1UNLA 3EOCA 4IVBA 5EQYA 4GU6A 4M0ZA 5LMBA 2QI8A 4A9SA 4G3CA 4G6NA 4LMNA 2BIKB 2BHHA 5K0KA 4E6CA 4RC4A 3U51A 4F0FA 5M07A 3WF8A 2DUVA 4XG4A 5F9EA 3IPHA 3A7HA 4G17A 4XOZA 2A0CX 4FKRA 5CTPA 4D9UA 2W9FB 2WIPA 3FY2A 5IQIA 3UIMA 3VS2A 5ANDA 1V0PA 3CPCA 1MRUA 2P2IA 2CKQA 1LEZA 2OW3A 5I9VA 3VS3A 3UQCA 2QOLA 5IQEA 5HLWA 1DI9A 2G2FA 5HG8A 5IA2A 5EOLA 5F95A 4OLIA 5DRBA 3QYWA 4YLKA 3ZRMA 3MFSA 2CGVA 3SXFA 4C2WA 2WB8A 4D4VA 2GS6A 3GC9A 3QUEA 4FT7A 4N6YA 3LOKA 4O0VA 5FTGA 1M7QA 4XP2A 4WNPA 3MV5A 4FSWA 1PYXA 3TT0A 3HKOA 3MWUA 4JG7A 4DC2A 5BX0A 4MNFA 5C8NA 5LVLA 4S30A 3ROYA 4D2PA 4IAAA 2UZDA 3FI2A 3EFLA 5HNGA 2GTNA 1DAWA 1IRKA 4GIHA 3LZBA 4CCUA 3QLFA 4NH1A 2IZSA 3AD4A 4CFXA 1P14A 5M51A 4D2VA 1GNGA 4I4EA 2YACA 4MX9A 4PUZA 4X3FB 2PUNA 3DBDA 1U5RA 2JBPA 2BRBA 3EYGA 2BZHB 1IAJA 4PDPA 1PHKA 3EZVA 2QOKA 3NYOA 3VBVA 4EUUA 4F9AA 4BN1A 4WNOA 2UZBA 4X3FC 4B0GA 5DFPA 4RRVA 1OGUA 4FNXA 2PVKA 4H1MA 3TJCA 4L3LA 3VQUA 2PYWA 3LQ8A 2VO6A 2J0LA 3SHEA 4OUCA 2OO8X 3RWQA 3B2TA 5LWNA 4CG9A 3MY5A 1YI4A 3NX8A 4UWCA 1U59A 5AIRA 2C1BA 4X3FA 3W16A 3ANRA 3EFWA 3LCDA 5DIAA 3QWKA 4XX9A 3GP0A 3D83A 4NW5A 4YLLA 2GHLA 3O71A 2ITNA 1FVRA 2LAVA 4GFMA 1SVHA 3UNKA 4UYNA 3R8UA 1L8TA 3I0OA 3MB7A 3ORLA 3ZHPC 3A4OX 4B8MA 2IN6A 3RK5A 4I5MA 3UIXA 3U54A 2V55A 1OPJA 4X2NA 5HEZA 3TNPC 3QD3A 3VUGA 4FG8A 4Y8DA 3QA0A 4YJVA 3KMUA 3KN6A 4LYNA 4AN2A 4BDHA 3CLYA 4C0TA 4CKRA 3MFTA 4FTMA 3R1NA 4M0YA 3Q5IA 4ZTMA 4FGRA 5AUZA 4C62A 3KGAA 3H3CA 4ID7A 4ASZA 2H8HA 2ITTA 3IG7A 5LVOA 4RT7A 5AP4A 4YHJA 4YURA 4DGLC 3EN9A 4JBPA 3R1QA 5DR2A 1JSTA 2I0EA 2C5NA 5A4TA 4F0IA 3LHJA 4FKPA 3QRIA 3BQCA 3R1YA 3POZA 4JJRA 2VWXA 3A61A 4FTQA 4LGGA 2OIBA 3DXQA 4L67A 2O0UA 2AYPA 4QMYA 3DJ6A 3E5AA 4IADA 3HV4A 2UW7A 4G5JA 5J9ZA 4O86A 4JL9A 2IZTA 1KV1A 2UZVA 3HUCA 4UY9A 1LPUA 4EI4A 3R9OA 3ZU7A 2VTTA 2G1TA 4L3PA 4LV5A 2A27A 5F20A 3VAPA 3PVUA 2GTMA 4GG7A 2OK1A 1ZRZA 4YTFA 3TKUA 3TM0A 5EFQA 3FLYA 3Q04A 5ETIA 3KCFA 1OKYA 3R9RA 4DFXE 5KMIA 5CF4A 3F9NA 5BUIA 3PTGA 5DR6A 3WZEA 3WOWA 2J5EA 5E1SA 2C47A 4BDBA 2ZM4A 3R22A 4QMNA 3NNVA 4FSNA 1K2PA 3QTRA 3V5TA 4BTJA 4TN6A 3RCJA 3T9IA 5GJDA 3FMHA 1UWJA 4J98A 5CYIA 5A9UA 5BQ0A 3CGFA 3RALA 3KULA 3FLWA 4QT1A 2ZB1A 3GI3A 2GDOA 2Y4PA 1YI6A 4FG9A 4QP8A 3FLSA 3QL8A 4GH2A 3DA6A 3O50A 4ZJIA 1ZYCA 3CR0A 3OC1A 3NCZA 3W55A 2KULA 1W7HA 1PY5A 4U81A 3BV3A 1H0VA 3V5PA 1KUTA 4QP9A 3ZH8A 2WQBA 4GUBA 5ACKA 3V8TA 4FKOA 5E90A 3H9OA 2PUUA 3LJ0A 3Q32A 4FKWA 1GZKA 4XG8A 1J7IA 3F5GA 3WF9A 2WOTA 3HLLA 2BR1A 4RSSA 1SNXA 2C6EA 4R6VA 4O82A 3ANQA 3KL8A 5C01A 5DE2A 3F3ZA 4L44A 1YDTE 3ZZEA 2PK9A 3PIXA 4KBAA 4J99A 4D28A 4W4XA 3MJ2A 1Q62A 2PPQA 4QTBA 2J0IA 3H10A 2RSVA 4YC6A 1H1PA 5KZ0A 5I3RA 1YWNA 3WZUA 3DAEA 3FMJA 1CTPE 4DFBA 2IW6A 4FSZA 5EM8A 3KC3A 3PZHA 2OZAB 3WZJA 3W2PA 5DLSA 1PXKA 2J0JA 2UW4A 1Y91A 3D5VA 3PXZA 5E9EA 1FPUA 1H8FA 2VZ6A 4BBMA 5BVNA 1ZYDA 4NTSA 5H3QA 3D5XA 2R3GA 4YJSA 2QR8A 3CY2A 3UP7A 1GY3A 4L7FA 4ZLYA 2PSQA 4PPAA 4YHFA 3NW6A 3OEZA 3D4QA 4EHZA 4Z7GA 4C3FA 3BGPA 4L9IA 2ZOQA 3G51A 5JRSA 3P79A 4FMQA 4WRSA 3EQBA 1ERKA 1ZYJA 4ZIMA 2OZAA 3AMYA 3OXZA 2W1DA 5BYZA 2JIVA 2VTIA 3HV3A 4C36A 3I6WA 4KIKB 1HOWA 4RZVA 2J5FA 3H30A 1ZMUA 3BYSA 3QX2A 2OXDA 2YLEA 2VWUA 3FSFA 3F3TA 2W05A 4E7WA 2C0TA 4WBBB 3BCEA 4XV1A 1PXJA 5HCZA 4RVLA 2PZYA 1G8SA 3C13A 1FMKA 3DBFA 4ZTSA 2XK9A 4DN5A 3OROA 2FB8A 3RPYA 3IDBA 3FKNA 5IA1A 5TO8A 1DI8A 4ITJA 4S32A 2NPQA 2J0KA 2J6MA 3V51A 4UWBA 4ACHA 4QQTA 5BVFA 2QU6A 4IAFA 4R7IA 3Q9ZA 4DG2E 5LJJA 4D1SA 2X6EA 3FWQA 4Q5HA 3LKMA 4IQ6A 3QCXA 4J96A 4A9TA 4AWIA 4Q5EA 3O23A 4HVGA 3PP1A 4KD1A 1G3NA 5FDXA 5I5ZA 5KKRB 4YR8A 1J1BA 4GK3A 2VTQA 1XHAA 3PSCA 5TE0A 4HNIA 5B2LA 3V5JA 5KKRC 4XP3A 3G5DA 5K5NA 4XS2A 5DRDA 1O6LA 3GOPA 1H24A 2BAQA 3FQHA 3QHWA 5HX6A 4FX3A 5HCYA 5AUTA 4EH7A 1JKLA 3C9WA 4GYIA 2HENA 2ITYA 4Y5HA 2C3IB 4H05A 3KRRA 3UMXA 4EONA 4D1ZA 2UZEA 3QZHA 4IE9A 2R0IA 2C1AA 2HZ0A 3RAWA 2ZV7A 2WMUA 2PVRA 4K8AA 3S1HA 4QMOA 4NKAA 1OMWA 1OKZA 4FEUA 2YISA 4BF2A 4FSRA 4RIYB 1RDQE 4XRJA 3DXNA 4EYJA 2W1EA 3GB2A 2WMWA 4JG6A 3OOMA 3D2IA 4NTTA 3FEGA 1K9AA 3AT3A 4FIFA 1JKSA 5IEYA 3R01A 2PVHA 1XKKA 4I6QA 4OTDA 2WTKB 2YM7A 2YDKA 4JIAA 4JR7A 4MBJA 4U6RA 3TV4A 4BCOA 3V01A 1OKVA 4LMUA 4YJNA 4DTAA 3BQRA 4RIYA 2EXCX 3H0YA 3C4XA 2QURA 2WTKC 4F7NA 4EJ7A 1WMKA 4ARKA 2OJFE 4ZEGA 2IVTA 3HUBA 3P9JA 2H6DA 5AP2A 5JGBA 4G3DA 5CQWA 2X7FA 5HKMA 4OBPA 1YXXA 4C57A 5I0BA 2XNEA 1UV5A 3MPMA 3F6XA 3UDBA 5TR6A 3RPRA 4O7NA 1YHWA 3FC1X 3TTIA 1XH7A 4EK3A 2WMAA 1PKDA 4A4XA 2Y0AA 3TI1A 3QKKA 3A4PA 2YZAA 3TCPA 5HQ0A 3F82A 4DG3E 2XJ2A 3BPRA 4DFYA 3WIKA 4Y72A 4A07A 4GG5A 3FMKA 1H26A 2PZPA 4FTJA 5FBOA 4XUFA 3Q4ZA 4EQCA 2VTJA 4XNEA 3C0HA 3OUKA 5HU3A 3ATTA 5I9WA 3CTQA 5L2TA 3NYNA 4C02A 4FV9A 2X9EA 3QC4A 4QTCA 3UNZA 4IAKA 2PZ5A 4KKHA 3G0FA 3VUIA 4YJTA 4UMPA 1CKIA 4D2SA 4XV3A 4USFA 5JGDA 5IQCA 1VZOA 2JDRA 1H01A 3ZOSA 1ZLTA 3VRYA 4FKGA 4CTCA 4E26A 4HVHA 5KHWA 2Q0NA 4GIIA 4P90A 1Q4LA 3R00A 1GZOA 4O0WA 4CMUA 5CASA 1QCFA 1W0XC 5JH6A 5K9IA 1SZMA 1OUKA 4RZWA 4WUNA 4R5YA 5JFSA 1YQJA 4KRCA 4FK6A 5A4EA 4JXFA 4V04A 2WU6A 4C4EA 3ZLSA 3AT2A 4FV3A 1R1WA 5AUXA 5LWMA 3OWLA 4BTMA 4C59A 5KMMA 4G9RA 2WTVA 4DBXA 5C4LA 4U44A 4LQMA 1ZMWA 3E7VA 2BALA 5IKWA 5HE1A 4E5WA 4O7SA 5H8GA 4BCKA 3KY2A 1UU8A 4IVAA 3FE3A 3PYYA 3A8WA 4DCAA 3I7BA 3GU5A 4O7LA 1JLUE 3WYYA 4FF8A 1URWA 4HGSA 4YC8A 1F3MC 5K4JA 3NR9A 2ZDTA 5FP5A 4DH8A 3P7AA 1W98A 3GU7A 3HV5A 4PV0A 2WIHA 4EOMA 4FBXA 5AP3A 4NL0A 4R3CA 4FR4A 4QP7A 3LFNA 4YZDA 4YPSA 4BYJA 2BKKA 2XCKA 2Z8CA 3TV7A 3DAKA 2OBJA 3CXWA 3PSDA 5HBEA 5M55A 2QNJA 2FH9A 4EZ5A 4JOAA 1ZY4A 3A7IA 3B2WA 4FKUA 2R5TA 4RIXA 4H36A 4U79A 4QNAA 4R5SA 4JIKA 3BYOA 4J97A 3BBTB 4DF3A 3IW6A 5EYMA 3SXRA 1SNUA 2YERA 3O2MA 2ZV9A 5HO6A 3M42A 3C4FA 4YJPA 4C4HA 2IVVA 3BX5A 4U41A 2F49A 4IB0A 1YOJA 4X6QC 3OWPA 4F9WA 2JDOA 3C4WA 3ORKA 5DYJA 4GVAA 5FDPA 4PNKA 3VULA 4FTNA 3LM0A 3KK8A 3PPKA 4MEDA 3VF9A 4QOXA 3GU4A 4O2ZA 4APPA 4KB8A 4P4CA 3U9CA 4FVRA 4I1ZA 2PULA 2Y4IB 3TDVA 2H9VA 4O0YA 4BI2A 4FZFB 3PWDA 4EOJA 4RWLA 4EWQA 4ZAUA 4RQVA 5M06A 2YIWA 5FGKA 2V7OA 2XIXA 3FMMA 2YWVA 1QPEA 4ASEA 1WZYA 2Y9QA 4E73A 4FT3A 2Y4IC 3R7YA 3TTJA 3ZM9A 2WTIA 4K6ZA 1APME 3DTCA 4XG9A 1H0WA 4IWOA 5CWZA 4BI0A 2F2CB 3E8DA 2XMYA 4YUQA 1MUOA 1M14A 3C4CA 3ALOA 3QYZA 4RIWA 3Q52A 3UZRA 2CCHA 3PXKA 4J53A 3VNTA 2PMLX 2WOUA 3AD5A 4FTKA 4ERKA 3RAKA 2YM4A 4GU9A 2XZSA 3ZEPA 4CFVA 2Q83A 4FNWA 1VJYA 5KHXA 5ETAA 4OTIA 3QUDA 3HECA 5F94A 4U8ZA 3NUAA 2JAVA 2PE1A 3M11A 1M2RA 3TZ7A 4K2RA 5HCXA 1W8CA 4JRVA 4M69A 5DT4A 2X7GA 4FL2A 3LCSA 3QGWA 2R7IA 4AZWA 4LV8A 5IDNA 1QMZA 5DT3A 4D0WA 4K0YA 3HAMA 2RG6A 3HDNA 3OW4A 1Y57A 5FTQA 2PVMA 4ALWA 4AT4A 3QRKA 4ENYA 3KXMA 4EZ7A 2WNTA 3GCPA 4IM3A 3ZO2A 3E8CA 4JG8A 2JFLA 3R7IA 2GHGA 2XYUA 2OXXA 3R63A 4FSTA 4CFNA 4D4YA 2VO0A 2YCFA 3P7CA 1P4FA 3I7CA 3VQHA 4BVUA 4L8MA 4M84A 3DAJA 1R0PA 4FUXA 4NSTA 4NWMA 4ZSGA 3VF8A 1UU3A 4HNFA 5CEMA 3FLNC 2ACXA 4FZDB 4EH8A 3I60A 4FV1A 4HPTE 4XG7A 4Y5QA 4C37A 2B52A 2R3HA 3GC7A 4C35A 2WHBA 2Y6MA 4U0IA 2R3QA 3E93A 4CYJA 2BDWA 3ZYAA 2B9HA 5E8YA 5ETCA 1Q8ZA 4MBIA 2FSTX 3MY0A 2JEDA 5BVWA 3VHKA 4XBRA 2XRUA 1PJKA 2C3JA 2VO3A 4P5QA 3EL7A 1OL2A 5I3OA 3FMDA 3VS5A 2GNGA 4M15A 3BZ3A 3SX9A 3LM5A 5CVGA 5M4IA 3W8LA 2HXQA 3KQ7A 5CY3A 3D9VA 3R8LA 2RGPA 2J2IB 3NGAA 5AAFA 4A4OA 3KXHA 3NUXA 3TACA 3A7FA 2DS1A 5HLNA 4N0SA 3ATSA 4BGQA 2F7EE 4QMTA 4FNYA 2V62A 4F1TA 3F2RA 3R8VA 3R9NA 4WNMA 4HGTA 3QC9A 4IB5A 4S34A 5AMNA 3ZTXA 2G2HA 4OGRA 3UOKA 4EL9A 3QF9A 4I24A 5HO8A 2GU8A 3DJ5A 2Z7QA 2VTOA 4D2TA 3DNDA 1OM1A 3CD8A 1H4LA 1Q41A 3ET7A 3TKIA 4KINA 4CLIA 3O0GA 4PL4A 5LVMA 2OG8A 2GHMA 4KUJA 3WF6A 4RJ5A 3R1SA 3EQRA 3BEGA 1VYZA 4FSYA 4G6LA 4M68A 4ASXA 4EOOA 2QLQA 5ANGA 3CBLA 4AW0A 3QKLA 4KKGA 3FC2A 4ZSLA 1MRYA 2OJIA 3K3IA 2B4SB 4E20A 3Q96A 4NYEA 4JR3A 4BIEA 4I94A 4FKSA 5IQHA 3PPZA 4CT2A 1YXVA 5CNOA 3UP2A 5BVEA 3ZO3A 5FEDA 3C5UA 2YFXA 3BU6A 4FV8A 3BLQA 3FZPA 3BU3A 3U9NA 4IB1A 5CEKA 3RCDA 3SGCA 3EN4A 5L8KA 3NZ0A 4HPUE 5EDRA 3F61A 3I6UA 3BLRA 4FZ6A 5HLPA 4FTRA 2KTYA 4U9AA 4DGMA 1QL6A 2C6KA 3FV8A 4PDSA 5KMJA 3BHHA 2HXLA 2FGIA 4FIJA 4CSVA 4G16A 5DHJA 2YWPA 3BYVA 4K33A 2GNHA 4QO9A 4IIRA 2Z7SA 4F6SA 1I44A 4AP7A 4XCUA 4ANLA 4P2KA 2WAJA 5IUHA 3AC4A 3ZC6A 5IQDA 3KMWA 5G1XA 2OIQA 5HIDA 1JSVA 5HD4A 2W4OA 4FTLA 4JVGA 3EQFA 2V22A 3CD3A 3QQKA 3UOHA 5H8BA 2WMXA 1YXTA 3FY0A 3AC1A 5ICPA 1QPJA 1J3HA 4PPCA 3G6HA 3IDCA 3OCBA 4TYJA 3NIEA 1OL5A 3NUPA 4KRDA 3V5WA 4F9BA 4JDJA 3FUPA 3MFRA 4LOQA 4ZSAA 3HA8A 3NW5A 2YHVA 1LEWA 3GCSA 4D5HA 5I9ZA 1Q24A 5GHVA 3A2CA 3VWAA 4LRJA 3UYSA 1BX6A 3VW6A 3VJOA 2VWYA 3LXPA 3RM7A 4FZ7A 4BDKA 5A4LA 5DH3A 4AUAA 2W5HA 2C3KA 3CY3A 3O51A 2J50A 4AOJA 2P3GX 2JDTA 2OXYA 4FTIA 4MVFA 5KBRA 4QP1A 4Q9ZA 3GFEA 3A60A 3L8PA 3G2FA 4CTBA 4PP7A 2WQOA 5J87A 3DY7A 4MQ1A 4I22A 2GCDA 3WBLA 5EYDA 4YZNA 1XJDA 2IO6A 4PL3A 5EK7A 4AG8A 2O3PA 4TYEA 4RJ7A 3LFFA 4W4YA 4BBFA 3PJ3A 3S3IA 4CMOA 2ZM3A 1Q99A 3ACJA 4IX4A 5EYKA 5LVPA 5J5TA 3PRIA 3A62A 4WBOA 2JLDA 3KMMA 4PP9A 4RA4A 5DEWA 4A4LA 5EHYA 4GFOA 3RMFA 4BCQA 2VV9A 1OPKA 3AMBA 4GYGA 3W33A 2XA4A 4EK4A 3HRCA 3UG1A 1YHSA 3DLZA 3QUPA 4NFNA 5CEQA 3ZFXA 4K77A 3AD6A 4MNEA 2E9OA 2VWZA 3G9NA 3DCVA 3KXXA 3FYKX 2GS7A 4QMLA 4UXQA 3MPAA 3SAYA 4EK6A 4M14A 2WQNA 1PXMA 4TWOA 2QOOA 4M3QA 1FMOE 1PF8A 2ONLC 2VTAA 3BYUA 3FQSA 1S9IA 2C0IA 3WYXA 1MP8A 4W9WA 3LXKA 3OCGA 4L46A 4NJ3A 2PHKA 3QTXA 4F70A 2LGCA 1NY3A 5HE2A 4A7CA 2NRUA 3NAXA 3P23A 2BROA 3FLQA 2ONLA 2IVSA 4L53A 5HD7A 3RJCA 4BDGA 4QP2A 3V8SA 5FG8A 1PKGA 3ZDIA 3ZO1A 3F3UA 3AMAA 5A3XA 3U6JA 3HA6A 3PLSA 4FT5A 2F9GA 4L52A 4O96A 4YZMA 3NNUA 4DTKA 5L8LA 3DV3A 2E2BA 4KKEA 3F69A 1OIQA 5GJGA 3UG2A 2WZJA 3EL8A 4YZCA 2WFYA 2XBJA 2XF0A 4USDA 4HCUA 1WVYA 3UQFA 3MTFA 5CNNA 3ZZWA 3QCSA 3HV6A 4HJOA 3O8UA 3BRBA 3Q5ZA 4O0UA 2GNJA 3ZCLA 1PXPA 3LFAA 2I0VA 2R4BA 4PRJA 4CCBA 3VS6A 5EM7A 2RFDA 2QONA 1GJOA 4C8BA 4FV5A 3QTIA 3U87A 4U3YA 3U4WA 2PE0A 1XBCA 1G8AA 2ITXA 4BKJA 4C4GA 2YLFA 1TQIA 4L42A 5C27A 4PNIA 3ZS5A 2E9PA 3OT8A 3UO4A 1LP4A 2Z7RA 3BE9A 1UNGA 2XEZA 5HU9A 1FBNA 3QZFA 1H1WA 3CPBA 3DNEA 5CEIA 4OTRA 3R7EA 5DMZA 2IW9A 3HEGA 1U5QA 2C6MA 5BVOA 3DDQA 2A19B 5EG3A 5LMKC 3OWKA 4K1BA 1M52A 4G9CA 3S95A 4AOIA 4MK0A 5TT7A 1VEBA 1E9HA 4EOSA 2J0MB 4FA2A 3ZRKA 5C26A 5HNBA 2X7OA 3ORZA 3RPSA 2PMNX 2YAKA 5HIBA 2G01A 3HRBA 4N6ZA 4C33A 4UV0A 5LMKA 3GVUA 5HX8A 1Q3WA 3WF7A 4AGWA 3ZXZA 3TL8A 2WQMA 3GT8A 4ZZNA 4YHTA 4U80A 4YNOA 4HVIA 4QTEA 4RX7A 3FYJX 3T8OA 4KNBA 3DGKA 5M57A 2O5KA 4PMTA 4G3EA 4AW2A 2C4GA 3CP9A 4O2PA 4YO4A 4F7JA 3KULB 3II5A 4HZSA 5HBJA 1B6CB 2ITZA 3G6GA 3F7ZA 5IQFA 4FIEA 2XYNA 3POOA 3TIYA 4U3ZA 3CE3A 4AF3A 4EC9A 4YJQA 4CZYB 1FINA 1YXSA 2GFCA 1YRPA 2QO9A 3WZKA 4TYGA 1XR1A 2DWBA 3QQHA 4BICA 2PVYA 5CALA 4EUTA 3E8EA 4I5PA 1FGIA 3PG3A 4GJ2A 4PDYA 4NT4A 4X3JA 3GFWA 3LXLA 4LRKA 2OZOA 3BWFA 2P4IA 4AZTA 5B2KA 4JBVA 4IAZA 4QPSA 2RF9A 3JPVA 4BYIA 3ENHA 3OMVA 5CAQA 5JGAA 2BTSA 3CJFA 3LCOA 4L43A 3QD0A 4YC3A 4YBKA 2UUEA 3PSBA 1ZARA 2XRWA 4XBUA 5FXSA 4FT0A 4WSYA 4WKQA 3C7QA 2W96B 4JRNA 3TV6A 1NXKA 4BDAA 3TN8A 4J1RA 4TTHB 1OECA 4EYMA 5DR9A 4Z7HA 4NU1A 3TDWA 3VN9A 5BMSA 3QA8A 3DPKA 1DS5A 1X8BA 5IA0A 5LQFA 2XJ1A 5EYCA 1QPCA 4DGGA 2RKUA 4K9YA 3L9LA 3FZSA 3MSSA 4AA4A 3MH1A 2C0OA 3QTUA 5GZ9A 5E91A 1ATPE 1STCE 2XBAA 2ZMDA 4ZTQA 2BTRA 2F4JA 3DLSA 4EOKA 2A2AA 4FEXA 4APCA 3C0IA 3EN6A 4X6RA 3ZC5A 4RVMA 4FICA 4DEDA 4DLJA 5BVDA 2QOQA 3MN3A 2XK3A 4AXAA 4I5HA 2X8EA 4R77A 4BCMA 1KWPA 5IMEA 2QOIA 4I20A 2ITPA 2VTSA 2WTDA 2GSFA 2JKQA 4J8NA 3KK9A 4KSPA 3FBVA 3ZBFA 4O0XA 2FYSA 4CD0A 5CEOA 4G3GA 5E92A 3BIZA 4GFGA 3R0TA 2X9FA 4RX8A 4H3QA 4CZUA 3RNIA 3MIYA 2AC3A 2PTKA 5M4FA 5CF6A 3ODYX 1XH9A 4EHVA 1KOAA 3WF5A 4M97A 4ZJJA 2BAKA 3QTZA 3I5ZA 3N9XA 4L68A 4S31A 1JBPE 2ITVA 1OIRA 3NUSA 5FTOA 3GCUA 3FXWA 4CKJA 1EH4A 2VU3A 4UBAA 5HZNA 5LOHA 4BDDA 3VS4A 4XH6A 3DBQA 3TUDA 3R9HA 4QTDA 3LW0A 4I0RA 3DB8A 4UZDA 1PYEA 3BKBA 2G9XA 2OLCA 5AFVA 2EXEA 2IZUA 1Y6AA 2B1PA 3FZTA 3QKMA 4GRBA 4FV6A 4IFCA 2FSMX 4DAWA 3V04A 4EH9A 3NNWA 3Q4CA 1WBTA 1UU9A 4LRMA 4ZSJA 5HE3A 4IW0A 3VS1A 5KUPA 1FGKA 1R39A 4BCIA 4FKVA 4ALVA 4AZFA 3PE1A 2QOFA 3FLZA 4NM5A 4C38A 5CQUA 2R3KA 3QGYA 5GIPE 5FLFA 1T45A 3TKHA 3DOGA 2V0DA 4KS8A 2C6TA 4IVDA 4YTCA 2JDSA 1DAYA 4CV9A 4CXAA 2CDZA 3PY3A 3MA3A 1CKJA 1ND4A 4HW7A 3QHRA 5AX9A 2C6IA 4FKQA 3ALNA 4QP6A 2O8YA 2C69A 4BZOA 2UZWE 3BHYA 4GT4A 3AQVA 2VN9A 3OZ6A 4ZOGA 3KN5A 3PA5A 4IZ7A 4YJUA 4E6QA 2OFVA 5M09A 5GZ8A 2OICA 3OY3A 3ZSGA 2UW5A 2J9MA 2X6DA 3D14A 3K3JA 3NIZA 4MBLA 3TEIA 2WXVA 1J7UA 3LQ3A 4O7TA 3UVRA 4CFMA 3NPCA 4ZZOA 1V0OA 5I9XA 5J9LA 1ZOEA 4TY1A 1Q8TA 4DA5A 1JKKA 2XP2A 4N70A 3SG9A 4YGAA 2E9VA 4YO6A 2X8IA 3PY0A 4DINA 3QTWA 3NEWA 2R3RA 3FMNA 2XS0A 3HGKA 4ANSA 5EKNA 5JFXA 3CIKA 4CKIA 3VBQA 2ERKA 2B0QA 1Z9XA 3OBJA 5L8JA 4EKKA 4L6QA 3OXTA 3QAME 4ZMFA 1XH5A 3LMGA 4IANA 3IONA 3ZONA 1MQBA 3VS0A 4QP3A 1L3RE 4RFZA 4WOVA 5I9YA 3FZRA 3TG1A 4FC0A 5AR2A 4LGDA 4G5PA 4WHZA 2W1IA 4FZAB 4EHGA 4UX9A 2W0JA 1GZNA 3NLBA 3ORTA 3P08A 2YA9A 3PZEA 3MW1A 3Q9WA 4QMQA 3KB7A 5D11A 2HZNA 3QQUA 3CSVA 3PUPA 3BGZA 4ANOA 1UNHA 3L1SA 4GKHA 3BI6A 4X0MA 3G90X 2CPKE 3U6HA 2BRGA 3PLAE 1YOLA 4BDCA 3OCSA 5A4QA 3PFQA 3CTHA 3N4UA 4BWKA 4TWCA 2OJ9A 2EVAA 4WG3A 1YXUA 3PXRA 4LGHA 2O2UA 4AGUA 1SM2A 3ODZX 5E4HA 1ZAOA 2YIRA 3RHXA 2YITA 3V6SA 4OR5A 2BHEA 2FSLX 2XK8A 2PE2A 2B9FA 3Q9XA 2PMIA 3BU5A 4LM5A 4PTCA 4JBOA 1RJBA 2YCRA 3MS9A 3RM6A 4AZEA 2ZM1A 4DTBA 5HVYA 2QODA 4BB4A 4W8DA 4BKYA 2HWPA 3ZM4A 3KXNA 4I93A 4IBMA 1OL7A 2RG5A 5EKOA 4Z16A 1JAMA 1Z57A 3HP2A 4QMVA 3RK7A 3PVWA 4X2FA 3ELJA 4B6LA 2A1AB 3DS6A 4BRXA 4F7LA 3VO3A 3KRWA 5IQGA 2C6DA 5J1WA 1HCLA 4C34A 5FEQA 4NKSA 4PY1A 2C68A 1Y6BA 5AR8A 4ZY4A 2NNWB 3F5UA 2WO6A 2VX3A 4ZY5A 1Y8YA 3R6XA 5E8SA 2VTHA 4MF1A 2XNNA 4TZRA 1KE7A 4IC7A 4USEA 2IPXA 3KKVA 3CQWA 2QOBA 2PWLA 4MXCA 4NW6A 4KBKA 5AUVA 4FKJA 3SC1A 4BDIA 2I6LA 4AU8A 2X4ZA 4EZ3A 3UMWA 3NW7A 2YIYA 2FVDA 5H2UA 2JKOA 3DK6A 3PVBA 4FSQA 5AUYA 3RPOA 1WBNA 1VYWA 2BRMA 2VRXA 2QOCA 4KSQA 4XOYA 4AT5A 4O7VA 1PRYA 5G6VA 4E6AA 4D1XA 4C61A 3A8XA 4X7QA 2BIYA 3GCQA 2CGXA 5CEPA 3THBA 1REJA 3RWPA 4C2VA 2PVNA 3DBCA 3NNXA 4C4JA 3Q6WA 5JSMA 5KNJA 4RJ6A 3UGCA 2XEYA 4D5KA 4YP8A 2CNUA 1YWRA 2YM5A 1VR2A 2YABA 4RIXB 2EU9A 3NVKI 3FAAA 3P0MA 2JFMA 5KX8A 4RLKA 4FODA 1ZYSA 4DH3A 5LVNA 3LFCA 4EK5A 2EXMA 4IM2A 3MBLA 4J95A 4ZTHA 5TOZA 3ZLXA 4XMOA 1YW2A 1JWHA 4ZP5A 2VTNA 2BUJA 4R8QA 3V3VA 1BL6A 3R71A 3WARA 5JMSA 3L9PA 3LLAA 1RQQA 4ZSEA 3IW5A 2EWAA 3ZFMA 5HIEA 2DYLA 4OTHA 1B38A 3ORPA 5HE0A 1CMKE 5HGIA 4KIOA 2JKKA 1IG1A 4QYEA 2HCKA 2R3NA 4IEBA 2PVFA 4K11A 4BI1A 4GSBA 5JEBA 5IA4A 5CSVA 5HOAA 5E8UA 3E62A 3R30A 4OTFA 1M17A 1BMKA 3R83A 3DFCB 3KRLA 4MXOA 3F5XA 4EKLA 4DEBA 5K3YA 4QTAA 5M56A 3G33A 3LJ2A 3DU8A 4RIWB 4O0RA 2QVSE 4BHZA 2JBOA 4WT6A 5DI1A 3CQEA 5E8TA 4E5AX 3DK7A 3WZDA 4G1WA 1JNKA 4C3PA 2OU7A 4XJ0A 4WG4A 3ZMMA 3EWHA 5CU3A 3ZUUA 2IZRA 2OH0E 1JVPP 2B54A 3U55A 3CQUA 3VC4A 4BIBA 3VHEA 4TNBA 5HVJA 5HICA 2VTLA 5DNRA 2JC6A 1R78A 1O9UA 3OT3A 3G9LX 3HRFA 4WSQA 4M69B 2UW0A 3COKA 4PF4A 5IA3A 3JR1A 5M08A 2BKZA 4NIFB 3N51A 4XHKB 2R3JA 3E92A 3FI3A 4Q2AA 4TYHB 4OBQA 5B7VA 3TZMA 2XIRA 2V5QA 4WG5A 5HVKA 1KV2A 2OFUA 4FUYA 4ORKA 4S33A 1CKPA 3ORNA 4EHEA 4MXYA 4QMUA 4XEYA 4L7SA 1XO2B 3IO7A 3E88A 3OXIA 4BKZA 3RK9A 3EN5A 2BRHA 1WAKA 5ANIA 2C5OA 2W7XA 4GL9A 3MA6A 3R28A 3QBNA 1OVEA 2Y6OA 2I40A 2HZIA 4NIFA 5FBNC 5CZIA 4FTTA 5CAUA 4TYHA 3OOGA 4KIQA 4ZK5A 1TQMA 2F57A 3R7UA 1I09A 3QLGA 4UN0C 3F2AA 3GNIB 4IWPA 4PTEA 2ZMCA 3RINA 4IDVA 3MJ1A 4WRGA 4H1JA 2IVUA 4JAJA 3IQ7A 3QQJA 4LI5A 5HBHA 3VVHA 3Q6UA 4E6DA 3LFQA 2BZIB 3IDPA 3LXNA 4NEUA 3RZFA 5A46A 1ZOGA 3OBGA 2VNYA 3VBXA 5AV0A 4XLIA 4I3ZA 5FD2A 2SRCA 2VWBA 2OF4A 3HVCA 2UW9A 5CS6A 1H28A 3FHRA 2R9SA 5HTIA 5HO7A 3JS2A 2XNOA 3GOKA 1A48A 2W5AA 2PUPA 3OW3A 4KBCA 4U97A 3EKNA 3C50A 3TIZA 3ENMA 4TXCA 4F6WA 2XB7A 3ROCA 5IQBA 3AT4A 4MHAA 1A06A 5M53A 2CJMA 2YCQA 4NK9A 5AUWA 2WTCA 4DEIA 5KMNA 3GC8A 3PWYA 4DT9A 2ITQA 4JDKA 5E8XA 3P7BA 3DZOA 4FSMA 2CKOA 1KSWA 3BBWA 3LMIA 2QCSA 4E1ZA 4K18A 5AP7A 3MB6A 1GIJA 4YPDA 3TWJA 4GT3A 2YIXA 3RZBA 1YWVA 4BDEA 3UZTA 1KE5A 5EW8A 4ZS0A 4U7ZA 4CRSA 1NA7A 3R7OA 3R7VA 4UWYA 4DH1A 5AADA 5ANKA 4LG4A 2P33A 2VX1A 4FV0A 2JDVA 5CF8A 1OUYA 4JT3A 4LL0A 4TWNA 2HZ4A 1H25A 3HDMA 4RWKA 4XYFA 4IVCA 3UE4A 2WMVA 4DEHA 5AP6A 3DK3A 3ACKA 3UJGA 4F1OA 4DHFA 2RFNA 3D5UA 3GU6A 3RBWA 1UKHA 3NSZA 4IHPA 3SW7A 4M12A 4H3PA 4BHNA 5EH0A 4BGHA 3PRFA 3IW8A 5A6OA 5CU2A 2QHMA 4NCTA 3R8MA 5C4KA 4MKCA 2Z7LA 5CSHA 2YDIA 3ITZA 3HMPA 4EH3A 1AQ1A 5AP5A 3TZ9A 4P5ZA 5KCVA 3ULIA 4MWHA 4C4FA 3A99A 4V01A 4AAAA 4HYHA 2CLXA 4PWNA 3KXZA 3KVWA 3PE2A 3CGOA 3PDTA 3NUNA 5EW9A 3KA0A 4QPAA 4RVKA 4EEVA 3EQDA 2XKCA 1ZYLA 3GCVA 2VD5A 3EFJA 4R1YA 1OL1A 5JZNA 3SVVA 3RP9A 3U8WA 3GQLA 2OJGA 5AV2A 4OAVB 4ZS4A 3W2CA 2VGPA 3JY9A 4NUSA 1PXIA 4F08A 4OAUC 3HP5A 2R3FA 2ETRA 2PZRA 5FUTA 2CN8A 4MCVA 4YSMA 3P4KA 4J8MA 4FL3A 4YBJA 2A4LA 4RIOA 5C8KA 3QWJA 5GNKA 4DCEA 3KREA 3HMMA 3LQ5A 4PMSA 5I4NA 1DM2A 3W2SA 3DKGA 3C51A 3B8QA 5BVKA 4UMTA 2NP8A 1CM8A 4QPMA 2X81A 3UPZA 4QMMA 1QPDA 4LUEA 2E9NA 5AUUA 4M13A 4IJ9A 4TW9A 4DFUA 3RVGA 3ORIA 1Q5KA 4X2KA 4F4PA 3HV7A 1CDKA 3O8TA 1XQZA 4NM0A 3OHTA 4OTGA 1WCCA 3O7LB 1MRVA 5EHOA 3Q2MA 3IKAA 5L6OA 5I9UA 4FTOA 5K4IA 1A9UA 4RBLA 5HG5A 4DH7A 4E4LA 5FXRA 4DFNA 5AAGA 3BYMA 3P78A 5H9BA 3CJGA 3G0EA 4BCGA 5IUGA 2BAJA 1KE6A 3TNIA 5ACBC 5IEVA 3D7TB 1UA2A 3LFDA 4UMQA 2GQGA 2E9UA 3QRUA 3MPTA 4JNWA 4QYGA 2OWBA 5D7AA 3MH2A 5BPYA 4O6EA 3L8SA 5CI6A 4AOTA 3K2LA 4RFYA 4JI9A 1OI9A 3IGGA 2XNBA 5CU0A 4I6BA 2Y7JA 3EQCA 3JVRA 3ZSIA 3E8NA 5CSWA 1KOBA 4RVTA 2REIA 5HHWA 3F66A 4RGJA 3Q4UA 3N4TA 1WBVA 4BGGA 3BHUA 2HAKA 3QD2B 2ZAZA 3D7TA 2UZTA 3FSKA 3IGOA 3IS5A 3LCKA 2QO7A 1TQPA 5BUEA 5IA5A 4CVAA 1GOLA 2J7TA 5E7RA 4E93A 4JDHA 4MNEB 1LUFA 1NVQA 4IWDA 4J52A 1Q8WA 4FGBA 2W9ZB 3I81A 5EHLA 1OBGA 4O83A 2JITA 2PZIA 2C5YA 3QQFA 2HY0A 2ITWA 4ALUA 5CXZA 1WBOA 2YJRA 4FV2A 4EH2A 4EH4A 1OITA 3VUDA 2G2IA 3CKXA 3QFVA 4FIIA 4RA5A 4ZJVA 1OB3A 3C5IA 2XIZA 3COIA 3SV0A 2AUHA 4BR3A 5AV3A 4D4SA 4QYFA 2BILB 5FEEA 3AC8A 3OY1A 4ACGA 1OBDA 5CX9A 2PU8A 4OW8A 3TNQB 3KF7A 2C5VA 1U54B 3DKFA 3GBZA 4IZYA 5EOBA 5AR3A 4EC8A 5IDPA 4FOCA 2ITUA 1YDRE 5AWMA 5EM6A 2V7AA 3R7GA 2WQEA 4V0GA 1UWHA 3FXZA 4RJ3A 4XG2A 4CRLA 5GJFA 4WO5A 4N4SA 4BFMA 4CEGA 3FDNA 3W2OA 4FEVA 4B9DA 2O65A 2UVXA 2YAAA 4GK4A 5D1JA 2F2UA 1OZ1A 4P7EA 4FTUA 4X21A 5L2IA 3T3UA 3LLTA 5LCJA 1U54A 2BPMA 3MIAA 4YU2A 3O17A 4EOQA 2XM9A 3PA3A 4MYGA 5J95A 1W83A 2RL5A 4H39A 3ZUVA 5AA9A 1R3CA 1P4OA 3DFAA 2WTJA 2IG7A 3VUMA 2OSCA 3FZ1A 1PXLA 4Y73A 1PXNA 5AM7A 4BCFA 2UW8A 3RNYA 3D5WA 4ANNA 1OL6A 1W84A 3K5VA 4IJPA 2QD9A 1E1VA 3QRJA 4GCJA 5BYYA 1V0BA 2ETKA 1Q97A 2IWIA 3H9RA 4G6OA 4QMPA 4C7TA 5M44A 3PIYA 3PXFA 4C58A 3V5LA 2XK6A 4F9CA 3QX4A 1YOMA 1XWSA 2C30A 5DEYA 4B4LA 4E3CA 1G5SA 4MQ2A 2JD5A 4DEEA 4IACA 5CSXA 4MD7E 4ZLOA 4J7BA 2FSOX 4FIGA 3R9DA 4WUAA 3RI1A 2XNMA 3FQEA 3D15A 4TYIA 4TL0A 2R3IA 2B55A 4ZZMA 1H1RA 4DGNA 4EWHA 2BRNA 2YN8A 2XCHA 1TKIA 3LVPA 4KS7A 3ZO4A 1U46A 2R0UA 2C5XA 3DB6A 4RC2A 4MD9E 4TRLA 5IISA 4D4RA 3ORMA 2XH5A 5KZIA 5L2SA 2ZYBA 2JKMA 2P0CA 4HYSA 3KRJA 4LOPA 4F09A 3QTQA 3LIJA 4U40A 4Z3VA 3FI4A 5E8VA 2QKRA 5C1QB 3R2BA 3W1FA 5IMXA 3EB0A 4RC3A 4IAIA 4O1PA 5JK3A 2I7QA 1ZXEA 4AA0A 2CMWA 4YMJA 4F7SA 4G3FA 4IZAA 3UVPA 3MDYA 5LCKA 3UOLA 3KF4A 4EH6A 2JIIA 2ITOA 3GQIA 4FE2A 3EQGA 1Q61A 2NRYA 2DQ7X 4F9YA 1O6YA 5B2MA 2B9IA 4MXXA 2GFSA 3R8ZA 3VIDA 2W1ZA 4BBEA 4CG8A 2BCJA 2XK7A 3NWWA 4FV4A 4HGEA 1Q3DA 5EI6A 1IASA 5H8EA 3UIUA 1URCA 5IQAA 5JN2A 1M2QA 4DG0E 4QNYA 4ANQA 4RLLA 3SLSA 2ETMA 4QMWA 4R1VA 4D2WA 2PVJA 3Q4TA 5FP6A 1KE8A 3EFKA 3M1SA 5BUJA 2HELA 2WTWA 4I6FA 3FMEA 3KFAA 5HG9A 5FWKK 3I5NA 5J7HA 4O84A 4BCNA 1H07A 1UKIA 4W8EA 2GS2A 3EH9A 5ANEA 4DBNA 3G15A 1OKWA 5CXHA 2UZLA 1GZ8A 4ZTRA 3VRZA 4CFWA 2R2PA 3Q53A 3OFMA 3K5UA 3NUUA 1XH4A 1V1KA 3HMNA 5ANOA 4QQCA 4E4NA 1K3AA 2VTRA 4J71A 3ULZA 1O6KA 3VW8A 3PPJA 5CANA 3MVLA 2VTMA 5CF5A 1FVTA 3R8PA 2YDJA 3I0QA 1XH6A 4IH8A 2X2KA 3FKLA 2ESMA 2HW6A 4Y46A 3FL4A 3VBWA 3R73A 5F4NA 2ZVAA 1JPAA 4CYIA 2W1CA 4A9RA 4DFLA 4BDJA 5A4CA 3DZQA 5E8ZA 5IG1A 4NJDA 3JY0A 3NVMB 5C8MA 2UVYA 5JFWA 5L2WA 5DOSA 3DKOA 3QD4A 4GS6A 1P2AA 2Y8OA 4GW8A 2CNQA 3UNJA 2HW7A 2WMTA 2YCSA 5EQPA 4AGCA 3DBEA 3CTJA 3HX4A 4FSUA 4XV9A 3PP0A 4RQKA 2XKDA 2OH4A 3EHAA 1Y8GA 4FKTA 4BZDA 3I1AA 4ITIA 5LARA 2XIYA 4RJ8A 3TZ8A 3S0OA 3MFUA 5FRIA 2X8DA 4CNHA 4WD5A 4HVDA 3DQWA 2X1NA 3RAHA 2R64A 2B9JA 1XBAA 3A7GA 3JXWA 3QXOA 4O7RA 5AV4A 4RX9A 1OPLA 5JQ5A 5IEXA 1MQ4A 1F0QA 1U4DA 2OGVA 4FYOA 2NO3A 3QXPA 4G2FA 1JOWB 4I4FA 4QMSA 3I79A 5JRQA 1T46A 3PVGA 1ZY5A 3SOAA 2BDFA 2XIKA 4CLJA 4R7BA 3EJ1A 2OIDA 2XKFA 3KVXA 4QYYA 2OF2A 4JLCA 4QP4A 4M66A 3BWJA 2J51A 2WELA 3SDJA 4KAOA 4EQMA 4FKIA 2EB2A 5AP0A 5J79A 4Z9LA 4O21A 1YKRA 4MWIA 5ANJA 5AP1A 4KA3A 3RKBA 4PMPA 3ZXTA 3MH3A 1PMUA 4IB3A 2G15A 4XV2A 3MGYA 1J1CA 3OS3A 4N57A 3EQHA 2R3OA 3HZTA 4PDOA 3EQPA 2H34A 3IW7A 3AXWA 4MF0A 3AGLA 3BLHA 4MAOA 4MD8E 4IDTA 5CU4A 3W8QA 3COHA 5BYLA 4QMZA 2ZJWA 3IOPA 1J91A 5HTBA 2VWVA 3IW4A 3LMHA 2H96A 3QU0A 3ZLYA 1H27A 3PY1A 4KIKA 4FVPA 2X2MA 4HOKA 5DT0A 3ZRLA 4CT1A 4BCJA 2ZDUA 4UEUA 3DJ7A 2QQ7A 4Z55A 3SG8A 5K5XA 2CLQA 3HMIA 4HCVA 4ZXTA 3R2YA 1RW8A 4CFUA 4G34A 4BL1A 5EQEA 3W32A 5IH4A 4O22A 2CSNA 4GT5A 3HAVA 5EDQA 1AD5A 2XNGA 4I41A 3GUBA 1R0EA 4OTPA 2Z2WA 4W9XA 3S4QA 4KIPA 4Y95A 4GVJA 1Z5MA 2RIOA 3AG9A 4GJ3A 4I6HA 1RE8A 2RFEA 4O0SA 5ETFA 3BHVA 3JYAA 4JS8A 3D7ZA 4S2ZA 1YDSE 5EM5A 5CAPA 5B0XA 1J7LA 4BDFA 4GK2A 3UO6A 3P5KA 1BI7A 3ZFYA 4NFMA 4D55A 2OI4X 3GU8A 4EORA 3TUCA 1ZZLA 2GNLA 3F2NA 4FL1A 4R3RA 4JAIA 4DH5A 3OG7A 4BIDA 2UW6A 4EOPA 3CEKA 2F7XE 3SA0A 2WGJA 4E5BA 2CN5A 4RG0A 4L45A 5J1VA 2HIWA 2R7BA 4ONAA 4B8LA 5AAEA 4EBVA 4X2JA 3PG1A 5ITAA 2Z02A 4FT9A 1H08A 4BZNA 4AW1A 2R3MA 1CSNA 2J90A 4D58A 3NYVA 4AW5A 1BL7A 4RWIA 5DVRA 4E4MA 3BEAA 4LFIA 3GEQA 4BC6A 1NT2A 2IJMA 2I1MA 3V5QA 5EDPA 4D9TA 4IX6A 2UZNA 4KABA 4OBOA 5A14A 3TXOA 5CENA 4AZSA 5K0XA 4DYMA 2W4JA 2C3LA 3EZRA 3H9FA 3VUKA 4BCPA 3L9NA 4BWXA 3ORXA 3WILA 3OP5A 5CT0A 3SKCA 3OF0A 3SW4A 2CKEA 1P5EA 3D94A 3GXLA 3ZLWA 3ZEWA 5JKGA 2BZKB 2PL0A 2WEIA 4YLJA 2IW8A 3LE6A 3E3PA 4TWPA 5D7VA 5D10A 3QZGA 2ERZE 4NZWB 3SOCA 4O6LA 3MY1A 2XJ0A 3NMUF 4FEWA 4W4WA 3U6IA 5J9YA 4RFMA 5TF9A 4JX7A 1BYGA 3OUNB 2X39A 1IR3A 2HWOA 5AX3A 2FUMA 3SD0A 3ZSHA 4FV7A 1M7NA 3M2WA 3VBTA 5CVFA 4RX5A 3FJQE 4O81A 3O7LD 2GNFA 4AE9A 1IA9A 5CI7A 2HK5A 3NDMA 3OD6X 4II5A 3F88A 3QQLA 3KRXA 5CSPA 3QQGA 1PMNA 2UZUE 3QZIA 4FI1A 4IX3A 3E7OA 4YTIA 4HVSA 5IZFA 5KMOA 3COMA 3BGQA 4UMUA 2UV2A 3LFEA 3PJ1A 3W2QA 4CMTA 4FNZA 4DT8A 5AJQA 4BWPA 3KU2A 4IZ5A 3LJ1A 5HESA 2W06A 4CFFA 2O63A 3EKKA 4AQCA 5BMMA 3SRVB 4AS0A 4BCHA 4Y83A 4ZLZA 5CAVA 3PJ8A 4R78A 2Z60A 2ZV2A 3LAUA 4IWQA 4YJOA 2UVZA 4PQNA 1B39A 4HYIA 5IH5A 4MH7A 5L6PA 5CU6A 2WKMA 2YM8A 3CC6A 5D41A 4PX6A 3MI9A 3HMOA 3V8WA 5BNJA 4QYHA 2CNVA 3L8VA 5D12A 3MH0A 4IXPA 1UU7A 5FXQA 3UPXA 5IF1A 2HY81 3CS9A 3SRVA 3VUHA 2JAMA 2UZOA 2WD1A 4PTGA 5CZHA 2JGZA 4IM0A 1FOTA 1UVRA 3FZOA 2VGOA 3FMLA 1AGWA 3PJCA 5EI2A 4FIHA 3QTSA 4X2GA 4CQEA 4PL5A 5IUIA 4IAYA 5DG5A 5C9CA 2XM8A 3F3WA 3ERKA 3L8XA 4AE6A 1GAGA 1YVJA 4O7YA 2QR7A 4FTCA 3C0GA 3NCGA 4HZRA 1BKXA 2I0YA 3HYHA 2VNWA 2B53A 4F63A 5JQ8A 4FKLA 3AC3A 1JQHA 5HG7A 5KBQA 3OWJA 1FQ1B 3R04A 2PUIA 2PY3A 4U43A 3AC5A 4M8TA 2QO2A 3EYHA 3ZDUA 3A7JA 3IK3A 5FM3A 4DE4A 4PPBA 3FKOA 3TNWA 3WIGA 1TVOA 2VAGA 2VWIA 4ENXA 4MTAA 5GZAA 1LR4A 4H58A 2XUUA 4O1OA 4E4XA 4A06A 2QG5A 2W4KA 4KWPA 5CVHA 2CGWA 3RPVA 3OTVA 2W5BA 5AR4A 2GQRA 4ANMA 5AA8A 4XP0A 5CAOA 5DPVA 2WMRA 2W17A 4UB7A 1KE9A 4ITHA 4BY9E 2JIUA 5E8WA 3JVSA 2C6OA 4DEAA 1XBBA 3UO5A 3MVHA 1FVVA 5AR5A 3CKWA 4ZTLA 2WMBA 4F65A 4M7IA 2GNIA 2OJJA 3GENA 4I23A 4ANBA 2CCIA 2WPAA 4XG6A 5A6NA 3W10A 4L01A 4U5JA 3UVQA 4O38A 5KMKA 3R02A 2OKRA 4IC8A 1BI8A 5D9HA 3RHKA 2YZLA 4NM7A 2P2HA 5C03A 3P1AA 2P55A 2XKEA 3OEFX 1GIIA 3WI6A 4F99A 3RTPA 5E1EA 3UIBA 2BVAA 2W1GA 1XH8A 2VUWA 2J4ZA 1ZWSA 4LOOA 2B7AA 3VUTA 4RWJA 1PXOA 4I0SA 5CLPA 4O7WA 2ZV8A 4FTAA 4TKSA 2CKPA 3F7WA 2FO0A 3W18A 5M4UA 4F1MA 5L3AA 3UBDA 4FEQA 4L00A 1NVRA 4FOBA 4AN9A 2QOHA 1W82A 2HYYA 4O0TA 4ZTNA 2VX0A 3S2PA 1ZMVA 5JFVA 1H1SA 1Q8YA 3BHTA 2RFSA 4XLVA 4F6UA 2R3PA 1JKTA 2BMCA 5KO1A 1IAHA 5AV1A 5GINE 3BV2A 1H1QA 1WVWA 5DBXA 2W99B 2BDJA 2UW3A 5A54A 4DGOA 3TUBA 3MYGA 4ASDA 4D2RA 5JT2A 1M2PA 4EH5A 4EQUA 2VO7A 2XVDA 4U45A 5T3QA 4ZMEA 4YZBA 4I92A 2WEVA 2YIQA 5EI8A 3Q2JA 5J8IA 3EN7A 3JUHA 3E63A 2PMOX 5IU2A 2QG7A 4JDIA 4JX3A 4YZ9A 3MESA 2X2LA 4A9YA 3I4BA 4CZTA 1SVGA 4I5CA 2YM3A 2VWWA 5L2QA 3FXXA 3UZPA 3CCNA 3EIDA 2YM6A 3EQIA 5IPJA 4HGLA 4Q9SA 5AIKA 1PW2A 3D2KA 3FHIA 4ACMA 3EMGA 1BLXA 3PXQA 5FQDC 1WBWA 2BFYA 3AOXA 3T3VA 4EBWA 4EOLA 4JQEA 5AM6A 4E8AA 2CHLA 4MXAA 3FPQA 2W1HA 3UC4A 1H00A 3K54A 4CGAA 4U42A 4DITA 2F7ZE 3AGMA 2C6LA 5T68A 1HCKA 4ACCA 5AEPA 5HTCA 3F5PA 4AFEA 4O7ZA 3OTUA 5DWRA 2GQSA 5GIOE 1BUHA 3T9TA 4CQGA 2HOGA 3IECA 4DLIA 4EJNA 4NCTC 4ZY6A 3UTOA 5J7BA 4AACA 4BTKA 3NUYA 2X0GA 4F0GA 4DEGA 4I0TA 3HNGA 3U4UA 2QLUA 4Y85A 4AFJA 4ERWA 1SVEA 5FM2A 3H4JA 4QRCA 3MVMA 2W1FA 3VJNA 2WU7A 3E64A 3KCKA 3TJDA 5F1ZA 4AX8A 3O96A 3DT1A 3OVVA 4YNEA 5DN3A 3UC3A 2GPHA 1PMVA 2ZB0A 4QQJA 5HI2A 1NVSA 4WNKA 5JZJA 3SXSA 3LCTA 3NAYA 1WVXA 5HORA 5AR7A 3OCTA 5HNIX 4IFGA 2XNPA 4R7HA 3ETAA 3PJ2A 4GMYA 3B8RA 3LFSA 3LPBA 3QCYA 1JSUA 4G31A 4B7TA 4DFZE 4M67A 3PXYA 3Q3BA 4AA5A 4JQ8A 2QU5A 4I21A 3DKCA 3UQGA 1SMHA 1ZOHA 4YTHA 3Q9YA 2WMSA 4HYUA 4MXZA 3V6RA 5DA3A 5LXMA 1WBSA 2EB3A 3MTLA 3BELA 3NS9A 4IMYA 4QMXA 3O8PA 3L9MA 4OT6A
chains in the Genus database with same CATH superfamily
4LL5A 4FK3A 3VS7A 2YJSA 4O27B 3WE4A 4WA9A 1SYKA 5CT7A 1OIYA 5TKDA 4AZVA 4BJJA 5DGZA 3C4ZA 4RMZA 4JBQA 4LUDA 4RJ4A 4GKIA 4HCTA 1E1XA 4L3JA 1S9JA 3QCQA 4CV8A 5IH6A 4RPVA 2BZJA 5KMLA 1YHVA 3DTWA 4JQ7A 4UALA 4WIHA 5LMAA 5J5SA 4C3RA 3ID6C 2QC6A 3PA4A 5L6WL 3BE2A 1WFCA 4O91A 4GUEA 4FYNA 4YJRA 3W2RA 2VTPA 2QHNA 3C4EA 3FPMA 3REPA 5M4CA 3D0EA 4UZHA 4AGDA 2BFXA 2I0HA 4AN3A 2CGUA 5L4QA 4GEOA 4OTQA 1OIUA 4UYAA 2YEXA 3DQXA 4QD6A 3IOKA 2O64A 4XRLA 3H0ZA 3KXGA 3SQQA 3DXPA 3NYXA 3GC0A 3ZBXA 4PMMA 2PVLA 4UMRA 2X4FA 4XG3A 3UYTA 3FI8A 3FL5A 3TNHA 3QALE 3F3VA 3LFBA 2R3LA 4TT7A 3Q60A 4FVQA 4AXDA 4TPTA 4C4IA 3S00A 3VBYA 4EK8A 3WE8A 1ZZ2A 2XK4A 3RGFA 1PMEA 4V05A 4IX5A 4A9UA 3KEXA 3RAIA 3N4VA 1WBPA 3E3BX 2EUFB 2GMXA 3HL7A 4OT5A 4TNDA 3DDPA 3UOJA 5KE0A 5EW3A 3ZUTA 4QQ5A 4BTFA 3UODA 4F64A 2FA2A 4W4VA 2Q0BA 3AC2A 4H3BA 2QKWB 5T6KA 4GV1A 4EOIA 3P86A 3QRTA 4OTWA 1GIHA 1IA8A 3NRMA 2AC5A 4UXLA 4D0XA 3MVJA 1NW1A 1F5QA 1YI3A 3GGFA 3C1XA 1IEPA 3PIZA 2WMQA 4NM3A 4FG7A 4ACDA 1REKA 4B99A 4V0GB 3E87A 3R21A 1Q8UA 4AT3A 4YSJA 4R3PA 1UNLA 3EOCA 4IVBA 5EQYA 4GU6A 4M0ZA 5LMBA 2QI8A 4A9SA 4G3CA 4G6NA 4LMNA 2BIKB 2BHHA 5K0KA 4E6CA 4RC4A 3U51A 4F0FA 5M07A 3WF8A 2DUVA 4XG4A 5F9EA 3IPHA 3A7HA 4G17A 4XOZA 2A0CX 4FKRA 5CTPA 4D9UA 2W9FB 2WIPA 3FY2A 5IQIA 3UIMA 3VS2A 5ANDA 1V0PA 3CPCA 1MRUA 2P2IA 2CKQA 1LEZA 2OW3A 5I9VA 3VS3A 3UQCA 2QOLA 5IQEA 5HLWA 1DI9A 2G2FA 5HG8A 5IA2A 5EOLA 5F95A 4OLIA 5DRBA 3QYWA 4YLKA 3ZRMA 3MFSA 2CGVA 3SXFA 4C2WA 2WB8A 4D4VA 2GS6A 3GC9A 3QUEA 4FT7A 4N6YA 3LOKA 4O0VA 5FTGA 1M7QA 4XP2A 2X0QA 4WNPA 3MV5A 4FSWA 1PYXA 3TT0A 3HKOA 3MWUA 4JG7A 4DC2A 5BX0A 4MNFA 5C8NA 5LVLA 4S30A 3ROYA 4D2PA 4IAAA 2UZDA 3FI2A 3EFLA 5HNGA 2GTNA 1DAWA 1IRKA 4GIHA 3LZBA 4CCUA 3QLFA 4NH1A 2IZSA 3AD4A 4CFXA 1P14A 5M51A 4O4CA 4D2VA 1GNGA 4I4EA 2YACA 4MX9A 4PUZA 4X3FB 2PUNA 3DBDA 1U5RA 1ST4A 2JBPA 2BRBA 3EYGA 2BZHB 1IAJA 4PDPA 1PHKA 3EZVA 2QOKA 3NYOA 3VBVA 4EUUA 4F9AA 4BN1A 4WNOA 2UZBA 4X3FC 4B0GA 5DFPA 4RRVA 1OGUA 4FNXA 2PVKA 4H1MA 3TJCA 4L3LA 3VQUA 2PYWA 3LQ8A 2VO6A 2J0LA 3SHEA 4OUCA 2OO8X 3RWQA 3B2TA 5LWNA 4CG9A 3MY5A 1YI4A 3NX8A 4UWCA 1U59A 5AIRA 3TYKA 2C1BA 4X3FA 3W16A 3ANRA 3EFWA 3LCDA 5DIAA 3QWKA 3KIOC 1TZDA 4XX9A 3GP0A 3D83A 4NW5A 4YLLA 1OGYA 2GHLA 3O71A 2ITNA 1FVRA 2LAVA 4GFMA 1SVHA 3UNKA 4UYNA 3R8UA 1L8TA 3I0OA 3MB7A 3ORLA 3ZHPC 3A4OX 4B8MA 2IN6A 3RK5A 4I5MA 3UIXA 3U54A 2V55A 1OPJA 4X2NA 5HEZA 3TNPC 3QD3A 3VUGA 4FG8A 3UDTA 4Y8DA 3QA0A 4YJVA 3KMUA 3KN6A 4LYNA 4AN2A 4BDHA 3CLYA 4C0TA 4LV7A 4CKRA 3MFTA 4FTMA 3R1NA 4M0YA 3Q5IA 4ZTMA 4FGRA 5AUZA 4C62A 3KGAA 3H3CA 4ID7A 4ASZA 2H8HA 2ITTA 3IG7A 5LVOA 4RT7A 5AP4A 4YHJA 4YURA 4DGLC 3EN9A 4JBPA 3R1QA 5DR2A 1JSTA 2I0EA 2C5NA 5A4TA 4F0IA 3LHJA 4FKPA 3QRIA 3BQCA 3R1YA 3POZA 4JJRA 2VWXA 3A61A 4FTQA 4LGGA 2OIBA 3DXQA 4L67A 2O0UA 2AYPA 4QMYA 3DJ6A 3E5AA 4IADA 3HV4A 2UW7A 4G5JA 5J9ZA 4O86A 4DHJA 4JL9A 2IZTA 1KV1A 2UZVA 3HUCA 4UY9A 1LPUA 4EI4A 3R9OA 3ZU7A 2VTTA 2G1TA 4L3PA 4LV5A 2A27A 5F20A 3VAPA 3PVUA 2GTMA 4GG7A 2OK1A 1ZRZA 4YTFA 3TKUA 3TM0A 5EFQA 3FLYA 3Q04A 5ETIA 3KCFA 1OKYA 3R9RA 4DFXE 5KMIA 5CF4A 3F9NA 5BUIA 3PTGA 5DR6A 3WZEA 3WOWA 2J5EA 5E1SA 2C47A 4BDBA 3NFFB 2ZM4A 3R22A 4QMNA 3NNVA 4FSNA 1K2PA 3QTRA 4JMQA 3V5TA 4BTJA 4TN6A 3RCJA 3T9IA 5GJDA 3FMHA 1UWJA 4J98A 5CYIA 5A9UA 5BQ0A 3CGFA 2ZFYA 3RALA 3KULA 3FLWA 4QT1A 3PFYA 2ZB1A 3GI3A 2GDOA 2Y4PA 1YI6A 4FG9A 4QP8A 3FLSA 3QL8A 4GH2A 3DA6A 3O50A 4ZJIA 1ZYCA 3CR0A 3OC1A 3NCZA 3W55A 2KULA 1W7HA 1PY5A 4U81A 3BV3A 1H0VA 3V5PA 1KUTA 4QP9A 3AKKA 3ZH8A 2WQBA 4GUBA 5ACKA 3V8TA 4FKOA 5E90A 3H9OA 2PUUA 3LJ0A 3Q32A 4FKWA 1GZKA 4XG8A 1J7IA 3F5GA 3WF9A 2WOTA 3HLLA 2BR1A 4RSSA 1SNXA 2C6EA 4R6VA 4O82A 3ANQA 3KL8A 5C01A 5DE2A 3F3ZA 4L44A 1YDTE 3ZZEA 2PK9A 3PIXA 4KBAA 4J99A 4D28A 1G8KA 4W4XA 3MJ2A 1Q62A 2PPQA 4QTBA 2J0IA 3H10A 2RSVA 4YC6A 1H1PA 5KZ0A 5I3RA 1YWNA 3WZUA 3DAEA 3FMJA 1CTPE 4DFBA 2IW6A 4FSZA 5EM8A 3KC3A 3PZHA 2OZAB 3WZJA 3W2PA 5DLSA 1PXKA 2J0JA 2UW4A 1Y91A 3D5VA 3PXZA 5E9EA 1FPUA 1H8FA 2VZ6A 4BBMA 5BVNA 1ZYDA 4NTSA 5H3QA 3D5XA 2R3GA 4YJSA 2QR8A 3CY2A 3UP7A 1GY3A 4L7FA 4ZLYA 2PSQA 4PPAA 4YHFA 3NW6A 3OEZA 3D4QA 4EHZA 4Z7GA 4C3FA 3BGPA 4L9IA 2ZOQA 3G51A 5JRSA 3P79A 4FMQA 4WRSA 3EQBA 1ERKA 1ZYJA 4ZIMA 2OZAA 3AMYA 3OXZA 2W1DA 5BYZA 2JIVA 2VTIA 3HV3A 4C36A 3I6WA 4KIKB 1HOWA 4RZVA 2J5FA 3H30A 1ZMUA 3BYSA 3QX2A 2OXDA 2YLEA 2VWUA 3FSFA 3F3TA 2W05A 4E7WA 2C0TA 4WBBB 3BCEA 4XV1A 3W0QA 1PXJA 5HCZA 4RVLA 2PZYA 1G8SA 3C13A 1FMKA 3DBFA 4ZTSA 2XK9A 4DN5A 3OROA 2FB8A 3RPYA 3IDBA 3FKNA 5IA1A 5TO8A 1DI8A 4ITJA 4S32A 2NPQA 2J0KA 2J6MA 3V51A 4UWBA 4ACHA 4QQTA 5BVFA 2QU6A 4IAFA 4R7IA 3Q9ZA 4DG2E 5LJJA 4D1SA 2X6EA 3FWQA 4Q5HA 3LKMA 4IQ6A 3QCXA 4J96A 4A9TA 4AWIA 4Q5EA 3O23A 4HVGA 3PP1A 4KD1A 1G3NA 5FDXA 5I5ZA 5KKRB 4YR8A 1J1BA 4GK3A 2VTQA 4AXEA 1XHAA 3PSCA 5TE0A 4HNIA 3UDZA 5B2LA 3V5JA 5KKRC 4XP3A 3G5DA 5K5NA 4XS2A 5DRDA 1O6LA 3GOPA 1H24A 2BAQA 3FQHA 3QHWA 5HX6A 4FX3A 5HCYA 5AUTA 4EH7A 1JKLA 3C9WA 4GYIA 2HENA 2ITYA 4Y5HA 2C3IB 4H05A 3KRRA 3UMXA 4EONA 4D1ZA 2UZEA 3QZHA 4IE9A 2R0IA 2C1AA 2HZ0A 3RAWA 2ZV7A 2WMUA 2PVRA 4K8AA 3S1HA 4QMOA 4NKAA 1OMWA 1OKZA 4FEUA 2YISA 4BF2A 4FSRA 4RIYB 3PUFC 1RDQE 4XRJA 3DXNA 4EYJA 2W1EA 3GB2A 2WMWA 4JG6A 3OOMA 3D2IA 4NTTA 3FEGA 1K9AA 3AT3A 4FIFA 1JKSA 5IEYA 3R01A 2PVHA 1XKKA 4I6QA 4OTDA 2WTKB 2YM7A 2YDKA 4JIAA 4JR7A 4MBJA 4U6RA 3TV4A 4BCOA 3V01A 1OKVA 4LMUA 4YJNA 4DTAA 3BQRA 4RIYA 2EXCX 3H0YA 3C4XA 2QURA 2WTKC 4F7NA 4EJ7A 1WMKA 4ARKA 2OJFE 4ZEGA 2IVTA 3HUBA 3P9JA 2H6DA 5AP2A 5JGBA 4G3DA 5CQWA 2X7FA 5HKMA 4OBPA 1YXXA 4C57A 5I0BA 2XNEA 1UV5A 2AQXA 3MPMA 3F6XA 3UDBA 5TR6A 3RPRA 4O7NA 1YHWA 3FC1X 3TTIA 1XH7A 4EK3A 2WMAA 1PKDA 4A4XA 2Y0AA 4DDGA 3TI1A 3QKKA 3A4PA 2YZAA 3TCPA 5HQ0A 3F82A 4DG3E 2XJ2A 3BPRA 4DFYA 3WIKA 4Y72A 4A07A 4GG5A 3FMKA 4F78A 1H26A 2PZPA 4FTJA 5FBOA 4XUFA 3W0PA 3Q4ZA 4EQCA 2VTJA 4XNEA 3C0HA 3OUKA 5HU3A 3ATTA 5I9WA 3CTQA 5L2TA 3NYNA 4C02A 4FV9A 2X9EA 3QC4A 4QTCA 3UNZA 4IAKA 2PZ5A 4KKHA 3G0FA 3VUIA 4YJTA 4UMPA 1CKIA 4D2SA 4XV3A 4USFA 5JGDA 5IQCA 1VZOA 2JDRA 1H01A 3ZOSA 1ZLTA 3VRYA 4FKGA 2IF8A 4CTCA 4E26A 4HVHA 5KHWA 2Q0NA 4GIIA 4P90A 1Q4LA 3R00A 1GZOA 4O0WA 4CMUA 5CASA 1QCFA 1W0XC 5JH6A 5K9IA 1SZMA 1OUKA 4RZWA 4WUNA 4R5YA 5JFSA 1YQJA 4KRCA 4FK6A 5A4EA 4JXFA 4V04A 2WU6A 4C4EA 3ZLSA 3AT2A 4FV3A 1R1WA 5AUXA 5LWMA 3OWLA 4BTMA 4C59A 5KMMA 4G9RA 2WTVA 4DBXA 5C4LA 4U44A 4LQMA 1ZMWA 2XAOA 3BLAA 3E7VA 2BALA 5IKWA 5HE1A 4E5WA 4O7SA 5H8GA 4BCKA 3KY2A 1UU8A 4IVAA 3FE3A 3PYYA 3A8WA 4DCAA 3I7BA 3GU5A 4O7LA 1JLUE 3WYYA 4FF8A 1URWA 4HGSA 4YC8A 1F3MC 5K4JA 3NR9A 2ZDTA 5FP5A 4DH8A 3P7AA 1W98A 3GU7A 3HV5A 4PV0A 2WIHA 4EOMA 4FBXA 5AP3A 4NL0A 4R3CA 4FR4A 4QP7A 3LFNA 4YZDA 4YPSA 4BYJA 2BKKA 2XCKA 2Z8CA 3TV7A 3DAKA 2OBJA 3CXWA 3PSDA 5HBEA 5M55A 2QNJA 2FH9A 4EZ5A 4JOAA 1ZY4A 3A7IA 3B2WA 4FKUA 2R5TA 4RIXA 4H36A 4U79A 4QNAA 4R5SA 4JIKA 3BYOA 4J97A 3BBTB 4DF3A 3IW6A 5EYMA 3SXRA 1SNUA 2YERA 3O2MA 2ZV9A 5HO6A 3M42A 3C4FA 4YJPA 4C4HA 2IVVA 3BX5A 4U41A 2F49A 4IB0A 1YOJA 4X6QC 3OWPA 4F9WA 2JDOA 3C4WA 3ORKA 5DYJA 4GVAA 5FDPA 4PNKA 3VULA 4FTNA 3LM0A 3KK8A 3PPKA 4MEDA 3VF9A 4QOXA 3GU4A 4O2ZA 4APPA 4KB8A 4P4CA 3U9CA 4FVRA 4I1ZA 2PULA 2Y4IB 3TDVA 2H9VA 4O0YA 4BI2A 4FZFB 3PWDA 4EOJA 4RWLA 4EWQA 4ZAUA 4RQVA 5M06A 2YIWA 5FGKA 2V7OA 2XIXA 3FMMA 2YWVA 1QPEA 4ASEA 1WZYA 2Y9QA 4E73A 4FT3A 2Y4IC 3R7YA 3TTJA 3ZM9A 4BJJB 2WTIA 4K6ZA 1APME 3DTCA 4XG9A 1H0WA 4IWOA 5CWZA 4BI0A 2F2CB 3E8DA 2XMYA 4YUQA 1MUOA 1M14A 3C4CA 3ALOA 3QYZA 4RIWA 3Q52A 3UZRA 2CCHA 3PXKA 4J53A 3VNTA 2PMLX 2WOUA 3AD5A 4FTKA 4ERKA 3RAKA 2YM4A 4GU9A 2XZSA 3ZEPA 4CFVA 2Q83A 4FNWA 1VJYA 5KHXA 5ETAA 4OTIA 3QUDA 3HECA 5F94A 4U8ZA 3NUAA 2JAVA 2PE1A 3M11A 1M2RA 3TZ7A 4K2RA 5HCXA 1W8CA 4JRVA 4M69A 5DT4A 2X7GA 4FL2A 3LCSA 3QGWA 2R7IA 4AZWA 4LV8A 5IDNA 1QMZA 5DT3A 4D0WA 4K0YA 3HAMA 2RG6A 3HDNA 3OW4A 1Y57A 5FTQA 2PVMA 4ALWA 4AT4A 3QRKA 4ENYA 3KXMA 4EZ7A 2WNTA 3GCPA 4IM3A 3ZO2A 3E8CA 4JG8A 2JFLA 3R7IA 2GHGA 2XYUA 2OXXA 3R63A 4FSTA 4CFNA 4D4YA 2VO0A 2YCFA 3P7CA 1P4FA 3I7CA 3VQHA 4BVUA 4L8MA 4M84A 3DAJA 1R0PA 4FUXA 4NSTA 4NWMA 4ZSGA 3VF8A 1UU3A 4HNFA 5CEMA 3FLNC 2ACXA 4FZDB 4EH8A 3I60A 4FV1A 4HPTE 4XG7A 4Y5QA 4C37A 2B52A 2R3HA 3GC7A 4C35A 2WHBA 2Y6MA 4U0IA 2R3QA 3E93A 4CYJA 2BDWA 3ZYAA 2B9HA 5E8YA 5ETCA 1Q8ZA 4MBIA 2FSTX 3MY0A 2JEDA 5BVWA 3VHKA 4XBRA 2XRUA 1PJKA 2C3JA 2VO3A 4P5QA 3EL7A 1OL2A 5I3OA 3FMDA 3VS5A 2GNGA 4M15A 3BZ3A 3SX9A 3LM5A 5CVGA 5M4IA 3W8LA 2HXQA 3KQ7A 5CY3A 3D9VA 3R8LA 2RGPA 2J2IB 3NGAA 5AAFA 4A4OA 3KXHA 3NUXA 3TACA 3A7FA 2DS1A 5HLNA 4N0SA 3ATSA 4BGQA 2F7EE 4QMTA 4FNYA 2V62A 4F1TA 3F2RA 3R8VA 3R9NA 4WNMA 4HGTA 3QC9A 4IB5A 4S34A 5AMNA 3ZTXA 2G2HA 4OGRA 3UOKA 4EL9A 3QF9A 4I24A 5HO8A 2GU8A 3DJ5A 2Z7QA 2VTOA 4D2TA 3DNDA 1OM1A 3CD8A 1H4LA 1Q41A 3ET7A 3TKIA 4KINA 4CLIA 3O0GA 4PL4A 5LVMA 2OG8A 2GHMA 4KUJA 3WF6A 4RJ5A 3R1SA 3EQRA 3BEGA 1VYZA 4FSYA 4I6LA 4G6LA 4M68A 4ASXA 4EOOA 2QLQA 5ANGA 3CBLA 4AW0A 3QKLA 4KKGA 3FC2A 4ZSLA 1MRYA 2OJIA 3K3IA 2B4SB 4E20A 3Q96A 4NYEA 4JR3A 4BIEA 4I94A 4FKSA 5IQHA 3PPZA 4CT2A 1YXVA 3P5JC 5CNOA 3UP2A 5BVEA 3ZO3A 5FEDA 3C5UA 2YFXA 3BU6A 4FV8A 3BLQA 3FZPA 3BU3A 3U9NA 4IB1A 5CEKA 3RCDA 3SGCA 3EN4A 5L8KA 3NZ0A 4HPUE 5EDRA 3F61A 3I6UA 3BLRA 4FZ6A 5HLPA 4FTRA 2KTYA 4U9AA 4DGMA 1QL6A 2C6KA 3FV8A 4PDSA 5KMJA 3BHHA 2HXLA 2FGIA 4FIJA 4CSVA 4G16A 5DHJA 2YWPA 3BYVA 4K33A 2GNHA 4QO9A 4IIRA 2Z7SA 4F6SA 1I44A 4AP7A 4LDTA 4XCUA 4ANLA 4P2KA 2WAJA 5IUHA 3AC4A 3ZC6A 5IQDA 3KMWA 5G1XA 2OIQA 5HIDA 1JSVA 5HD4A 2W4OA 4FTLA 4JVGA 3EQFA 2V22A 3CD3A 3QQKA 3UOHA 5H8BA 2WMXA 1YXTA 3FY0A 2X0PA 3AC1A 5ICPA 1QPJA 1J3HA 4PPCA 3G6HA 3IDCA 3OCBA 4TYJA 3NIEA 1OL5A 3NUPA 4KRDA 3V5WA 4F9BA 4JDJA 3FUPA 3MFRA 4LOQA 4ZSAA 3HA8A 3NW5A 2YHVA 1LEWA 3GCSA 4D5HA 5I9ZA 1Q24A 5GHVA 3A2CA 3VWAA 4LRJA 3UYSA 1BX6A 3VW6A 3VJOA 2VWYA 3LXPA 3RM7A 4FZ7A 4BDKA 5A4LA 5DH3A 4AUAA 2W5HA 2C3KA 3CY3A 3O51A 2J50A 4AOJA 1TFFA 2P3GX 2JDTA 2OXYA 4FTIA 4MVFA 5KBRA 4QP1A 4Q9ZA 3GFEA 3A60A 3L8PA 3G2FA 4CTBA 4PP7A 2WQOA 5J87A 3DY7A 4QEBA 4MQ1A 4I22A 2GCDA 3WBLA 5EYDA 4YZNA 1XJDA 2IO6A 4PL3A 5EK7A 4AG8A 2O3PA 4TYEA 4RJ7A 3LFFA 4W4YA 4BBFA 3PJ3A 3S3IA 4CMOA 2ZM3A 1Q99A 3ACJA 4IX4A 5EYKA 5LVPA 5J5TA 3PRIA 3A62A 4WBOA 2JLDA 3KMMA 4PP9A 4RA4A 5DEWA 4A4LA 5EHYA 4GFOA 3RMFA 4BCQA 2VV9A 1OPKA 3AMBA 4GYGA 3W33A 2XA4A 4EK4A 3HRCA 3UG1A 1YHSA 3DLZA 3QUPA 4NFNA 5CEQA 3ZFXA 4K77A 3AD6A 4MNEA 2E9OA 2VWZA 3G9NA 3DCVA 3KXXA 3FYKX 2GS7A 4QMLA 4UXQA 3MPAA 3SAYA 4EK6A 4M14A 1XMLA 2WQNA 1PXMA 4TWOA 2QOOA 4M3QA 1FMOE 1PF8A 2ONLC 2VTAA 3BYUA 3FQSA 1S9IA 2C0IA 3WYXA 1MP8A 4W9WA 3LXKA 3OCGA 4L46A 4NJ3A 2PHKA 3QTXA 4F70A 2LGCA 1NY3A 5HE2A 4A7CA 2NRUA 3NAXA 3P23A 2BROA 3FLQA 2ONLA 2IVSA 4L53A 5HD7A 3RJCA 4BDGA 4QP2A 3V8SA 5FG8A 1PKGA 3ZDIA 3ZO1A 3F3UA 3AMAA 5A3XA 3U6JA 3HA6A 3PLSA 4FT5A 2F9GA 4L52A 4O96A 1W2FA 4YZMA 3NNUA 4DTKA 5L8LA 3DV3A 2E2BA 4KKEA 3F69A 1OIQA 5GJGA 3UG2A 2WZJA 3EL8A 4YZCA 2WFYA 2XBJA 2XF0A 4USDA 4HCUA 1WVYA 3UQFA 3MTFA 5CNNA 3ZZWA 3QCSA 3HV6A 4HJOA 3O8UA 3BRBA 3Q5ZA 4O0UA 2GNJA 3ZCLA 1PXPA 3LFAA 2I0VA 2R4BA 4PRJA 4CCBA 3VS6A 5EM7A 2RFDA 2QONA 1GJOA 4C8BA 4FV5A 3QTIA 3U87A 4U3YA 3U4WA 2PE0A 1XBCA 1G8AA 2ITXA 4BKJA 4C4GA 2YLFA 1TQIA 4L42A 5C27A 4PNIA 3ZS5A 2E9PA 3OT8A 3UO4A 1LP4A 2Z7RA 3BE9A 1UNGA 2XEZA 5HU9A 1FBNA 3QZFA 1H1WA 3CPBA 3DNEA 5CEIA 4OTRA 3R7EA 5DMZA 2IW9A 3HEGA 1U5QA 2C6MA 5BVOA 3DDQA 2A19B 5EG3A 5LMKC 3OWKA 4K1BA 1M52A 4G9CA 3S95A 4AOIA 4MK0A 5TT7A 1VEBA 1E9HA 4EOSA 2J0MB 4FA2A 3ZRKA 5C26A 5HNBA 2X7OA 3ORZA 3RPSA 2PMNX 2YAKA 5HIBA 2G01A 3HRBA 4N6ZA 4C33A 4UV0A 5LMKA 3GVUA 5HX8A 1Q3WA 3WF7A 4AGWA 3ZXZA 3TL8A 3BL7A 2WQMA 3GT8A 4ZZNA 4YHTA 4U80A 4YNOA 4HVIA 4QTEA 4RX7A 3FYJX 3T8OA 4KNBA 3DGKA 5M57A 2O5KA 4PMTA 4G3EA 4AW2A 2C4GA 3CP9A 4O2PA 4YO4A 4F7JA 3KULB 3II5A 4HZSA 5HBJA 1B6CB 2ITZA 3G6GA 3F7ZA 5IQFA 4FIEA 2XYNA 3POOA 3TIYA 4U3ZA 3CE3A 4AF3A 4EC9A 4YJQA 4CZYB 1FINA 1YXSA 2GFCA 1YRPA 2QO9A 3WZKA 4TYGA 1XR1A 2DWBA 3QQHA 4BICA 2PVYA 5CALA 4EUTA 3E8EA 4I5PA 1FGIA 3PG3A 4GJ2A 4PDYA 4NT4A 4X3JA 3GFWA 3LXLA 4LRKA 2OZOA 3BWFA 2P4IA 4AZTA 5B2KA 4JBVA 4IAZA 4QPSA 2RF9A 3JPVA 4BYIA 3ENHA 3OMVA 5CAQA 5JGAA 2BTSA 3CJFA 3LCOA 4L43A 3QD0A 4YC3A 4YBKA 2UUEA 3PSBA 1ZARA 2XRWA 4XBUA 5FXSA 4FT0A 4WSYA 4WKQA 3C7QA 2W96B 4JRNA 3TV6A 1NXKA 4BDAA 3TN8A 4J1RA 4TTHB 1OECA 4EYMA 5DR9A 4Z7HA 4NU1A 3TDWA 3VN9A 5BMSA 3QA8A 3DPKA 1DS5A 1X8BA 5IA0A 5LQFA 2XJ1A 5EYCA 1QPCA 4DGGA 2RKUA 4K9YA 3L9LA 3FZSA 3MSSA 4AA4A 3MH1A 2C0OA 3QTUA 5GZ9A 5E91A 1ATPE 1STCE 2XBAA 2ZMDA 4ZTQA 2BTRA 2F4JA 3DLSA 4EOKA 2A2AA 4FEXA 4APCA 3C0IA 3EN6A 4X6RA 3ZC5A 4RVMA 4FICA 4DEDA 4DLJA 5BVDA 2QOQA 3MN3A 2XK3A 4AXAA 4I5HA 2X8EA 4R77A 4BCMA 1KWPA 5IMEA 2QOIA 4I20A 2ITPA 2VTSA 2WTDA 2GSFA 2JKQA 4J8NA 3KK9A 4KSPA 3FBVA 3ZBFA 4O0XA 2FYSA 4CD0A 5CEOA 4G3GA 5E92A 3BIZA 4GFGA 3R0TA 2X9FA 4RX8A 4H3QA 4CZUA 3RNIA 3MIYA 2AC3A 2PTKA 5M4FA 2XARA 5CF6A 3ODYX 1XH9A 4EHVA 1KOAA 3WF5A 4M97A 4ZJJA 4O4DA 2BAKA 3QTZA 3I5ZA 3N9XA 4L68A 4S31A 1JBPE 2ITVA 1OIRA 3NUSA 5FTOA 3GCUA 3FXWA 4CKJA 1EH4A 2VU3A 4UBAA 5HZNA 5LOHA 4BDDA 3VS4A 4XH6A 3DBQA 3TUDA 3R9HA 4QTDA 3LW0A 4I0RA 3DB8A 4UZDA 1PYEA 3BKBA 2G9XA 2OLCA 5AFVA 2EXEA 2IZUA 1Y6AA 2B1PA 3FZTA 3QKMA 4GRBA 4FV6A 4IFCA 2FSMX 4DAWA 3V04A 3UDSA 4EH9A 3NNWA 3Q4CA 1WBTA 1UU9A 4LRMA 4ZSJA 5HE3A 4IW0A 3VS1A 5KUPA 1FGKA 1R39A 4BCIA 4AAYA 4FKVA 4ALVA 4AZFA 3PE1A 2QOFA 3FLZA 4NM5A 4C38A 5CQUA 2R3KA 2IEWA 3QGYA 5FLFA 1T45A 3TKHA 3DOGA 2V0DA 5GIPE 4KS8A 2C6TA 4IVDA 4YTCA 2JDSA 1DAYA 4CV9A 4CXAA 2CDZA 3PY3A 3MA3A 1CKJA 1ND4A 4HW7A 3QHRA 5AX9A 2C6IA 4FKQA 3ALNA 4QP6A 2O8YA 2C69A 4BZOA 2UZWE 3BHYA 4GT4A 3AQVA 2VN9A 3OZ6A 4ZOGA 3KN5A 3PA5A 4IZ7A 4YJUA 4E6QA 2OFVA 5M09A 5GZ8A 2OICA 3OY3A 3ZSGA 2UW5A 2J9MA 2X6DA 3D14A 3K3JA 3NIZA 4MBLA 3TEIA 2WXVA 1J7UA 3LQ3A 4O7TA 4AQKA 3UVRA 4CFMA 3NPCA 4ZZOA 1V0OA