4PP7A

Highly potent and selective 3-n-methylquinazoline-4(3h)-one based inhibitors of b-rafv600e kinase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
267
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title Highly potent and selective 3-N-methylquinazoline-4(3H)-one based inhibitors of B-Raf(V600E) kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 71
structure length 267
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4pp7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pp7A01
5LVPA 3HA6A 2C5VA 2XK9A 3GVUA 3I5NA 4EORA 3DAJA 3UBDA 3QD0A 4EOJA 1M2PA 2YIYA 3VBYA 2XNBA 3VULA 3ZM4A 2ETMA 3DDQA 2VTMA 4FTNA 4ONAA 5CU0A 2IVUA 2HWPA 2UW6A 3COIA 3V3VA 4DG2E 4EKLA 1M2RA 2JC6A 3BE9A 2OK1A 3E8EA 3OBGA 2XUUA 2W1HA 4UALA 4ZOGA 5DE2A 4BDKA 4GMYA 4EOIA 3DNEA 3PPJA 5HQ0A 4TY1A 2ITTA 4MF1A 2I1MA 2UW3A 3QTXA 2HY81 1PRYA 4ZMFA 2BFXA 5EM6A 2W96B 4RX7A 5A14A 5CSPA 3ZO2A 3ZONA 4OT5A 4DG3E 1P14A 2XNMA 5JFVA 4ID7A 2UVXA 1H0VA 3PZHA 3TV6A 4IW0A 5L8JA 3EKKA 4AW0A 4C4JA 2Z02A 2QKRA 1XH5A 3AMYA 1JSVA 2ZM4A 3CD3A 3ZTXA 4O91A 4DH5A 5KBRA 1PYEA 3LOKA 5BMMA 4H05A 3ZSGA 3VS7A 3ATTA 2R3HA 4DE4A 1G8AA 2YN8A 3ZCLA 1FMOE 3HV3A 2H96A 4BTFA 1U59A 4LRMA 3H3CA 4RMZA 5M55A 4PL3A 1JOWB 5IH6A 4A9UA 4FK6A 3R63A 2CKEA 3N51A 3MJ1A 5M4CA 2I0EA 4RZWA 3MBLA 1Z9XA 2W7XA 3ZRKA 3WYXA 1PXKA 3UYSA 2PUPA 2HWOA 3PWYA 5AIKA 5HOAA 1OPLA 4JX7A 2XJ1A 4K18A 2PULA 4FE2A 1O9UA 4NFNA 5HLNA 5IA1A 1FVRA 3LFQA 3QU0A 3EH9A 1WAKA 4OTFA 5KMNA 2BRGA 4DEAA 3LQ3A 4D4YA 4CFMA 4I0TA 2XKCA 3UNZA 2OSCA 4J7BA 4GUEA 4GG5A 4LGGA 4MWHA 3G15A 3PXYA 4F65A 2BRHA 3BX5A 2ZMDA 3ZEWA 3V6SA 4O7YA 3LFEA 3RPYA 3R7OA 3AG9A 4BF2A 1B39A 2W06A 1PXPA 3TKIA 3TT0A 1CKPA 5HLPA 3EMGA 1G8SA 4CLJA 5K9IA 2VNWA 4IAFA 3C4WA 2VO6A 4U97A 4ZS4A 4I6QA 4CLIA 2UZOA 3U9CA 1YDRE 2YLEA 3KY2A 3GB2A 2O2UA 4M3QA 4H58A 2OJJA 1A06A 4WKQA 5D7AA 4G5PA 5HTIA 3OOGA 2CKOA 2GNFA 5EDRA 5HESA 2QU6A 3UIBA 3I60A 1YVJA 3RM6A 3MPMA 4EH5A 3PP1A 4C34A 5DG5A 4FTCA 4XV2A 4EK6A 4GIHA 1H07A 1BL6A 2YERA 3FMJA 1ZRZA 3H9OA 1Y6BA 5KHXA 4FIFA 5LMKA 3MFSA 5BVOA 2XNOA 2VWYA 1KWPA 4FF8A 1QPCA 3HEGA 4PL5A 3QRKA 4EOMA 4CV8A 2WU6A 4F9YA 5M44A 4IAYA 4YTIA 3KKVA 4YC6A 3FZTA 4HGTA 3CE3A 5EI6A 5BUEA 1NVQA 4MQ1A 4UMRA 4W4YA 4FTQA 3ORTA 4B6LA 4Q5HA 3R83A 3GC8A 4FTTA 4R8QA 4WHZA 5EKNA 5FXQA 3NSZA 1XHAA 3MIAA 4LV8A 1IR3A 2P2IA 5EM8A 3VUKA 3U55A 4QOXA 1H4LA 2WHBA 3MH2A 5DEYA 5HO6A 3NYXA 4O2ZA 4DFZE 2HIWA 3ODYX 5CQUA 4I0SA 3UO6A 3AMBA 2QURA 4KBKA 2X2KA 2QO2A 3R22A 5D1JA 3WZKA 5ANKA 4ASDA 3EN6A 3O96A 1FMKA 1Q62A 3FQHA 4I6BA 2NRUA 1W84A 3JY9A 3F3WA 4DGGA 2ZAZA 4R7IA 2IVTA 4RVKA 1OBDA 2ZYBA 3GT8A 4FTRA 4WSYA 1O6KA 4PDPA 5FM3A 4MXAA 4F63A 3QHRA 4HYIA 4ZS0A 4ZSJA 3UVPA 4FZ6A 2YM5A 3PFQA 3VBTA 4PL4A 2YWPA 3V01A 4AT4A 2VO3A 5DT4A 5BYYA 3REPA 5L2IA 3OF0A 4JI9A 4WT6A 4FNZA 1URCA 4LYNA 5CAQA 4NKAA 5A4CA 3CJFA 2CSNA 4R78A 4KA3A 1AQ1A 3BGPA 1SMHA 2BZKB 2QCSA 2Y7JA 3DS6A 1GZOA 4WNPA 4P5ZA 4BZNA 4J52A 5L8LA 1CM8A 3DZQA 3MS9A 4FKRA 3OEFX 1R0PA 2GU8A 2E9PA 2BRBA 3PJ3A 4HVDA 4W8EA 5CEIA 2YJSA 4RIWA 3OVVA 4BCQA 3R2BA 1PXIA 2VTJA 3GCUA 2UW0A 5I9VA 4NZWB 5AEPA 3NUYA 4BDJA 1SNUA 2FB8A 3EN9A 3UOHA 1YXVA 2BCJA 3NCZA 2Z7LA 2PZRA 3MTLA 4ZZMA 4FVRA 3L8VA 3O2MA 4IQ6A 1PKDA 5DPVA 4ITIA 5DI1A 2C6DA 5AJQA 3CTJA 3D5WA 2UW9A 3KC3A 2BHEA 4C2WA 4FV6A 4IVBA 4DCAA 1MUOA 3EOCA 2DUVA 4DH7A 3R8PA 4R7BA 2BVAA 4EWHA 3QHWA 4FNWA 3HMNA 5AR8A 1PY5A 2AC3A 4WG3A 3QD3A 4O6EA 3PXRA 1S9IA 4N70A 4DLJA 3NZ0A 4L67A 3D5VA 1NVRA 4USDA 3AMAA 4YTFA 1UWJA 3U51A 1ZZ2A 4PWNA 4YLLA 4YO4A 2RG6A 4FKTA 3LMIA 3JY0A 2RF9A 3R9OA 5ITAA 1FVVA 4AGWA 4IE9A 3PA4A 4XRLA 3ZDUA 1GJOA 1QPEA 4IJ9A 1VYZA 5HE2A 2XKFA 3OY3A 4M7IA 5E92A 4UY9A 3D7TA 1GAGA 4HJOA 2G9XA 1GIIA 5TF9A 1XH4A 5HIBA 5J5TA 3DZOA 5LOHA 1L8TA 1UNGA 3UG1A 4D2VA 3DQXA 3L1SA 3SAYA 5IQCA 2E9UA 3QQGA 4QMTA 4RIYA 3FKOA 2NRYA 3BE2A 4FKQA 3MN3A 4K11A 2BFYA 3ULIA 2C3LA 4FTAA 4C0TA 4DC2A 3VVHA 3LFCA 4Y5HA 1DI9A 4D1XA 5H2UA 4Q9ZA 2ZV8A 2ITPA 3A7JA 4I22A 5AA9A 2G1TA 4O0VA 5AP6A 4E6CA 1YW2A 2A2AA 3H0YA 1K3AA 3NEWA 3SG9A 2VTOA 5ICPA 3R7VA 4BGQA 2C6IA 3FY2A 4BCNA 4AZEA 4L01A 4GJ3A 2X0GA 4PPCA 3JR1A 4XLVA 5J9YA 3ANQA 4PTEA 5ACBC 3F2RA 4QMSA 1PMEA 4U5JA 3E5AA 3MY1A 3Q4CA 3DBEA 4R5SA 4D1ZA 2GFCA 4NTTA 4CMTA 5IQDA 4WIHA 5IQEA 3ZSHA 3LFDA 5LARA 2IWIA 3A60A 5AWMA 3QBNA 4I0RA 4AGUA 4XP3A 5HEZA 3IDBA 3PY3A 2A4LA 4XJ0A 2J0MB 3K2LA 1H1SA 3C4XA 3CY3A 3TUCA 4D1SA 4OLIA 4FKPA 5C01A 2R7BA 3R9HA 5J1VA 3BV3A 4FYOA 5BNJA 5JGAA 2Y6MA 2WTKC 2YIWA 2VWUA 1KOAA 2R7IA 3A61A 4X2FA 4EH8A 3S1HA 4N57A 5FEDA 1LUFA 2HOGA 1AGWA 3V5JA 2GQRA 3TWJA 5L2WA 4YSMA 2WIHA 4FT0A 1BUHA 2J7TA 2XK6A 2YIRA 4IM0A 3SVVA 3EWHA 3DKCA 3MV5A 1XH7A 3DK7A 3EYHA 4D0WA 4ZZOA 5J7BA 4RJ6A 1SVGA 4L00A 4MBJA 4Y72A 5FBNC 3EKNA 3SD0A 2EXEA 3TTJA 4DBNA 1ZY4A 4I41A 4J96A 4JAIA 4BICA 4CMUA 4E7WA 1YQJA 3GU7A 3NYOA 2PU8A 4FV0A 4XEYA 3C5UA 4ZY4A 4R1YA 3DLZA 4QQCA 4IX4A 4S2ZA 2YZLA 3UPXA 2SRCA 3UOJA 3HX4A 4AFJA 5LWMA 4Z16A 1OPJA 5IEVA 5KKRB 3FLYA 4WBOA 1NXKA 3EQHA 3PXQA 3IO7A 4R3CA 3VN9A 4ANQA 4CKJA 3W8QA 1UU8A 3D4QA 5JQ8A 4YZMA 4IM2A 2XIYA 4B0GA 3Q9ZA 2EUFB 3NYNA 2QO9A 3C4ZA 4H1MA 5HVJA 3LCOA 3D0EA 4DGNA 4E26A 5C8KA 4G9RA 4UWCA 4XYFA 3Q3BA 2ZV9A 1OL6A 3GP0A 4FT3A 2PVRA 4PUZA 2OXYA 4AT3A 2W5AA 1UU3A 1GIHA 4FL3A 3CTHA 5G1XA 3FZPA 4L6QA 2BDFA 5A3XA 3DU8A 5HCXA 5CU3A 1O6LA 3PG1A 3GCSA 3SXFA 1NY3A 2B55A 3FMEA 3G6HA 4WG5A 1XBBA 5DLSA 3ROYA 5DVRA 3IW5A 3ZLXA 3HKOA 3HMOA 1XH6A 3OW4A 4RA4A 2R3LA 2Y8OA 3LJ0A 4MXCA 4WSQA 5AX9A 3RTPA 2X9EA 4F9AA 3R1SA 2Y9QA 3DB6A 2O0UA 2X2MA 2XZSA 2Z2WA 2WB8A 4RIXA 3RMFA 3VJNA 1K2PA 3HP5A 2XMYA 4O0TA 4TNBA 2W1IA 2I7QA 5AIRA 4ERWA 3RJCA 2ITWA 4DITA 3OZ6A 3PVUA 5BVWA 3GENA 2IPXA 5EW8A 3G90X 4APPA 3RCDA 3L8PA 3UIUA 5BPYA 4I3ZA 2IO6A 4NJ3A 1OGUA 2UW5A 5J7HA 3R0TA 4YURA 2C0TA 5AV2A 5HNBA 2QQ7A 2W0JA 2WMUA 2WMXA 4RT7A 2YAAA 5HORA 1OKWA 3Q5IA 4M67A 4P7EA 2WMQA 4L45A 4O81A 2JGZA 3E7OA 2C5YA 5BVKA 4BDCA 4QYHA 2GS2A 3DPKA 3R9NA 3SV0A 5EI8A 3N4VA 3BBWA 5DNRA 4EOQA 2YWVA 2QNJA 2YM8A 3E87A 4Y85A 4FT9A 4J71A 5EHOA 3OY1A 3RAWA 4BZOA 1OIRA 4U81A 3OROA 3D2KA 2WQMA 3Q9WA 4DFLA 3R1QA 2CCIA 4K0YA 3VAPA 5M07A 4D2PA 5BVFA 3M42A 3MTFA 3KK9A 1WBNA 3DFCB 3F5UA 4C4FA 2W05A 3NPCA 4U45A 3LXPA 3OMVA 1H28A 3DK6A 3RKBA 2CHLA 3R1NA 4BRXA 5IZFA 5TT7A 4RPVA 3ZDIA 1JKKA 4MCVA 3RK5A 2HAKA 4UYAA 3VHKA 4TYEA 3PXKA 1PXJA 5LVNA 4PY1A 4QP2A 5M56A 3HUBA 3LLAA 3QUPA 2JEDA 3FKLA 3E62A 2DS1A 4PPBA 4PMSA 2RIOA 1YOLA 1WVXA 3G0FA 5JMSA 4ZSAA 3KULB 3MPAA 4CTCA 4XS2A 4RLKA 2XKEA 1Q8ZA 2XIRA 4DEDA 2IW6A 3EQDA 5FWKK 2OICA 3QAME 3P86A 4AE6A 2WELA 2VTNA 5K4IA 3KXMA 1OPKA 2PK9A 5ANIA 3BI6A 4EOLA 3PY0A 3LCTA 5FP6A 3F69A 5AUUA 3QTWA 1JSUA 5EQEA 3FI3A 3NDMA 4IADA 3OWKA 3A7HA 4B7TA 1YWRA 1YHWA 1X8BA 3SG8A 5D12A 5LMKC 3KQ7A 3LCDA 4FKSA 4GFMA 3MB7A 2XA4A 3N4UA 2F7XE 3II5A 3KN6A 4D55A 3ALOA 3GU4A 3QZFA 5GIPE 1YXUA 2VN9A 3QCSA 3UQGA 4C4EA 4C4GA 4FKOA 3UG2A 3QL8A 2F9GA 3H4JA 2OG8A 3A62A 3RZFA 4E3CA 3QYZA 3E8NA 3OTVA 5HIDA 3U6HA 1JKSA 2JIUA 2QHMA 2C6OA 1XWSA 3GI3A 3JS2A 3RALA 4EQCA 4BGHA 3THBA 4NYEA 1M2QA 3BHVA 3ZLYA 2XH5A 3KRRA 3LFBA 3P7AA 2VWWA 4LI5A 3LPBA 4XG9A 4FSUA 2PMIA 3JXWA 3ORNA 2QD9A 3A7IA 3QKKA 2IVSA 3DGKA 5E8VA 4IB1A 4CFNA 2QC6A 4LOPA 4R3PA 5AP2A 4CFVA 2GQSA 2C4GA 4LFIA 3CS9A 3F7ZA 4FGBA 4FSYA 5HX6A 4MTAA 4BI1A 3ELJA 4S34A 1PMVA 1J91A 3HV6A 4MYGA 3COMA 4QPSA 1V0PA 5KZ0A 2UZLA 3DFAA 2WOTA 4TWNA 4FX3A 4II5A 5DH3A 1H24A 4ZLYA 5LVOA 5M4UA 4ZTRA 3MB6A 2GPHA 1FOTA 1Y8GA 4MAOA 5HNGA 5CT0A 3D5XA 2J0IA 5JGBA 3H0ZA 2YIXA 3DBCA 4IB0A 1FPUA 4EBWA 2BDJA 2F49A 5C26A 3RP9A 1PF8A 3QA8A 4DLIA 4O22A 5EYMA 3TXOA 4PDYA 3K54A 4QTBA 4GU9A 4IB3A 3RVGA 2CN5A 3GCVA 5AP5A 5HG5A 3U87A 3FLSA 5FUTA 5CTPA 4OAVB 4XMOA 3WF9A 3M11A 4YC8A 3MFTA 3UC3A 2IZTA 1Q8WA 5I4NA 5AUXA 4BCKA 3I1AA 4I5MA 4C02A 3ATSA 2JAVA 3GU8A 4IDVA 5EHLA 2F57A 1YWVA 3DAKA 5HLWA 3LJ1A 5FDXA 2OIDA 5J1WA 2JDTA 3MW1A 4TYGA 2CGWA 5EM5A 4ZJJA 2WGJA 4ACHA 3ZO1A 5B2MA 2BZJA 3O8TA 3TDVA 4DEEA 4FIEA 5H3QA 4TPTA 4FVPA 5CF6A 4O0XA 4FV8A 1DAYA 1SM2A 5LVLA 4GIIA 3MA3A 4FTKA 4JDKA 2R3KA 4IZAA 4HZRA 1UVRA 3PZEA 3ZC5A 3DCVA 3QTZA 3NX8A 2ITUA 4QQTA 2H8HA 5J8IA 4XG4A 4MNFA 3GU5A 4YO6A 1OUYA 4YZNA 1PMUA 4FUYA 5AX3A 4EH4A 3QZGA 4JR3A 3OWLA 3GBZA 3UDBA 3AT3A 2WTDA 4F1MA 3VS1A 4HYSA 4L3JA 4MD7E 3E8CA 4FTIA 4UMPA 1OKZA 3BYUA 4OTGA 2HW7A 4AGCA 4BI0A 4BZDA 3BWFA 5CI6A 4FSMA 2C3KA 3RCJA 1YI6A 4NM5A 3T9IA 5EQPA 3MGYA 4FZAB 5JKGA 3LM0A 3SRVB 5J5SA 4N0SA 2FA2A 5EW9A 2VX0A 4AZVA 4M66A 4CG8A 2IZRA 4C35A 4D2RA 3FE3A 4QNYA 4UYNA 4NU1A 3PIZA 3EFWA 4BHZA 2VTPA 4JQ8A 3SHEA 3UNJA 2J5FA 1CSNA 4ASZA 3HDNA 2YCFA 3HP2A 5CAOA 1OIUA 3PPZA 4O7TA 4I1ZA 4QQJA 1STCE 1ZY5A 2G01A 3S95A 5EFQA 1H26A 1KE9A 3BYMA 2C5NA 5FLFA 3MY5A 4FBXA 1KE8A 1PJKA 3BRBA 1B38A 3ZEPA 5A4EA 4WG4A 5M06A 3D83A 3H10A 2Q0BA 4QMUA 4FG9A 3C5IA 4FSQA 4JG6A 2VTRA 5IUIA 3QX4A 4BWXA 4C3FA 3CD8A 3FQEA 3LAUA 3BKBA 3R8LA 5GNKA 2P3GX 2VAGA 4PQNA 3VUMA 2C6TA 3QF9A 3TN8A 3G5DA 4TWCA 3EQPA 4PX6A 3R00A 4DH3A 4ZTLA 4X2KA 3F66A 4NIFB 2O3PA 3F2NA 4O6LA 4TKSA 1WBTA 4J99A 4UXQA 4XHKB 5EYDA 3ZO3A 2AYPA 2ZMCA 3ROCA 3FL4A 4HPUE 4KRCA 3UIXA 4F9WA 3AD6A 4ZIMA 3FYKX 3LCKA 1BMKA 3FQSA 1JKLA 2F7ZE 4O0UA 3I4BA 3MVLA 3SX9A 3UOLA 4CMOA 4YJVA 4TXCA 3TNWA 5BVEA 1H8FA 4NM7A 5DR9A 5TOZA 3TEIA 5IISA 2FSOX 4XOZA 5DGZA 4IEBA 2QONA 4YJSA 3TJDA 2HENA 3E3BX 2V62A 2IJMA 3NVKI 3JVSA 3DTWA 4ZJIA 3W16A 4AACA 2HK5A 2QG7A 4AW2A 3OC1A 5D41A 3A8WA 4FIJA 3RPOA 3FHIA 4WNMA 3OW3A 4TYHA 2HXLA 3LM5A 3R21A 2XF0A 3ZZEA 2J2IB 2OZAB 2YZAA 1UNHA 3NR9A 4FA2A 3LHJA 3Q53A 3RPRA 4O7RA 4IX6A 1W0XC 1SVHA 2XEYA 4OTIA 5F9EA 4AW1A 3VNTA 2WTCA 5EOBA 4N6YA 4C61A 4P5QA 4JIKA 1PMNA 3GCQA 1OBGA 5IQBA 4TT7A 4R77A 4YJRA 3RZBA 5BQ0A 1JQHA 4FKWA 4I5PA 5JFXA 2YFXA 2CPKE 2PVNA 1AD5A 4G3CA 4FOBA 4UBAA 2GNGA 2WXVA 2GFSA 4M15A 3FPQA 1BI8A 3A4PA 3K5UA 4K8AA 5FP5A 3DY7A 3PE2A 4PDSA 3PE1A 4YHFA 3TNIA 3DXPA 4AE9A 3FDNA 3ORLA 4YBJA 1H08A 1UU7A 4WNKA 4X6RA 3U4UA 2PVMA 3ZO4A 3COKA 4BIEA 3LMHA 4Y95A 2JIIA 3LE6A 2PY3A 3V04A 3HMMA 3S3IA 3RNYA 4A06A 5L4QA 4IWPA 4LGDA 2GHMA 4M69B 3LXNA 4RGJA 3TUBA 3ZM9A 5IQAA 5H8GA 1MQBA 3TKHA 4JG7A 4MX9A 2YA9A 2JBPA 1W98A 2YJRA 4ORKA 2HZIA 1IA8A 2O8YA 4OTRA 5D9HA 5CX9A 5DR6A 3I0QA 3WZDA 5BX0A 2RFEA 3KA0A 2ZJWA 4O96A 4I6HA 4TZRA 2CMWA 2NPQA 5CEOA 3POZA 5IQHA 5K5XA 2GTMA 2WMTA 1Q8YA 3I81A 3QCYA 2OFUA 4IX3A 4D4VA 1J7IA 2G2HA 2PE1A 1BKXA 3F3VA 3C9WA 4O21A 2EU9A 2FVDA 3C50A 3VBVA 4BGGA 2WMAA 4C8BA 4ZK5A 2RKUA 5CEPA 3ZHPC 3ZLSA 2J50A 3L9LA 4PTCA 5K5NA 3LFAA 1XJDA 2OJ9A 4RG0A 4XX9A 4I92A 4OTPA 1ND4A 2W4JA 3AC2A 2R3PA 3F3TA 2Z7SA 3ERKA 4O27B 5CU4A 4FKJA 3VHEA 2C0IA 4GU6A 2VWBA 5HD7A 3POOA 1M17A 2ONLC 2QKWB 2YLFA 4MF0A 3UO5A 2WMSA 4IWOA 4BBFA 4F99A 2IG7A 4X3JA 4DA5A 4RJ5A 4NCTA 3KL8A 1XH9A 4FICA 5I9UA 5KZIA 3WF8A 4DGLC 3CKXA 4O7WA 2E9OA 3ORKA 4BDGA 3D7ZA 4FV4A 5BYLA 2NO3A 2YCRA 3R9RA 3D9VA 2OF2A 4IVDA 1Q97A 3NMUF 5BYZA 3C4CA 4RX5A 1RE8A 4FV9A 1Q61A 2VUWA 5HBHA 4Q9SA 1UA2A 3R7EA 4S30A 1OKVA 3TNPC 4F08A 4QTDA 3W2OA 5F1ZA 1YHSA 4AZSA 3ZZWA 4NFMA 3QXOA 1W8CA 4V0GA 4BDDA 4QMQA 5B2LA 4QYGA 5JRQA 4FL2A 1UKIA 1H00A 3GGFA 3OS3A 4FIGA 4JQEA 2PVFA 2XB7A 2ZOQA 4KIKB 3SW7A 1ZOGA 3PSBA 3GNIB 3AQVA 4XH6A 3AC1A 2RG5A 3MA6A 3LFNA 2W4OA 4DHFA 2R3OA 2C30A 3BPRA 4QMVA 4M8TA 3G9LX 2JD5A 3F2AA 3G6GA 1L3RE 5CWZA 1S9JA 4XG6A 3IW7A 3PVGA 3VJOA 3IGGA 2A0CX 2QOHA 4IZ7A 4KSPA 3P1AA 3UZPA 2WD1A 1E9HA 3A99A 3FC1X 2GTNA 2A19B 4MHAA 3FZ1A 4OTDA 1PXNA 5FG8A 4BKJA 1DAWA 2I0VA 2OLCA 5AUYA 4B8LA 1UKHA 2VD5A 2OO8X 5AR3A 2WTKB 2PTKA 2AUHA 4MQ2A 3SKCA 5CVFA 3ZUVA 4NH1A 2H9VA 2C1AA 5HCYA 1MP8A 4F6UA 2OH4A 3EFJA 5CU2A 4F7NA 5JFSA 5FTOA 5LCJA 1J7LA 4HCTA 4K9YA 5IDPA 4CD0A 4QP1A 3AC5A 5I9ZA 4O7VA 2R3FA 2B52A 4QP6A 4PPAA 1KV1A 5TE0A 4E5AX 3V8TA 4O1OA 5EDQA 1XR1A 3E63A 5EG3A 4C7TA 5CEMA 2P0CA 4F64A 5DBXA 1JVPP 5K3YA 4DCEA 2YABA 4QMLA 2A1AB 5CVGA 5M08A 5E8TA 4EKKA 4EH2A 2GS7A 4O7LA 3FL5A 3ACJA 4OR5A 2W9FB 3BYVA 4C4IA 3QRTA 5L6PA 3B2WA 4QP9A 4JAJA 3FI4A 3HZTA 3CPCA 1R3CA 4JBOA 1OUKA 2XVDA 3C4EA 1JNKA 1IASA 4UWYA 1H1WA 2UUEA 3JUHA 4K1BA 3F82A 4PP9A 4GCJA 2QR7A 5AFVA 4FT5A 3BHUA 3EL8A 3IKAA 5KCVA 5FXRA 2XNEA 4FZFB 4FIIA 4QTAA 1KUTA 3SQQA 2RSVA 2YM7A 3ORXA 4FV5A 5F20A 4FEQA 5JZNA 5KMJA 4EC9A 3ZFYA 1KV2A 3CKWA 2VTQA 4XRJA 1Q24A 3UQFA 1MQ4A 2PVHA 2X9FA 4G17A 3E3PA 4BI2A 1FINA 2B0QA 3QD2B 2AC5A 5CALA 2ACXA 4CKRA 2V7AA 4RX9A 2JFLA 2HELA 2CNQA 3PXZA 2QG5A 4HYHA 2WO6A 4I20A 3QZIA 4FKVA 1QMZA 5F94A 5A6OA 3Q9XA 2O64A 3P7BA 5TR6A 2VWVA 3TUDA 4ZTSA 2UVYA 4PDOA 2B9FA 2GHLA 4ZMEA 4RFYA 2IW8A 4FMQA 3I0OA 4XG7A 4EQMA 3FSFA 3R8UA 3G0EA 4MH7A 4GK3A 4IVAA 4YC3A 4IMYA 4XV3A 4F0GA 3PJ8A 3QA0A 4U40A 3PRIA 5EOLA 1YDSE 2XYUA 4G6OA 5C9CA 4OT6A 3V5TA 3W2RA 4CTBA 5I3RA 3WF5A 3DJ5A 4I4EA 3ORIA 4NKSA 5CEQA 1DI8A 4J98A 1OM1A 4WUAA 3RAHA 5HTBA 2VX3A 5AAGA 3S00A 2VTHA 4IJPA 4YJPA 4EZ3A 2WMBA 4F6WA 3TZ7A 4LM5A 4BKYA 2J4ZA 5BUJA 5HO8A 4XNEA 1Z57A 3ZFMA 3I7CA 3GC0A 3QGWA 4OTWA 2QLQA 3IOPA 4BDFA 4GK4A 4IZ5A 4DH8A 4R1VA 5HVKA 2QODA 1JKTA 2A27A 2W5BA 3KB7A 5A9UA 3U6IA 4GYGA 2WU7A 4FV1A 2VWZA 4YPSA 5B7VA 3BU5A 3UMXA 4FUXA 3KMWA 4ZTNA 1MRVA 4F1OA 4HOKA 4KBCA 4WBBB 5C8MA 4AA5A 5AUTA 3U9NA 4ZLZA 1GNGA 4QNAA 3IOKA 1YOMA 2E9NA 2BAQA 3QQHA 4LL0A 2EVAA 3P08A 4RX8A 4E1ZA 2W1DA 3I6UA 3NUUA 4MNEA 4ACDA 4BHNA 3MVJA 3FBVA 4YPDA 1CTPE 3Q4ZA 3QWKA 2QI8A 4JDHA 4EQUA 2JITA 2YM3A 5AAEA 4DT9A 2F4JA 4FEWA 5KBQA 2W17A 2WTVA 3C13A 4FNYA 4TRLA 4W9XA 3KGAA 4F09A 2CKPA 3OCTA 3P7CA 1V0BA 1UNLA 4BTKA 3LVPA 2UW8A 4LOOA 3MI9A 4AG8A 4FSNA 5CXHA 2XNPA 2R4BA 5DMZA 2YEXA 5CSVA 1BYGA 5AUWA 1REKA 1QPJA 3VS3A 3EN5A 5FEEA 1NW1A 5CF4A 1YXTA 5ETIA 4FIHA 3DBDA 4WOVA 3TZMA 1OI9A 5I9XA 2PVLA 2KTYA 4YP8A 2I0HA 1J3HA 1I44A 5D11A 4O7SA 3MVMA 3UVQA 3KREA 2OJFE 4G6LA 3W2QA 3LCSA 3ZFXA 5BMSA 2W1GA 5KMIA 5M51A 4CVAA 4O83A 3FZRA 1ERKA 4MXOA 3TCPA 3FUPA 4B99A 3UO4A 3IG7A 4E73A 3DV3A 3EN4A 4D58A 4Y46A 4CT2A 2W5HA 3CQEA 5BVNA 2BRMA 5HI2A 2UZNA 4HZSA 4UMUA 3IS5A 4JS8A 2ZB0A 4ZAUA 1Q4LA 4DFUA 2HCKA 4AAAA 4IZYA 3DKOA 3TTIA 3A4OX 4DFYA 1M7QA 4O0RA 2W1EA 5AV4A 3PJ2A 4HVSA 1OL7A 1IAJA 5LMAA 1WBOA 4PNKA 3HV5A 2G15A 1YI3A 3DTCA 4YUQA 4QP4A 3NIZA 3DXQA 4EK5A 1F3MC 4D5HA 3BHTA 2PUUA 5K4JA 5C4LA 4KD1A 3EZRA 1APME 3QALE 3KXGA 3R8MA 4EUTA 3RNIA 3BV2A 5IQFA 2B9IA 1BLXA 1ZOEA 4NTSA 4QQ5A 2J6MA 1U54A 3UP2A 2RFDA 4U80A 4CKIA 2XIXA 3ZU7A 4AWIA 4HYUA 1HOWA 3NNWA 1UWHA 3IW6A 3OFMA 3Q96A 4GS6A 3OXTA 2Z7QA 5AP1A 2XNGA 4CG9A 1H27A 3CQWA 5EI2A 4P4CA 4H39A 3TKUA 5CZIA 3FI8A 2Q0NA 5EDPA 3P0MA 5C03A 4C3PA 5I9WA 3F5GA 4GRBA 4GVAA 4CNHA 4BCJA 3GQIA 1P5EA 4OBQA 3PA3A 4EUUA 3BCEA 4HCVA 3W2SA 3BHHA 3FLNC 3OTUA 3DDPA 3PJCA 2R5TA 3ZC6A 4C58A 3AT2A 4KKEA 3RHXA 4DTKA 2PVJA 2ONLA 1SZMA 5HZNA 3WE4A 4FG8A 4RWIA 2VTAA 3DOGA 2P4IA 5E1SA 3EN7A 4BTJA 4XOYA 2X8IA 4KIOA 3KEXA 2X8DA 4NWMA 3FC2A 5CZHA 2ZV2A 1XKKA 5DFPA 4BCPA 5HTCA 2XBAA 5CSHA 3PIYA 2ITOA 4KAOA 2NNWB 4CEGA 2WQOA 2WTIA 4RFZA 3Q6WA 1CMKE 5FEQA 2JLDA 4RWKA 5E4HA 4U6RA 1OVEA 2FH9A 4DTBA 1OIQA 4IAKA 4RIWB 4X3FA 5HHWA 5GJFA 3RWQA 4QYEA 3QD4A 3UYTA 4DTAA 5DEWA 3HRBA 4RRVA 3DA6A 5GHVA 2X39A 2BZIB 2X4ZA 4YJOA 3QC4A 2Q83A 5IQGA 1Q8UA 3CSVA 5IMEA 4L53A 1E1XA 3OT8A 3TG1A 4U3YA 4AN3A 3ZLWA 1YI4A 3KRJA 3DJ7A 2R2PA 3TDWA 5AP7A 1TQPA 4G6NA 5GJDA 3KXNA 3T9TA 4BYIA 3ZSIA 3MESA 3VW6A 2OIQA 4RJ3A 3HYHA 2UVZA 1R0EA 2X7GA 4RIOA 3JVRA 3DBQA 2ZDTA 3QYWA 2CNVA 2ETRA 4F0FA 2BILB 2VX1A 1XBCA 1SVEA 4E6QA 4PMPA 3VRYA 2CJMA 4NUSA 3QTQA 5CY3A 4ZLOA 2FSLX 1QCFA 3FMDA 3QGYA 3MIYA 2O5KA 4CFUA 2GS6A 3CC6A 4C37A 5HU9A 2FSMX 3NRMA 5JZJA 3VS0A 3QQFA 2VGOA 1WBWA 4L7SA 3D7TB 4CGAA 4ANBA 2C3IB 3GFWA 3HLLA 1IG1A 2UV2A 3DB8A 2WMVA 4FTUA 4R7HA 1WBSA 3L8XA 3NAXA 3VS6A 4IX5A 5CXZA 3OCGA 4YGAA 3MH1A 3UZRA 4P2KA 1VEBA 4RIYB 5E8ZA 3RPVA 1TVOA 5E8SA 2BMCA 3CGFA 4BYJA 3WF7A 4NCTC 4C38A 5L6OA 4I6FA 4LMNA 4BDBA 4YNEA 4CFFA 3LJ2A 4ITHA 4NEUA 3N9XA 4F7SA 4O7ZA 2CDZA 4G16A 3QCXA 5CT7A 2HY0A 4BDHA 2W1FA 3EQIA 4YJUA 5CQWA 3TZ8A 5CAVA 2YCQA 5FXSA 1J1BA 5CASA 3C0HA 3FLQA 3C0GA 5CENA 5M4IA 3O7LB 3VUGA 3KRWA 1GZNA 3PJ1A 4M13A 5E8YA 3IK3A 4D4SA 4EH9A 4G3FA 5KKRC 1ZLTA 2PZ5A 2PL0A 1P2AA 3FMLA 4O1PA 4PMMA 2WEIA 3BYSA 4N4SA 4YHJA 4K33A 3NNUA 4KRDA 3KVXA 3AD5A 1JBPE 5EKOA 1GY3A 4HVGA 5AMNA 2OH0E 5FBOA 4YTCA 2VTIA 4DYMA 4HCUA 3EQGA 1WBPA 3Q2MA 4R3RA 2UW4A 5EHYA 3WARA 3Q4UA 3NNVA 5HG9A 3UPZA 3TI1A 2JFMA 2WEVA 1FGIA 1F0QA 4ARKA 4ZY5A 3V5QA 3HUCA 3W10A 3CLYA 3DXNA 1VR2A 4RJ8A 2W9ZB 5F95A 5JK3A 5LWNA 3GU6A 5J87A 1JAMA 2BALA 2P55A 3ALNA 3DQWA 1ZWSA 1R39A 4I4FA 4YLKA 5CLPA 4FTJA 3ZMMA 2YIQA 3SOAA 4ZZNA 2C47A 2CGXA 3OHTA 4IB5A 2PSQA 3R7GA 2W1CA 4KBAA 4CXAA 5AUZA 3AXWA 3FZSA 3OXZA 3A8XA 4NSTA 3IW8A 3UNKA 4RZVA 2XJ2A 4DN5A 3W2CA 2JDOA 5IA2A 4BIDA 4EK4A 3HA8A 1SNXA 5J9LA 3FV8A 1ZMWA 2I6LA 4KINA 3UZTA 2CKQA 2X4FA 4OGRA 5CSWA 3PSCA 3R01A 5ETAA 3RK9A 1LEZA 5IA4A 5H9BA 1GZ8A 3NUAA 2X6DA 5H8BA 1TKIA 4M12A 5FQDC 3OCSA 2GNLA 2PYWA 2DWBA 2VTLA 3TNQB 3ZRLA 2XRUA 4S32A 4MWIA 4BC6A 4FKGA 4V04A 3PIXA 3PSDA 4QP3A 4CRSA 2JKMA 1REJA 2FGIA 2CGUA 4WUNA 4RJ7A 3V6RA 1WCCA 4GKIA 4M0ZA 4G34A 4U7ZA 2IZSA 2CLQA 4CRLA 4DH1A 4EOPA 4LQMA 4YZ9A 4ACGA 4E20A 4F70A 4HGSA 3QTIA 3QTUA 4L8MA 4JL9A 4V05A 4J53A 2IN6A 3R8ZA 4PV0A 3RBWA 5AADA 2R3IA 3F61A 4ALVA 1KE6A 4Y5QA 2HZNA 2W1ZA 4L43A 4RVTA 3DKGA 1LP4A 5JT2A 4EHGA 3LMGA 3ORMA 3OUKA 4RC4A 3C7QA 4GL9A 4EHVA 2OBJA 4Z55A 4GT3A 2ERKA 2XJ0A 3OT3A 3VBWA 3P23A 2JBOA 2PMNX 3HRFA 1WVYA 3I6WA 4QD6A 5IA5A 3Q04A 3QUEA 3W8LA 4KNBA 4O7NA 5HVYA 3KCKA 2WTWA 5HGIA 5I9YA 3EJ1A 5H8EA 5KMMA 5IA3A 3N4TA 5AP4A 4O0SA 4I94A 4BTMA 4ENXA 1PYXA 5BVDA 3FLWA 3HECA 2B9HA 2X81A 1YHVA 3QKLA 4H3BA 5JRSA 4RIXB 3KRXA 2R3QA 4D5KA 4DG0E 4QMWA 4GEOA 3T8OA 1Q41A 3C1XA 3RHKA 1I09A 3VS4A 2BUJA 4FZ7A 4NL0A 3BLQA 5M53A 4AGDA 4L52A 2Y4IC 5DIAA 1BI7A 4IAIA 1FGKA 3MVHA 4XG8A 3BEAA 4EBVA 3NS9A 4YJQA 1PXOA 2XS0A 4BWPA 5GZ8A 3TJCA 4W4XA 2EWAA 4QRCA 4A9SA 1GZKA 5DR2A 5A4TA 1VZOA 2BZHB 3PPKA 4IAAA 3OEZA 3Q6UA 4BL1A 1U5RA 3UE4A 2QOLA 4QYFA 4CYJA 4IFCA 2XKDA 3FMMA 3FSKA 3W2PA 1WMKA 3L8SA 4RWJA 4Z7HA 3ZBFA 5DWRA 3OCBA 3QC9A 1KSWA 5CI7A 5AV0A 2C69A 2RFSA 3UOKA 4E6DA 4LMUA 4HNIA 3RPSA 4C33A 3CIKA 4ZJVA 1SYKA 1HCKA 4H3QA 5KE0A 2C6KA 4K6ZA 2V7OA 1KE7A 2QOOA 3LQ5A 3TACA 4IXPA 2ITVA 5L2TA 1LEWA 2PE0A 3WIKA 2GDOA 4X7QA 3W55A 4YHTA 2JKKA 3QXPA 4H1JA 4L46A 3M2WA 4Y8DA 3RGFA 2JKQA 5DRDA 3KCFA 2OJIA 5KX8A 3HDMA 1A9UA 4L68A 2EB3A 5CNNA 3VRZA 4ASXA 3AC3A 3IONA 5EQYA 1P4FA 2QU5A 3A7FA 4ANLA 2HYYA 4RSSA 4AXAA 3E93A 2F2CB 3FMHA 4IBMA 5TO8A 4GSBA 4PRJA 2C6MA 4Z9LA 5FTQA 3FXZA 1OKYA 2ITXA 4DEIA 4DEHA 2ITYA 4D9TA 1JLUE 3LIJA 4JBVA 4FV7A 1NVSA 4Z7GA 4D4RA 4JVGA 5JGDA 5L6WL 3NCGA 4X2GA 5AR4A 3SXRA 3V51A 2RFNA 3QQLA 3FEGA 5JQ5A 2BR1A 1WZYA 4RQKA 5IH5A 4CT1A 3EL7A 3HV7A 4RC3A 1H1QA 2G2FA 4O2PA 5L2QA 2PPQA 2XP2A 2OZOA 2Z60A 3O17A 3ZOSA 5CNOA 3BELA 2ITNA 2WIPA 3OWJA 3FMNA 3HMIA 1IAHA 5AR2A 1QL6A 1XO2B 2VV9A 3B8RA 3EFLA 3FYJX 2GHGA 3LFSA 4J95A 4JIAA 4XBUA 5AAFA 3WI6A 2PVYA 5HNIX 2B1PA 5HIEA 4A4OA 4QMOA 2REIA 1Q5KA 3CQUA 4ZTQA 2BDWA 3G33A 4G9CA 4QPAA 4NM3A 4G31A 4APCA 2WOUA 3KN5A 4S33A 2XM8A 3UVRA 3HAMA 1ZYSA 2JDSA 3TM0A 5JEBA 4GFOA 3NUSA 5KMKA 3SGCA 5CS6A 2CGVA 1TQMA 2XNNA 3NUXA 4L3LA 1Q8TA 4U3ZA 2VGPA 5T68A 3MFUA 3QRUA 4F7JA 5KMOA 4GVJA 2B54A 3SC1A 1UU9A 3IGOA 4UZDA 2XK4A 4GG7A 4NM0A 3BEGA 4OBOA 2EXMA 3KK8A 4DEBA 4EH3A 4F4PA 4QTEA 3ZUUA 1YWNA 4LUEA 4OAUC 4XV9A 2GMXA 4QYYA 3W1FA 2YDIA 4MXXA 3C51A 2OI4X 3KF7A 4RA5A 3TIZA 1QPDA 3WE8A 4JBQA 3G9NA 4TYIA 2WQBA 1E1VA 4HNFA 3P4KA 4CQGA 1OECA 4G5JA 2C3JA 4IANA 4AOTA 3AD4A 1RDQE 3AOXA 2GNJA 3H9RA 1M52A 2E2BA 3PVBA 4ZSGA 3RWPA 2WPAA 5BUIA 1EH4A 2ETKA 4MXYA 5HG7A 3TIYA 4U79A 3BGQA 4A9TA 3MPTA 3NIEA 3MH3A 4ENYA 4UX9A 4XG2A 3D5UA 4TL0A 4E5BA 2QHNA 5K0KA 3G51A 2XCKA 2C5XA 4FZDB 5E8UA 3EQCA 3K3JA 4QP8A 3HVCA 4YTHA 4AT5A 3FMKA 5CANA 2UW7A 4X3FC 4ZTHA 2YCSA 4D2TA 3VUTA 4YZBA 4RLLA 4U44A 4EHZA 4A7CA 5A46A 2BRNA 4M84A 3NWWA 5FD2A 4IIRA 3T3UA 3RAIA 4LV5A 2DYLA 4KS8A 4FVQA 4W4WA 5HE3A 2PWLA 5ETFA 2OFVA 3VC4A 4Y83A 3SOCA 4JQ7A 3BZ3A 3OWPA 2XK3A 3AC8A 3LZBA 3OUNB 3OXIA 4JRNA 1CKJA 3ULZA 3NNXA 2J0JA 1W7HA 4EOOA 2ZM3A 3MY0A 2R3NA 3MSSA 3LFFA 3U54A 1OZ1A 3F5XA 4N6ZA 4CZYB 5FGKA 3K3IA 4FSZA 1YXSA 2QR8A 2ZV7A 3R71A 3L9NA 2F2UA 4AA4A 4DGMA 5CF5A 3V8SA 5HBJA 3O0GA 4IC7A 2EXCX 2PZIA 5EH0A 2V0DA 1U5QA 4D28A 5D7VA 4CCUA 4ANNA 2ERZE 4KUJA 5AR5A 5LCKA 3C4FA 3QLGA 2RL5A 4MEDA 4M14A 3V5PA 5AR7A 2C1BA 3WILA 1OL1A 4EL9A 3ZXTA 3HAVA 3CBLA 4FI1A 3IPHA 2UZDA 4YLJA 3HL7A 2CCHA 1IRKA 2Z7RA 3M1SA 3UC4A 4W4VA 3VQUA 3WZUA 3O8PA 1IA9A 1CKIA 2PHKA 2GQGA 2P33A 4IM3A 2FUMA 2QLUA 3ETAA 1DM2A 4JLCA 3TZ9A 5AP0A 3HGKA 3DLSA 3ZXZA 4YMJA 1J7UA 3F3UA 3BGZA 4BCIA 4EH7A 4FL1A 4FSWA 4HVIA 3I7BA 5JH6A 4ERKA 4C62A 5I0BA 4MK0A 4JDIA 2G2IA 5FM2A 4MD9E 4WO5A 5GINE 3HRCA 3MYGA 1ZOHA 3ET7A 4BVUA 2YITA 2JDVA 3L9PA 5L8KA 4FEVA 1Y57A 4AW5A 3NYVA 3QWJA 2VWXA 3NW6A 1T46A 4BB4A 2VZ6A 3QRIA 4PMTA 4Z3VA 2F7EE 3TV7A 4EWQA 4I23A 2Y0AA 4RQVA 4YR8A 5HD4A 2X7OA 5J9ZA 4KIQA 3BHYA 4BIBA 4A4LA 3KVWA 3F88A 5CU6A 3LKMA 2PMLX 2XCHA 2WZJA 4PP7A 2BTSA 2BHHA 4XUFA 5CEKA 1ZYCA 2UZTA 3R2YA 5IEXA 4EH6A 3ACKA 3VBXA 3ORZA 3JYAA 4XBRA 4HVHA 4USFA 3R04A 2ESMA 1V1KA 3HV4A 4ZXTA 4CYIA 4CCBA 4DEGA 4DF3A 4DGOA 3BYOA 4LGHA 3E7VA 2QOBA 4MKCA 3TV4A 3NLBA 4G2FA 3B2TA 2JDRA 2E9VA 2O65A 3KULA 5AM7A 3WBLA 2C6LA 4FV2A 5HX8A 4UV0A 1ZAOA 3QTRA 3NVMB 1URWA 4O0YA 3UJGA 1P4OA 3V5WA 2HW6A 5DA3A 3VQHA 5C1QB 1H01A 4JRVA 1YKRA 2XIKA 5ANEA 4F0IA 5IH4A 3NW7A 1GIJA 3VBQA 2PUIA 4FTMA 5IUGA 4TYHB 3FKNA 4BDEA 4W9WA 4RJ4A 4H3PA 3VO3A 1RJBA 3DBFA 4AQCA 2YM4A 4TWOA 3CJGA 4U43A 2QOFA 2J0LA 4QMZA 2IW9A 3PLSA 2V22A 4L9IA 4DINA 1ZARA 5K0XA 2W4KA 2YISA 4RBLA 3QZHA 4AS0A 2X1NA 2I0YA 4AA0A 4ANOA 2OKRA 5CVHA 4X2JA 2OGVA 2UZWE 3FY0A 4WRSA 3WZJA 3SA0A 2BROA 4KIPA 1ZYJA 4X6QC 5ANGA 4E4XA 1XQZA 3ZUTA 4O84A 4GV1A 2C0OA 1M7NA 3GC7A 3SDJA 3W33A 1WBVA 3QQKA 3QKMA 3UMWA 4UN0C 3JPVA 4FK3A 4KABA 4AN2A 3O71A 5HBEA 4UWBA 4AUAA 3IDPA 2Y4PA 4UZHA 5EW3A 4W8DA 4B8MA 3O51A 3PP0A 4FYNA 4WNOA 4JG8A 4UMTA 3F9NA 3C0IA 1Y91A 3QRJA 3S4QA 4A4XA 4BWKA 3SLSA 3BU6A 4G3DA 2OXXA 3IDCA 4B9DA 3LLTA 2ZM1A 2XK8A 4UB7A 4QMNA 4QTCA 1JPAA 3KFAA 4KKGA 4K2RA 1Q3WA 3ZH8A 2FYSA 2QOCA 3GOKA 5JSMA 4ZP5A 3VIDA 1ZZLA 4PTGA 2VTSA 3KXXA 4YJTA 4FT7A 4XG3A 3O7LD 5FDPA 2HXQA 5E90A 4RC2A 3U4WA 4FTOA 3GXLA 4X2NA 2J9MA 5FRIA 4BBMA 4AF3A 5A4LA 3CY2A 3PTGA 5ANJA 4F9BA 1W82A 2ZVAA 3P79A 4MBLA 2H6DA 4FR4A 4FKUA 5LMBA 3E88A 1BX6A 4BCHA 4R6VA 2YACA 3GCPA 4E8AA 5IA0A 3V8WA 4E4NA 4CV9A 1Y6AA 1RW8A 5HICA 4DAWA 5KUPA 3H9FA 1UV5A 4J8MA 5T3QA 4HGEA 3MFRA 4JDJA 4Q5EA 5ACKA 5I5ZA 5IF1A 3VS5A 3OD6X 3V5LA 4ACCA 4U8ZA 4V01A 4BCFA 4FTLA 4J97A 4ZSEA 2YAKA 4EOKA 4FKIA 4NW6A 4YU2A 2X2LA 2BIKB 3R1YA 1H1PA 3KXHA 3FJQE 1W83A 4BN1A 4E4LA 5CAPA 1LPUA 1XBAA 2R0IA 4KB8A 4ZTMA 4NJDA 3B8QA 4U41A 5C27A 2BIYA 2P2HA 4JOAA 3R28A 3P9JA 1PW2A 5IDNA 1Q99A 2OWBA 5TKDA 3I5ZA 4FOCA 5HCZA 4GFGA 5FTGA 5LJJA 4V0GB 2OF4A 3QTSA 3VF8A 4ANMA 2YDJA 3VW8A 3EYGA 3ODZX 3QUDA 3SXSA 4QMPA 3MWUA 5B2KA 4AP7A 3VUDA 2C5OA 2KULA 3PVWA 2XK7A 3LQ8A 2BAKA 2VRXA 2XIZA 4YNOA 4LL5A 4CQEA 4XP0A 1OMWA 4C36A 2UZUE 5AA8A 5EYKA 3DT1A 3LXLA 4NT4A 1IEPA 4QMYA 4JXFA 3RK7A 4JX3A 3AT4A 4BFMA 3RM7A 4EOSA 3NUNA 2J5EA 1PXLA 2PE2A 2OXDA 5GJGA 5HKMA 2Y6OA 3SRVA 1R78A 4F7LA 2BPMA 2QVSE 5IKWA 2UZVA 4G3EA 3CXWA 4RVLA 3Q52A 2UZEA 3EQRA 4E4MA 5J79A 5DYJA 4WD5A 4IH8A 4FSRA 1T45A 4HGLA 2FO0A 4AZWA 2VTTA 3CPBA 3U8WA 2X7FA 4AX8A 2R3RA 2YM6A 2H34A 4FC0A 4H36A 3O50A 4U42A 4JJRA 4XV1A 4F1TA 4OBPA 4AN9A 4USEA 1YRPA 3EB0A 3FLZA 5KO1A 3QX2A 3ZYAA 4P90A 4U0IA 5IMXA 2CNUA 3NGAA 1YDTE 3CCNA 3PY1A 5M09A 2VNYA 4NW5A 5JFWA 2Z8CA 4GT5A 4CZUA 4YZCA 5A6NA 3PWDA 3CEKA 4IAZA 4TYJA 4ZY6A 3KXZA 4J8NA 4RFMA 1KE5A 2WMWA 1VJYA 3BU3A 3PRFA 4I5HA 3F3ZA 3EIDA 3Q5ZA 3Q60A 3A2CA 1O6YA 2LAVA 4XLIA 3UTOA 2ITZA 4EYJA 1YXXA 4FNXA 4I93A 1OL2A 4NIFA 2O63A 1H25A 2IVVA 3FAAA 5GZAA 3BQCA 3UGCA 4S31A 4AZFA 3MDYA 4QMMA 2R3JA 4EK3A 3Q32A 1RQQA 1J1CA 4IVCA 3UODA 3GEQA 4BCOA 4EJ7A 3ENMA 3BQRA 5IUHA 5HO7A 2XRWA 4IFGA 3CR0A 1OITA 3K5VA 4KS7A 2XBJA 3W32A 3EHAA 2WQEA 4F6SA 3Q2JA 3BLRA 2IZUA 3IW4A 4G1WA 2I40A 2WAJA 4ITJA 4PNIA 3EQFA 3R8VA 1V0OA 4OTHA 2ITQA 3ENHA 2BTRA 5GZ9A 2WTJA 5E9EA 1A48A 2LGCA 3S0OA 3KF4A 4UEUA 1ZMVA 4ALWA 4D2WA 3LXKA 1FBNA 5J95A 4OW8A 3FPMA 1JSTA 3NAYA 3BBTB 3COHA 2J90A 4A9RA 5IU2A 2OZAA 3GFEA 5E7RA 3RAKA 4C3RA 2JAMA 5M4FA 4BDAA 4FEXA 3D14A 2J0KA 3MJ2A 3E8DA 3VF9A 4X0MA 4EZ7A 4HW7A 5C8NA 1FVTA 2JKOA 3OG7A 4EC8A 4GT4A 2GNIA 3GUBA 4L7FA 4YBKA 5EM7A 4ASEA 3QQJA 2ZB1A 2CLXA 4GH2A 4C57A 3FHRA 4C2VA 4BR3A 4BY9E 3TL8A 3DK3A 1PKGA 4O82A 2B9JA 4WA9A 5IG1A 4M97A 3F5PA 4DFXE 3PA5A 3WOWA 2Y4IB 2HZ0A 3R02A 4J1RA 4FG7A 5DN3A 4LG4A 2C6EA 3QCQA 5EK7A 3MH0A 5CYIA 4O38A 4FEUA 1CDKA 1BL7A 2R64A 4KSQA 3R30A 4M0YA 5T6KA 3BWJA 2VU3A 3BIZA 2OW3A 3R7IA 1HCLA 3R7YA 2YDKA 1NT2A 3ID6C 1TQIA 3VUHA 4ANSA 1ZXEA 4O0WA 1ZMUA 3ZS5A 4JNWA 2C68A 4M68A 4DBXA 4EONA 4M69A 3FZOA 3PYYA 2BKZA 4JBPA 4BBEA 1ZYLA 4BCGA 5C4KA 2B4SB 4XCUA 4MNEB 4BCMA 2R3MA 2PZPA 4IACA 3EZVA 3PDTA 4D9UA 3O8UA 5D10A 5E91A 5LQFA 4L42A 4UMQA 3VUIA 3DAEA 5CAUA 2X8EA 3P78A 5HE0A 1OL5A 3D15A 3NUPA 4L44A 4U9AA 4YZDA 5E1EA 1F5QA 1OB3A 5A54A 4FGRA 3H30A 4KKHA 3E64A 2FSTX 5KHWA 3UP7A 5E8WA 3F6XA 4JR7A 4E5WA 3ZRMA 5KMLA 1LR4A 3E92A 4MD8E 5G6VA 4L3PA 4GUBA 4DT8A 1U4DA 3NW5A 2WQNA 4XP2A 4GK2A 1Q3DA 4LUDA 3G2FA 1ZYDA 4DFBA 4EYMA 2GCDA 3AC4A 1R1WA 4Y73A 3S2PA 5AV1A 5AM6A 4WRGA 4E93A 1MRUA 1ATPE 1M14A 3BLHA 4O86A 4FKLA 5LVMA 5HE1A 3FWQA 5DT0A 4ZSLA 5B0XA 1Z5MA 1H0WA 4BKZA 1PXMA 4TWPA 4TNDA 2QOIA 4F9CA 5GIOE 4I21A 5IPJA 1WFCA 3WIGA 3GC9A 3AGLA 3FXXA 5JN2A 1U46A 3CTQA 3TNHA 3AGMA 3T3VA 3KMUA 2CN8A 4JT3A 3O23A 2RGPA 3A7GA 4GYIA 3KRLA 4IHPA 4OUCA 4IWQA 5ANOA 1YOJA 2QOQA 2R0UA 2B53A 4AFEA 4EZ5A 5DHJA 3ZBXA 4TTHB 4I24A 4TN6A 3IECA 4AZTA 3CGOA 3UIMA 2R3GA 4AOIA 4DFNA 4EI4A 5DOSA 3D94A 4YSJA 4IDTA 1OIYA 2WKMA 3CP9A 4EK8A 5HU3A 5I3OA 3P5KA 5M57A 2WMRA 4KIKA 4BDIA 3QQUA 2BAJA 1G3NA 5AP3A 3WYYA 2EB2A 2X6EA 3RINA 4A07A 2QO7A 3R6XA 4EHEA 3OBJA 2VO0A 4X21A 1GOLA 2PUNA 3OOMA 4QP7A 1B6CB 1MRYA 2JIVA 4MXZA 4R5YA 4EEVA 1U54B 4E6AA 2XYNA 2VWIA 1PHKA 2OU7A 3EFKA 4ALUA 5IQIA 3DJ6A 4FSTA 4I5CA 2PMOX 5EYCA 3F7WA 3I79A 4NK9A 3SW4A 3FXWA 4RVMA 4FODA 3VS2A 2W99B 4C59A 4D2SA 4CZTA 1XH8A 2NP8A 5ETCA 3IQ7A 4CFWA 2DQ7X 1K9AA 3R7UA 4GKHA 2GNHA 5F4NA 5LXMA 1VYWA 5CSXA 4IWDA 5AUVA 4ACMA 2WNTA 4QPMA 4CFXA 3ITZA 4D0XA 2B7AA 4QMXA 4PF4A 3OP5A 3LW0A 5DRBA 4CSVA 3QFVA 2WFYA 2ZDUA 4C4HA 5L2SA 2V55A 4Q2AA 3R9DA 3ANRA 3FI2A 4RWLA 2PZYA 3KMMA 5ANDA 2GSFA 2R9SA 3PXFA 5DT3A 2XEZA 3HNGA 3DNDA 2VO7A 2J51A 4FV3A 3UQCA 2YHVA 4LOQA 4B4LA 2QOKA 3DKFA 4MBIA 4HPTE 3RI1A 3PUPA 3L9MA 1FQ1B 3GQLA 1JWHA 1G5SA 1WVWA 4GJ2A 4G3GA 4IC8A 1DS5A 2HZ4A 4ZEGA 4MVFA 2BKKA 2XM9A 4AOJA 3PLAE 4QT1A 3Q9YA 4X3FB 1Y8YA 4YJNA 4A9YA 1KOBA 4LRJA 5L3AA 1H1RA 2OJGA 4LRKA 4EJNA 3PG3A 5AV3A 3EQBA 4K77A 1NA7A 3ORPA 5E8XA 3GOPA 3QLFA 3HMPA 3WF6A 4AU8A 2V5QA 3U6JA 2UZBA 5IEYA 4QO9A 4OTQA 3VWAA 3WZEA 4UXLA 2OIBA 4GW8A 5A4QA 3KU2A 3R73A 5CF8A 4KWPA 3D2IA 5KNJA 3Q4TA 3W18A 5HG8A 4TW9A 2PVKA
chains in the Genus database with same CATH superfamily
5LVPA 3HA6A 2C5VA 2XK9A 3GVUA 3I5NA 4EORA 3DAJA 3UBDA 3QD0A 4EOJA 1M2PA 2YIYA 3VBYA 2XNBA 3VULA 3ZM4A 2ETMA 3DDQA 2VTMA 4FTNA 4ONAA 5CU0A 2IVUA 2HWPA 2UW6A 3COIA 3V3VA 4DG2E 4EKLA 1M2RA 2JC6A 3BE9A 2OK1A 3E8EA 3OBGA 2XUUA 2W1HA 4UALA 4ZOGA 5DE2A 4BDKA 4GMYA 4EOIA 3DNEA 3PPJA 5HQ0A 4TY1A 2ITTA 4MF1A 2I1MA 2UW3A 3QTXA 2HY81 1PRYA 4ZMFA 2BFXA 5EM6A 2W96B 4RX7A 5A14A 5CSPA 3ZO2A 3ZONA 4OT5A 4DG3E 1P14A 2XNMA 5JFVA 4ID7A 2UVXA 1H0VA 3PZHA 3TV6A 4IW0A 5L8JA 3EKKA 4AW0A 4C4JA 2Z02A 2QKRA 1XH5A 3AMYA 1JSVA 2ZM4A 3CD3A 3ZTXA 4O91A 4DH5A 5KBRA 1PYEA 3LOKA 5BMMA 4H05A 3ZSGA 3VS7A 3ATTA 3BL7A 2R3HA 4DE4A 1G8AA 2YN8A 3ZCLA 1FMOE 3HV3A 2H96A 4BTFA 1U59A 4LRMA 3H3CA 4RMZA 5M55A 4PL3A 1JOWB 5IH6A 4A9UA 3UDZA 4FK6A 3R63A 2CKEA 3N51A 3MJ1A 5M4CA 2I0EA 4RZWA 3MBLA 1Z9XA 2W7XA 3ZRKA 3WYXA 1PXKA 3UYSA 2PUPA 2HWOA 3PWYA 5AIKA 5HOAA 1OPLA 4JX7A 2XJ1A 4K18A 2PULA 4FE2A 1O9UA 4NFNA 5HLNA 5IA1A 1FVRA 3LFQA 3QU0A 3EH9A 1WAKA 4OTFA 5KMNA 2BRGA 4DEAA 3LQ3A 4D4YA 4CFMA 4I0TA 2XKCA 3UNZA 2OSCA 4J7BA 4GUEA 4GG5A 4LGGA 4MWHA 3G15A 3PXYA 4F65A 2BRHA 3BX5A 2ZMDA 3ZEWA 3V6SA 4O7YA 3LFEA 3RPYA 3R7OA 2IF8A 3AG9A 4BF2A 1B39A 2W06A 1PXPA 3TKIA 3TT0A 1CKPA 5HLPA 3EMGA 1G8SA 4CLJA 5K9IA 2VNWA 4IAFA 3C4WA 2VO6A 4U97A 4ZS4A 4I6QA 4CLIA 2UZOA 3U9CA 1YDRE 2YLEA 3KY2A 3GB2A 2O2UA 4M3QA 4H58A 2OJJA 1A06A 4WKQA 5D7AA 4G5PA 5HTIA 3OOGA 2CKOA 1VLRA 2GNFA 5EDRA 5HESA 2QU6A 3UIBA 3I60A 1YVJA 3RM6A 3MPMA 4EH5A 3PP1A 4C34A 5DG5A 4FTCA 4XV2A 4EK6A 4GIHA 1H07A 1BL6A 2YERA 3FMJA 1ZRZA 3H9OA 1Y6BA 5KHXA 4FIFA 5LMKA 4QDEA 3MFSA 5BVOA 2XNOA 2VWYA 1KWPA 4FF8A 1QPCA 3HEGA 4PL5A 3QRKA 4EOMA 4CV8A 2WU6A 3W0MA 4F9YA 5M44A 4IAYA 4YTIA 3KKVA 4YC6A 3FZTA 4HGTA 3CE3A 5EI6A 5BUEA 1NVQA 4MQ1A 4UMRA 4W4YA 4FTQA 3ORTA 4B6LA 4Q5HA 3R83A 3GC8A 4FTTA 4R8QA 4WHZA 5EKNA 5FXQA 3NSZA 1XHAA 3MIAA 4LV8A 1IR3A 2P2IA 5EM8A 3VUKA 3U55A 4QOXA 2X0QA 1H4LA 2WHBA 3MH2A 5DEYA 5HO6A 3NYXA 4O2ZA 4DFZE 2HIWA 3ODYX 5CQUA 4I0SA 3UO6A 3AMBA 2QURA 4KBKA 2X2KA 2QO2A 3R22A 5D1JA 3WZKA 5ANKA 4ASDA 3EN6A 3O96A 1FMKA 1Q62A 3FQHA 4I6BA 2NRUA 1W84A 3JY9A 3F3WA 4DGGA 2ZAZA 4R7IA 2IVTA 4RVKA 1OBDA 2ZYBA 3GT8A 4FTRA 4WSYA 1O6KA 4PDPA 5FM3A 4MXAA 4F63A 3QHRA 4HYIA 4ZS0A 4ZSJA 3UVPA 4FZ6A 2YM5A 3PFQA 3VBTA 4PL4A 2YWPA 3V01A 4AT4A 2VO3A 5DT4A 5BYYA 3REPA 5L2IA 3OF0A 4JI9A 4WT6A 4FNZA 1URCA 4LYNA 5CAQA 4NKAA 5A4CA 3CJFA 2CSNA 4R78A 4KA3A 1AQ1A 3BGPA 1SMHA 2BZKB 2QCSA 2Y7JA 3DS6A 1GZOA 4WNPA 4P5ZA 4BZNA 4J52A 5L8LA 1CM8A 3DZQA 3MS9A 4FKRA 3OEFX 1R0PA 2GU8A 2E9PA 4DHIB 2BRBA 3PJ3A 4HVDA 4W8EA 5CEIA 2YJSA 4RIWA 3OVVA 4BCQA 3R2BA 1PXIA 2VTJA 3GCUA 2UW0A 5I9VA 4NZWB 5AEPA 3NUYA 4BDJA 1SNUA 2FB8A 3EN9A 3UOHA 1YXVA 2BCJA 3NCZA 2Z7LA 2PZRA 3MTLA 4ZZMA 4FVRA 3L8VA 3O2MA 4IQ6A 1PKDA 5DPVA 4ITIA 5DI1A 2C6DA 3P5JC 5AJQA 3CTJA 3D5WA 2UW9A 3KC3A 2BHEA 4C2WA 4FV6A 4IVBA 4DCAA 1MUOA 3EOCA 2DUVA 4DH7A 3R8PA 4R7BA 2BVAA 4EWHA 3QHWA 4FNWA 4FRFA 3HMNA 5AR8A 3W0QA 1PY5A 2AC3A 4WG3A 3QD3A 4O6EA 3PXRA 1S9IA 4N70A 4O4CA 3NZ0A 4DLJA 4L67A 3D5VA 1NVRA 4USDA 3AMAA 4YTFA 1UWJA 4MUQA 3U51A 1ZZ2A 4PWNA 4YLLA 4YO4A 2RG6A 4FKTA 3LMIA 3JY0A 2RF9A 3R9OA 5ITAA 1FVVA 4AGWA 4IE9A 4DHJA 3PA4A 4XRLA 3ZDUA 1GJOA 1QPEA 4IJ9A 1VYZA 5HE2A 2XKFA 3OY3A 4M7IA 5E92A 4UY9A 3D7TA 1GAGA 4HJOA 2G9XA 1GIIA 5TF9A 1XH4A 5HIBA 5J5TA 3DZOA 5LOHA 1L8TA 3PFYA 1UNGA 3UG1A 4D2VA 3DQXA 3L1SA 3SAYA 5IQCA 2E9UA 3QQGA 4QMTA 4RIYA 3FKOA 2NRYA 3BE2A 4FKQA 3MN3A 4K11A 2BFYA 3ULIA 2C3LA 4FTAA 4C0TA 4DC2A 3VVHA 3LFCA 4Y5HA 1DI9A 4D1XA 5H2UA 4Q9ZA 2ZV8A 2ITPA 3A7JA 4I22A 5AA9A 2G1TA 4O0VA 5AP6A 4E6CA 1YW2A 2A2AA 3H0YA 1K3AA 3NEWA 3SG9A 2VTOA 5ICPA 3R7VA 4BGQA 2C6IA 3FY2A 4BCNA 4AZEA 4L01A 4GJ3A 2X0GA 4PPCA 3JR1A 4XLVA 5J9YA 3ANQA 4PTEA 5ACBC 3F2RA 4QMSA 1PMEA 4U5JA 3E5AA 3MY1A 3Q4CA 3DBEA 4R5SA 4D1ZA 2GFCA 4NTTA 4CMTA 5IQDA 4WIHA 5IQEA 3ZSHA 3LFDA 5LARA 2IWIA 3A60A 5AWMA 3QBNA 4I0RA 4AGUA 4XP3A 5HEZA 3IDBA 3PY3A 2A4LA 4XJ0A 2J0MB 3K2LA 1H1SA 3C4XA 3CY3A 3TUCA 4D1SA 4OLIA 4FKPA 5C01A 2R7BA 3R9HA 5J1VA 3BV3A 4FYOA 5BNJA 5JGAA 2Y6MA 2WTKC 2YIWA 2VWUA 3UDSA 1KOAA 2R7IA 3A61A 4X2FA 4EH8A 3S1HA 4N57A 5FEDA 1LUFA 4F78A 2HOGA 1AGWA 2X0PA 3V5JA 2GQRA 3TWJA 5L2WA 4YSMA 2WIHA 4FT0A 1BUHA 2J7TA 2XK6A 2YIRA 4IM0A 3SVVA 3EWHA 3DKCA 3MV5A 1XH7A 3DK7A 3EYHA 4D0WA 4ZZOA 5J7BA 4RJ6A 1SVGA 4L00A 4MBJA 4Y72A 5FBNC 3EKNA 3SD0A 2EXEA 3TTJA 4DBNA 1ZY4A 4I41A 4J96A 4JAIA 4BICA 4CMUA 4E7WA 1YQJA 3GU7A 3NYOA 2PU8A 4FV0A 4XEYA 3C5UA 4ZY4A 4R1YA 3DLZA 4QQCA 4IX4A 4S2ZA 2YZLA 3UPXA 2SRCA 3UOJA 3HX4A 4AFJA 5LWMA 4Z16A 1OPJA 5IEVA 5KKRB 3FLYA 4WBOA 1NXKA 3EQHA 3PXQA 3IO7A 4R3CA 3VN9A 4ANQA 4CKJA 3W8QA 1UU8A 3D4QA 5JQ8A 4YZMA 4IM2A 2XIYA 4B0GA 3Q9ZA 2EUFB 3NYNA 2QO9A 3C4ZA 4H1MA 4DDIA 5HVJA 3LCOA 3D0EA 4DGNA 4E26A 5C8KA 4G9RA 4UWCA 4XYFA 3Q3BA 3AKLA 2ZV9A 1OL6A 3GP0A 4FT3A 2PVRA 4PUZA 2OXYA 4AT3A 2W5AA 1UU3A 1GIHA 4FL3A 3CTHA 5G1XA 3FZPA 4L6QA 2BDFA 5A3XA 3DU8A 5HCXA 5CU3A 4O4EA 1O6LA 3PG1A 3GCSA 3SXFA 1NY3A 2B55A 3FMEA 3G6HA 4WG5A 1XBBA 5DLSA 3ROYA 5DVRA 3IW5A 3ZLXA 3HKOA 3HMOA 1XH6A 3OW4A 4RA4A 2R3LA 2Y8OA 3LJ0A 4MXCA 4WSQA 5AX9A 3RTPA 2X9EA 4F9AA 3R1SA 2Y9QA 3DB6A 2O0UA 2X2MA 2XZSA 2Z2WA 2WB8A 4RIXA 3RMFA 3VJNA 1K2PA 3HP5A 2XMYA 4O0TA 4TNBA 2W1IA 2I7QA 5AIRA 4ERWA 3RJCA 4AXFA 2ITWA 4DITA 3OZ6A 3PVUA 5BVWA 3GENA 2IPXA 5EW8A 3G90X 4APPA 3RCDA 3L8PA 3UIUA 5BPYA 4I3ZA 2IO6A 4NJ3A 1OGUA 2UW5A 5J7HA 3R0TA 4YURA 2C0TA 5AV2A 5HNBA 2QQ7A 2W0JA 2WMUA 2WMXA 4RT7A 2YAAA 5HORA 1OKWA 3Q5IA 4M67A 4P7EA 2WMQA 4L45A 4O81A 2JGZA 3E7OA 2C5YA 5BVKA 4BDCA 4QYHA 2GS2A 3DPKA 3R9NA 3SV0A 5EI8A 3N4VA 3BBWA 5DNRA 4EOQA 2YWVA 2QNJA 2YM8A 3E87A 4Y85A 4FT9A 4J71A 5EHOA 3OY1A 3RAWA 4BZOA 1OIRA 4U81A 3OROA 3D2KA 2WQMA 3Q9WA 4DFLA 3R1QA 2CCIA 4K0YA 3VAPA 5M07A 4D2PA 5BVFA 3M42A 3MTFA 3KK9A 1WBNA 3DFCB 3F5UA 4C4FA 2W05A 3NPCA 4U45A 3LXPA 3OMVA 1H28A 4O4FA 3DK6A 3RKBA 2CHLA 3R1NA 4BRXA 5IZFA 5TT7A 4RPVA 3ZDIA 1JKKA 4MCVA 3RK5A 2HAKA 4UYAA 3VHKA 4TYEA 3PXKA 1PXJA 5LVNA 4PY1A 4QP2A 5M56A 3HUBA 3LLAA 3QUPA 2JEDA 3FKLA 3E62A 2DS1A 4PPBA 4PMSA 2RIOA 1YOLA 1WVXA 3G0FA 5JMSA 4ZSAA 3KULB 3MPAA 4CTCA 4XS2A 4RLKA 2XKEA 1Q8ZA 2XIRA 4DEDA 2IW6A 3EQDA 5FWKK 2OICA 3QAME 3P86A 4AE6A 2WELA 2VTNA 5K4IA 3KXMA 1OPKA 2PK9A 5ANIA 3BI6A 4EOLA 3PY0A 3LCTA 5FP6A 3F69A 5AUUA 3QTWA 1JSUA 5EQEA 3FI3A 3NDMA 4IADA 3OWKA 3A7HA 4B7TA 1YWRA 1YHWA 1X8BA 3SG8A 5D12A 5LMKC 3KQ7A 3LCDA 4FKSA 4GFMA 3MB7A 2XA4A 1G8KA 3N4UA 2F7XE 3II5A 3KN6A 4D55A 3ALOA 3GU4A 3QZFA 5GIPE 1YXUA 2VN9A 3QCSA 3UQGA 4C4EA 4C4GA 4FKOA 3UG2A 3QL8A 2F9GA 3H4JA 2OG8A 3A62A 3RZFA 4E3CA 3QYZA 3E8NA 3OTVA 5HIDA 3U6HA 1JKSA 2JIUA 2QHMA 2C6OA 1XWSA 3GI3A 3JS2A 3RALA 4EQCA 4BGHA 3THBA 4NYEA 1M2QA 3BHVA 3ZLYA 2XH5A 3KRRA 3LFBA 3P7AA 2VWWA 4LI5A 3LPBA 4XG9A 4FSUA 2PMIA 3JXWA 3ORNA 2QD9A 3A7IA 3QKKA 2IVSA 3DGKA 5E8VA 4IB1A 4CFNA 2QC6A 4LOPA 4R3PA 5AP2A 4CFVA 2GQSA 2C4GA 4LFIA 3CS9A 3F7ZA 4FGBA 4FSYA 5HX6A 4MTAA 4BI1A 3ELJA 4S34A 1PMVA 1J91A 3HV6A 4MYGA 3COMA 4QPSA 1V0PA 5KZ0A 2UZLA 3DFAA 2WOTA 4TWNA 4FX3A 4II5A 5DH3A 1H24A 4ZLYA 5LVOA 5M4UA 4ZTRA 3MB6A 2GPHA 1FOTA 1Y8GA 4MAOA 5HNGA 5CT0A 3D5XA 2J0IA 5JGBA 3H0ZA 2YIXA 3DBCA 4IB0A 1FPUA 4EBWA 4BJJA 2BDJA 2F49A 5C26A 3RP9A 1PF8A 3QA8A 4DLIA 4O22A 5EYMA 3TXOA 4PDYA 3K54A 4QTBA 4GU9A 4IB3A 3RVGA 2CN5A 3GCVA 5AP5A 5HG5A 3U87A 3FLSA 5FUTA 5CTPA 4OAVB 4XMOA 3WF9A 3M11A 4YC8A 3MFTA 3UC3A 2IZTA 1Q8WA 5I4NA 5AUXA 4BCKA 3I1AA 4I5MA 4C02A 3ATSA 2JAVA 3GU8A 4IDVA 5EHLA 2F57A 1YWVA 3DAKA 5HLWA 3PUFC 3LJ1A 5FDXA 2OIDA 5J1WA 2JDTA 3MW1A 4TYGA 2CGWA 5EM5A 4ZJJA 2WGJA 4ACHA 3ZO1A 5B2MA 2BZJA 3O8TA 3TDVA 4DEEA 4FIEA 5H3QA 4TPTA 4FVPA 5CF6A 4O0XA 4FV8A 1DAYA 1SM2A 5LVLA 4GIIA 3MA3A 4FTKA 4JDKA 2R3KA 4IZAA 4HZRA 1UVRA 3PZEA 3ZC5A 3DCVA 3QTZA 3NX8A 2ITUA 4QQTA 2H8HA 5J8IA 4XG4A 4MNFA 3GU5A 4YO6A 1OUYA 4YZNA 1PMUA 4FUYA 5AX3A 4EH4A 3QZGA 4JR3A 3OWLA 3GBZA 3UDBA 3AT3A 2WTDA 4F1MA 3VS1A 4HYSA 4L3JA 4MD7E 3E8CA 4FTIA 4UMPA 1OKZA 3BYUA 4OTGA 2HW7A 4AGCA 4BI0A 4BZDA 3BWFA 5CI6A 4FSMA 2C3KA 3RCJA 1YI6A 4NM5A 3T9IA 5EQPA 3MGYA 4FZAB 5JKGA 4QEBA 3LM0A 3SRVB 5J5SA 4N0SA 2FA2A 5EW9A 2VX0A 4AZVA 4M66A 4CG8A 2IZRA 4C35A 4D2RA 3FE3A 4QNYA 4UYNA 4NU1A 3PIZA 3EFWA 4BHZA 2VTPA 4JQ8A 3SHEA 3UNJA 2J5FA 1CSNA 4ASZA 3HDNA 2YCFA 3HP2A 5CAOA 1OIUA 3PPZA 4O7TA 4I1ZA 4QQJA 1STCE 1ZY5A 2G01A 3S95A 5EFQA 1H26A 1KE9A 3BYMA 2C5NA 5FLFA 3MY5A 4FBXA 1KE8A 1PJKA 3BRBA 1B38A 3ZEPA 5A4EA 4WG4A 5M06A 3D83A 3H10A 2Q0BA 4QMUA 4FG9A 3C5IA 4FSQA 4JG6A 2VTRA 5IUIA 3QX4A 4BWXA 4C3FA 3CD8A 3FQEA 3LAUA 3BKBA 3R8LA 5GNKA 2P3GX 2VAGA 4PQNA 3VUMA 2C6TA 3QF9A 2X0OA 3TN8A 3G5DA 4TWCA 3EQPA 4PX6A 3R00A 4DH3A 4ZTLA 4X2KA 3F66A 4NIFB 2O3PA 3F2NA 4O6LA 4TKSA 1WBTA 4J99A 4UXQA 4XHKB 5EYDA 3ZO3A 2AYPA 2ZMCA 3ROCA 3FL4A 4HPUE 4KRCA 3UIXA 4F9WA 3AD6A 4ZIMA 3FYKX 3LCKA 4AQKA 1BMKA 3FQSA 1JKLA 2F7ZE 4O0UA 3I4BA 3MVLA 3SX9A 3UOLA 4CMOA 4YJVA 4TXCA 3TNWA 5BVEA 1H8FA 4NM7A 5DR9A 5TOZA 3TEIA 5IISA 2FSOX 4XOZA 5DGZA 4IEBA 2QONA 4YJSA 3TJDA 2HENA 3E3BX 2V62A 2IJMA 3NVKI 3JVSA 3DTWA 4ZJIA 3W16A 4AACA 2HK5A 2QG7A 4AW2A 3OC1A 5D41A 3A8WA 3W0RA 4FIJA 3RPOA 3FHIA 4WNMA 3OW3A 4TYHA 2HXLA 3LM5A 3R21A 2XF0A 3ZZEA 2J2IB 2OZAB 2YZAA 1UNHA 3NR9A 4FA2A 3LHJA 3Q53A 3RPRA 4O7RA 4IX6A 1W0XC 1SVHA 2XEYA 4OTIA 5F9EA 4AW1A 3VNTA 2WTCA 5EOBA 4N6YA 4C61A 4P5QA 4JIKA 1PMNA 3GCQA 1OBGA 5IQBA 4TT7A 4R77A 4YJRA 3RZBA 5BQ0A 4FJVA 1JQHA 4FKWA 4I5PA 5JFXA 2YFXA 2CPKE 2PVNA 1AD5A 4G3CA 4FOBA 4UBAA 2GNGA 2WXVA 2GFSA 4M15A 3FPQA 1BI8A 3A4PA 3K5UA 4K8AA 5FP5A 3DY7A 3PE2A 4PDSA 3PE1A 4YHFA 3TNIA 3DXPA 4AE9A 3FDNA 3ORLA 4YBJA 1H08A 1UU7A 4WNKA 4X6RA 3U4UA 2PVMA 3ZO4A 3COKA 4BIEA 3LMHA 4Y95A 2JIIA 3LE6A 2PY3A 3V04A 3HMMA 3S3IA 3RNYA 4A06A 5L4QA 4LDTA 4IWPA 4LGDA 2GHMA 4M69B 3LXNA 4RGJA 3TUBA 3ZM9A 5IQAA 5H8GA 1MQBA 3TKHA 4JG7A 4MX9A 2YA9A 2JBPA 1W98A 2YJRA 4ORKA 2HZIA 1IA8A 2O8YA 4OTRA 5D9HA 5CX9A 5DR6A 3I0QA 3WZDA 5BX0A 2RFEA 3KA0A 2ZJWA 4O96A 4I6HA 4TZRA 2CMWA 2NPQA 5CEOA 3POZA 5IQHA 5K5XA 2GTMA 2WMTA 1Q8YA 3I81A 3QCYA 2OFUA 4IX3A 4D4VA 1J7IA 2G2HA 2PE1A 1BKXA 3F3VA 3C9WA 4O21A 2EU9A 2FVDA 3C50A 3VBVA 4BGGA 2WMAA 4C8BA 4ZK5A 2RKUA 5CEPA 3ZHPC 3ZLSA 2J50A 3L9LA 4PTCA 5K5NA 3LFAA 1XJDA 2OJ9A 4RG0A 4XX9A 4I92A 4OTPA 1ND4A 2W4JA 3AC2A 2R3PA 3F3TA 2Z7SA 3ERKA 4O27B 5CU4A 4FKJA 3VHEA 2C0IA 4GU6A 2VWBA 5HD7A 3POOA 1M17A 2ONLC 2QKWB 2YLFA 4MF0A 3UO5A 2WMSA 4IWOA 4BBFA 4F99A 2IG7A 4X3JA 4DA5A 4RJ5A 4NCTA 3KL8A 1XH9A 4FICA 5I9UA 5KZIA 3WF8A 4DGLC 3CKXA 4O7WA 2E9OA 3ORKA 4BDGA 3D7ZA 1ST4A 4FV4A 5BYLA 2NO3A 2YCRA 3R9RA 3D9VA 2OF2A 4IVDA 1Q97A 3NMUF 5BYZA 3C4CA 4RX5A 1RE8A 4FV9A 1Q61A 2VUWA 5HBHA 4Q9SA 1UA2A 3R7EA 4S30A 1OKVA 3TNPC 4F08A 4QTDA 3W2OA 5F1ZA 1YHSA 4AZSA 3ZZWA 4NFMA 3QXOA 1W8CA 4V0GA 4BDDA 4QMQA 5B2LA 4QYGA 5JRQA 4FL2A 1UKIA 1H00A 3GGFA 3OS3A 4FIGA 4JQEA 2PVFA 2XB7A 2ZOQA 4KIKB 3SW7A 1ZOGA 3PSBA 3GNIB 3AQVA 4XH6A 3AC1A 2RG5A 3MA6A 3LFNA 2W4OA 4DHFA 2R3OA 2C30A 3BPRA 4QMVA 4M8TA 3G9LX 2JD5A 3F2AA 3G6GA 1L3RE 5CWZA 3O5AA 1S9JA 4XG6A 3IW7A 3PVGA 3VJOA 3IGGA 2A0CX 2QOHA 4IZ7A 4KSPA 3P1AA 3UZPA 2WD1A 1E9HA 3A99A 3FC1X 2GTNA 2A19B 4MHAA 3FZ1A 4OTDA 1PXNA 5FG8A 4BKJA 1DAWA 2I0VA 2OLCA 5AUYA 4B8LA 1UKHA 2VD5A 2OO8X 5AR3A 2WTKB 2PTKA 2AUHA 4MQ2A 3SKCA 5CVFA 3ZUVA 4NH1A 2H9VA 2C1AA 5HCYA 1MP8A 4F6UA 2OH4A 3EFJA 5CU2A 4F7NA 5JFSA 5FTOA 5LCJA 1J7LA 4HCTA 4K9YA 5IDPA 4CD0A 4QP1A 3AC5A 5I9ZA 4O7VA 2R3FA 2B52A 4QP6A 4PPAA 1KV1A 5TE0A 4E5AX 3V8TA 4O1OA 5EDQA 1XR1A 1W2FA 3E63A 5EG3A 4C7TA 5CEMA 2P0CA 4F64A 5DBXA 1JVPP 5K3YA 4DCEA 2YABA 4QMLA 2A1AB 5CVGA 5M08A 5E8TA 4EKKA 4EH2A 2GS7A 4O7LA 3BL9A 3FL5A 3ACJA 4OR5A 2W9FB 3BYVA 4C4IA 3QRTA 5L6PA 3B2WA 4QP9A 4JAJA 3FI4A 3HZTA 1XMLA 3CPCA 1R3CA 4JBOA 1OUKA 2XVDA 3C4EA 1JNKA 1IASA 4UWYA 1H1WA 2UUEA 3JUHA 4K1BA 3F82A 4PP9A 4GCJA 2QR7A 5AFVA 4FT5A 3BHUA 3EL8A 3IKAA 5KCVA 5FXRA 2XNEA 4FZFB 4FIIA 4QTAA 1KUTA 3SQQA 2RSVA 2YM7A 3ORXA 4FV5A 5F20A 4FEQA 5JZNA 5KMJA 4EC9A 3ZFYA 1KV2A 3CKWA 2A98A 2VTQA 4XRJA 1Q24A 3UQFA 1MQ4A 2PVHA 2X9FA 4G17A 3E3PA 4BI2A 1FINA 2B0QA 3QD2B 2AC5A 5CALA 2ACXA 4CKRA 2V7AA 4RX9A 2JFLA 3UDTA 2HELA 2CNQA 3PXZA 2QG5A 4HYHA 2WO6A 4I20A 3QZIA 4FKVA 1QMZA 5F94A 5A6OA 3Q9XA 2O64A 3P7BA 5TR6A 2VWVA 3AKKA 3TUDA 4ZTSA 2UVYA 4PDOA 2B9FA 2GHLA 4ZMEA 4RFYA 2IW8A 4FMQA 3I0OA 4XG7A 4EQMA 3FSFA 3R8UA 3G0EA 4MH7A 4GK3A 4IVAA 4YC3A 4IMYA 4XV3A 4F0GA 3PJ8A 3QA0A 4U40A 3PRIA 5EOLA 1YDSE 2XYUA 4G6OA 4O4DA 4OT6A 5C9CA 3V5TA 3W2RA 4CTBA 5I3RA 3WF5A 3DJ5A 4I4EA 3ORIA 4NKSA 5CEQA 1DI8A 4J98A 1OM1A 4WUAA 3RAHA 5HTBA 2XAMA 2VX3A 5AAGA 3S00A 2VTHA 4IJPA 4YJPA 4EZ3A 2WMBA 4F6WA 3TZ7A 4LM5A 4BKYA 2J4ZA 5BUJA 5HO8A 4XNEA 1Z57A 3ZFMA 3I7CA 3GC0A 3QGWA 4OTWA 2QLQA 3IOPA 4BDFA 4GK4A 4IZ5A 4DH8A 4R1VA 5HVKA 2QODA 1JKTA 2A27A 2W5BA 3KB7A 5A9UA 3U6IA 4GYGA 2WU7A 4FV1A 2VWZA 4YPSA 5B7VA 3BU5A 3UMXA 4FUXA 3KMWA 4ZTNA 1MRVA 4F1OA 4HOKA 4KBCA 4WBBB 5C8MA 4AA5A 5AUTA 3U9NA 4ZLZA 1GNGA 4QNAA 3IOKA 1YOMA 2E9NA 2BAQA 3QQHA 4LL0A 2EVAA 3P08A 4RX8A 4E1ZA 2W1DA 3I6UA 3NUUA 4MNEA 4ACDA 4BHNA 3MVJA 3TYKA 3FBVA 4YPDA 1CTPE 3Q4ZA 3QWKA 2QI8A 4JDHA 4EQUA 2JITA 2YM3A 5AAEA 4DT9A 2F4JA 4FEWA 5KBQA 2W17A 2WTVA 3C13A 4FNYA 4TRLA 4W9XA 3KGAA 4F09A 2CKPA 3OCTA 3P7CA 1V0BA 1UNLA 4BTKA 3LVPA 2UW8A 4LOOA 3MI9A 4AG8A 4FSNA 5CXHA 2XNPA 2R4BA 5DMZA 2YEXA 5CSVA 1BYGA 5AUWA 1REKA 1QPJA 3VS3A 3EN5A 5FEEA 1NW1A 5CF4A 1YXTA 4QDVA 5ETIA 4FIHA 3DBDA 4WOVA 3TZMA 1OI9A 5I9XA 2PVLA 2KTYA 4YP8A 2I0HA 1J3HA 1I44A 5D11A 4O7SA 3MVMA 3UVQA 3KREA 2OJFE 4G6LA 3W2QA 3LCSA 3ZFXA 5BMSA 2NYAA 2W1GA 5KMIA 5M51A 4CVAA 4O83A 3FZRA 1ERKA 4MXOA 3TCPA 3FUPA 4B99A 3UO4A 3IG7A 4E73A 3DV3A 3EN4A 4D58A 4Y46A 4CT2A 2W5HA 3CQEA 5BVNA 2BRMA 5HI2A 2UZNA 4HZSA 4UMUA 3IS5A 4JS8A 2ZB0A 4ZAUA 1Q4LA 4DFUA 2HCKA 4AAAA 4IZYA 3DKOA 3TTIA 3A4OX 4DFYA 1M7QA 4O0RA 2W1EA 5AV4A 4O4BB 3PJ2A 4HVSA 1OL7A 4AXEA 1IAJA