4PP7A

Highly potent and selective 3-n-methylquinazoline-4(3h)-one based inhibitors of b-rafv600e kinase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
267
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Highly potent and selective 3-N-methylquinazoline-4(3H)-one based inhibitors of B-Raf(V600E) kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
total genus 71
structure length 267
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4pp7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pp7A01
1R1WA 3TCPA 4EK3A 3PXRA 3IG7A 4R78A 3I4BA 1ATPE 5F9EA 4RIYA 4I94A 2QU6A 3CQWA 2EVAA 3UG2A 4H36A 4CTCA 4EQUA 3CTQA 4CG9A 3R9RA 4YO4A 4HOKA 5A3XA 4EHVA 3ACKA 4IEBA 5HNGA 4I22A 4CKJA 4N57A 4ORKA 5JT2A 5IQEA 4BB4A 3LOKA 3OFMA 3POOA 4FSYA 3RINA 3V5LA 3A8WA 4G6NA 3TKHA 4C4EA 1YVJA 1Q8WA 2X81A 3AC8A 4W4WA 4FR4A 5JH6A 3W2CA 3SC1A 4C38A 5KO1A 4RG0A 3U55A 1JVPP 4C4JA 2OJIA 4FG9A 2NRUA 3LW0A 2WMQA 2H8HA 3B8QA 4IX6A 4EK8A 2F7ZE 2YISA 3GQLA 3SOCA 5I9YA 3VBYA 3PY1A 1PXMA 4GIIA 5DG5A 2OW3A 1FVRA 2IZUA 4G9RA 4IFCA 3VN9A 3QAME 4YLKA 3U9CA 1AQ1A 4LGDA 4ZZMA 3DGKA 4I0TA 4MD9E 3OD6X 1H0VA 4LFIA 3W16A 4FTOA 3ZFMA 3FY0A 4NW5A 3RK7A 4AZVA 4YTCA 5AV0A 4YLLA 3DAEA 1Y8YA 2V7AA 2ZJWA 2J51A 1ZYSA 1ERKA 3PPZA 4U44A 4UMUA 3QHRA 4JX7A 3C5UA 3L9LA 4QP9A 4R77A 5M44A 4ZTNA 2JIIA 1YHSA 2UZDA 5DPVA 4DEAA 5F94A 2ITNA 5L8JA 5AV2A 3PRFA 4S34A 3BU3A 2FO0A 2XYUA 4HNFA 3UG1A 3VS6A 4BR3A 3PE2A 5CANA 4AGDA 1J7IA 4Y46A 4DEGA 1UKHA 3ZLSA 3QUPA 3NIEA 1J1CA 3R21A 4P5ZA 1FVVA 2ZV8A 2IZTA 3QLGA 5HEZA 3VBQA 4D1SA 5AA8A 3NMUF 2E9NA 3KKVA 1ND4A 4CZUA 4D5KA 3GBZA 3NDMA 4NM0A 4CYJA 5M56A 4FOCA 3S2PA 1IR3A 3FMNA 3RZFA 2P3GX 5E92A 5E8XA 4BCQA 4MQ1A 4DG2E 3ID6C 4L53A 5C03A 5ACKA 3GC8A 2OXXA 3V6SA 2G15A 3VUMA 2B9HA 3D5VA 4F9WA 5IQIA 1PXNA 2RFNA 3ZC5A 4Z9LA 3TM0A 3QF9A 2OIQA 1JKKA 4AQCA 4KBAA 3QTSA 4NM3A 5DBXA 5BX0A 4L9IA 2C3IB 4AX8A 1ZZLA 3DAJA 4N4SA 3QWJA 3UPZA 1XWSA 5EKNA 2PU8A 3QXOA 3EQRA 3QQUA 4QQ5A 2B1PA 4GL9A 4K1BA 4E20A 3C5IA 2GQRA 5E9EA 2YEXA 5M06A 2ITQA 4HVDA 4FGBA 4XG7A 1H8FA 4FOBA 4C3FA 1G8SA 4BKYA 3LQ3A 3E8DA 5HX8A 1OKVA 2HZIA 3BELA 3E3PA 4QO9A 1HCKA 2C5XA 3DJ5A 4I6FA 3QQJA 2XYNA 2JBOA 3HA8A 3NRMA 3RBWA 3R2BA 1PXKA 4IZ7A 3TIZA 4KD1A 3VBVA 3DQXA 3I7CA 4NTTA 1CMKE 5CT0A 2BTRA 3DCVA 2XB7A 5K0XA 2IVSA 4CFXA 2ACXA 3PPJA 1HOWA 4AA0A 3SVVA 2C1AA 2YM7A 1U54B 3DBCA 1WBPA 2VX1A 3RZBA 4N0SA 4DH7A 2OI4X 3COIA 4JL9A 2FUMA 3UMXA 2CGXA 3ORNA 4XCUA 2X7FA 2JKMA 4DINA 4RJ5A 2ERKA 3G0EA 2VTOA 3HUCA 2EXMA 4YSMA 3TV7A 3HUBA 2XIZA 4AUAA 3GOKA 4HCTA 3IGGA 4D1ZA 4IWQA 2BR1A 3GC7A 4G2FA 4G5JA 4BY9E 2E9PA 3FKOA 2HWPA 4GYGA 1Q3WA 3Q4TA 2W96B 3C7QA 4IH8A 3DXNA 4A9SA 3NEWA 5JKGA 5E1SA 1JPAA 5CEKA 4IMYA 3D5XA 3DLZA 3OS3A 4PDSA 5DHJA 1Z9XA 2X2MA 3ZBFA 1H28A 3Q9YA 4D2VA 2RL5A 4RX7A 5E4HA 3RCJA 2WQNA 2R0UA 5DIAA 4QMWA 3VBTA 2FSMX 4RWKA 1XH8A 3LHJA 2HENA 5F95A 3VQHA 4HGSA 3HRBA 3OUNB 5B2KA 1REJA 4EK6A 2W1GA 3PVBA 3QD4A 3CTHA 3DV3A 4OBQA 2YZLA 4IVCA 2WTIA 4OUCA 2VGPA 2BDJA 1HCLA 5G1XA 2VTPA 4HVIA 3DNDA 2XNPA 5B2LA 4M84A 4BCJA 3ZM9A 3R22A 5DH3A 1UVRA 3LIJA 2QOFA 4LV8A 4XG2A 3N4VA 2RFDA 2ZVAA 2R3GA 4JNWA 2JFLA 4EEVA 4IB0A 4RX5A 3UVPA 5CEQA 4BBFA 4MEDA 1G3NA 3LXKA 4V0GB 1JKLA 2JDOA 1IA9A 3DBDA 3O50A 1SVEA 3LPBA 2BVAA 3P78A 3HV4A 2UW7A 2HZ4A 2W5AA 3ORKA 3R2YA 4IDTA 4M68A 4USFA 4AS0A 5HX6A 4ZTMA 4FV6A 4OTQA 5JQ8A 3KU2A 3QFVA 2OJGA 2IJMA 1BUHA 3C4XA 4LG4A 4O6EA 4O1OA 5HNBA 4BGHA 2BZHB 2I0YA 3EFKA 2C0TA 5BUEA 4EC8A 2ITWA 2VNWA 3A8XA 2BRHA 3CP9A 3L1SA 4DTBA 4U97A 5DNRA 4F4PA 4G5PA 2P2IA 4AOIA 4D0XA 5AV4A 3MVJA 3KXHA 4ZLOA 1XJDA 1PF8A 3MPTA 2QO9A 3LFBA 1OPJA 2JIUA 4EH5A 3JYAA 3KVWA 3QZFA 3ZFXA 2C6KA 2WMVA 4BWPA 4W9WA 3KCKA 2FVDA 4LOQA 4TNBA 1OI9A 4LRJA 3EL7A 4OTHA 4MNEB 1KV2A 3PVUA 3O0GA 3F3TA 5J1VA 3Q96A 4IBMA 3RWQA 4PP7A 3FLSA 5DRBA 4F1OA 4BTFA 2PK9A 4FICA 4GV1A 1ZWSA 3JVRA 4XX9A 5HU9A 3EL8A 4WA9A 2JKQA 2UV2A 1TQMA 4BDAA 1E1XA 4XBUA 4ZJVA 3F66A 3U6HA 5ETFA 3QYWA 1W83A 3ZTXA 3FHIA 3DNEA 2EB3A 3AC5A 5CSPA 2Z7LA 2IW9A 3OW4A 4WNKA 3VHEA 3WZEA 3D5WA 5AAEA 3FPMA 4GH2A 3V3VA 4UXQA 5FBOA 4UV0A 3ZLWA 4RPVA 3NIZA 2FH9A 1DI8A 2I1MA 3IQ7A 3K5UA 4FTTA 3NUPA 2W4OA 4J7BA 5HBHA 3HMIA 4F0IA 2VTIA 4XOYA 1H1RA 4I5HA 1YXUA 2Y4PA 2GS6A 5IQAA 4MBJA 3WI6A 3W33A 4APPA 3C13A 3FE3A 5I9WA 4GJ2A 2BZIB 3NUSA 4FC0A 3CPBA 1CSNA 3GU7A 2W1HA 1GIHA 3V5TA 5IPJA 3DJ6A 1LP4A 1YWVA 2XKCA 3MGYA 4HZSA 3R7UA 4UN0C 4S30A 3ATTA 4A4OA 3DFCB 2WMWA 4BDIA 2PE1A 1OL7A 3G6HA 4MXOA 4HGLA 2RIOA 4I92A 4RVTA 3P79A 5A4EA 4FV8A 4D58A 1PMVA 5EYCA 3IOKA 2Z7RA 1YOLA 2O3PA 4NIFB 4AFEA 5JZNA 2J5FA 3DBFA 3N4UA 5IKWA 4GS6A 4YZDA 4RT7A 3ORLA 1K3AA 3SV0A 4QYYA 3GC9A 4FV7A 2QHMA 4QMVA 3OROA 3GI3A 4A7CA 4K18A 4U6RA 4TYHA 3ZO1A 4EL9A 2VWUA 3BX5A 4EOJA 2CNQA 4RIWA 2HELA 3MFUA 4EUUA 2B9IA 4TWOA 3OY1A 3MESA 2OF4A 3V6RA 1KSWA 3V01A 4ZTHA 3TXOA 4IB1A 4FKIA 3MWUA 4NT4A 3VQUA 3TKIA 5JGAA 2YWPA 4NKSA 2PUUA 5E8ZA 2PYWA 4MD7E 4ZMFA 4FKRA 3GENA 3SDJA 3FMDA 4FKPA 3LMGA 1P4OA 4O96A 3GC0A 4DEHA 4QP7A 3R9DA 2GTNA 4LQMA 4RIOA 5DLSA 1Y91A 3EH9A 2VWXA 4J1RA 2XF0A 4CRSA 1GNGA 2OWBA 3CY2A 5LVLA 2GTMA 2XH5A 4IHPA 4B6LA 4F09A 2E9OA 4KA3A 3DB6A 3RK9A 1Y57A 2UZNA 5I9VA 4MX9A 2YN8A 1GJOA 3EN7A 2CHLA 3Q53A 1H1QA 2IW8A 5EDQA 2ZMCA 3QTWA 2GQGA 3NUAA 3M2WA 4MHAA 5CU0A 4ACMA 2R3RA 4FNYA 4EOLA 4CVAA 5H8EA 3I0OA 2EXCX 4M12A 4XEYA 5FXQA 5B2MA 4XS2A 1JSVA 2YFXA 2VX3A 4YLJA 5BUIA 5CQUA 4R7BA 2W5BA 4GUBA 3RPOA 2O2UA 5HORA 4QNYA 2PVYA 3QKLA 4I6HA 2DS1A 2QO2A 3F5UA 5CWZA 5EI2A 3KREA 3UOHA 1RE8A 2HW6A 2IVVA 4FUYA 4GT5A 4CFMA 3OWPA 3TUDA 5DEWA 4RC4A 3QA8A 4FEQA 3WYYA 4YSJA 1QPDA 1Y8GA 3NYVA 5AR5A 2EXEA 4QTBA 3V5WA 4AACA 4B4LA 4NYEA 5FP6A 5HG7A 4OAVB 3KXZA 4QQTA 3TDVA 3ZS5A 4BCGA 2G2IA 4WNMA 3D9VA 4FT5A 5J8IA 3EN4A 2A19B 4O7YA 4IM0A 3Q52A 3WOWA 3MFSA 3R83A 4IIRA 4D2TA 2CN5A 3Q5IA 3QRIA 5FEQA 4BYIA 4C4FA 4CSVA 1VZOA 2IZSA 2QG5A 2OJFE 2IVTA 4FKWA 3LFQA 4KSQA 4DG3E 4F6UA 4F1TA 3S1HA 4JAIA 1SVHA 1WAKA 5C27A 4JDKA 3QRTA 3WIGA 5CAOA 5AAFA 4YC6A 3FXWA 3OHTA 4D0WA 3K3JA 4AZSA 4MQ2A 4BFMA 2H34A 4ZSLA 4BICA 5K5NA 3QXPA 4D1XA 2J9MA 3P1AA 2VRXA 4BDHA 2FB8A 2XK4A 3NNUA 4IAYA 3WIKA 5I0BA 4M69B 2VN9A 2PMLX 2WOTA 5AUZA 3ZO4A 5HICA 1XH4A 4J96A 5KZIA 3PWYA 4CFNA 3BV3A 4TTHB 5AR2A 4Y95A 4QP2A 1U5RA 3TI1A 4FBXA 3MDYA 2XNMA 4HCUA 3R7IA 3H9OA 3QGYA 5EOLA 3TG1A 3LZBA 2QI8A 3HVCA 5L2WA 2XNBA 4AE6A 4MYGA 4TL0A 4BI0A 4KSPA 4H1MA 3R7VA 2RKUA 3CE3A 1CM8A 4RVMA 5HIDA 4F99A 5AMNA 4FVRA 1QPEA 3W1FA 1OL1A 2NP8A 3LE6A 5AP2A 4LOOA 4NL0A 4OTPA 2A1AB 4HW7A 4DLJA 3FAAA 4CT1A 4UWCA 1Q97A 5EM6A 2YIXA 2C3LA 2J2IB 4ZJJA 1CKJA 4WG3A 1M14A 3FZ1A 4ACGA 2PVLA 5KNJA 3EKKA 1NVRA 1A48A 3AG9A 2ZYBA 2FSTX 4PMPA 2HWOA 3MV5A 4BTMA 2RSVA 5LJJA 2QLUA 4PDPA 2YCRA 2WIHA 1KE7A 2PULA 3ZZWA 2C3JA 5AWMA 2PMIA 3HP2A 3NAYA 1QPCA 2E9UA 3QZHA 4QMLA 1ZXEA 1E1VA 2R3KA 3ZO3A 1Q8UA 1KUTA 2UZOA 4XJ0A 3QQFA 1J3HA 1NVQA 2IZRA 4GG5A 4CMTA 2QCSA 2PTKA 3R73A 5EDPA 2PVMA 4LL5A 3R9OA 3QQGA 2WOUA 4ALWA 4UALA 1OIRA 3IECA 4FL1A 1MRYA 1WCCA 3BQRA 4IAFA 4WBBB 3BYVA 5CEMA 5LVPA 4O7NA 1XH5A 4EBVA 5TO8A 3ENHA 1JKSA 4FSZA 4TWPA 4BF2A 3EYGA 1OKZA 3O23A 4S31A 4YC8A 4EWHA 2YDIA 3SG8A 3R30A 3MFRA 2X1NA 2QO7A 5CALA 1YDSE 2RG5A 4ANNA 4CFVA 3IS5A 4FT3A 4QYEA 5CASA 2KULA 2PL0A 3GOPA 1AD5A 3I5NA 2YM4A 3BE2A 4L3JA 3W8LA 3JS2A 3QKKA 5F20A 5BVDA 2W1EA 2W1DA 4DH3A 5C1QB 5J79A 4O81A 3QC9A 3UO4A 3DDPA 3R8LA 5D12A 2XNEA 3Q9WA 4DAWA 4X3JA 4BZNA 4CLIA 3W10A 3BGQA 3F6XA 4EHGA 5GINE 2B54A 4I6QA 3TZ7A 4EOMA 5CF8A 4I4EA 2GDOA 3ROYA 4YJUA 1UNHA 4M0YA 2UW0A 4KINA 3W8QA 5J5TA 3ORPA 4MWIA 4M13A 2ITTA 4IZYA 3TT0A 5J5SA 5KBQA 2AC5A 4Q5HA 3T9TA 3PA5A 3DZOA 4WHZA 3MA3A 4AGUA 2J0MB 1URWA 3HP5A 4TZRA 4YJQA 4EOIA 3CR0A 3ATSA 4LGHA 2OFUA 3UZTA 4U3YA 1KE6A 2UZLA 3KN6A 2CLQA 4A06A 4AOJA 4AT4A 2OZAA 4FG8A 3KXXA 1B38A 1M2RA 4O2PA 3TN8A 4Y85A 3SKCA 1FBNA 4FIIA 5C8NA 4ZAUA 5HBEA 4U9AA 3SW7A 1PMUA 3PY3A 4OGRA 1Y6AA 2B55A 2WTKC 3CBLA 3POZA 5CSXA 2LGCA 1UA2A 2OIBA 3QHWA 4MBLA 5HBJA 2Y4IB 4CZYB 5HO7A 4C3PA 3WF9A 5DT0A 1X8BA 3ZSHA 4FV5A 4OW8A 2BROA 3A7JA 1OIQA 4QMXA 3OWKA 2JBPA 3EB0A 4AW5A 4IZ5A 4O86A 3A62A 5AP1A 3ZYAA 3MN3A 3MTLA 2W1ZA 4Z3VA 3QUEA 4EZ5A 3NVKI 5AR8A 5HQ0A 1H4LA 4FT0A 4YJRA 2WQEA 4XP0A 2J50A 4RA4A 4I6BA 3DS6A 2R3HA 1KE8A 1PXOA 1PY5A 2HIWA 3UOKA 3GUBA 5FRIA 3EQGA 2XM8A 4PL3A 4ASEA 4C35A 5HE0A 2DYLA 3H10A 3HEGA 4CV8A 2R3QA 2YACA 3NNWA 5GZ8A 3BKBA 3RHKA 1QMZA 3CSVA 4BDJA 3OTVA 2VO6A 4XBRA 2F49A 3LM0A 5AP3A 4FV1A 1U46A 3KA0A 3RCDA 3ZU7A 3VNTA 4BDEA 4CQEA 1SNUA 2WMSA 2QU5A 3LXLA 3HGKA 2YA9A 3UOLA 2Z7SA 2B7AA 5JZJA 4D55A 3W2PA 4P7EA 5FDXA 2BKKA 3Q32A 4K77A 3EFWA 3IW8A 4UZHA 4YJSA 2VU3A 2O0UA 3HDMA 3Q2MA 2C6TA 5AM7A 4GJ3A 4ARKA 3FMJA 4V04A 5FG8A 5TE0A 5LMBA 4R5YA 4BKZA 3QZGA 4PX6A 4Z7GA 2JDSA 3VJOA 1BLXA 1IASA 1UWHA 2J0JA 2QKRA 4KAOA 2WTVA 4AA5A 3A61A 3F61A 4PP9A 2W1IA 4EOQA 5HESA 2A4LA 2XJ1A 2YZAA 5CF4A 3KL8A 4GVJA 5DT3A 2P55A 3HECA 4RMZA 4E73A 3D5UA 4G3EA 3K3IA 5ICPA 4BCIA 5ETCA 4HYHA 1NY3A 4GVAA 4ANOA 4AN2A 4E6DA 4DGOA 4GUEA 4RWLA 2QOLA 5AUVA 4GCJA 3D4QA 4AWIA 3ZXTA 4FL2A 3ORIA 3TNIA 3FV8A 4JR3A 4CCBA 4QPAA 2UW5A 2ONLA 3G15A 2WMUA 2CN8A 4O0WA 3TEIA 3IDCA 5EM5A 4E6AA 4H05A 1YOMA 3R7OA 3F3VA 4JI9A 1CTPE 5D41A 3OCSA 4ZTLA 4FZDB 5AUUA 1UU9A 5TOZA 5J7HA 5L6PA 3ZO2A 2CJMA 5C4LA 3ODYX 4DGLC 4QP6A 4W8DA 3RMFA 5C26A 4FZ6A 3RM7A 3Q4ZA 3ZEPA 3RPSA 4YZ9A 4CLJA 3IW5A 2C6OA 4G17A 5AP5A 5AP6A 3BU5A 5A4LA 2PE2A 4C33A 4ID7A 1KE9A 3C1XA 2VO0A 2WZJA 3DK3A 2VX0A 4PQNA 1VR2A 4D2WA 4I0RA 2CKPA 4KIPA 3QCSA 4OR5A 2OH0E 4X2KA 4K2RA 5LVOA 3LKMA 3EQHA 3GVUA 4N6YA 4YNEA 1GZNA 3HRCA 3KMMA 3FKLA 3GEQA 2V62A 1JOWB 4EOOA 2GS2A 2GNHA 3ZXZA 5EM8A 1NW1A 4X6RA 5I4NA 2QG7A 4OTFA 3QQHA 5EW3A 4R8QA 2PUPA 1DAWA 4EH3A 5JFWA 2UVXA 1ZYCA 1O9UA 4MH7A 1ZARA 4I5PA 4I3ZA 1JAMA 3FMKA 5HVKA 2EU9A 3BYMA 2X8DA 3VIDA 3VUKA 4Y83A 2VWIA 3D7TA 4PNIA 3V5PA 4CV9A 4YBKA 3IO7A 1H25A 4YJVA 2FA2A 1YKRA 3FXXA 3MB6A 3RGFA 4CQGA 5BUJA 4X7QA 5KMMA 4DFUA 2J90A 3W32A 4E7WA 4UMTA 5IA3A 4HYSA 2QC6A 1Q3DA 3BLHA 3F88A 3O17A 4WIHA 4ZIMA 3SLSA 3ZRLA 4DITA 4XG4A 4H3BA 2PVKA 2I7QA 1LEWA 4ZSEA 2J4ZA 3OCBA 3CD8A 1GIJA 3GCQA 4RC2A 4FE2A 1F0QA 3NYNA 4KUJA 3B8RA 3FC1X 3NPCA 1PXIA 1H26A 5CVFA 3UNJA 5FXRA 4XOZA 1IAHA 4WD5A 3KY2A 3PZHA 3RM6A 1XKKA 3LQ5A 3HA6A 3MPMA 4J53A 5AUWA 4WG4A 1R0PA 4FTMA 4FEXA 2O8YA 5AA9A 3CY3A 4ZS0A 3UZRA 4ZSJA 2R2PA 3D15A 3S3IA 3JY9A 4XMOA 4FSUA 1M2QA 2R3LA 3ZSIA 3R9HA 3PZEA 3HKOA 2GMXA 4DA5A 2QOIA 4HYIA 4FKVA 2BRBA 3CQEA 4CMOA 1BKXA 3R04A 2HZ0A 3UP7A 2ZM3A 4ITJA 3D94A 3FBVA 5EKOA 3FLWA 3SX9A 1MRUA 3VS5A 4L42A 2ITOA 2BPMA 2QHNA 3P7CA 1ZRZA 4WKQA 3HAVA 5AR7A 2Z8CA 3H9RA 4PTCA 2BCJA 2OLCA 3VS1A 2YM8A 4X2JA 4FI1A 4HPUE 4E1ZA 2WMXA 1RQQA 5KMNA 4UY9A 4RJ3A 3DT1A 2P2HA 4GT4A 3U6IA 1OPKA 5E8WA 4FEVA 3AQVA 3E63A 3A7HA 3E8NA 3FMHA 2WFYA 4RVKA 1V0BA 1PYXA 2OO8X 2XP2A 5TKDA 5TT7A 2XK3A 3LFSA 5C01A 1U4DA 2WB8A 3BHUA 3ZEWA 4L3PA 4KS7A 4CRLA 5IEYA 2OIDA 5CZIA 1G5SA 5ANIA 2UZEA 4BDKA 3DTWA 3DB8A 2C5NA 4MXZA 2UW4A 1GZOA 3FQHA 1FMKA 2VTSA 3JUHA 4DFYA 1ZOHA 4EBWA 3FMMA 5DYJA 5BQ0A 1OUKA 3KGAA 3QALE 3DK7A 4J8MA 5FBNC 3AMAA 1V1KA 1KV1A 4KRDA 3DKGA 4BL1A 1JQHA 4E93A 1PXLA 4IW0A 4RIWB 2F57A 4X0MA 4ASZA 5LVNA 2NNWB 3PXKA 4BTJA 2R7BA 5IG1A 2VD5A 4F1MA 2SRCA 2A0CX 3TWJA 3QWKA 4RLKA 3BHVA 5CYIA 5GJDA 2YM6A 3ZZEA 3DLSA 3QUDA 1E9HA 1WVWA 4KABA 4O0SA 4ZMEA 3NUXA 5ITAA 4DCEA 1OL2A 3QRUA 1WMKA 4C62A 4RIXA 2X7GA 4IAKA 3RP9A 5EYDA 3E8EA 4ZTSA 2Y9QA 1XBBA 1DAYA 2W05A 5IUIA 2Y6MA 2WMRA 5CNOA 2GU8A 4R7HA 5I5ZA 4E4LA 1WFCA 4H1JA 1YXVA 2BDWA 2VTQA 3OC1A 3KXMA 5T68A 1T46A 4ACDA 2X6EA 5TF9A 4GU9A 3VF9A 4MD8E 3AGLA 2G2HA 4F0FA 4D4RA 4MCVA 3OT8A 5FM3A 2Z2WA 2XEZA 4BYJA 2VO3A 2OF2A 2ZDUA 4B9DA 4F7NA 2X7OA 5IMEA 4GIHA 4JRNA 1RW8A 5FD2A 1BYGA 4XG9A 2ITXA 1DI9A 3O7LB 3F7ZA 2NO3A 4FVQA 4U7ZA 1YDTE 4Z16A 5AR3A 3FXZA 3L9NA 3F69A 4HJOA 4YC3A 4U40A 5LVMA 2W7XA 4NSTA 4BI1A 1I44A 4ONAA 4BGGA 2QODA 3F3ZA 4QP8A 4WUAA 3FL5A 4BDCA 4E4XA 4NFNA 5M57A 3UC4A 1BI7A 3BHYA 1H00A 5KMIA 3G0FA 3E64A 5ANOA 2ETMA 2H6DA 4L01A 4TYEA 4NK9A 5TR6A 3V8WA 1WBNA 2R3FA 4O83A 2ITUA 1MUOA 1BI8A 5BVOA 2CCIA 3NSZA 2OZAB 3OG7A 3QCYA 3ANRA 4QMZA 4JIAA 4ZP5A 2XKEA 5FDPA 2HAKA 3EJ1A 4WNOA 2ZMDA 5HOAA 3ZCLA 5JMSA 5CAUA 1APME 3LFCA 5AP0A 4XG6A 4P90A 2W0JA 3AMYA 3V5JA 5CU3A 3AMBA 2X39A 2JD5A 2XEYA 2VTRA 3HZTA 4FUXA 3RPYA 3FDNA 3BPRA 2QOBA 3LQ8A 3OVVA 4YUQA 4C4GA 5KZ0A 5JFXA 2JKKA 2ETRA 3QTUA 2IWIA 4FV9A 3CTJA 5E8TA 5DA3A 4EYMA 1BX6A 5FEDA 2WU6A 4EHZA 4GKHA 2RG6A 2YDJA 2BZKB 5IQGA 3NUUA 3U4WA 2W17A 4MF0A 3MI9A 3PPKA 4J8NA 5A14A 5JSMA 1PJKA 2J0IA 4FV3A 3B2WA 4U79A 5DRDA 5BMMA 4EQCA 5LOHA 4RWJA 4USDA 5KHXA 2GNJA 1LR4A 4YTFA 5E8UA 4UX9A 1YRPA 5D9HA 2WD1A 2QOOA 4WSYA 3S0OA 4PRJA 2CNVA 4QMQA 2XBAA 3TNWA 3ULZA 3EQBA 2C1BA 4FIFA 5DFPA 4TN6A 4S32A 4XH6A 4I41A 2PVRA 2BIKB 4NWMA 5HG5A 4B8MA 2YCQA 2WXVA 4IXPA 3HDNA 3FI8A 3FI4A 3GFWA 5E8VA 5FXSA 3ERKA 3V8TA 2HXLA 4GFMA 5CU6A 3MFTA 2VO7A 4AP7A 3I5ZA 4O91A 4YJOA 4L46A 4E6QA 4M7IA 3K5VA 2IW6A 4MXXA 3LFAA 4MNEA 3FLQA 4UZDA 4O82A 4FTIA 4DFNA 3CEKA 4FKJA 1WZYA 5BVEA 2F2CB 2ITVA 2Y7JA 3AD6A 3MS9A 3GP0A 2PVNA 4RIYB 3BYOA 3MY0A 3OZ6A 1UNGA 4UXLA 3N9XA 3IK3A 4QTAA 4J97A 3HV7A 4A9UA 1W8CA 4O2ZA 4JOAA 4ASXA 5IA0A 4M97A 3ZOSA 4DBNA 3C4ZA 3LCKA 5EHYA 5LXMA 3UIBA 4FZFB 3H4JA 1OUYA 5A4TA 4KIOA 3TJDA 3P9JA 4K9YA 4PNKA 4BCOA 3F2AA 1OMWA 3LJ2A 5J95A 3VAPA 3PRIA 1M7QA 3GXLA 4O0YA 4UB7A 4Y73A 4I1ZA 4Y8DA 4EOSA 3I6UA 3PP1A 3QU0A 4S33A 4IZAA 2YIWA 3WZUA 5D1JA 4M0ZA 4PPCA 5H2UA 4MK0A 5CNNA 3DKCA 4XRJA 2CGWA 3JY0A 3II5A 4XHKB 3ALNA 3E8CA 4I21A 5HE1A 3R7YA 4AGWA 4C59A 1PKDA 4QP1A 5EK7A 4IADA 5AUYA 3R02A 5IMXA 2ONLC 1OM1A 3ORXA 2X2LA 5M08A 3FY2A 2LAVA 5EHOA 4AGCA 3OUKA 1FQ1B 3RPVA 5DR6A 4C0TA 5IF1A 2XVDA 3G33A 5BVFA 3R7GA 1Q41A 2OICA 3ACJA 3HL7A 4NIFA 3EFLA 4BC6A 2O5KA 3DBQA 3F5PA 1JKTA 4YP8A 5L6WL 4NM5A 1WBWA 2CGVA 1PMEA 2PZRA 2V0DA 4G3FA 4GG7A 4Y5HA 4D4YA 2VWYA 2OGVA 1YXTA 4DFLA 3G6GA 2OH4A 3H3CA 4L68A 3KRWA 2B9FA 2ETKA 3C0GA 3LXPA 3C50A 3CGFA 4E6CA 4ZLZA 5HTCA 3S00A 4FTKA 4F7LA 4ZS4A 4PV0A 2UW3A 1F5QA 2R3JA 2BIYA 3C0IA 3VUHA 3PLSA 5IA5A 3CGOA 3QD0A 3CXWA 2PHKA 5T3QA 4AZFA 5IA1A 1PRYA 2YLFA 3VW8A 3ELJA 2JDTA 3FZTA 4JS8A 4R6VA 5HLNA 3RK5A 4DC2A 2R4BA 1FGIA 4U80A 5CZHA 4IB5A 4IVAA 4RC3A 2HCKA 3VO3A 3TV6A 3UNZA 1K9AA 3O8UA 4IB3A 3G5DA 5JK3A 2F9GA 3BIZA 4ZXTA 1H24A 3KN5A 3Q3BA 1LPUA 2BILB 4V01A 5CSHA 2O64A 4NJ3A 2ESMA 2P33A 3QD3A 3VF8A 1OB3A 4DFZE 1S9IA 3IONA 2C0OA 5T6KA 5IEVA 3TIYA 3SW4A 3G2FA 1JLUE 4D28A 4AW2A 2BHHA 1MQ4A 2ZM1A 4W8EA 3VW6A 2X2KA 3BYUA 3D7ZA 3E92A 5GJFA 4FSNA 2X8IA 4BZOA 1H0WA 5GJGA 2XK6A 3SHEA 1XH6A 2C5VA 2UZTA 3D83A 3FLZA 4G6OA 1H08A 3M42A 3NUNA 3ROCA 2VWWA 4KB8A 4G3CA 4OTGA 4ITHA 1W7HA 1DS5A 2YLEA 4JBOA 4JDIA 1XH9A 2YABA 3R00A 4CNHA 4FKUA 4XV9A 3HNGA 4N6ZA 4OBPA 2XNOA 4FSMA 3G9LX 4KS8A 4RZVA 4RA5A 3FI2A 3UBDA 1AGWA 3Q60A 4ZK5A 2YJRA 4GFOA 4AN3A 3U54A 3TTJA 4PF4A 2XJ2A 4EH9A 4AG8A 4R1YA 4BCNA 5HE2A 1FPUA 4B7TA 2BTSA 3DDQA 4KWPA 4CYIA 4R1VA 5H8GA 5HO8A 3BEGA 2WQOA 4NM7A 1TQPA 2BRMA 5CTPA 5HO6A 1W82A 4FODA 2QNJA 5M53A 2XRWA 2JFMA 4D4SA 2R3PA 3FYKX 4XYFA 5E1EA 3QTQA 3PJ2A 4FSRA 3O96A 3VVHA 3ZDIA 1IRKA 4O1PA 4WT6A 5IH6A 5E91A 3FL4A 5AM6A 3I60A 4LYNA 5A54A 3DKFA 4EK4A 4HVHA 1U59A 4PL5A 4Q5EA 3GFEA 4TYHB 2UW6A 2RFEA 5HGIA 1L8TA 4M3QA 1VYZA 5DVRA 5CAQA 4JVGA 5K3YA 4PTEA 4C3RA 2B4SB 4RWIA 4E26A 1YWRA 5LCJA 3RNYA 2YERA 2UZUE 2YWVA 2UZBA 5A46A 3MVLA 3SRVA 3PYYA 5DN3A 4L45A 3HLLA 3R0TA 5L2QA 3W18A 2FSOX 2C30A 4YJPA 1O6LA 5DE2A 2R3NA 5AP7A 5BYLA 4OTRA 1YHVA 5E8YA 2WU7A 2G01A 4FYOA 5AFVA 2Z7QA 3GCVA 2CLXA 1IAJA 5IQFA 1M7NA 4JX3A 3U87A 4QMMA 3C4FA 5HIEA 3VUIA 3LLTA 4F9BA 4WNPA 3RTPA 3CJFA 3UODA 1GIIA 1K2PA 3A7IA 4TXCA 4F65A 4UMPA 4QYFA 4FKSA 2PUIA 1OVEA 2JDRA 3H0ZA 4BIBA 2Y8OA 4DFBA 5ANEA 3V04A 4C37A 3PG3A 4YJTA 3OWLA 5IDPA 3BU6A 3GNIB 4IM3A 3VULA 3LXNA 4GK4A 4MWHA 2PWLA 4MKCA 3WZKA 3DPKA 3BHHA 3OOMA 3UQFA 1V0OA 4G3GA 1PXJA 4C2VA 5DMZA 4G34A 1BL6A 3CKWA 2Q0NA 4V05A 5L6OA 2G2FA 3KK9A 4O84A 3GU5A 2YDKA 3VC4A 4BIDA 3F82A 3E62A 1ZMWA 2GFCA 3UVQA 4C61A 3OY3A 4YZCA 4EH8A 3OEZA 4NEUA 2WO6A 4EONA 5K4IA 4YR8A 5LWNA 1QCFA 5KUPA 4FIHA 3T8OA 2QKWB 5FGKA 3D0EA 2VTHA 3O7LD 4HGEA 5AIRA 2XK8A 4ANMA 4HNIA 3JXWA 3GQIA 3KVXA 3RVGA 4C34A 2UUEA 3FUPA 4CEGA 3BQCA 3ZONA 3FZPA 3SXSA 3PA3A 4I24A 4JDHA 4APCA 4G16A 4JQ8A 4NH1A 4UYNA 2WTJA 3NCZA 4G6LA 3SRVB 3QX4A 3VUGA 1JBPE 1YI6A 5D11A 3EQCA 4OBOA 4YJNA 3PSCA 4DT9A 4IE9A 4E4MA 3U51A 3E87A 3PJCA 5I3RA 2O65A 4HZRA 3UPXA 4RJ8A 1OITA 2XIRA 5J87A 2Z02A 3OT3A 2ZB0A 4HGTA 2BKZA 3VUTA 4JBVA 4DT8A 2XKFA 2XRUA 4QMTA 3RALA 4L8MA 2W99B 4BHZA 4U8ZA 4CXAA 4LRKA 5CXHA 3UQCA 3QTZA 4BN1A 4P2KA 5DI1A 1WVXA 4IX4A 5JRQA 4DTKA 4OLIA 2FYSA 4X2GA 3LFEA 3C4EA 3KXNA 1OGUA 3QL8A 4PPBA 3MPAA 2R7IA 5FM2A 3T3UA 5LMAA 4CZTA 5A9UA 3QRJA 1XO2B 3BV2A 5IU2A 3EWHA 2BALA 2VTMA 1Q8TA 4U41A 4O7LA 3NZ0A 4NCTC 3S4QA 2XIXA 3OF0A 5EQYA 3TZMA 2GHGA 3IOPA 4FSTA 2B9JA 1U54A 4IWPA 2OXDA 3OXTA 3WF5A 5HG9A 4D9TA 4JRVA 3EHAA 3FSFA 3OEFX 4JQ7A 5IA4A 2I0HA 1F3MC 1SM2A 1BL7A 4W4VA 4PDYA 1SZMA 3IKAA 4BRXA 4O7VA 4EWQA 5CI6A 4W9XA 5AV1A 4GKIA 4C36A 3KEXA 3KMWA 4AF3A 3W2SA 4XV3A 3R6XA 4WBOA 2XM9A 1KOBA 5L3AA 2WIPA 4P4CA 2RF9A 3LCSA 3C0HA 5JGBA 2WELA 4TW9A 3T9IA 2YITA 4W4XA 4KKHA 3RNIA 3THBA 3TDWA 4FNXA 2C0IA 5CF5A 2V5QA 2W06A 4XP3A 3FQEA 3KFAA 5F4NA 3E88A 2CKOA 5EG3A 3ZLYA 3NW5A 4TNDA 4ANLA 5JGDA 4Y72A 3QZIA 5J9YA 2AUHA 3WARA 4CCUA 5BVKA 2XIKA 3ET7A 4JT3A 5HZNA 3SD0A 5HD7A 2ITPA 1T45A 4QMOA 2XIYA 5HI2A 4BCKA 4LRMA 1J7LA 4D2RA 1B6CB 3BI6A 1OIUA 4BWKA 5FEEA 1V0PA 5B0XA 3LFFA 3P86A 4QT1A 4R3RA 1R3CA 3ZUTA 2I0EA 4MNFA 5IISA 4K6ZA 2J6MA 4RIXB 2DQ7X 4DE4A 4F9AA 5CXZA 4PDOA 2BAJA 5EYKA 5I9ZA 4O22A 4MBIA 4L67A 3LCTA 4DEDA 4CGAA 5BPYA 1ZOGA 2F7XE 4FV0A 4GK3A 2UZVA 2YHVA 5J9LA 4IACA 2WMTA 3WF8A 4O6LA 5FTOA 4OTWA 4D4VA 5EQPA 1XH7A 2F7EE 5AP4A 3CCNA 5G6VA 3IW6A 4YHTA 2QVSE 2C47A 4ZTRA 5IH5A 4DFXE 3P5KA 4KIKA 4YTHA 2XK9A 2JKOA 4AZWA 3VRZA 2VTTA 3E7OA 1J91A 5GNKA 3R9NA 4BKJA 3KF4A 3I81A 3JVSA 2PVHA 2W4JA 3R63A 5CEOA 1VYWA 3CQUA 1WBSA 3RAIA 2Z60A 4IX5A 3QTIA 3L8VA 3P7AA 2C6LA 1GZ8A 2KTYA 2WKMA 5KHWA 4C2WA 4GSBA 2X0GA 1TVOA 3PY0A 1VEBA 2QR7A 4YGAA 3RWPA 5IUHA 3ORTA 3W2QA 3FHRA 2PVJA 4NW6A 5ACBC 4F0GA 2ZDTA 4QP4A 1P2AA 3R1SA 2B53A 3LFDA 3UO5A 3QCXA 4XG8A 3R8UA 3LMIA 4QQJA 5EDRA 3ULIA 4E5AX 4FSQA 4O0RA 4FK6A 5CX9A 4LMUA 3BCEA 2R3MA 5DR9A 3FKNA 2WEVA 4UEUA 2XBJA 4X3FB 4H3PA 3R7EA 5AAGA 3WE8A 1REKA 3HV5A 3DAKA 4V0GA 2HY81 3GU6A 3DFAA 3BBTB 4O0XA 2ZB1A 2J0KA 3UZPA 2EB2A 4H58A 3RAKA 2I6LA 4EUTA 4ANBA 5M09A 1OZ1A 3BWJA 3U4UA 4DEBA 4XNEA 5H9BA 4ANQA 4EKKA 1WVYA 3P23A 3SQQA 3UOJA 2QR8A 1P5EA 4RVLA 4FKLA 3FLYA 5JFVA 3MVMA 4RFMA 4X6QC 2OKRA 1Q8YA 2WMBA 4HVGA 4LGGA 3VUDA 3O71A 5IH4A 3TL8A 5FWKK 1G8AA 3WZJA 5J7BA 4OAUC 5FUTA 5HCZA 3PIYA 3LMHA 1H1PA 4XLVA 4DGGA 1Q62A 3HYHA 2OU7A 4EH7A 3CD3A 3AT2A 4GU6A 2A2AA 3KB7A 3NX8A 3CKXA 4IM2A 1PMNA 4TWCA 5I3OA 4UMRA 3HMOA 2OXYA 5A6OA 3D14A 2DWBA 4YZNA 1YOJA 1M17A 4FKQA 1J7UA 2CCHA 4TYGA 4ZY6A 2BRGA 4DH8A 2A27A 4XV2A 4F7JA 4HVSA 1NXKA 2CGUA 3N51A 2OK1A 5CLPA 4TT7A 4DCAA 3W55A 3PVGA 4U81A 3ZRMA 4E8AA 1Q61A 1STCE 3MBLA 3DOGA 2VV9A 4FIEA 4RQKA 3OP5A 3FEGA 4FIGA 3DJ7A 5HLPA 2CMWA 4OT5A 3BBWA 4J99A 5LWMA 1S9JA 1GOLA 4YO6A 1TQIA 4N70A 2VNYA 3MJ1A 3Q4UA 3F3WA 4JG6A 4EYJA 4F9YA 4RQVA 5CSWA 1YQJA 3WZDA 3LLAA 3HAMA 4ACCA 3ZM4A 4C58A 2BDFA 3PVWA 5HCXA 2C6IA 4EQMA 2YM3A 2CDZA 2B52A 4E3CA 4ACHA 3M1SA 3NYOA 3VS7A 3QCQA 3IW4A 3MB7A 1IG1A 3IDPA 1OIYA 4L3LA 5CSVA 4FGRA 2P4IA 4HPTE 4EJ7A 2ERZE 3H0YA 2ITZA 4XV1A 4IDVA 5EI8A 3EMGA 3UIXA 4G3DA 3MH1A 4ANSA 5ETIA 4F7SA 5KMOA 4QOXA 5D10A 5L8KA 2JAVA 3QRKA 4DGMA 2ZV2A 3KULA 4PMTA 3MY1A 5EI6A 3D2KA 1OKYA 4GW8A 4J95A 3DQWA 3KRJA 3Q9ZA 4J71A 2XZSA 3TZ9A 4TRLA 4F9CA 2R0IA 2WGJA 5CEPA 4GYIA 4BBEA 5KX8A 4FT7A 1OECA 2QOQA 3K2LA 4II5A 5CQWA 2JDVA 4L44A 4MTAA 4MXCA 5CVGA 4UBAA 4QTCA 5IQCA 2X4FA 4O7SA 4PMMA 1VJYA 4DN5A 4RFZA 2WTWA 4YHFA 3LAUA 4AT3A 2OZOA 3HV3A 2XCKA 1WBTA 3OTUA 2ZV9A 2QOCA 3C9WA 3V8SA 1OL5A 4ZTQA 5HD4A 4PUZA 4F6WA 1H27A 4QP3A 4BHNA 1JNKA 2BAKA 4G9CA 3PSBA 4EORA 3R71A 5E7RA 1ZOEA 1Q4LA 1IEPA 3HRFA 5EQEA 1JSUA 4MF1A 4XRLA 3DU8A 3BE9A 3DKOA 4JJRA 1ZAOA 2R3IA 1OKWA 2W9FB 3FC2A 4YZMA 3AC3A 3VS2A 4K8AA 2ZOQA 4KKGA 4DG0E 4QMPA 4G1WA 3KC3A 5FTQA 2OBJA 1NA7A 4K0YA 4E5BA 4DEIA 5CS6A 5HNIX 5M51A 3IW7A 2WEIA 3G9NA 3MA6A 2YM5A 1ZY5A 4FZAB 2VTLA 3RAHA 1Z57A 4ENYA 4QMNA 3U9NA 2HOGA 2Y6OA 1GZKA 4A4XA 3G51A 3F5XA 2YAAA 4E5WA 3UNKA 1W84A 5LARA 4F63A 5HVYA 1MP8A 2GNFA 3MYGA 4ITIA 3FPQA 2PPQA 3A99A 4BCPA 4QMUA 1W98A 5M4FA 1CKPA 5HTBA 2W1CA 5B7VA 1ZMUA 2PSQA 3D7TB 4FNZA 5H3QA 2X4ZA 4NU1A 4C8BA 2PE0A 2R64A 2X9EA 4M66A 4RJ7A 4OT6A 4PL4A 3R8ZA 3WF6A 5A4CA 2XS0A 3HMPA 2RFSA 3ANQA 2JLDA 3FZOA 2PVFA 3SOAA 2Q0BA 4Z7HA 4K11A 4KBKA 4NFMA 4EZ3A 4LOPA 1Q5KA 2CNUA 3TZ8A 2BMCA 4JR7A 4ZEGA 5CVHA 2XMYA 3OOGA 2BZJA 4UYAA 2W5HA 3VS0A 4IFGA 2H96A 4GK2A 3ZUVA 4EKLA 3DZQA 5HCYA 4BWXA 3WBLA 5CI7A 4AE9A 5C8KA 1PW2A 1R0EA 4YURA 4U43A 4OTIA 2FSLX 4PPAA 1Q99A 3E93A 2JC6A 3EFJA 3KRXA 3EN6A 5M55A 4Q9ZA 3LCOA 3CJGA 2BAQA 3PIZA 3NW7A 2C69A 4W4YA 5HKMA 1YI4A 4AXAA 3EN9A 5HVJA 3KRLA 4IWDA 4M8TA 4WO5A 5AEPA 4X3FA 4D2PA 2GS7A 4DLIA 4CKRA 3Q04A 3FYJX 1WBOA 2IN6A 3O8TA 2B0QA 5A4QA 4CD0A 3A2CA 5C4KA 1FMOE 2JGZA 2VWBA 3NNVA 4A07A 4O7TA 4FYNA 5GZ9A 3TUCA 4QTDA 4O7ZA 2J7TA 3NAXA 4RX9A 4RZWA 4WG5A 2UW9A 4QYGA 4BDBA 3SGCA 2GHMA 3OCTA 3L8XA 2C3KA 4FNWA 3RHXA 5KMJA 4L7FA 5C8MA 5J9ZA 4FTRA 2WQMA 3L8PA 3PXQA 5FLFA 3IGOA 4I5MA 4FV2A 3F2NA 4DH1A 2C5OA 2XKDA 3FQSA 2YCSA 3KF7A 4DGNA 2F2UA 3QC4A 4GMYA 3SG9A 3DK6A 2VWVA 4A4LA 1FINA 3DY7A 5AADA 4Y5QA 3Q2JA 3ETAA 3REPA 1IA8A 4IAIA 4NCTA 4AAAA 4F08A 4ERWA 2Q83A 4TYJA 4U45A 4BCMA 3AGMA 4I4FA 1XBCA 5FTGA 2FGIA 5AUXA 2RGPA 5L2SA 4FTNA 4JG8A 5IQHA 3P08A 3AXWA 2C6DA 3KRRA 1YXSA 2DUVA 3E5AA 2JAMA 4P5QA 3PXFA 4E4NA 2VTNA 3UTOA 3EQDA 3P0MA 3PSDA 5JFSA 3BLQA 5CF6A 3QLFA 3ZDUA 3F3UA 3VRYA 5KCVA 3O51A 3EIDA 3NCGA 1ZYLA 1UKIA 2R3OA 4KNBA 5BVWA 3R8MA 1SVGA 4EH4A 3P7BA 3A7FA 1Q8ZA 4JBQA 4FTJA 2P0CA 4RFYA 2XJ0A 3FWQA 4I23A 4O21A 3HMMA 1DM2A 4U42A 1O6KA 5CU4A 2UW8A 5ANJA 2XCHA 3FI3A 3FMLA 1M2PA 3A7GA 2WMAA 4JLCA 4M69A 4FKOA 3PXYA 3VBWA 2GCDA 4AW0A 4CT2A 3LVPA 1SMHA 5IZFA 2WAJA 2XA4A 4H3QA 4QMSA 3TNHA 1PYEA 2E9VA 2ZAZA 4NKAA 5AX3A 1P4FA 2BFYA 3KMUA 1URCA 2E2BA 3AD4A 4WRSA 3V5QA 3JR1A 4OTDA 4QPMA 4FMQA 3QQLA 4RJ6A 4FV4A 1J1BA 4O0VA 4S2ZA 5M07A 2WHBA 3RJCA 4EJNA 2HK5A 3EKNA 3ENMA 3KK8A 3HMNA 4TKSA 3TTIA 3OXZA 3ZC6A 3EOCA 5DEYA 1ZLTA 3R28A 1W0XC 2EWAA 3PA4A 3PJ8A 4IWOA 3RI1A 3CLYA 3UYTA 4AZEA 4O0UA 3TUBA 1R39A 5LCKA 3L9PA 5L2IA 4FEUA 1YI3A 3UIUA 2EUFB 3QA0A 3E3BX 2PY3A 5DT4A 5EW8A 5C9CA 2V55A 5HG8A 3UMWA 2YJSA 4DH5A 3EZVA 3QBNA 5H8BA 3ZLXA 5KKRB 2ZV7A 4JG7A 3EYHA 3DXQA 2BFXA 4ZY4A 2F4JA 3VJNA 3COHA 2IPXA 4BDFA 3R8VA 4L43A 4ENXA 4O7WA 2C5YA 3CIKA 4KRCA 1JWHA 4I5CA 4BZDA 4ZLYA 5D7AA 2C4GA 5EH0A 5AV3A 3LJ0A 3DXPA 2XNNA 4M67A 3BWFA 4B99A 3O2MA 3A4OX 1KWPA 3LFNA 4RJ4A 3ODZX 5K0KA 3ORMA 3UC3A 5ANGA 5DOSA 4M15A 3K54A 2GNLA 2OG8A 3R8PA 4BDDA 3R1YA 4RX8A 4GRBA 3CPCA 3QGWA 1YDRE 3VBXA 1QL6A 1XR1A 3I1AA 4BIEA 3FJQE 3TNPC 1FGKA 2C6MA 2JITA 2NRYA 4FVPA 3SA0A 1NT2A 4HYUA 3TKUA 4LI5A 4PWNA 2YIYA 3WE4A 4EOKA 4XG3A 1FVTA 1KE5A 3RKBA 2OSCA 1PKGA 4IC7A 4LUDA 4QYHA 5BYZA 3Q6UA 5CENA 3UQGA 4D2SA 3IPHA 5EM7A 4D9UA 5F1ZA 1XHAA 3B2TA 3CC6A 3GCUA 5BMSA 3COMA 4J52A 3U8WA 2V22A 4WUNA 4QPSA 3MSSA 1NVSA 1WBVA 4YZBA 2HY0A 3BGPA 5EYMA 4CFUA 5E90A 5HTIA 1OBDA 5BVNA 3CS9A 2OJJA 4G31A 3DA6A 4B8LA 4F64A 1UV5A 3GU8A 4Z55A 3T3VA 4EH6A 3F2RA 3AC4A 3QQKA 3AT4A 4ZSAA 2XK7A 3D2IA 1LEZA 3FSKA 4ALVA 2AYPA 2WNTA 2VTJA 3QYZA 2UZWE 4CFWA 3NLBA 3UVRA 1XQZA 1Y6BA 3KULB 2PMNX 3PXZA 3QD2B 5IEXA 1FOTA 2GNIA 3QTXA 4QTEA 1PHKA 1XBAA 3EQFA 4JXFA 4ZOGA 4FTLA 4ASDA 4L6QA 2WTKB 3EQIA 3MH2A 3MVHA 2PZYA 4JAJA 5K5XA 4FEWA 3PJ3A 2WPAA 4A9RA 3BGZA 5CT7A 5KBRA 3F9NA 2OJ9A 1YWNA 3GGFA 4WSQA 5LQFA 5FP5A 4U3ZA 3VS4A 2WQBA 2CPKE 4IAZA 4JDJA 4B0GA 2UVZA 3A60A 4BGQA 1UU7A 2QLQA 3FZSA 3NNXA 5JEBA 4WOVA 4BCHA 3R01A 3ZBXA 3SXRA 4AU8A 2UVYA 4PMSA 1A06A 3W2RA 4EH2A 4FL3A 3PJ1A 4FZ7A 2CSNA 4K33A 2PUNA 3GCSA 3Q4CA 4BVUA 4LM5A 4TY1A 5EHLA 5AX9A 4FIJA 3UYSA 4CTBA 2O63A 4MXYA 4DEEA 3I7BA 4AN9A 3PFQA 1B39A 2I40A 2QOKA 4CG8A 2REIA 3KXGA 2G1TA 4EHEA 3PWDA 1H1WA 2YIQA 2Y4IC 2ITYA 4X2NA 3ZHPC 5IA2A 2R9SA 3I6WA 4RRVA 3NVMB 2CKEA 4O38A 3OBJA 3QKMA 2J5EA 4DTAA 3PE1A 5CAVA 1OPLA 1YHWA 2PZIA 5IDNA 4L00A 3VHKA 3ALOA 4J98A 2GPHA 4RBLA 5LMKC 5GIPE 4BCFA 4X21A 4FK3A 4KBCA 1GY3A 1EH4A 5CU2A 5K4JA 3AOXA 3A4PA 4MXAA 2QURA 3OCGA 4KIKB 1CKIA 2IO6A 5GZAA 4YPDA 3PUPA 3AC2A 4Q2AA 4ZJIA 2W4KA 4DYMA 4DBXA 2VWZA 4EI4A 3Q5ZA 5ETAA 2CKQA 3FZRA 3MIAA 5KKRC 1SYKA 3ITZA 4AZTA 1GAGA 2PZ5A 1O6YA 2X8EA 4FKGA 4AW1A 3M11A 3NUYA 4AA4A 4ZSGA 1SNXA 2H9VA 3GU4A 2JIVA 3WILA 2BHEA 1Z5MA 5D7VA 4A9TA 3PP0A 3UGCA 3NWWA 4IANA 5DWRA 3Q9XA 4TPTA 1H07A 4JQEA 2HXQA 4O27B 5M4CA 4IVDA 4EZ7A 3SAYA 3F7WA 4NUSA 4BI2A 4FT9A 3NYXA 4CKIA 4QNAA 2YIRA 3EQPA 2GNGA 4LUEA 4NTSA 5BYYA 3UJGA 5KMKA 3BEAA 3L9MA 3VS3A 1BMKA 2W1FA 5BNJA 3EN5A 5CY3A 5E8SA 1P14A 3UO6A 5CEIA 3PDTA 3LJ1A 3P4KA 3DTCA 3EZRA 3UIMA 4KKEA 5HU3A 4IC8A 2QD9A 3E7VA 4FA2A 3HX4A 5LMKA 3MIYA 4BBMA 1M52A 2QQ7A 4L7SA 4AFJA 4C02A 3C4WA 3I0QA 3L8SA 4F6SA 4AOTA 4FG7A 5AJQA 4AT5A 4MAOA 2VZ6A 4MVFA 3UE4A 2XNGA 4M14A 4JBPA 2Y0AA 2GSFA 2HW7A 2NPQA 4NJDA 4X3FC 3UDBA 1L3RE 3QTRA 3RPRA 1OBGA 3PLAE 3KCFA 2PMOX 5DR2A 4IJPA 2VTAA 3C51A 4XLIA 4ERKA 4UWYA 3NW6A 3NS9A 4XUFA 2IVUA 4H39A 4ZY5A 4YMJA 3BHTA 4IJ9A 1TKIA 3AD5A 4YNOA 3QX2A 4FSWA 2X9FA 1UU3A 4YTIA 5IQDA 4GEOA 1Q24A 3I79A 3SXFA 4FTAA 1JSTA 5EW9A 5J1WA 2HZNA 5AUTA 4FX3A 4UMQA 3U6JA 4IQ6A 3UP2A 4O0TA 2X6DA 4YPSA 3ZH8A 2XUUA 3PIXA 3BZ3A 1MRVA 5KE0A 3FMEA 1RJBA 3R1QA 4RSSA 3BYSA 2VAGA 4EC9A 2YAKA 3TJCA 4DHFA 4U5JA 4HCVA 4Q9SA 4FKTA 3IDBA 5L8LA 1U5QA 2QOHA 4CMUA 1YXXA 2G9XA 3PTGA 4TYIA 1I09A 4UWBA 2BUJA 3MH3A 4U0IA 3ORZA 1A9UA 4R5SA 4F70A 3RAWA 4C57A 2QONA 2GHLA 4IAAA 4PY1A 5HE3A 4IVBA 4BDGA 5JQ5A 4IX3A 3H9FA 1UNLA 2GQSA 2C6EA 3GCPA 3O8PA 3Q6WA 4YBJA 5IUGA 5IQBA 3BRBA 5AIKA 1ZYJA 4YHJA 3FLNC 3MJ2A 4FTCA 5JN2A 1ZY4A 4ZZNA 3JPVA 4L52A 2W9ZB 4DF3A 3LM5A 2R5TA 3AC1A 3TNQB 5ANDA 4D5HA 3R1NA 4QRCA 3ZFYA 2J0LA 5CAPA 3MH0A 3AT3A 3ZMMA 1ZZ2A 5JRSA 4C4HA 4X2FA 4LV5A 4XP2A 4QQCA 5HLWA 2VGOA 3DBEA 3OW3A 4R3CA 4C4IA 4R7IA 1R78A 1H01A 2WTCA 3OWJA 5EOBA 3WYXA 1H1SA 4R3PA 4YU2A 1MQBA 1ZYDA 5KMLA 3GT8A 2OFVA 3TV4A 3BLRA 3NR9A 5EFQA 3LCDA 4I20A 4CFFA 5FQDC 2IG7A 4NZWB 2BRNA 1RDQE 2YCFA 3F5GA 3PG1A 5DGZA 4BTKA 4EK5A 5L2TA 5AR4A 1PXPA 3NGAA 5K9IA 4A9YA 2C68A 4QMYA 1KOAA 2HYYA 1OL6A 3V51A 3ZSGA 3WF7A 4FTUA 5I9XA 5HHWA 3OBGA 4USEA 2I0VA 2PZPA 2WTDA 2JEDA 4LL0A 4QD6A 4FF8A 3KQ7A 4GFGA 3G90X 3MY5A 4JIKA 5HIBA 3ZUUA 3H30A 5A6NA 3N4TA 3MW1A 2AC3A 3VWAA 4RLLA 3OMVA 3S95A 1CDKA 2ZM4A 4PTGA 5M4IA 5GHVA 1UWJA 2V7OA 4I0SA 4C7TA 4WRGA 4RGJA 3HV6A 3GB2A 1LUFA 1UU8A 3COKA 3C4CA 4KIQA 3ZRKA 5ANKA 5I9UA 1ZMVA 2GFSA 3TACA 3W2OA 1QPJA 4FTQA 4ALUA 4ZZOA 4I93A 4GT3A 4EOPA 5L4QA 4O7RA 1YW2A 5M4UA 4LMNA 3OXIA 3MTFA 2VUWA 4TWNA 5GIOE
chains in the Genus database with same CATH superfamily
1R1WA 3TCPA 4EK3A 3PXRA 3IG7A 4R78A 3I4BA 1ATPE 5F9EA 4RIYA 4I94A 2QU6A 3CQWA 2EVAA 2IEWA 4H36A 3UG2A 4CTCA 3CTQA 4EQUA 4CG9A 3R9RA 4YO4A 4HOKA 5A3XA 4EHVA 3ACKA 4IEBA 5HNGA 4I22A 4CKJA 4N57A 4ORKA 5JT2A 5IQEA 4BB4A 3LOKA 3OFMA 3POOA 4FSYA 3RINA 3V5LA 3A8WA 4G6NA 3TKHA 4C4EA 1YVJA 1Q8WA 2X81A 3AC8A 4W4WA 4FR4A 5JH6A 3W2CA 3SC1A 4C38A 5KO1A 4RG0A 3U55A 1JVPP 4C4JA 2OJIA 4FG9A 2NRUA 3LW0A 2WMQA 2H8HA 3B8QA 4IX6A 4EK8A 2F7ZE 2YISA 3GQLA 3SOCA 5I9YA 3VBYA 3PY1A 1PXMA 4GIIA 5DG5A 2OW3A 1FVRA 2IZUA 4G9RA 4IFCA 3VN9A 3QAME 4YLKA 3U9CA 1AQ1A 4LGDA 4ZZMA 3DGKA 4I0TA 3TMOA 4MD9E 3OD6X 1H0VA 4LFIA 3W16A 4FTOA 3ZFMA 3FY0A 4NW5A 3RK7A 4AZVA 4YTCA 1VLRA 5AV0A 4YLLA 3DAEA 1Y8YA 2V7AA 2ZJWA 2J51A 1ZYSA 1ERKA 3PPZA 4U44A 4UMUA 3QHRA 4JX7A 3C5UA 3L9LA 4QP9A 4R77A 5M44A 4ZTNA 2JIIA 1YHSA 2UZDA 5DPVA 4DEAA 5F94A 2ITNA 5L8JA 5AV2A 3PRFA 4S34A 3BU3A 2FO0A 2XYUA 4HNFA 3UG1A 3VS6A 4BR3A 3PE2A 5CANA 4AGDA 1J7IA 4Y46A 4DEGA 1UKHA 3ZLSA 3QUPA 3NIEA 1J1CA 3R21A 4P5ZA 1FVVA 2ZV8A 2IZTA 3QLGA 5HEZA 3VBQA 4D1SA 5AA8A 3NMUF 2E9NA 3KKVA 1ND4A 4CZUA 4D5KA 3GBZA 3NDMA 4NM0A 4CYJA 5M56A 4FOCA 3S2PA 1IR3A 3FMNA 3RZFA 2P3GX 5E92A 5E8XA 4BCQA 4MQ1A 4DG2E 3ID6C 4L53A 5C03A 5ACKA 3GC8A 2OXXA 3V6SA 2G15A 3VUMA 2B9HA 3D5VA 4F9WA 5IQIA 1PXNA 2RFNA 3ZC5A 4Z9LA 3TM0A 3QF9A 2OIQA 1JKKA 4AQCA 4KBAA 3QTSA 4NM3A 5DBXA 5BX0A 4L9IA 2C3IB 4AX8A 1ZZLA 4MUQA 3DAJA 4N4SA 3QWJA 3UPZA 1XWSA 5EKNA 2PU8A 3QXOA 3EQRA 3QQUA 4QQ5A 2B1PA 4GL9A 4K1BA 4E20A 3C5IA 2GQRA 5E9EA 2YEXA 5M06A 2ITQA 4HVDA 4FGBA 4XG7A 1H8FA 4FOBA 4C3FA 1G8SA 4BKYA 3LQ3A 3E8DA 5HX8A 1OKVA 2HZIA 3BELA 3E3PA 4QO9A 1HCKA 2C5XA 3DJ5A 4I6FA 3QQJA 2XYNA 2JBOA 3HA8A 3NRMA 3RBWA 3R2BA 1PXKA 4IZ7A 3TIZA 4KD1A 3VBVA 3DQXA 3I7CA 4NTTA 1CMKE 5CT0A 2BTRA 3DCVA 2XB7A 5K0XA 2IVSA 4CFXA 2ACXA 3PPJA 1HOWA 4AA0A 3SVVA 2C1AA 2YM7A 1U54B 3DBCA 1WBPA 2VX1A 3RZBA 4N0SA 4DH7A 2OI4X 3COIA 4JL9A 2FUMA 3UMXA 2CGXA 3ORNA 4XCUA 2X7FA 2JKMA 4DINA 4RJ5A 2ERKA 3G0EA 2VTOA 3HUCA 2EXMA 4YSMA 3TV7A 3HUBA 2XIZA 4AUAA 3GOKA 4HCTA 3IGGA 4D1ZA 4IWQA 2BR1A 3GC7A 4G2FA 4G5JA 4BY9E 2E9PA 3FKOA 2HWPA 4GYGA 1Q3WA 3Q4TA 2W96B 3C7QA 4IH8A 3DXNA 4A9SA 3NEWA 5JKGA 5E1SA 1JPAA 5CEKA 4IMYA 3D5XA 3DLZA 3OS3A 4PDSA 5DHJA 1Z9XA 2X2MA 3ZBFA 1H28A 3Q9YA 4D2VA 2RL5A 4RX7A 5E4HA 3RCJA 2WQNA 2R0UA 5DIAA 4QMWA 3VBTA 2FSMX 4RWKA 1XH8A 3LHJA 2HENA 5F95A 3VQHA 4HGSA 3HRBA 3OUNB 5B2KA 1REJA 4EK6A 2W1GA 3PVBA 3QD4A 3CTHA 3DV3A 4OBQA 2YZLA 4IVCA 2WTIA 4OUCA 2VGPA 2BDJA 3W0PA 1HCLA 5G1XA 2VTPA 4HVIA 3DNDA 2XNPA 5B2LA 4M84A 4BCJA 3ZM9A 3R22A 5DH3A 1UVRA 3LIJA 2QOFA 4LV8A 4XG2A 3N4VA 2RFDA 2ZVAA 2R3GA 4JNWA 2JFLA 4EEVA 4IB0A 4RX5A 3UVPA 5CEQA 4BBFA 4MEDA 1G3NA 3LXKA 4V0GB 1JKLA 2JDOA 1IA9A 3DBDA 3O50A 1SVEA 3LPBA 2BVAA 3P78A 3HV4A 2UW7A 2HZ4A 2W5AA 3ORKA 3R2YA 4IDTA 4M68A 4USFA 4AS0A 5HX6A 4ZTMA 4FV6A 4OTQA 5JQ8A 3KU2A 3QFVA 2OJGA 2IJMA 1BUHA 3C4XA 4LG4A 4O6EA 4O1OA 5HNBA 4BGHA 2BZHB 2I0YA 3EFKA 2C0TA 5BUEA 4EC8A 2ITWA 2VNWA 3A8XA 2BRHA 3CP9A 3L1SA 4DTBA 4U97A 5DNRA 4F4PA 4G5PA 2P2IA 4AOIA 4D0XA 5AV4A 3MVJA 3KXHA 4ZLOA 3ML1A 1XJDA 1PF8A 3MPTA 2QO9A 3LFBA 1OPJA 2JIUA 4EH5A 2XANA 3JYAA 3KVWA 3QZFA 3ZFXA 2C6KA 2WMVA 4BWPA 4W9WA 3KCKA 2FVDA 4LOQA 4TNBA 1OI9A 4LRJA 3EL7A 4OTHA 3NFGB 4MNEB 1KV2A 3PVUA 3O0GA 3F3TA 5J1VA 3Q96A 4IBMA 3RWQA 4PP7A 3FLSA 5DRBA 4F1OA 4BTFA 2PK9A 4FICA 4GV1A 1ZWSA 3JVRA 4XX9A 5HU9A 3EL8A 4WA9A 2JKQA 2UV2A 1TQMA 4BDAA 1E1XA 4XBUA 4ZJVA 3F66A 3U6HA 5ETFA 3QYWA 1W83A 3ZTXA 3FHIA 3DNEA 2EB3A 3AC5A 5CSPA 2Z7LA 2IW9A 3OW4A 4WNKA 3VHEA 3WZEA 3D5WA 5AAEA 3FPMA 4GH2A 3V3VA 4UXQA 5FBOA 4UV0A 3ZLWA 4RPVA 3NIZA 2FH9A 1DI8A 2I1MA 3IQ7A 3K5UA 4FTTA 3NUPA 2W4OA 4J7BA 5HBHA 3HMIA 4F0IA 2VTIA 4XOYA 1H1RA 4I5HA 1YXUA 2Y4PA 2GS6A 5IQAA 4MBJA 3WI6A 3W33A 4APPA 3C13A 3FE3A 5I9WA 4GJ2A 2BZIB 3NUSA 4FC0A 3CPBA 1CSNA 3GU7A 2W1HA 1GIHA 3V5TA 5IPJA 3DJ6A 1LP4A 1YWVA 2XKCA 3MGYA 4HZSA 3R7UA 4UN0C 4S30A 3ATTA 4A4OA 3DFCB 2WMWA 4BDIA 2PE1A 1OL7A 3G6HA 4MXOA 4HGLA 2RIOA 4I92A 3P5JC 4RVTA 3P79A 5A4EA 4FV8A 4D58A 1PMVA 5EYCA 3IOKA 2Z7RA 1YOLA 2O3PA 4NIFB 4AFEA 5JZNA 2J5FA 3DBFA 3N4UA 5IKWA 4GS6A 4YZDA 4RT7A 3ORLA 1K3AA 3SV0A 4QYYA 3GC9A 4FV7A 2QHMA 4QMVA 3OROA 3GI3A 4A7CA 4K18A 4U6RA 4TYHA 3ZO1A 4LDTA 4EL9A 2VWUA 3BX5A 4EOJA 2CNQA 4RIWA 4FJVA 2HELA 3MFUA 4EUUA 2B9IA 4TWOA 3OY1A 3MESA 2OF4A 3V6RA 1KSWA 3V01A 4ZTHA 3TXOA 4IB1A 4FKIA 3MWUA 4NT4A 3VQUA 3TKIA 5JGAA 2YWPA 4NKSA 2PUUA 5E8ZA 2PYWA 4MD7E 4ZMFA 4FKRA 3GENA 3SDJA 3FMDA 4FKPA 3LMGA 1P4OA 4O96A 3GC0A 4DEHA 3AKLA 4QP7A 3R9DA 2GTNA 4LQMA 4RIOA 5DLSA 1Y91A 3EH9A 4O4BB 2VWXA 4J1RA 2XF0A 4CRSA 1GNGA 2OWBA 3CY2A 5LVLA 2GTMA 2XH5A 4IHPA 4B6LA 4F09A 2E9OA 4KA3A 3DB6A 3RK9A 1Y57A 2UZNA 5I9VA 4MX9A 2YN8A 3EN7A 1GJOA 2CHLA 3Q53A 1H1QA 2IW8A 5EDQA 2ZMCA 3QTWA 2GQGA 3NUAA 3M2WA 4MHAA 5CU0A 4ACMA 2R3RA 4FNYA 4EOLA 4CVAA 5H8EA 3I0OA 2EXCX 4M12A 4XEYA 5FXQA 5B2MA 4XS2A 1JSVA 2YFXA 2VX3A 4YLJA 5BUIA 5CQUA 4R7BA 2W5BA 4GUBA 3RPOA 2O2UA 5HORA 4QNYA 2PVYA 3QKLA 4I6HA 2DS1A 2QO2A 3F5UA 5CWZA 5EI2A 3KREA 2NYAA 3UOHA 1RE8A 2HW6A 2IVVA 4FUYA 4GT5A 4CFMA 3OWPA 3TUDA 5DEWA 4RC4A 3QA8A 4FEQA 3WYYA 4YSJA 1QPDA 1Y8GA 3NYVA 5AR5A 2EXEA 4QTBA 3V5WA 4AACA 4B4LA 4NYEA 5FP6A 5HG7A 4OAVB 3KXZA 4QQTA 3TDVA 3ZS5A 4BCGA 2G2IA 4WNMA 3D9VA 4FT5A 5J8IA 3EN4A 2A19B 4O7YA 4BJJB 4IM0A 3Q52A 3WOWA 3MFSA 3R83A 4IIRA 4D2TA 2CN5A 3Q5IA 3QRIA 5FEQA 4BYIA 4C4FA 4CSVA 1VZOA 2IZSA 2QG5A 2OJFE 2IVTA 4FKWA 3LFQA 4KSQA 4DG3E 4F6UA 4F1TA 3S1HA 4JAIA 1SVHA 1WAKA 5C27A 4JDKA 3QRTA 3WIGA 5CAOA 5AAFA 4YC6A 3FXWA 3OHTA 4D0WA 3K3JA 4AZSA 4MQ2A 4BFMA 2H34A 4ZSLA 4BICA 5K5NA 3QXPA 4D1XA 2J9MA 3P1AA 2VRXA 4BDHA 2FB8A 2XK4A 3NNUA 4IAYA 3WIKA 5I0BA 4M69B 2VN9A 2PMLX 2WOTA 5AUZA 3ZO4A 5HICA 1XH4A 4J96A 5KZIA 3PWYA 4CFNA 4O4CA 3BV3A 4TTHB 5AR2A 4Y95A 4QP2A 1U5RA 3TI1A 4FBXA 3MDYA 2XNMA 4HCUA 3R7IA 3H9OA 3QGYA 5EOLA 3TG1A 3LZBA 2QI8A 3HVCA 5L2WA 2XNBA 4AE6A 4MYGA 4TL0A 4BI0A 4KSPA 4H1MA 3R7VA 2RKUA 3CE3A 1CM8A 4RVMA 5HIDA 4F99A 5AMNA 4FVRA 1QPEA 3W1FA 1OL1A 2NP8A 3LE6A 5AP2A 4LOOA 4NL0A 4OTPA 4AXCA 2A1AB 4HW7A 4DLJA 3FAAA 4CT1A 4UWCA 1Q97A 5EM6A 2YIXA 2C3LA 2J2IB 4ZJJA 1CKJA 4WG3A 1M14A 3FZ1A 4ACGA 2AEGA 2PVLA 5KNJA 3EKKA 1NVRA 1A48A 3AG9A 2ZYBA 2FSTX 4PMPA 2HWOA 3MV5A 4BTMA 2RSVA 5LJJA 2QLUA 4PDPA 2YCRA 2WIHA 1KE7A 2PULA 3ZZWA 2C3JA 5AWMA 2PMIA 3HP2A 3NAYA 1QPCA 2E9UA 3QZHA 4QMLA 1ZXEA 1E1VA 3W0RA 2R3KA 3ZO3A 1Q8UA 1KUTA 2UZOA 4XJ0A 3QQFA 1J3HA 1NVQA 2IZRA 4GG5A 4CMTA 2QCSA 2PTKA 3R73A 5EDPA 2PVMA 4LL5A 3R9OA 3QQGA 2WOUA 4ALWA 4UALA 1OIRA 3IECA 4FL1A 1MRYA 1WCCA 3BQRA 4IAFA 4WBBB 3BYVA 5CEMA 5LVPA 4O7NA 1XH5A 4EBVA 5TO8A 3ENHA 1JKSA 4FSZA 4TWPA 4BF2A 3EYGA 1OKZA 3O23A 4O4EA 4S31A 4YC8A 2YDIA 4EWHA 3R30A 3MFRA 3SG8A 2X1NA 2QO7A 5CALA 1YDSE 2RG5A 4DDGA 4ANNA 4CFVA 3IS5A 4FT3A 4QYEA 5CASA 2KULA 2PL0A 3GOPA 1AD5A 3I5NA 2YM4A 3BE2A 4L3JA 3W8LA 3JS2A 3QKKA 5F20A 5BVDA 2W1EA 2W1DA 4DH3A 5C1QB 5J79A 4O81A 3QC9A 3UO4A 3DDPA 3R8LA 5D12A 2XNEA 3Q9WA 4DAWA 4X3JA 4BZNA 4CLIA 3W10A 3BGQA 3F6XA 4EHGA 5GINE 2B54A 4I6QA 3TZ7A 4EOMA 5CF8A 4I4EA 2GDOA 3ROYA 4YJUA 1UNHA 4M0YA 2UW0A 4KINA 3W8QA 5J5TA 3ORPA 4MWIA 4M13A 2ITTA 4IZYA 3TT0A 5J5SA 5KBQA 2AC5A 4Q5HA 3T9TA 3PA5A 3DZOA 4WHZA 3MA3A 4AGUA 2J0MB 1URWA 3HP5A 4TZRA 4YJQA 4EOIA 3CR0A 3ATSA 4LGHA 2OFUA 3UZTA 4U3YA 1KE6A 2UZLA 3KN6A 2CLQA 4A06A 4AOJA 4AT4A 2OZAA 4FG8A 3KXXA 1B38A 1M2RA 4O2PA 3TN8A 4Y85A 3SKCA 1FBNA 4FIIA 5C8NA 4ZAUA 5HBEA 4U9AA 3SW7A 1PMUA 3PY3A 4OGRA 1Y6AA 2B55A 2WTKC 3CBLA 3POZA 5CSXA 2LGCA 1UA2A 2OIBA 3QHWA 4MBLA 5HBJA 2Y4IB 4CZYB 5HO7A 4C3PA 3WF9A 5DT0A 1X8BA 3ZSHA 4FV5A 4OW8A 2BROA 3A7JA 1OIQA 4QMXA 3OWKA 2JBPA 3EB0A 4AW5A 4IZ5A 4O86A 3A62A 5AP1A 3ZYAA 3MN3A 3MTLA 2W1ZA 4Z3VA 3QUEA 4EZ5A 3NVKI 5AR8A 5HQ0A 1H4LA 4FT0A 4YJRA 2WQEA 4XP0A 2J50A 4RA4A 4I6BA 3DS6A 2R3HA 1KE8A 1PXOA 1PY5A 2HIWA 3UOKA 3GUBA 5FRIA 3EQGA 2XM8A 4PL3A 4ASEA 4C35A 5HE0A 2DYLA 3H10A 3HEGA 4CV8A 2R3QA 2YACA 3NNWA 5GZ8A 3BKBA 3RHKA 1QMZA 3CSVA 4BDJA 3OTVA 2VO6A 4XBRA 2F49A 3LM0A 5AP3A 4FV1A 1U46A 3KA0A 3RCDA 3ZU7A 3VNTA 4BDEA 4CQEA 1SNUA 2WMSA 2QU5A 3LXLA 3HGKA 2YA9A 3UOLA 2Z7SA 2B7AA 5JZJA 4AXEA 4D55A 3W2PA 4P7EA 5FDXA 2BKKA 3Q32A 4K77A 3EFWA 3IW8A 4UZHA 4YJSA 2VU3A 2O0UA 3HDMA 3Q2MA 2C6TA 5AM7A 4GJ3A 4ARKA 3FMJA 4V04A 5FG8A 5TE0A 5LMBA 4R5YA 4BKZA 3AKKA 3QZGA 4PX6A 4Z7GA 2JDSA 3VJOA 1BLXA 1IASA 1UWHA 2J0JA 2QKRA 4KAOA 2WTVA 4AA5A 3A61A 3F61A 4PP9A 2W1IA 4EOQA 5HESA 2A4LA 2XJ1A 2YZAA 5CF4A 3KL8A 4GVJA 5DT3A 2P55A 3HECA 4RMZA 4E73A 3D5UA 4G3EA 3K3IA 5ICPA 4BCIA 5ETCA 4HYHA 1NY3A 4GVAA 4ANOA 4AN2A 4BJJA 4E6DA 4DGOA 4GUEA 4RWLA 2QOLA 5AUVA 4GCJA 3D4QA 4AWIA 3ZXTA 4FL2A 3ORIA 3TNIA 3FV8A 4JR3A 4CCBA 4QPAA 2UW5A 2ONLA 3G15A 2WMUA 2CN8A 4O0WA 3TEIA 3IDCA 5EM5A 4E6AA 4H05A 1YOMA 3R7OA 3F3VA 4JI9A 1CTPE 5D41A 3OCSA 4ZTLA 4FZDB 5AUUA 1UU9A 5TOZA 5J7HA 5L6PA 3ZO2A 2CJMA 5C4LA 4FRFA 3ODYX 4DGLC 4QP6A 4W8DA 3RMFA 5C26A 4FZ6A 3RM7A 3Q4ZA 3ZEPA 3RPSA 4YZ9A 4CLJA 3IW5A 2C6OA 4G17A 5AP5A 5AP6A 3BU5A 5A4LA 2PE2A 4C33A 3W0SA 4ID7A 1KE9A 3C1XA 2VO0A 2WZJA 3DK3A 2VX0A 4PQNA 1VR2A 4D2WA 4I0RA 2CKPA 4KIPA 3QCSA 4OR5A 2OH0E 4X2KA 4K2RA 5LVOA 3LKMA 3EQHA 3GVUA 4N6YA 4YNEA 1GZNA 3HRCA 3KMMA 3FKLA 3GEQA 2V62A 1JOWB 4EOOA 2GS2A 2GNHA 3ZXZA 5EM8A 1NW1A 4X6RA 5I4NA 2QG7A 4OTFA 3QQHA 5EW3A 4R8QA 2PUPA 1DAWA 4EH3A 5JFWA 2UVXA 1ZYCA 1O9UA 4MH7A 1ZARA 4I5PA 4I3ZA 1JAMA 3FMKA 5HVKA 2EU9A 3BYMA 2X8DA 3VIDA 3VUKA 4Y83A 2VWIA 3D7TA 4PNIA 3V5PA 4CV9A 4YBKA 3IO7A 1H25A 4YJVA 2FA2A 1YKRA 3FXXA 3MB6A 3RGFA 4CQGA 5BUJA 4X7QA 5KMMA 4DFUA 2J90A 3W32A 4E7WA 4UMTA 5IA3A 4HYSA 2QC6A 1Q3DA 3BLHA 3F88A 3O17A 4WIHA 4ZIMA 3SLSA 3ZRLA 4DITA 4XG4A 4H3BA 2PVKA 2I7QA 1LEWA 4ZSEA 2J4ZA 3OCBA 3CD8A 1GIJA 3GCQA 4O4DA 4RC2A 4FE2A 1F0QA 3NYNA 4KUJA 3B8RA 3FC1X 3NPCA 1PXIA 1H26A 5CVFA 3UNJA 5FXRA 4XOZA 1IAHA 4WD5A 3KY2A 3PZHA 3RM6A 1XKKA 3LQ5A 3HA6A 3MPMA 4J53A 5AUWA 4WG4A 1R0PA 4FTMA 4FEXA 2O8YA 5AA9A 3CY3A 4ZS0A 3UZRA 4ZSJA 2R2PA 3D15A 4O4FA 3JY9A 4XMOA 4FSUA 3S3IA 1M2QA 2R3LA 3ZSIA 3R9HA 3PZEA 3HKOA 2GMXA 4DA5A 2QOIA 4HYIA 4FKVA 2BRBA 3CQEA 4CMOA 1BKXA 3R04A 2HZ0A 3UP7A 2ZM3A 4ITJA 1W2CA 2AQXA 3D94A 3FBVA 5EKOA 3FLWA 3SX9A 1MRUA 3VS5A 4L42A 2ITOA 2BPMA 2QHNA 3P7CA 1ZRZA 4WKQA 3HAVA 5AR7A 2Z8CA 3H9RA 4PTCA 2BCJA 2OLCA 3VS1A 2YM8A 4X2JA 4FI1A 4HPUE 4E1ZA 2WMXA 1RQQA 5KMNA 4UY9A 4RJ3A 3DT1A 2P2HA 4GT4A 3U6IA 1OPKA 5E8WA 4FEVA 3AQVA 3E63A 3A7HA 3E8NA 3FMHA 2WFYA 4RVKA 1V0BA 1PYXA 2OO8X 2XP2A 5TKDA 5TT7A 2XK3A 3LFSA 5C01A 1U4DA 2WB8A 3BHUA 3ZEWA 4L3PA 4KS7A 4CRLA 5IEYA 2OIDA 5CZIA 1G5SA 5ANIA 2UZEA 4BDKA 3DTWA 3DB8A 2C5NA 4MXZA 2UW4A 1GZOA 3FQHA 1FMKA 2VTSA 3JUHA 4DFYA 1ZOHA 4EBWA 3FMMA 5DYJA 5BQ0A 1OUKA 3KGAA 3QALE 3DK7A 4J8MA 5FBNC 3AMAA 1V1KA 1KV1A 4KRDA 3DKGA 4BL1A 1JQHA 4E93A 1PXLA 4IW0A 4RIWB 2F57A 4X0MA 4ASZA 5LVNA 2NNWB 3PXKA 4BTJA 2R7BA 5IG1A 2VD5A 4F1MA 2SRCA 2A0CX 3TWJA 3QWKA 4RLKA 3BHVA 5CYIA 5GJDA 2YM6A 3ZZEA 3DLSA 3QUDA 1E9HA 1WVWA 4KABA 4O0SA 4ZMEA 3NUXA 5ITAA 4DCEA 1OL2A 3QRUA 1WMKA 4C62A 4RIXA 2X7GA 4IAKA 3RP9A 5EYDA 3E8EA 4ZTSA 2Y9QA 1XBBA 1DAYA 2W05A 5IUIA 2Y6MA 2WMRA 5CNOA 2GU8A 4R7HA 5I5ZA 4E4LA 1WFCA 4H1JA 1YXVA 2BDWA 2VTQA 3OC1A 3KXMA 5T68A 1T46A 4ACDA 2X6EA 5TF9A 4GU9A 3VF9A 4MD8E 3AGLA 2G2HA 4F0FA 4D4RA 4MCVA 3OT8A 5FM3A 2Z2WA 2XEZA 4BYJA 1W2DA 2VO3A 2OF2A 2ZDUA 4B9DA 4F7NA 2X7OA 5IMEA 4GIHA 4JRNA 1RW8A 5FD2A 1BYGA 4XG9A 2ITXA 1DI9A 3O7LB 3F7ZA 2NO3A 4FVQA 4U7ZA 1YDTE 4Z16A 5AR3A 3FXZA 3L9NA 3F69A 4HJOA 4YC3A 4U40A 5LVMA 2W7XA 4NSTA 1ST4A 4BI1A 1I44A 4ONAA 4BGGA 2QODA 3F3ZA 4QP8A 4WUAA 3FL5A 4BDCA 4E4XA 4NFNA 5M57A 2A98A 3UC4A 1BI7A 3BHYA 1W2FA 1H00A 5KMIA 3G0FA 3E64A 5ANOA 2ETMA 2H6DA 4L01A 4TYEA 4NK9A 5TR6A 3V8WA 1WBNA 2R3FA 4O83A 2ITUA 1MUOA 1BI8A 5BVOA 2CCIA 3NSZA 2OZAB 3OG7A 3QCYA 3ANRA 4QMZA 4JIAA 4ZP5A 2XKEA 5FDPA 2HAKA 3EJ1A 4WNOA 2ZMDA 5HOAA 3ZCLA 5JMSA 1XMMA 5CAUA 1APME 3LFCA 5AP0A 4XG6A 4P90A 2W0JA 3AMYA 3V5JA 5CU3A 3AMBA 2X39A 2JD5A 2XEYA 2VTRA 3HZTA 4FUXA 3RPYA 3FDNA 3BPRA 2QOBA 3LQ8A 3OVVA 4YUQA 4C4GA 5KZ0A 5JFXA 2JKKA 2ETRA 3QTUA 2IWIA 4FV9A 3CTJA 5E8TA 5DA3A 4EYMA 1BX6A 5FEDA 2WU6A 4EHZA 4GKHA 2RG6A 2YDJA 2BZKB 5IQGA 3NUUA 3U4WA 2W17A 4MF0A 3MI9A 3PPKA 4J8NA 5A14A 5JSMA 1PJKA 2J0IA 4FV3A 3B2WA 4U79A 5DRDA 5BMMA 4EQCA 5LOHA 4RWJA 4USDA 5KHXA 2GNJA 1LR4A 4YTFA 5E8UA 4UX9A 1YRPA 5D9HA 2WD1A 2QOOA 4WSYA 3S0OA 4PRJA 2CNVA 4QMQA 2XBAA 3TNWA 3ULZA 3EQBA 2C1BA 4FIFA 5DFPA 4TN6A 4S32A 4XH6A 4I41A 2PVRA 2BIKB 4NWMA 5HG5A 4B8MA 2YCQA 2WXVA 4IXPA 3HDNA 3FI8A 3FI4A 3GFWA 5E8VA 5FXSA 3ERKA 3V8TA 2HXLA 4GFMA 5CU6A 3MFTA 2VO7A 4AP7A 3I5ZA 4O91A 4YJOA 4L46A 4E6QA 4M7IA 3K5VA 2IW6A 4MXXA 3LFAA 4MNEA 3FLQA 4UZDA 4O82A 4FTIA 4DFNA 3CEKA 4FKJA 1WZYA 5BVEA 4I6LA 2F2CB 2ITVA 2Y7JA 3AD6A 3MS9A 3GP0A 2PVNA 4RIYB 3BYOA 3MY0A 3OZ6A 1UNGA 4UXLA 3N9XA 3IK3A 4QTAA 4J97A 3HV7A 4A9UA 1W8CA 4O2ZA 4JOAA 4ASXA 5IA0A 4M97A 3ZOSA 4DBNA 3C4ZA 3LCKA 5EHYA 5LXMA 3UIBA 4FZFB 3H4JA 1OUYA 5A4TA 4KIOA 3TJDA 3P9JA 4K9YA 4PNKA 4BCOA 3F2AA 1OMWA 3LJ2A 5J95A 3VAPA 3PRIA 1M7QA 3GXLA 4O0YA 4UB7A 4Y73A 4I1ZA 4Y8DA 4EOSA 3I6UA 3PP1A 3QU0A 4S33A 4IZAA 2YIWA 3WZUA 5D1JA 4M0ZA 4PPCA 5H2UA 4MK0A 5CNNA 3DKCA 4XRJA 2CGWA 3JY0A 3II5A 4XHKB 3ALNA 3E8CA 4I21A 5HE1A 3R7YA 4AGWA 4C59A 1PKDA 4QP1A 5EK7A 4IADA 5AUYA 3R02A 5IMXA 2ONLC 1OM1A 3ORXA 2X2LA 5M08A 3FY2A 2LAVA 5EHOA 4AGCA 3OUKA 1FQ1B 3RPVA 5DR6A 4C0TA 5IF1A 2XVDA 3G33A 5BVFA 3R7GA 1Q41A 2OICA 3ACJA 3HL7A 4NIFA 3EFLA 4BC6A 2O5KA 3DBQA 3F5PA 1JKTA 4YP8A 5L6WL 4NM5A 1WBWA 2CGVA 1PMEA 2PZRA 2V0DA 4G3FA 4GG7A 4Y5HA 4D4YA 2VWYA 2OGVA 1YXTA 4DFLA 3G6GA 2OH4A 3H3CA 4L68A 3KRWA 2B9FA 2ETKA 3C0GA 3LXPA 3C50A 3CGFA 4E6CA 4ZLZA 5HTCA 3S00A 4FTKA 4F7LA 4ZS4A 4PV0A 2UW3A 1F5QA 2R3JA 2BIYA 3C0IA 3VUHA 3PLSA 5IA5A 3CGOA 3QD0A 3CXWA 2PHKA 5T3QA 4AZFA 5IA1A 1PRYA 2YLFA 3VW8A