4PP7A

Highly potent and selective 3-n-methylquinazoline-4(3h)-one based inhibitors of b-rafv600e kinase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
267
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
publication title Highly potent and selective 3-N-methylquinazoline-4(3H)-one based inhibitors of B-Raf(V600E) kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 267
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4pp7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pp7A01
3K5UA 3SRVB 4D28A 3FLSA 3VS2A 1FMKA 4BTKA 3RI1A 5EQYA 2X2KA 4S30A 5DRDA 3S4QA 4U40A 4AOIA 2W9ZB 4O0VA 4OTPA 1WBSA 3NW6A 2PYWA 5CEOA 2XIKA 2YM3A 4IFCA 4FK6A 5ETFA 4WA9A 5D1JA 1DI9A 4IAZA 4ENYA 1H25A 4L00A 5IQGA 2XZSA 2VTTA 4ZZOA 1IAHA 4Z7HA 4A06A 3GC7A 4QP1A 3ROYA 5CX9A 3MDYA 4GKHA 4GRBA 4ITHA 3GU4A 3EL7A 1UU8A 4F08A 2H34A 3RWPA 4KNBA 4XRJA 5HLPA 5IUGA 4RWKA 3FMNA 5CAVA 3FWQA 4U45A 2ZJWA 2GS2A 3PLSA 4XJ0A 3VVHA 3R71A 4NTTA 1V0BA 3KFAA 3LAUA 1X8BA 4WG3A 1BX6A 4XG9A 4RMZA 3KRWA 3RCJA 2ZV8A 5A6NA 3CTQA 4AT4A 3BX5A 2CN5A 1M2PA 4HZSA 3LCOA 2VTOA 1LPUA 4MTAA 4F6WA 5IPJA 3CJGA 3EMGA 3V5WA 3WZJA 2XK6A 4UY9A 3QU0A 4RC2A 3VW6A 4AW2A 4C58A 4S32A 5JKGA 2PE0A 3E87A 3R8UA 2ETKA 4M13A 4FKOA 4AGDA 3LPBA 4EZ5A 4DEGA 4F09A 1ZMVA 4YJQA 4DH3A 3MH3A 5AP6A 4UZHA 2O5KA 2V7OA 1PYXA 3D7ZA 3DK3A 3FSKA 2WOUA 5HHWA 5A4QA 4ZXTA 5FTGA 4LGGA 3ORZA 3AGLA 3R6XA 4F7JA 4CQEA 4FYOA 1FGKA 3PUPA 1J7LA 3A2CA 1B38A 4BYJA 3UVRA 5J87A 2UW6A 4C4HA 4NM0A 5LVLA 2EB2A 3D5XA 3SOAA 2WMRA 4YJTA 4D1SA 4IC7A 2Z7RA 4RIXA 4EKKA 3DPKA 4D55A 5CAQA 4ZOGA 2QHNA 4DA5A 4ZSLA 4EK8A 4DG2E 4CCBA 3GP0A 3TKHA 3VJNA 3P7BA 3PY1A 3MH1A 3ENHA 3VWAA 2E9NA 3LXNA 1UKHA 4GFGA 2REIA 4D4RA 2W5HA 3DLZA 3WI6A 1MRYA 4BCIA 3LLAA 5HE0A 3H4JA 4E4XA 1ZOEA 4BDDA 4EHGA 1CSNA 2YWVA 1PXNA 4IAAA 4Y95A 1Y8YA 3KC3A 2RF9A 2YAKA 3PXZA 3GGFA 3ET7A 3L9MA 2BAQA 4ASDA 3HRBA 2B9FA 2CHLA 5DOSA 5FRIA 3WILA 4FV5A 5CEMA 4ERKA 4FIJA 3OY1A 3Q9ZA 4KRCA 5AP3A 5EM7A 5L2SA 4NK9A 4JIAA 3Q3BA 4X21A 3O2MA 5E92A 4ZJIA 5AV0A 2WTKC 5EI2A 4AGWA 4LL0A 3RPVA 4ARKA 4LUEA 4CKJA 1URWA 5JMSA 3CPBA 3DKOA 2IG7A 1JQHA 4UV0A 4TL0A 2WAJA 4EWHA 1L3RE 3F2AA 3D7TA 1JOWB 2R3LA 4YJRA 5DN3A 3RZBA 2ITXA 4BYIA 4Y5HA 4AW5A 5J8IA 2BAJA 2DWBA 3U54A 3H30A 2HZNA 4FNXA 3UO5A 4ASZA 4FT3A 4E3CA 4JQ8A 4RFYA 3VS0A 1QPEA 3BE9A 2O0UA 5FEDA 3W2OA 5LWNA 4Z9LA 5JGAA 4B8LA 2OXDA 2YHVA 4I0SA 5LVPA 3DGKA 5DT3A 2XIXA 2PZIA 4UB7A 3FMKA 3ZLWA 4E1ZA 4PMTA 5GIPE 1OL1A 5FBOA 4CLIA 5AA8A 4K33A 2XF0A 3FAAA 3FQEA 3MY5A 3CKWA 2PZYA 5HO8A 3RPRA 4Q5EA 3P4KA 1P5EA 2XK8A 3MA3A 2WMBA 2XCKA 3FEGA 3TNIA 4IJPA 2JITA 3TN8A 4AZSA 2R7IA 3R7EA 4AE9A 3IOKA 1UA2A 4E6AA 3QWJA 5BYLA 4L7FA 2HELA 1YKRA 4BI2A 1I09A 3V5LA 3KMMA 3OMVA 2JAVA 4CCUA 2H8HA 2CGWA 2CSNA 4K8AA 3UVPA 3ITZA 4O81A 3BBWA 3E64A 2BRNA 3HECA 3NNWA 2Y7JA 4KS8A 4OBPA 4RA5A 4AU8A 3I7CA 3GU5A 5KZIA 3L8PA 3LFSA 3QA8A 3WF8A 4BL1A 4CMOA 5M07A 4XG3A 2QOHA 3K2LA 5LMBA 4F7NA 1IASA 2CJMA 2VWXA 4U9AA 4WRSA 2VWYA 3FQSA 3U6IA 3VNTA 3TUCA 2OG8A 2BDJA 2UUEA 2W1EA 2HXQA 2ZDUA 1GIIA 1BKXA 4ZSGA 4G1WA 3RPOA 1O9UA 3SW4A 4FOCA 1YWVA 3TUBA 4AAAA 2JDOA 2OW3A 2QG7A 4PF4A 1WAKA 3R8ZA 1XJDA 4WUNA 3GU8A 3KGAA 2GDOA 2X6DA 1UV5A 3M42A 3ATTA 3OXIA 4JDJA 3IGGA 5JGDA 1CKPA 3SXFA 3DXPA 4JX7A 3P23A 3ZSGA 3SW7A 4XUFA 1OUKA 2ITZA 3NYOA 4N6YA 4G5JA 2XIZA 3R8LA 4AFEA 4XX9A 5JQ8A 5M51A 2BZJA 5HCZA 4YJSA 5D7VA 4N70A 4ZLYA 5FXQA 4BWKA 4DFUA 4JRVA 3LXKA 3FBVA 3OWKA 3CGOA 4KS7A 4L52A 2WTWA 3UYSA 3LKMA 3AMYA 3VIDA 1JPAA 4EI4A 2QHMA 3MPAA 5HKMA 5C26A 3PP1A 2PE2A 2QOKA 3FI3A 5EQEA 3JUHA 2G2FA 1YQJA 2R9SA 3KMWA 4YSMA 4MQ1A 3OF0A 1Q8TA 4DEBA 3F5PA 5TOZA 2QO7A 5KHWA 5GHVA 1RJBA 4BDAA 2IWIA 5AA9A 3DBQA 1DI8A 3MH2A 2A27A 5B2MA 4R1VA 2E9UA 4L3PA 4FTCA 1U59A 3GFWA 3F5GA 1SMHA 4R1YA 4OR5A 3CQWA 3MSSA 3NUXA 2HOGA 3O7LD 3ZC6A 5AM7A 3AD6A 3NDMA 4I6QA 4LG4A 2R7BA 1YDRE 3LJ1A 4NW6A 1J1BA 4J96A 5AM6A 3SG8A 1UU9A 3FPQA 4IAFA 4RIYA 3NUSA 3QRTA 4KSQA 2BMCA 3QC4A 4MD8E 2ETRA 2X1NA 2J0KA 2I40A 5EHLA 4DFNA 2JLDA 4UALA 4A4OA 2C30A 3R0TA 1Y6AA 2IW6A 3UOJA 4QPAA 4B8MA 4WD5A 5M56A 4ZAUA 1OKZA 2JIUA 2YCRA 4PMMA 4ZEGA 5IEVA 4FYNA 2BDFA 2I0HA 2JKKA 4FNWA 4IZAA 3Q4CA 4O7NA 3C0IA 4XLIA 5IA5A 4N57A 4O6EA 4XHKB 1BUHA 3OCGA 4AP7A 5FGKA 2HCKA 3QC9A 3QGWA 4P7EA 4PRJA 3PJ1A 5FP5A 2V5QA 5HNGA 2JDRA 3FDNA 3LFBA 4FV3A 4GMYA 1XH9A 5CLPA 2GNFA 3TEIA 3VQUA 1PXIA 5DPVA 4FC0A 1T46A 1PRYA 1E1VA 3TZ7A 4DBXA 2XP2A 3PZEA 2WMTA 2JBOA 3C5UA 3UJGA 3ULIA 3HLLA 2UW5A 4L3JA 1ZYSA 3PVWA 5EW3A 5CAPA 2YIWA 2ZYBA 3N9XA 3PP0A 4ZMEA 4BCMA 4MVFA 5D11A 4U44A 4X2JA 4GIIA 4CG8A 1H1PA 3R7GA 2BUJA 4KIKB 4QOXA 2W1FA 3CTHA 1JKSA 4BCJA 1GZKA 4FIHA 1RW8A 5B2KA 5IQEA 2BIKB 2PL0A 3FZRA 4V0GB 4XH6A 3BI6A 4XMOA 4A9TA 4PL4A 5HVKA 4W4XA 3QX2A 4FKGA 1KE8A 2VO6A 3W8LA 3GBZA 1B6CB 4M0ZA 3BV3A 3BELA 4FL1A 4IM0A 4DGLC 4O7RA 3DV3A 5KX8A 1ZOHA 5IQAA 3RAWA 2CGVA 4M15A 4IVDA 3BEAA 2GNIA 4LRJA 5CS6A 3NGAA 4B7TA 4EH2A 3L9LA 2BROA 4TY1A 2SRCA 3DB8A 3R1NA 3UO4A 4HZRA 3EKKA 3UOLA 3ZO1A 4AN2A 4RJ8A 3RINA 5L2IA 1V0OA 5HQ0A 4BDFA 2GNJA 1O6YA 3AC2A 5FD2A 2X6EA 4C38A 3MYGA 3QTWA 4C4GA 2Y8OA 3QUEA 2X9EA 3HYHA 3CQEA 5BVNA 3EYHA 1M17A 4G6NA 3OCTA 3OP5A 4C3PA 3TUDA 3RAKA 4Q9ZA 3ERKA 5CQUA 5EM5A 2JAMA 4JR7A 4O7ZA 3PA4A 4EQUA 3C1XA 4BBMA 1BL7A 3NNXA 3BPRA 3DDQA 3HP5A 3EL8A 1CKIA 5B0XA 2Z8CA 5EOBA 5I9VA 2OFUA 4WG4A 4Q2AA 2VTLA 4MBLA 1Q99A 2G9XA 5AP5A 3C50A 4O86A 2GTNA 3KQ7A 4LM5A 4PPBA 5F9EA 4I94A 2BRBA 3RM7A 4M8TA 3ORLA 1K2PA 1H0WA 2E9OA 3DXNA 3P7AA 4IANA 4MNFA 3OZ6A 2YJSA 4YJUA 4B99A 3PVGA 4KBAA 5AUXA 3TI1A 5KCVA 2JKOA 2W1GA 1P4FA 4RX5A 3SVVA 3KB7A 4DLJA 4N0SA 5HVJA 2UZDA 4X6RA 4WNOA 4QTDA 4DF3A 1M52A 2W96B 2QU5A 3VHEA 4BTFA 4YSJA 3VQHA 1U54B 4NT4A 4LMUA 3WYXA 3H10A 4YO4A 5HG8A 5M55A 3EIDA 3MBLA 4IIRA 3D94A 4GFOA 3QL8A 5JRQA 2V62A 4QMWA 3KRXA 4O1OA 3E8EA 1UU3A 4BBFA 3QZGA 4JQEA 3OVVA 5AR8A 2ITQA 4IQ6A 3V8SA 3TWJA 2BKZA 3KK8A 3PZHA 3QBNA 5HD7A 5H8GA 4IZ5A 4B9DA 1Q3WA 3CJFA 5ITAA 2FVDA 4I5PA 5CEPA 4B6LA 3LM0A 5L2WA 1XBCA 1Y6BA 3F7ZA 3G33A 3LFCA 4G2FA 5A4TA 4OTWA 5E4HA 5HICA 1XKKA 3ZEWA 5L8LA 3UNKA 3FC1X 5IA3A 1OECA 4Y85A 2QKWB 2XBAA 3VBQA 3BHTA 3VBWA 2FSOX 4J97A 4U80A 5GNKA 5AR5A 5IH6A 3RMFA 2EXMA 2OJGA 2IVVA 4XCUA 3ORIA 2VAGA 3UIUA 4JJRA 2B7AA 3VS6A 2R3IA 3S00A 4QQJA 5C4KA 1YI3A 3MGYA 3HL7A 5DR2A 3SRVA 3ZFMA 3UQCA 5DVRA 4UXQA 2YERA 3DNDA 5IA2A 1AQ1A 4L45A 2WEIA 5J7BA 4LV8A 4CV8A 4AW1A 3MIAA 1WBTA 1Z5MA 4NM7A 1CKJA 4GYIA 2VTPA 5ANKA 4IDTA 3QQFA 2BRGA 4YJPA 2GQGA 2PMOX 1ZARA 2XEZA 3IOPA 5AP0A 5FDXA 4BR3A 1RE8A 4DFBA 5GIOE 4DT8A 4MD9E 1XH8A 3PTGA 4GK3A 3VHKA 4BZNA 4QP4A 3HX4A 4YP8A 3DU8A 5AV3A 4FGBA 4W4WA 4EOKA 4K1BA 4BWXA 5TKDA 4KWPA 1IG1A 3KXZA 4G6OA 4RJ6A 4J99A 2R3QA 1BI8A 4AS0A 1PF8A 3NR9A 5E8SA 4RX9A 5EKNA 4FA2A 2WIHA 3F69A 4YNEA 5EQPA 2C6LA 5L8KA 2YDIA 2OF2A 4HCUA 3PLAE 4AA4A 4ONAA 5CU4A 4C33A 3SG9A 2ZOQA 1IA8A 2B9JA 2WMVA 4G16A 4QMSA 3OUNB 5FLFA 4DCAA 5L2TA 4JRNA 4RT7A 2A0CX 2XB7A 4RLKA 4YC3A 4IFGA 4PQNA 5AP4A 5EKOA 3R01A 3V5TA 4YTFA 3QAME 2RG6A 3C4CA 3QRUA 3F66A 1H1QA 2VGPA 2WU6A 4U79A 2UW0A 4EORA 4O91A 2BTRA 2YM8A 4JLCA 3HMPA 1R1WA 5HTBA 1BI7A 2VTAA 2HIWA 5GJDA 1NVSA 2RKUA 4M0YA 4M67A 5ACBC 1NT2A 2P0CA 3PJ3A 3UMXA 4C36A 5JFXA 4EOOA 3LZBA 4DAWA 5IA4A 3OHTA 2PVYA 3C7QA 5B7VA 3HV3A 4I6FA 3W18A 4C02A 1KE9A 2OJJA 1KOAA 2Z2WA 3WZUA 1B39A 4W8EA 2P33A 3ALNA 3UBDA 3A7IA 4Y5QA 2ONLA 3KCFA 4CFFA 3O50A 4WT6A 4IJ9A 3D83A 3QTRA 4Y8DA 3UTOA 3K54A 4JBQA 2QOOA 4TXCA 3MY0A 5E8VA 4HGSA 2C3LA 3JVRA 2W1ZA 5AV2A 3WE4A 2R3PA 5HEZA 4X6QC 5AUUA 2F2CB 2I1MA 3DXQA 4USFA 1XWSA 4E26A 4TYHA 4YGAA 4ITJA 3ZBXA 3MFUA 5HX8A 2VX0A 3OD6X 4TKSA 2YZAA 4TRLA 4CYJA 3UZRA 4IVAA 3UNZA 4OBOA 5EK7A 4ZJVA 4L43A 3AC5A 4YJNA 2I0EA 4YLKA 4PNKA 5CAOA 1MRUA 4GW8A 2R3NA 4BDKA 2QKRA 4FSZA 4K9YA 1UNHA 5LOHA 1E9HA 4FT9A 4USDA 4PL3A 5A14A 4YJOA 2BTSA 4HYHA 3DNEA 1UNGA 4FZDB 4D0WA 4AX8A 4AA0A 3R1YA 3MV5A 5M4IA 3WARA 2WMQA 4CV9A 4O0RA 3VW8A 3C4EA 4KABA 2B52A 4C4JA 4J7BA 4NUSA 4W9WA 2Q0BA 4IZYA 4RVLA 5ANJA 2O65A 1QL6A 2UW3A 3JYAA 1DAYA 3DBFA 4FUXA 5M4FA 4BC6A 3DKCA 2PK9A 4BVUA 5BUIA 5IQDA 1S9IA 5J9YA 4RBLA 4FL2A 2WGJA 3BWJA 3SD0A 2XM8A 4PUZA 2IJMA 1JSUA 5CTPA 2PPQA 3QFVA 3R22A 2J0LA 2JIVA 4K2RA 2AUHA 3KCKA 2FSMX 4EHVA 2GNGA 5BQ0A 4NM3A 2FB8A 4WNKA 4D4SA 3F88A 3R9DA 2QG5A 4ALVA 4RWIA 5M53A 2GSFA 4MHAA 5K4IA 2X4ZA 4DITA 3CTJA 4EH6A 3SV0A 4FZ6A 1VEBA 3MWUA 3ENMA 4YZCA 4ZZMA 3ORTA 2YABA 5D9HA 2RL5A 4PTCA 4TWPA 5ANDA 5L8JA 4O0UA 5HGIA 3Q96A 4FSTA 4O22A 4AZTA 5L3AA 1BL6A 2QQ7A 1IR3A 2GS6A 3A7JA 4DEEA 2QOBA 4Y83A 2OO8X 1XQZA 3FKNA 4QYGA 4LUDA 3UC4A 4NTSA 3NMUF 2OZOA 4KKEA 4YO6A 3U51A 5CU3A 4F1TA 3GQIA 4O7LA 3I5ZA 4O2PA 3IPHA 4RVKA 2ZM1A 3FYJX 3VBYA 1OL7A 2W1DA 4Y46A 3FI4A 4ACGA 2EXCX 4JDHA 3BKBA 5CY3A 5EHOA 3ROCA 3HAMA 3E8CA 3TIZA 4CMUA 5TR6A 4U3ZA 3BYMA 3GU7A 2Y4IB 3LCSA 3I0QA 4HYIA 5E91A 4F0FA 2BVAA 2ZM4A 2FA2A 3KY2A 4FSMA 4FSRA 4NKAA 5JFWA 5KKRC 3FHRA 4FKJA 4TW9A 4XG4A 4F63A 4PV0A 5GZ8A 3ZDUA 2J5FA 2PVKA 2G2IA 4C4EA 2OWBA 3PIXA 2GNLA 4NU1A 2OU7A 1PKDA 2FSTX 5JQ5A 2CNUA 4R7IA 4C59A 4GKIA 2BDWA 2I0YA 2J0JA 3BLHA 3W32A 4EHEA 3P7CA 4BDGA 1JKLA 4BCNA 2QR7A 3EN9A 3R28A 3LW0A 2ESMA 3LCTA 3ODZX 4XP0A 4JBVA 5KBRA 4EC8A 2JKQA 1Q8YA 2XYNA 3I4BA 4BN1A 4XRLA 4YLJA 2B54A 4G6LA 4S34A 3D14A 2W1IA 3RJCA 4BIDA 1FBNA 5DH3A 5I9YA 4GUEA 4FICA 4PTEA 3OS3A 3R00A 3I6WA 3P78A 4N4SA 2PE1A 3RNIA 5ICPA 2XYUA 3AC4A 5DBXA 3VF8A 4DLIA 3FI2A 4L42A 4ACMA 4HCVA 3BHUA 4TPTA 3OOMA 4AN9A 2UZWE 2X39A 1NVRA 4IB1A 2O8YA 3TJDA 4O7VA 4O82A 1CTPE 5C1QB 3CR0A 5A4CA 3HAVA 4F9CA 2V22A 4D0XA 2BZIB 4EYMA 2NNWB 5DYJA 2XNNA 3QTXA 2XJ1A 2WEVA 4OTHA 3QD4A 4XG7A 3OBGA 3PJ2A 1CMKE 1T45A 2RG5A 3R73A 2E2BA 2GS7A 4OT5A 3RHXA 3I7BA 3EFJA 3AQVA 3LQ5A 3R63A 3COMA 4CKRA 4MAOA 4FT5A 4C37A 3OEFX 4G3EA 3WF7A 2WO6A 4LL5A 4H3PA 3E92A 4UYNA 3ZHPC 4E5WA 4HVHA 4ZTSA 2IO6A 3EWHA 4MXXA 1XH5A 2C5XA 3HMIA 4LRMA 2WOTA 4EOSA 4H1JA 4ZIMA 3EB0A 4FV4A 5LMKA 3T3UA 3Q2MA 4AACA 3DJ6A 3N4TA 4V05A 1V0PA 1GAGA 2C4GA 4DG0E 1OL6A 4RJ5A 1XBAA 4FODA 2O2UA 4CMTA 4ANMA 2JC6A 2WIPA 4FTAA 3SX9A 3V6RA 2LAVA 3WOWA 3TZMA 4IXPA 4QMTA 4HW7A 5IISA 4BFMA 1GZ8A 5E1SA 3MS9A 4LOPA 4JDIA 5TO8A 4AT5A 2WNTA 3PE2A 4H58A 1TVOA 4CNHA 3HGKA 4QP2A 4MXAA 3UVQA 4QMXA 4F7LA 3MW1A 4J1RA 5CF8A 1P2AA 3C13A 3BHHA 4O0SA 3F5UA 3RP9A 3PSDA 2QOCA 4FTLA 3R8MA 2BZHB 2WHBA 5HLNA 3MIYA 3JPVA 2JKMA 1UWHA 3OXTA 2ERKA 4IEBA 4F9BA 3Q4UA 2VWZA 4EH8A 4CZUA 2YAAA 4RWJA 4AW0A 4A07A 4ZY4A 5H8EA 2AYPA 2DYLA 3SC1A 3KRRA 4F9YA 1OGUA 5CEQA 4BZDA 4RZWA 1Z57A 5HOAA 5IKWA 1YOJA 1PXKA 2PMNX 4UMQA 1UKIA 3BBTB 3EQBA 3V5QA 5AUTA 4V0GA 4L68A 3T9TA 3Q2JA 3TJCA 3A4OX 3BYVA 5FTOA 4PDOA 1RQQA 5IMEA 4BF2A 3BRBA 3B2WA 3BE2A 3ETAA 1W83A 4GVAA 4I0RA 4WO5A 3FXZA 2G15A 2UVXA 4FSUA 3RPSA 5AEPA 1H27A 4UMTA 4R3CA 4XG6A 3TV4A 4TZRA 5CEIA 2H96A 3HV6A 5ETCA 1JKKA 2PVJA 5CEKA 3FZTA 4MX9A 4FV2A 5HCYA 3FPMA 3S3IA 4E4LA 5K5XA 2C47A 5CENA 4QQ5A 3VS4A 3VUGA 3ZLSA 4PTGA 5KNJA 4FVRA 3IW4A 1GY3A 3ANRA 3KK9A 2IZUA 1DS5A 3HA8A 4UBAA 4WOVA 1U46A 5T6KA 4UN0C 2B0QA 3HDMA 5DEYA 3POOA 3IW6A 3DFCB 5JK3A 1XR1A 2VTRA 5BVEA 4I6BA 4EK3A 3P5KA 4MXYA 3IS5A 4C4FA 4CG9A 2OBJA 3FZPA 4QP9A 5F20A 5I3OA 2B9IA 1PXLA 4H36A 5BUEA 5A46A 2IW8A 4ORKA 2QU6A 4YBKA 2ITYA 4C57A 2YM6A 5CU6A 2WQNA 4ANBA 2KTYA 2C6KA 4X2KA 5HVYA 3TT0A 1WZYA 4EBVA 4EHZA 5JH6A 2Z7SA 2HZ0A 5G1XA 4NEUA 2ITTA 3KKVA 3PPJA 2OSCA 4CFWA 3C0HA 3ZZWA 5CU0A 3RHKA 4JG6A 2W17A 4LGHA 5AR2A 3OTVA 5DEWA 2VZ6A 2W05A 4IX6A 4QTAA 3R9OA 1U54A 3DQXA 1Q61A 2QURA 4IAIA 4G3CA 3UIMA 3VRYA 4M7IA 4YBJA 5ACKA 2B55A 4GYGA 3HUBA 2HY81 3Q4TA 4HYUA 3H3CA 1HCKA 1XHAA 3KXHA 4LFIA 4U97A 2Y4PA 5AMNA 4A4XA 4YC8A 4FTMA 4AOTA 3HV7A 4QPMA 5EDQA 3R1SA 1H1WA 4FZ7A 3VUKA 5AR4A 4BHZA 3TKIA 1CM8A 2PZRA 5DMZA 3N4VA 5BVOA 3CIKA 4CQGA 1LR4A 1OITA 2WMWA 4OTRA 4UZDA 3EN5A 4DFYA 5HG5A 5IQFA 2EB3A 1TQPA 3ULZA 3IDBA 3R7IA 4E4MA 4EUTA 1ZY4A 2HK5A 2VO3A 2Y0AA 4QYHA 3AT3A 5EM8A 4W4YA 4Z55A 1PXJA 4FV6A 4X2NA 2ITPA 1K3AA 4DTKA 4A9YA 5M09A 2QLUA 4I93A 1YXVA 1FINA 1OPLA 2CCIA 1PYEA 4BIBA 2V55A 4BICA 4GCJA 3TIYA 3S1HA 3FMJA 3MH0A 4CFMA 2CKQA 3NUUA 3CD3A 3A7FA 3FSFA 4I92A 3LOKA 4XP2A 4ZTLA 3ZH8A 5DE2A 3ALOA 4ZY6A 4XYFA 2VTHA 2FO0A 2VGOA 4FTKA 2UZOA 4FTNA 5IUHA 3BU6A 4GL9A 1GJOA 2PTKA 2IVSA 1WBVA 3DT1A 4FTQA 2XRWA 3AC8A 2JDTA 4NFMA 2IN6A 3DK7A 4NIFB 3ZMMA 4CRLA 4FEVA 3JS2A 3A7HA 3QX4A 3E93A 3DB6A 3CC6A 4XNEA 3SXSA 4DGMA 3UODA 2C3KA 5EI8A 3KA0A 3QTIA 4AOJA 3DBCA 2GHLA 3IG7A 4GJ3A 4DTAA 5IUIA 4E73A 2J2IB 3ORPA 1LEWA 4PMSA 5KMLA 4OTIA 2J0IA 4BKZA 2BRHA 3ACKA 4BCHA 4RIWB 5AV1A 1QPCA 2XIYA 4FKIA 4FIIA 2ITOA 4HCTA 3KN5A 3U8WA 2AC5A 5AP2A 3NIEA 1URCA 4GK2A 3FMDA 4LOOA 2J5EA 3PA3A 4KBCA 4DH8A 4RQVA 3MJ1A 1WBOA 4IX3A 1WBNA 2HZIA 5E8TA 5LARA 5AAGA 2XKDA 3FKLA 4QMOA 1DAWA 3G6HA 1O6LA 4BDJA 4HNIA 3HRFA 3QZIA 2W4OA 4WUAA 5DR6A 4TWCA 4EEVA 2EVAA 4F9WA 4JG8A 2Z02A 5E8XA 3EQIA 5CT7A 4CZYB 3RTPA 5JFSA 1PXMA 1OPKA 2R3FA 2YIXA 2YWPA 4TN6A 1OMWA 3QLGA 3S2PA 5BUJA 3F5XA 1OIYA 1YXSA 2XJ0A 4IVCA 2C6DA 4AUAA 2GCDA 1IEPA 4O7SA 3COHA 2UW8A 3OT3A 4ACDA 4FKLA 1KWPA 2P2IA 3ZM4A 4OTDA 3QTUA 1JVPP 3P1AA 3TDVA 3BV2A 2XH5A 3GU6A 5IA0A 3OUKA 3LFFA 4JNWA 2GFSA 3A99A 3NCZA 2F57A 5GZ9A 4EQMA 1APME 4UX9A 3QQKA 1H07A 2OGVA 3LMGA 2X8IA 2VX3A 4K0YA 4UYAA 4GVJA 4CEGA 1G8SA 5CNOA 1FGIA 4UWBA 3LE6A 2PVMA 3NUAA 4HYSA 2QNJA 1KV2A 4FOBA 4AGCA 2VNYA 3OXZA 4CGAA 4M69A 3VJOA 1WBPA 4ALUA 5LJJA 4P90A 3KMUA 4KIQA 3ZYAA 5J5TA 4F6UA 3KREA 4FZAB 5M06A 4WIHA 3MY1A 2DQ7X 3OCBA 3ZUTA 3OG7A 3OT8A 3KU2A 3QUPA 3CS9A 4NJDA 4R3RA 5EDRA 2CKOA 2ZAZA 1BYGA 3LFEA 4F70A 2ITVA 2J4ZA 4DEAA 4IH8A 5IMXA 2BPMA 2YITA 3BHVA 3NX8A 3P08A 1P4OA 4FTIA 4L53A 4CSVA 4BRXA 3MTFA 4DFXE 4W8DA 3R2YA 3V6SA 4ASXA 1JLUE 2OJFE 4BTJA 4FKVA 4BCFA 3QYWA 3FL5A 2ZV2A 4HPTE 3UP2A 3PSCA 2XUUA 4M68A 3G2FA 4Q5HA 4DFLA 5L4QA 1TKIA 4RJ7A 4IM2A 4EK5A 4CYIA 1YDTE 5IDPA 2PZ5A 4BDCA 4FZFB 4IC8A 4ZTHA 5KZ0A 3ZDIA 3FY2A 3MB6A 4O38A 4OLIA 3CQUA 2VO0A 4R7HA 4IVBA 1G8AA 2WTKB 4D58A 4D2VA 1FPUA 3RM6A 5HU3A 3EOCA 5DI1A 1DM2A 2XVDA 3ZO2A 2PUPA 3MJ2A 2X9FA 4MXOA 3VS3A 4YPSA 4EH5A 2VTQA 3EKNA 3AMBA 4I5MA 3PWYA 3V51A 4X7QA 2PUNA 3L9PA 1J1CA 3ID6C 3F3ZA 5ETIA 3UQFA 3QUDA 2J50A 3OW3A 4HOKA 4O0WA 3CGFA 4QRCA 2A2AA 4G9RA 3MVJA 4FF8A 3DAJA 3GNIB 4P4CA 2VTSA 2PZPA 5AR7A 2YM7A 3DS6A 3RPYA 1FMOE 1WMKA 5BYZA 4CFXA 2W0JA 4GT5A 2P55A 5HX6A 4J8NA 2C69A 3ZFXA 3WIGA 3R9RA 2UW7A 3V5JA 4BI1A 5GJFA 4I23A 3THBA 3I1AA 3NRMA 3EQCA 4EUUA 4NW5A 4S31A 3RCDA 3VS5A 4AZVA 4L67A 4D9TA 3HMMA 3NAYA 5AP1A 2OIDA 2UVYA 3A8WA 5IEYA 3G0FA 4J8MA 3Q9YA 3UZPA 4ZTRA 2CN8A 3BQRA 2YZLA 3FC2A 2X2LA 3NSZA 2CGXA 4LV5A 4DN5A 5KUPA 4RLLA 2H9VA 4XEYA 5DR9A 2F7ZE 2XNOA 3O8PA 1REJA 2XM9A 5EOLA 3TNPC 4EBWA 2GHMA 3GT8A 1R39A 1R3CA 4M97A 4CKIA 4B0GA 1FVTA 1LUFA 2YCSA 3GENA 3QQJA 4USEA 5HNIX 3NWWA 3UZTA 2J6MA 1R0PA 3FJQE 3QWKA 4P2KA 5E9EA 1Q8WA 3L9NA 2XIRA 3BZ3A 3NNUA 2XS0A 4JL9A 5DT0A 4RG0A 3QLFA 1V1KA 2OZAA 3L8VA 4AA5A 4HVSA 3D5UA 3JXWA 4FNZA 4I0TA 4PP9A 1PXPA 1VR2A 4HJOA 4R8QA 4C3RA 1PY5A 3P79A 4D2PA 2W1CA 5E8YA 2V7AA 5AUYA 3AC3A 3QKKA 4AXAA 3QZFA 5A9UA 3ORXA 4BHNA 2YIRA 2W4JA 4TYEA 3RBWA 3VO3A 3V3VA 4DFZE 2O63A 2HZ4A 4GU9A 1F3MC 2VO7A 5T68A 4IX4A 2PVHA 1YI6A 3HV4A 4YC6A 2C3IB 3OC1A 4CTCA 4JS8A 3WZKA 4AG8A 1JWHA 3H9RA 2XJ2A 4K6ZA 4L01A 1OIRA 4XG8A 4MF1A 4TWNA 5BMMA 3W2PA 3ATSA 3PVBA 2R3RA 1W82A 2Q83A 2I6LA 5TT7A 5IDNA 3UIBA 1QPJA 2DUVA 4O0YA 1H1RA 3FXXA 3HDNA 4O7TA 4FR4A 4GUBA 3C0GA 4QTEA 5HBHA 4YNOA 3W33A 2FGIA 2OKRA 4GT4A 2F9GA 2OJIA 2P2HA 4YLLA 2HY0A 3A7GA 4DINA 2JIIA 3QXOA 2IZTA 3I81A 3OWPA 4L44A 4WRGA 4QMQA 4FV0A 1VJYA 5I9UA 5CI7A 3TZ8A 4YURA 3C4WA 3DAEA 4F7SA 3HMNA 2BKKA 5AX9A 3HP2A 2YCQA 2PSQA 3Q32A 3CXWA 2YIYA 5HIBA 2VWIA 2YDJA 2DS1A 3QGYA 4UWCA 3GXLA 4DGNA 3H9FA 4UMPA 4R78A 3DCVA 3ZO3A 4XV2A 3FE3A 1STCE 3Q5IA 3ZZEA 1WCCA 4LQMA 4MF0A 1IRKA 2OXXA 3PXYA 3W16A 2YISA 4EJ7A 3F61A 3W1FA 4KBKA 3U4UA 1BMKA 2EUFB 4D4YA 4XS2A 3IK3A 2XNMA 3R7UA 4QO9A 5AAFA 4RQKA 1OIUA 2UZLA 5KMJA 4RZVA 3F3VA 3QRJA 3QYZA 1OPJA 2OF4A 3CLYA 4RRVA 3Q4ZA 1JSVA 5AIRA 3ZSIA 3N4UA 4G3DA 2EU9A 3F2NA 2C0TA 1LP4A 4ZSJA 4AT3A 3LFNA 3R21A 4D2WA 5ANIA 1OUYA 4IB3A 5KE0A 2XNBA 1UNLA 3CPCA 3KRJA 2YM4A 2XA4A 5E90A 3GCVA 4YR8A 4LYNA 4RPVA 2C0IA 4O27B 1W98A 4QMUA 2JD5A 5HTIA 4J95A 5H2UA 3QCSA 5JZJA 4WHZA 1EH4A 4JDKA 3TNQB 3RK7A 1SM2A 4XG2A 3ZC5A 4BTMA 4CT2A 3FYKX 4CTBA 3MPMA 3VS1A 4PDSA 3HMOA 3ODYX 4FKSA 5KMOA 4HPUE 4EC9A 4ZP5A 3FLWA 3VF9A 5C27A 4CZTA 3SXRA 4C7TA 4CVAA 1NW1A 4E6DA 1JKTA 5EM6A 5TF9A 4I20A 4UMRA 2ONLC 2RFNA 2YN8A 2VU3A 3SGCA 3TNWA 5AP7A 1KV1A 4TYIA 4KUJA 2P3GX 4FK3A 3BCEA 3LVPA 2BFYA 3BLQA 4HVIA 1ZYJA 3B2TA 3VS7A 3CEKA 2BAKA 3GC8A 2HW7A 3PE1A 4FI1A 2J90A 4RC4A 3DKFA 2WMSA 1G3NA 3GFEA 4JR3A 3G51A 4YHJA 4ACHA 2A19B 2W1HA 4A9UA 3TKUA 5HCXA 1SVHA 1J7IA 4GJ2A 4C34A 2WPAA 4EOJA 5HBEA 3EFLA 5I9WA 4GS6A 5EW9A 4YMJA 5IF1A 1K9AA 3EFKA 2PUUA 3MB7A 4FIGA 1BLXA 5HNBA 3F3UA 3UYTA 4BCOA 2BRMA 4I4FA 4ANLA 4BCPA 2QONA 3EQGA 2VTMA 3QRKA 5E1EA 5EYKA 2RFEA 2QD9A 1H1SA 4QYEA 4IX5A 3OWJA 3FZOA 2IZRA 4U8ZA 3EN7A 4CFNA 3O71A 5BVKA 3KXGA 3P0MA 3PJCA 5E8UA 4G31A 1GOLA 2F49A 4L9IA 2R0UA 3FUPA 4GV1A 2BHEA 3R30A 4U5JA 3KVWA 1YHSA 5JN2A 3VAPA 2ITUA 5DRBA 3PFQA 4KSPA 5JZNA 3RAHA 1TQMA 4E5BA 1A9UA 4J53A 3UG1A 3PWDA 4BBEA 4G5PA 1OBGA 5J79A 2JDSA 1QMZA 3DAKA 3PXKA 3WF5A 5IEXA 5CWZA 1Q24A 3GCPA 3QRIA 5DNRA 2C0OA 2R3JA 2RFDA 5BNJA 5GZAA 2QVSE 4W9XA 5CF6A 2NRUA 4L6QA 4MYGA 3K5VA 3QTQA 5JT2A 3PIYA 4X2FA 3LFQA 4P5ZA 4JOAA 5HI2A 3RWQA 4L7SA 3GCQA 3DK6A 4MCVA 4UWYA 3QQLA 3RNYA 5FWKK 4DBNA 5GINE 4KD1A 1VYZA 4IE9A 3NW7A 3BLRA 3E8NA 4IDVA 2W06A 3HKOA 3DKGA 3ZFYA 3K3JA 3E88A 1PMNA 4G3GA 4BGGA 1UU7A 4FSWA 4U81A 4DH7A 2HAKA 3CCNA 4FTTA 5CVGA 2X7FA 3CKXA 4FEUA 2B9HA 5CYIA 5E8WA 3QQGA 2KULA 1VYWA 3RVGA 3V01A 4KRDA 3H9OA 4E5AX 3TDWA 4ZY5A 3NUPA 4KA3A 4XP3A 5CSHA 3WF6A 2FH9A 3WYYA 3KXNA 3OCSA 4NSTA 1M2RA 4JI9A 4W4VA 5ETAA 2C68A 2QOQA 2O3PA 1Q41A 2CGUA 4IAKA 3VRZA 4V04A 3EHAA 4ZTMA 4RJ3A 3UOHA 2PVNA 2B4SB 1MP8A 3OOGA 5AV4A 2OLCA 2VTNA 3UIXA 3F7WA 1F5QA 4NIFA 4AE6A 2WXVA 2YCFA 5A3XA 1MRVA 4GEOA 2IW9A 2Z60A 4AQCA 3JY9A 1KE5A 3FMMA 3PY0A 4LGDA 4O0XA 4WG5A 1ATPE 2JFMA 4YZBA 4I4EA 5HU9A 5BVWA 4EL9A 5L6OA 3AT4A 4D2SA 4X0MA 1KE6A 2R5TA 3ZXTA 3CY3A 4QMPA 3BYOA 1LEZA 5T3QA 2NP8A 3CE3A 4OT6A 4CT1A 3EN4A 3SHEA 3KULB 2OIBA 2YLFA 4ZTQA 4NZWB 4C0TA 4C35A 1ND4A 3DJ5A 4RIWA 4FKUA 4C8BA 3QQHA 3LLTA 5CZIA 3ZLYA 2YA9A 3LMHA 4D5KA 4PY1A 4YZDA 4RFZA 4PPCA 3R04A 1Y91A 3GCUA 1YHWA 3LQ8A 4Q9SA 2UW9A 5L2QA 5K3YA 2QOIA 4DH5A 3F9NA 2OH0E 4HVDA 2EXEA 4FX3A 3WBLA 4HGTA 1WVXA 2ZV9A 1JBPE 4OTFA 4XV3A 4ZSEA 4EH4A 3UGCA 4IADA 1J3HA 3E7OA 2VD5A 3FLQA 4I21A 4Y73A 1Q3DA 3QA0A 4QP6A 1H0VA 1ZRZA 2UZBA 3VUTA 2RFSA 3DLSA 3DZOA 5I0BA 2WTJA 3I60A 1YXTA 1OI9A 4L46A 3BYUA 5EFQA 3HRCA 2VWUA 2BHHA 2GNHA 2YDKA 3A60A 4S33A 4YHFA 5EH0A 3VULA 4AN3A 1WVWA 4EJNA 5K4JA 4O1PA 3QALE 4TNDA 1OL5A 4PP7A 1PMEA 3E63A 4PNIA 5DWRA 4O0TA 2QO9A 3NCGA 4QTCA 2PMLX 2UV2A 3PJ8A 5CVFA 4IWQA 4FT0A 3SDJA 3HZTA 3EZVA 3I6UA 1GZNA 3IGOA 4TT7A 3ZRKA 1U5QA 4R3PA 2VWBA 4U43A 2C5YA 2ETMA 3ELJA 3TZ9A 2Y6OA 2WMXA 3EQRA 5C8NA 5HG7A 1PHKA 1Y8GA 4EOMA 4KIOA 1FQ1B 4JVGA 4OUCA 3MESA 4E4NA 4XLVA 5FXRA 2WB8A 4QMVA 2VWVA 4RGJA 5I9ZA 2GU8A 1Q4LA 3NYNA 2ITNA 1O6KA 5AR3A 4ZTNA 5LMKC 3MVHA 2ZB1A 4F99A 3BGQA 3TV7A 2WU7A 4PMPA 2BIYA 3PIZA 2H6DA 5IQHA 2E9PA 2R3KA 3IKAA 4WNMA 4KIKA 3WF9A 1OZ1A 5AJQA 2CKPA 2HWPA 3RZFA 1ZWSA 3LJ2A 3RAIA 2G2HA 4FVPA 2J7TA 4X3FB 3U6JA 4EWQA 3PYYA 3W10A 4FKTA 4QQCA 3P86A 2XKFA 3FMEA 4B4LA 4FTRA 5HO7A 1CDKA 3ANQA 4MH7A 1SZMA 3IW7A 3PDTA 2XNPA 3HNGA 4BGHA 3QCXA 1OKVA 4D1ZA 2YJRA 3RK5A 3UPZA 4H3QA 1ZYDA 4EZ3A 1UWJA 3R9HA 3W8QA 4MXZA 4U6RA 2JFLA 3FLYA 3KEXA 4E8AA 3EZRA 5CQWA 3KN6A 1I44A 3E8DA 1NY3A 4FT7A 5C4LA 3PPKA 3BEGA 3Q6WA 4TYHB 3LFDA 3AG9A 3MVMA 3LIJA 3VBVA 4YTCA 5EHYA 3D15A 2UVZA 4ZK5A 3HVCA 2XNGA 3NEWA 3G0EA 5DA3A 3SOCA 5K5NA 2JGZA 4BCGA 3NVKI 2WMAA 3NAXA 3BU5A 2YEXA 3O8TA 2YIQA 4FTUA 1PXOA 4ZJJA 2QC6A 4YTIA 3VC4A 3EQHA 4PX6A 4QPSA 4L3LA 5FEEA 5FP6A 2CNQA 2X7OA 4FG7A 4MQ2A 2CNVA 3O23A 1Q97A 5HBJA 1F0QA 1GNGA 2XEYA 3AOXA 4H39A 2IPXA 3TNHA 4PWNA 4WBOA 3TTJA 4QMNA 5KBQA 3LCDA 3MA6A 3R1QA 3AMAA 5ANOA 1R0EA 4EH3A 1KE7A 3TL8A 1H28A 2GQSA 4QNYA 4JAJA 4XBRA 4YUQA 2GQRA 2C6MA 4FNYA 3CP9A 4FGRA 4O84A 3V04A 4OBQA 3LM5A 3WZEA 5CVHA 4CFUA 4KKGA 4F9AA 5LQFA 4D2RA 4BDEA 4JT3A 1ZYLA 4AFJA 2YACA 5JGBA 1TQIA 3ZBFA 5BVDA 4IHPA 1FVRA 3GCSA 2GTMA 1J7UA 3VUHA 3KF7A 1RDQE 5IZFA 3ZXZA 4I41A 3G9LX 3DY7A 4R5SA 4BDIA 3R7OA 3IO7A 3MPTA 3LFAA 3QKLA 4IWPA 5GJGA 4NCTA 3VBTA 1M2QA 4MNEB 4CRSA 1NA7A 5KMIA 3AXWA 3FXWA 2VX1A 3II5A 3T3VA 2C5OA 4O6LA 5DIAA 4DEDA 4UMUA 4NL0A 5I3RA 5BVFA 1XH7A 3SQQA 1ZLTA 2WFYA 3OW4A 4BGQA 2XRUA 2WQEA 3GI3A 2R4BA 5KKRB 1GIJA 2W5AA 2XNEA 2FUMA 4WSQA 1H08A 2ZV7A 3FZSA 4ALWA 2X81A 1OL2A 1UVRA 1YOMA 2F7EE 1H26A 2UZNA 3IDPA 3F3TA 1H00A 2GFCA 3CBLA 4P5QA 5CSXA 5EI6A 3G9NA 4A7CA 4IW0A 4QMZA 2BALA 1SNXA 3HV5A 2J51A 1OIQA 4EONA 2FYSA 4D9UA 4O21A 5FTQA 5C8KA 1YDSE 4M84A 5EYDA 2C6IA 3T9IA 3PPZA 2I0VA 5LCKA 3ZO4A 1ZYCA 1REKA 2CMWA 2NPQA 3ZEPA 4DC2A 4NCTC 5HO6A 2PUIA 3A61A 2XCHA 3AGMA 5FBNC 5CZHA 3EFWA 5JFVA 3BU3A 4BKYA 2R64A 2X7GA 1W8CA 4QQTA 4ZSAA 5K9IA 3L1SA 3UOKA 3F2RA 3O0GA 2ZVAA 4NH1A 4DE4A 2C1AA 4O2ZA 5AUZA 5KHXA 3QHWA 5F95A 3G90X 5LCJA 4FIEA 4M14A 5IQIA 5D10A 3Q6UA 4GK4A 2C6TA 3DA6A 4GG7A 1AGWA 3Q04A 4MD7E 3R8VA 5HESA 3UMWA 1S9JA 3BQCA 5HIDA 4E7WA 3RK9A 3GEQA 3Q52A 1Q62A 4U3YA 3TXOA 4ERWA 5FDPA 3B8RA 2R3GA 4JQ7A 3AC1A 2BR1A 3OEZA 3R2BA 3PY3A 2AC3A 5DFPA 2QCSA 5AAEA 2W5BA 3LCKA 1W7HA 4JIKA 4F1MA 2Y6MA 2PWLA 4IAYA 3IW8A 1ERKA 3M2WA 5AWMA 1YXUA 3MFSA 3ORNA 3NZ0A 2E9VA 4ANNA 3NUNA 3QCQA 3FL4A 4FL3A 4DH1A 4RVTA 3IQ7A 3ORKA 5IA1A 2YLEA 5CSWA 1ZXEA 3TCPA 2PVFA 1W0XC 3EH9A 2GHGA 3DTCA 1H24A 4Z7GA 1A06A 1GIHA 3ZLXA 2XK9A 4F65A 4S2ZA 2RGPA 5J95A 4DHFA 4O83A 4O7YA 1ZMUA 2G1TA 3KVXA 4J52A 4NKSA 3D9VA 1ZAOA 2QOLA 3OFMA 3DZQA 3JVSA 4HNFA 4ZMFA 5AUWA 2PULA 4JG7A 1H8FA 2VWWA 3EQPA 3Q53A 4C2VA 3DBDA 2ERZE 3KXXA 3ZRMA 2A4LA 5IG1A 3ZCLA 3BGPA 2HWOA 5A54A 4I6HA 1E1XA 2WQOA 2BZKB 2WD1A 3ZUUA 4BZOA 4F6SA 5HTCA 2F4JA 4AZWA 4BKJA 3MVLA 3PG1A 4NYEA 5LXMA 3S0OA 1Y57A 3VUIA 3E62A 5EDPA 3A4PA 3L8XA 4QP7A 3TV6A 2C3JA 5KMNA 5HLWA 4EOPA 3IONA 1WBWA 3M11A 4FKWA 4OTQA 4R6VA 3QD3A 2X0GA 4OTGA 4DCEA 1XH6A 4GU6A 4GT3A 4ANSA 5KMMA 3MN3A 1YOLA 4ID7A 5FM3A 4FV1A 1ZY5A 2BCJA 4YU2A 4MWIA 3UE4A 1YW2A 3FMLA 3ZTXA 4QTBA 3HA6A 1KSWA 2YM5A 3DOGA 5G6VA 4Z3VA 2CLXA 3ZU7A 1MQ4A 4M12A 3ZRLA 3C4ZA 4QP8A 4NWMA 5ANGA 3C5IA 3Q5ZA 3E5AA 4II5A 5CXZA 4QNAA 4EH7A 4LI5A 3R02A 5F4NA 2O64A 3F82A 3I79A 3IECA 4GSBA 5H9BA 3UP7A 2OK1A 5CXHA 4AZFA 2PU8A 4LRKA 4XV1A 5JSMA 1KUTA 1AD5A 4MK0A 5CNNA 3A62A 3M1SA 2ZMDA 3C4XA 4RIXB 3JY0A 3R7VA 4A9RA 5IQBA 4E6CA 3K3IA 4D5HA 3UQGA 2WMUA 2WZJA 4QMYA 3NLBA 3S95A 4V01A 5CF5A 3QTZA 4O96A 4G17A 1U4DA 4CFVA 4DTBA 4C4IA 3DQWA 2VV9A 3PVUA 2QR8A 4XOZA 5AUVA 3POZA 4JBPA 5B2LA 4HGLA 3D5WA 3NVMB 1SVGA 3COIA 3C51A 3GOPA 3U6HA 3B8QA 3F6XA 4PL5A 4EQCA 4IM3A 3OROA 5K0XA 2RIOA 1M7NA 2Y9QA 4JX3A 1G5SA 2VTJA 2XMYA 1PJKA 4RWLA 5CI6A 3W55A 2XKCA 5I9XA 4D2TA 1SYKA 5EYCA 3IDCA 3AD5A 3BIZA 3U87A 1Q8ZA 2C5VA 4NFNA 4ZS0A 5JEBA 4OGRA 3LQ3A 3VUMA 4H05A 4K18A 2X4FA 3MFTA 1XBBA 4D4VA 4FV7A 4GH2A 2BFXA 5HE2A 3BWFA 4UXLA 5FUTA 4FV9A 3FKOA 2IVUA 4AGUA 3QKMA 5BYYA 4DYMA 5LVNA 4FKRA 5I5ZA 4WNPA 4Z16A 4WSYA 3GC9A 4ASEA 3FY0A 3D7TB 3C4FA 5F94A 4IZ7A 3EJ1A 1NVQA 3NW5A 4GIHA 5E7RA 5FM2A 4F0GA 4O7WA 4UEUA 2PMIA 5C03A 4MBIA 2F7XE 3BYSA 3H0YA 4CD0A 5F1ZA 4JBOA 5IQCA 5HE1A 4OAVB 3NYXA 5CALA 2Q0NA 3W2CA 4BI0A 1KOBA 3GQLA 4ZS4A 4D1XA 3NYVA 3E7VA 3PXQA 5FXSA 2R3OA 4AF3A 1YXXA 4GFMA 4IB5A 4RC3A 1PW2A 1PMVA 3NPCA 4XOYA 3Q9WA 3PRIA 4PPAA 4YJVA 4MWHA 4KKHA 3GB2A 4U41A 4ANOA 4WKQA 4RX8A 4FG9A 3U9CA 3BGZA 3G15A 2XBJA 4YZMA 3RGFA 1MQBA 3P9JA 3SKCA 5A4EA 1MUOA 5TE0A 1FVVA 5CASA 3ZM9A 5FG8A 4F1OA 4QT1A 1H4LA 1NXKA 2VTIA 3QD0A 3I0OA 5L6WL 3V8WA 2FSLX 4G34A 5L6PA 5LVOA 3DJ7A 2CLQA 2VRXA 4ZZNA 4BY9E 1OVEA 2Y4IC 5CF4A 4RSSA 2JBPA 5H8BA 2YFXA 3WE8A 3QHRA 4EOIA 4FE2A 4FSYA 3KXMA 3QZHA 5HORA 2W4KA 2WQMA 4HGEA 4MBJA 5CT0A 3LMIA 3KL8A 4FEQA 4QMLA 4AWIA 1WFCA 3AD4A 3GC0A 4X2GA 3R83A 4DGOA 3ZOSA 4J71A 3U4WA 4MEDA 3KULA 4NM5A 5DLSA 4RVMA 1XH4A 3PA5A 5C8MA 4CXAA 3NNVA 4IBMA 4YPDA 2R3HA 2GMXA 4MKCA 3OWLA 4BIEA 3COKA 4RX7A 4E6QA 4YZ9A 1M7QA 4Y72A 4J98A 1XO2B 4IWOA 2OXYA 3TM0A 2UZVA 3O51A 4ACCA 4IB0A 5D41A 1JAMA 4MXCA 3TG1A 1IA9A 3V5PA 3ZSHA 2QI8A 4FTOA 4A4LA 4JXFA 4BWPA 5FEQA 4FTJA 2R2PA 4KAOA 4TYJA 1R78A 4EH9A 4FEWA 5A6OA 2RSVA 5HZNA 1PKGA 2OICA 2EWAA 3JR1A 3D4QA 3O17A 4EOQA 3A8XA 5D7AA 3VN9A 3KRLA 4G3FA 1A48A 4JAIA 3EYGA 3TTIA 1J91A 1U5RA 3LXPA 3QTSA 5DHJA 2X8EA 3MFRA 3WIKA 1OKWA 5CSVA 2ZB0A 4APCA 1QCFA 1Q8UA 2C6EA 1HCLA 3UG2A 4KINA 3VUDA 5I4NA 1OB3A 2JEDA 4I5HA 4E93A 4K77A 4EKLA 3Q60A 5J5SA 1Q5KA 5CAUA 4EK6A 2I7QA 3GVUA 2WKMA 5CSPA 4FEXA 1SNUA 3NUYA 4DEHA 3BHYA 4TNBA 3CSVA 1IAJA 2J9MA 2PVLA 3HUCA 2OH4A 1YVJA 5E8ZA 4XV9A 3ACJA 1H01A 4CLJA 3DTWA 4QYFA 4G9CA 2C6OA 3QXPA 4RIYB 2C5NA 3MTLA 5HIEA 4F64A 1SVEA 2W9FB 3LJ0A 4DEIA 5EW8A 4FG8A 5IH4A 5C9CA 3QD2B 4FSQA 3D2KA 2Z7QA 3FMHA 2F2UA 4EZ7A 4RA4A 4FVQA 3ZS5A 4X3FA 5CU2A 3E3PA 4BDBA 4OAUC 2PHKA 3I5NA 4DGGA 3FQHA 2NRYA 4C61A 4PDPA 2XK4A 3REPA 2QODA 3GOKA 5A4LA 1YI4A 4APPA 4U42A 3LXLA 2XKEA 4RFMA 2X8DA 2Z7LA 5AIKA 3R7YA 4EYJA 4HVGA 5IU2A 2XK3A 5LMAA 3EN6A 1ZOGA 4U7ZA 2ZDTA 2WTDA 3GUBA 3FHIA 4ENXA 4L8MA 5LWMA 4IACA 1PMUA 1YWRA 3U9NA 3O96A 4M69B 4IWDA 2A1AB 4I5CA 4ZLOA 3ZONA 2CKEA 1OKYA 3QF9A 4ANQA 3FV8A 5CANA 4X3FC 4YZNA 2P4IA 2W99B 4A9SA 2QOFA 2VUWA 2XK7A 4TWOA 2WELA 5HG9A 1YWNA 2OIQA 4I1ZA 3SLSA 2GPHA 3VBXA 2WQBA 4AZEA 2R0IA 2PVRA 4NJ3A 4BDHA 4I24A 5EYMA 3C9WA 5HD4A 3NIZA 4IMYA 5IH5A 3FLNC 1OM1A 4BCKA 1OBDA 3OY3A 3UO6A 4E20A 3OBJA 3PXFA 5JRSA 1Z9XA 2QO2A 2VN9A 2IZSA 4C2WA 3G6GA 3SA0A 1YRPA 5KO1A 1W84A 4QMMA 3G5DA 2WTVA 1ZZLA 2OI4X 4BCQA 4XBUA 3EQFA 5J7HA 2JDVA 2WTIA 3FZ1A 1JNKA 3DBEA 1HOWA 2HW6A 4KB8A 4QYYA 5D12A 4EOLA 4ZLZA 3TACA 4FKPA 3V8TA 3U55A 4BB4A 2VNWA 2ITWA 5BX0A 4FMQA 5J1VA 3D0EA 3KF4A 5FQDC 3EQDA 5M4UA 2NO3A 1YHVA 5J9LA 4N6ZA 4TTHB 4TYGA 2UZUE 4FSNA 5AX3A 5HE3A 2OJ9A 3ORMA 2B53A 2UW4A 4MNEA 3SAYA 5DGZA 2CPKE 3OTUA 3LHJA 3QCYA 3D5VA 5BPYA 5K0KA 4QD6A 4RJ4A 4PDYA 3E3BX 1QPDA 4R7BA 3PSBA 5DG5A 3FLZA 2ZMCA 2ZM3A 3Q9XA 3CD8A 2HXLA 2WTCA 4YTHA 1ZMWA 3T8OA 1P14A 2PY3A 3W2SA 1M14A 4QP3A 4F4PA 5M08A 4FIFA 4GG5A 2LGCA 4H1MA 3UPXA 2C1BA 4EK4A 3D2IA 3N51A 3PG3A 4DG3E 4K11A 2G01A 5EG3A 3F3WA 3FI8A 3W2RA 4I3ZA 5H3QA 2HENA 3R8PA 3UNJA 2X2MA 3O8UA 3PRFA 4FBXA 2HYYA 3WZDA 2V0DA 3L8SA 4FUYA 4ITIA 3CY2A 1L8TA 3PXRA 3W2QA 2CDZA 2W7XA 2IVTA 4WBBB 3R9NA 1WVYA 4LOQA 4YHTA 2R3MA 4H3BA 3AT2A 5LVMA 5AADA 3H0ZA 3DFAA 1ZZ2A 4U0IA 4FV8A 3QQUA 5ANEA 4LMNA 5DT4A 4C62A 5BMSA 3HEGA 5KMKA 2CCHA 5AFVA 2UZTA 5C01A 4KIPA 4M66A 4FKQA 4I22A 2BILB 2ACXA 2QLQA 2UZEA 4R77A 4OW8A 3ZUVA 2OZAB 4X3JA 3DDPA 1VZOA 1GZOA 4M3QA 3IW5A 4F0IA 3MI9A 4C3FA 4R5YA 2OFVA 2J0MB 1FOTA 5M57A 5J9ZA 5M4CA 4DT9A 2B1PA 3RKBA 3NS9A 4RIOA 5M44A 5J1WA 1JSTA 3UDBA 3O7LB 3UC3A 3RALA
chains in the Genus database with same CATH superfamily
3K5UA 3SRVB 4D28A 3FLSA 3VS2A 1FMKA 4BTKA 3RI1A 5EQYA 2X2KA 4S30A 5DRDA 3S4QA 4U40A 4AOIA 2W9ZB 4O0VA 4OTPA 1WBSA 3NW6A 2PYWA 5CEOA 2XIKA 2YM3A 4IFCA 4FK6A 5ETFA 4WA9A 5D1JA 1DI9A 4IAZA 4ENYA 1H25A 4L00A 5IQGA 2XZSA 2VTTA 4ZZOA 1IAHA 4Z7HA 4A06A 3GC7A 4QP1A 3ROYA 5CX9A 3MDYA 4GKHA 4GRBA 4ITHA 3GU4A 3EL7A 1UU8A 4F08A 2H34A 3RWPA 4KNBA 4XRJA 5HLPA 5IUGA 4RWKA 3FMNA 5CAVA 3FWQA 4U45A 2ZJWA 2GS2A 3PLSA 4XJ0A 3VVHA 3R71A 4NTTA 1V0BA 3KFAA 3LAUA 1X8BA 3ML1A 4WG3A 1BX6A 4XG9A 4RMZA 3KRWA 3RCJA 2ZV8A 5A6NA 3CTQA 4AT4A 3BX5A 2CN5A 1M2PA 4HZSA 3LCOA 2VTOA 1LPUA 4MTAA 4F6WA 5IPJA 3CJGA 3EMGA 3V5WA 3WZJA 2XK6A 4UY9A 3QU0A 3NFGB 4RC2A 3VW6A 4AW2A 4C58A 4S32A 5JKGA 2PE0A 3E87A 3R8UA 2ETKA 4M13A 4FKOA 4AGDA 3LPBA 4EZ5A 4DEGA 4F09A 1ZMVA 4YJQA 4DH3A 3MH3A 5AP6A 4UZHA 2O5KA 2V7OA 1PYXA 3D7ZA 3DK3A 3FSKA 2WOUA 5HHWA 5A4QA 4ZXTA 5FTGA 4LGGA 3ORZA 3AGLA 3R6XA 1W2FA 4CQEA 4FYOA 4F7JA 1FGKA 3PUPA 1J7LA 3A2CA 1B38A 4BYJA 3UVRA 5J87A 2UW6A 4C4HA 4NM0A 5LVLA 2EB2A 3D5XA 3SOAA 2WMRA 4YJTA 4D1SA 4IC7A 2Z7RA 4RIXA 4EKKA 3DPKA 4D55A 5CAQA 4ZOGA 2QHNA 4DA5A 4ZSLA 4EK8A 4DG2E 4CCBA 3GP0A 3TKHA 3VJNA 3P7BA 3PY1A 3MH1A 3ENHA 3VWAA 2E9NA 3LXNA 1UKHA 4GFGA 2REIA 4D4RA 2W5HA 3DLZA 3WI6A 1MRYA 4BCIA 3LLAA 5HE0A 3H4JA 4E4XA 1ZOEA 4BDDA 4EHGA 1CSNA 2YWVA 1PXNA 4IAAA 4Y95A 1Y8YA 3KC3A 2RF9A 2YAKA 3PXZA 3GGFA 3ET7A 3L9MA 2BAQA 4ASDA 3HRBA 2B9FA 2CHLA 5DOSA 5FRIA 3WILA 4FV5A 5CEMA 4ERKA 4FIJA 3OY1A 3Q9ZA 4KRCA 5AP3A 5EM7A 5L2SA 4NK9A 4JIAA 3Q3BA 4X21A 3O2MA 5E92A 4ZJIA 5AV0A 2WTKC 5EI2A 4AGWA 4LL0A 3RPVA 4ARKA 4LUEA 4CKJA 1URWA 5JMSA 3CPBA 3DKOA 2IG7A 1JQHA 4UV0A 4TL0A 2WAJA 4O4DA 4EWHA 1L3RE 3F2AA 3D7TA 1JOWB 2R3LA 4YJRA 5DN3A 3RZBA 2ITXA 4BYIA 4Y5HA 4AW5A 5J8IA 3AKKA 2BAJA 2DWBA 3U54A 3H30A 2HZNA 4FNXA 3UO5A 4ASZA 4FT3A 4E3CA 4JQ8A 4RFYA 3VS0A 1QPEA 3BE9A 2O0UA 5FEDA 3W2OA 5LWNA 4Z9LA 5JGAA 4B8LA 2OXDA 2YHVA 4I0SA 5LVPA 3DGKA 2X0OA 5DT3A 2XIXA 2PZIA 4UB7A 3FMKA 3ZLWA 4E1ZA 4PMTA 5GIPE 1OL1A 5FBOA 4CLIA 5AA8A 4K33A 2XF0A 3FAAA 3FQEA 3MY5A 3CKWA 2PZYA 5HO8A 3RPRA 4Q5EA 3P4KA 1P5EA 2XK8A 3MA3A 2WMBA 2XCKA 4FRFA 3TNIA 3FEGA 4IJPA 2JITA 3TN8A 4AZSA 2R7IA 3R7EA 4AE9A 3IOKA 1UA2A 4E6AA 3QWJA 5BYLA 4L7FA 2HELA 1YKRA 4BI2A 1I09A 3V5LA 3KMMA 3OMVA 2JAVA 4CCUA 2H8HA 2CGWA 2CSNA 4K8AA 3UVPA 3ITZA 4O81A 3BBWA 3E64A 2BRNA 3HECA 3NNWA 2Y7JA 4KS8A 4OBPA 4RA5A 4AU8A 3I7CA 3GU5A 5KZIA 3L8PA 3LFSA 3QA8A 3WF8A 4BL1A 4CMOA 5M07A 4XG3A 2QOHA 3K2LA 5LMBA 4F7NA 1IASA 2CJMA 2VWXA 4U9AA 4WRSA 2VWYA 3FQSA 3U6IA 3VNTA 3TUCA 2OG8A 2BDJA 2UUEA 2W1EA 2HXQA 2ZDUA 1GIIA 1BKXA 4ZSGA 4G1WA 3RPOA 1O9UA 3SW4A 4FOCA 1YWVA 3TUBA 4AAAA 2JDOA 2OW3A 2QG7A 4PF4A 1WAKA 3R8ZA 1XJDA 4WUNA 3GU8A 3KGAA 2GDOA 2X6DA 1UV5A 3M42A 3ATTA 3OXIA 4JDJA 3IGGA 5JGDA 1CKPA 3SXFA 3DXPA 4JX7A 3P23A 3ZSGA 3SW7A 4XUFA 1OUKA 2ITZA 3NYOA 4N6YA 4G5JA 2XIZA 3R8LA 4AFEA 4XX9A 5JQ8A 5M51A 2BZJA 5HCZA 4YJSA 5D7VA 4N70A 4ZLYA 5FXQA 4BWKA 4DFUA 4JRVA 3LXKA 3FBVA 3OWKA 3CGOA 4KS7A 4L52A 2WTWA 3UYSA 3LKMA 3AMYA 3VIDA 1JPAA 4EI4A 2QHMA 3MPAA 5HKMA 5C26A 3PP1A 2PE2A 2QOKA 3FI3A 5EQEA 3JUHA 2G2FA 1YQJA 2R9SA 3KMWA 4YSMA 4MQ1A 3OF0A 3W0QA 1Q8TA 4DEBA 3F5PA 5TOZA 2QO7A 5KHWA 5GHVA 1RJBA 4BDAA 2IWIA 5AA9A 3DBQA 1DI8A 3MH2A 2A27A 5B2MA 4R1VA 2E9UA 4L3PA 4FTCA 4AXDA 1U59A 3GFWA 3F5GA 1SMHA 4R1YA 4OR5A 3CQWA 3MSSA 3NUXA 2HOGA 3O7LD 3ZC6A 5AM7A 3AD6A 3NDMA 4I6QA 4LG4A 2R7BA 1YDRE 3LJ1A 4NW6A 1J1BA 4J96A 5AM6A 3SG8A 1UU9A 3FPQA 4IAFA 4RIYA 3NUSA 3QRTA 4KSQA 4I6LA 2BMCA 1ST4A 3QC4A 4MD8E 2ETRA 2X1NA 2J0KA 2I40A 5EHLA 4DFNA 2JLDA 4UALA 4A4OA 2C30A 3R0TA 1Y6AA 2IW6A 3UOJA 4QPAA 4B8MA 4WD5A 5M56A 4ZAUA 1OKZA 2JIUA 2YCRA 4PMMA 4ZEGA 5IEVA 4FYNA 2BDFA 2I0HA 2JKKA 4FNWA 4IZAA 3Q4CA 4O7NA 3C0IA 4XLIA 5IA5A 4N57A 4O6EA 4XHKB 1BUHA 3OCGA 4AP7A 5FGKA 2HCKA 3QC9A 3QGWA 4P7EA 4PRJA 3PJ1A 5FP5A 2V5QA 5HNGA 2JDRA 3FDNA 3LFBA 4FV3A 4GMYA 1XH9A 5CLPA 2GNFA 3TEIA 3VQUA 1PXIA 5DPVA 4FC0A 1T46A 1PRYA 1E1VA 3TZ7A 4DBXA 2XP2A 3PZEA 2WMTA 2JBOA 3C5UA 3UJGA 3ULIA 3HLLA 2UW5A 4L3JA 1ZYSA 3PVWA 5EW3A 5CAPA 2XANA 2YIWA 2ZYBA 3N9XA 3PP0A 4ZMEA 4BCMA 4MVFA 5D11A 4U44A 4X2JA 4GIIA 4CG8A 3W0OA 1H1PA 3R7GA 2BUJA 4KIKB 4QOXA 2W1FA 3CTHA 1JKSA 4BCJA 1GZKA 4FIHA 1RW8A 5B2KA 5IQEA 2BIKB 2PL0A 3FZRA 4V0GB 4XH6A 3BI6A 4XMOA 4A9TA 4PL4A 4DDGA 5HVKA 4W4XA 3QX2A 4FKGA 1KE8A 2VO6A 3W8LA 3GBZA 1B6CB 4M0ZA 3BV3A 3BELA 4FL1A 4IM0A 4DGLC 4O7RA 3DV3A 5KX8A 1ZOHA 5IQAA 3RAWA 2CGVA 4M15A 4IVDA 3BEAA 2GNIA 4LRJA 5CS6A 3NGAA 4B7TA 4EH2A 3L9LA 2BROA 4TY1A 2SRCA 3DB8A 3R1NA 3UO4A 4HZRA 3EKKA 3UOLA 3ZO1A 4AN2A 4RJ8A 3RINA 5L2IA 1V0OA 5HQ0A 4BDFA 2GNJA 1O6YA 3AC2A 5FD2A 2X6EA 4C38A 3MYGA 3QTWA 4C4GA 2Y8OA 3QUEA 2X9EA 3HYHA 3CQEA 5BVNA 3EYHA 1M17A 4G6NA 3OCTA 3OP5A 4C3PA 3TUDA 3RAKA 4Q9ZA 3ERKA 5CQUA 5EM5A 2JAMA 4JR7A 4O7ZA 3PA4A 4EQUA 3C1XA 3UDZA 4BBMA 1BL7A 3NNXA 3BPRA 3DDQA 3HP5A 3EL8A 1CKIA 5B0XA 2Z8CA 5EOBA 5I9VA 2OFUA 4WG4A 4Q2AA 2VTLA 4MBLA 1Q99A 2G9XA 5AP5A 3C50A 4O86A 2GTNA 3KQ7A 4LM5A 4PPBA 5F9EA 4I94A 2BRBA 3RM7A 4M8TA 3ORLA 1K2PA 1H0WA 2E9OA 3DXNA 3P7AA 4IANA 4MNFA 3OZ6A 2YJSA 4YJUA 4B99A 3PVGA 4KBAA 5AUXA 3TI1A 5KCVA 2JKOA 2W1GA 1P4FA 4RX5A 3SVVA 3KB7A 4DLJA 4N0SA 5HVJA 2UZDA 4X6RA 4WNOA 4QTDA 4DF3A 1M52A 2W96B 2QU5A 3VHEA 4BTFA 4YSJA 3VQHA 1U54B 4NT4A 4LMUA 3WYXA 3H10A 4YO4A 5HG8A 5M55A 3EIDA 3MBLA 4IIRA 3D94A 4GFOA 3QL8A 5JRQA 2V62A 4QMWA 3KRXA 4O1OA 3E8EA 1UU3A 4BBFA 3QZGA 4JQEA 3OVVA 5AR8A 2ITQA 4IQ6A 3V8SA 3TWJA 2BKZA 3KK8A 3PZHA 3QBNA 5HD7A 5H8GA 4IZ5A 4B9DA 1Q3WA 3CJFA 5ITAA 2FVDA 4I5PA 5CEPA 4B6LA 1W2CA 3LM0A 5L2WA 1XBCA 1Y6BA 3F7ZA 3G33A 3LFCA 4G2FA 5A4TA 4OTWA 5E4HA 5HICA 1XKKA 3ZEWA 5L8LA 3UNKA 3FC1X 5IA3A 1OECA 4Y85A 2QKWB 2XBAA 3VBQA 3BHTA 3VBWA 2FSOX 4J97A 4U80A 5GNKA 5AR5A 5IH6A 3RMFA 2EXMA 2OJGA 2IVVA 4XCUA 3ORIA 2VAGA 3UIUA 4JJRA 2B7AA 3VS6A 2XARA 2R3IA 3S00A 4QQJA 5C4KA 1YI3A 3MGYA 3HL7A 5DR2A 4AXFA 3SRVA 3ZFMA 3UQCA 5DVRA 4UXQA 2YERA 3DNDA 3AKJA 5IA2A 1AQ1A 4L45A 2WEIA 5J7BA 4LV8A 4CV8A 4AW1A 3MIAA 1WBTA 1Z5MA 4NM7A 1CKJA 4GYIA 2VTPA 5ANKA 4IDTA 3QQFA 2BRGA 4YJPA 2GQGA 4QEBA 4O4CA 2PMOX 1ZARA 2XEZA 3IOPA 5AP0A 5FDXA 4AXCA 4BR3A 1RE8A 4DFBA 5GIOE 4DT8A 4MD9E 1XH8A 3PTGA 4GK3A 3VHKA 4BZNA 4QP4A 3HX4A 4YP8A 3DU8A 5AV3A 4FGBA 4W4WA 4EOKA 4K1BA 4BWXA 5TKDA 4KWPA 1IG1A 3KXZA 4G6OA 4RJ6A 4J99A 2R3QA 1BI8A 3TMOA 4AS0A 1PF8A 3NR9A 5E8SA 4RX9A 5EKNA 4FA2A 2WIHA 3F69A 4YNEA 5EQPA 2C6LA 5L8KA 2YDIA 2OF2A 4HCUA 3PLAE 4AA4A 4ONAA 5CU4A 4C33A 3SG9A 2ZOQA 1IA8A 2B9JA 1VLRA 2WMVA 4G16A 4QMSA 3OUNB 5FLFA 4DCAA 5L2TA 4JRNA 4RT7A 2A0CX 2XB7A 4RLKA 4YC3A 4IFGA 4PQNA 5AP4A 5EKOA 3R01A 3V5TA 4YTFA 3QAME 2RG6A 3C4CA 3QRUA 3F66A 1H1QA 2VGPA 2WU6A 4U79A 2UW0A 4EORA 4O91A 3PFYA 2BTRA 2YM8A 4JLCA 3HMPA 1R1WA 5HTBA 1BI7A 2VTAA 2HIWA 5GJDA 1NVSA 2RKUA 4M0YA 4M67A 5ACBC 1NT2A 2P0CA 3PJ3A 3UMXA 1XMLA 4C36A 5JFXA 4EOOA 3LZBA 4DAWA 5IA4A 3OHTA 2PVYA 3C7QA 5B7VA 3HV3A 4I6FA 3W18A 4C02A 1KE9A 2OJJA 1KOAA 2Z2WA 3WZUA 1B39A 4W8EA 2P33A 3ALNA 3UBDA 3A7IA 4Y5QA 2ONLA 3KCFA 4CFFA 3O50A 4WT6A 4IJ9A 3D83A 3QTRA 4Y8DA 3UTOA 3K54A 4JBQA 2QOOA 4TXCA 3MY0A 5E8VA 2XAMA 4HGSA 2C3LA 3JVRA 2W1ZA 5AV2A 3WE4A 2R3PA 5HEZA 4X6QC 5AUUA 2F2CB 2I1MA 3DXQA 4USFA 1XWSA 4E26A 4TYHA 4YGAA 4ITJA 3ZBXA 3MFUA 5HX8A 2VX0A 2X0PA 3OD6X 4TKSA 2YZAA 4TRLA 4CYJA 3UZRA 4IVAA 3UNZA 4OBOA 5EK7A 4ZJVA 4L43A 3AC5A 4YJNA 2I0EA 4YLKA 4PNKA 5CAOA 1MRUA 4GW8A 2R3NA 4BDKA 2QKRA 4FSZA 4K9YA 1UNHA 5LOHA 1E9HA 4FT9A 4USDA 4PL3A 5A14A 4YJOA 3W0NA 2BTSA 4HYHA 3DNEA 1UNGA 4FZDB 4D0WA 4AX8A 4AA0A 3R1YA 3MV5A 5M4IA 3WARA 2WMQA 4CV9A 4O0RA 3VW8A 2XALA 3C4EA 4KABA 2B52A 4C4JA 4J7BA 4NUSA 1G8KA 4W9WA 2Q0BA 4IZYA 4RVLA 5ANJA 2O65A 1QL6A 2UW3A 3JYAA 1DAYA 3DBFA 4FUXA 5M4FA 4BC6A 3DKCA 2PK9A 4BVUA 5BUIA 5IQDA 1S9IA 5J9YA 4RBLA 4FL2A 2WGJA 3BWJA 3SD0A 2XM8A 4PUZA 2IJMA 1JSUA 5CTPA 2PPQA 3QFVA 3R22A 2J0LA 2JIVA 4K2RA 2AUHA 3KCKA 2FSMX 4EHVA 2GNGA 5BQ0A 4NM3A 2FB8A 4WNKA 4D4SA 3F88A 3R9DA 2QG5A 4ALVA 4RWIA 5M53A 2GSFA 4MHAA 5K4IA 2X4ZA 4DITA 3CTJA 4EH6A 3SV0A 4FZ6A 1VEBA 3MWUA 3ENMA 4YZCA 4ZZMA 3ORTA 2YABA 5D9HA 2RL5A 4PTCA 4TWPA 5ANDA 5L8JA 4O0UA 5HGIA 3Q96A 4FSTA 4O22A 4AZTA 5L3AA 3O5AA 1BL6A 2QQ7A 1IR3A 2GS6A 3A7JA 4DEEA 2QOBA 4Y83A 2OO8X 1XQZA 3FKNA 4QYGA 4LUDA 3UC4A 4NTSA 3NMUF 2OZOA 4KKEA 4YO6A 3U51A 5CU3A 4F1TA 3GQIA 4O7LA 3I5ZA 4O2PA 4O4EA 3IPHA 4RVKA 2ZM1A 3FYJX 3VBYA 1OL7A 2W1DA 4Y46A 3FI4A 4ACGA 2EXCX 4JDHA 3BKBA 5CY3A 5EHOA 3ROCA 3HAMA 3E8CA 3TIZA 4LV7A 4CMUA 5TR6A 4U3ZA 3BYMA 3GU7A 2Y4IB 3LCSA 3I0QA 4HYIA 5E91A 4F0FA 2BVAA 2ZM4A 2FA2A 3KY2A 4FSMA 4FSRA 4NKAA 5JFWA 5KKRC 3FHRA 4FKJA 4TW9A 4XG4A 4F63A 4PV0A 5GZ8A 3ZDUA 2J5FA 2PVKA 2G2IA 4C4EA 2OWBA 3PIXA 2GNLA 4NU1A 2OU7A 1PKDA 2FSTX 5JQ5A 2CNUA 4R7IA 4C59A 4GKIA 2BDWA 2I0YA 2J0JA 3BLHA 3W32A 4EHEA 3P7CA 4BDGA 1JKLA 4BCNA 2QR7A 3KIOC 3EN9A 3R28A 3LW0A 2ESMA 3LCTA 3ODZX 4XP0A 4JBVA 5KBRA 4EC8A 2JKQA 1Q8YA 2XYNA 3I4BA 4BN1A 4XRLA 4YLJA 2B54A 4G6LA 4S34A 3D14A 2W1IA 3RJCA 4BIDA 1FBNA 5DH3A 5I9YA 4GUEA 4FICA 4PTEA 3OS3A 3R00A 3I6WA 3P78A 4N4SA 2PE1A 3RNIA 5ICPA 2XYUA 3AC4A 5DBXA 3VF8A 4DLIA 3FI2A 4L42A 1ST0A 4ACMA 4HCVA 3BHUA 4TPTA 3OOMA 4AN9A 2UZWE 2X39A 1NVRA 3W0SA 4IB1A 2O8YA 3TJDA 4O7VA 4O82A 1CTPE 5C1QB 3CR0A 5A4CA 3HAVA 4F9CA 2V22A 4D0XA 2BZIB 4EYMA 2NNWB 5DYJA 2XNNA 3QTXA 2XJ1A 2WEVA 4OTHA 3QD4A 4XG7A 3OBGA 3PJ2A 1CMKE 1T45A 2RG5A 3R73A 2E2BA 2GS7A 4OT5A 3RHXA 3I7BA 3EFJA 3AQVA 3LQ5A 3R63A 3COMA 4CKRA 1W2DA 4MAOA 4FT5A 4C37A 3OEFX 4G3EA 3WF7A 2WO6A 4LL5A 4H3PA 3E92A 4UYNA 3ZHPC 4E5WA 4HVHA 4ZTSA 2IO6A 3EWHA 4MXXA 1XH5A 2C5XA 3HMIA 4LRMA 2WOTA 4EOSA 4H1JA 4ZIMA 3EB0A 4FV4A 5LMKA 3T3UA 3Q2MA 4AACA 3DJ6A 3N4TA 4V05A 1V0PA 1GAGA 2C4GA 4DG0E 3AKLA 1OL6A 4RJ5A 1XBAA 4FODA 2O2UA 4CMTA 4ANMA 2JC6A 2WIPA 4FTAA 3SX9A 3V6RA 2LAVA 3WOWA 3TZMA 4IXPA 4QMTA 4HW7A 5IISA 4BFMA 1GZ8A 5E1SA 3MS9A 4LOPA 4JDIA 5TO8A 4AT5A 2WNTA 3PE2A 4H58A 1TVOA 4CNHA 3HGKA 4QP2A 4MXAA 3UVQA 3BL9A 4QMXA 4F7LA 3MW1A 4J1RA 5CF8A 1P2AA 3C13A 3BHHA 4O0SA 3F5UA 3RP9A 3PSDA 2QOCA 4FTLA 3R8MA 2BZHB 2WHBA 5HLNA 3MIYA 3JPVA 2JKMA 1UWHA 3OXTA 4JMQA 2ERKA 4IEBA 4F9BA 3Q4UA 2VWZA 4EH8A 4CZUA 2YAAA 4RWJA 4AW0A 4A07A 4ZY4A 5H8EA 2AYPA 2DYLA 3SC1A 3KRRA 4F9YA 1OGUA 3W0MA 5CEQA 4BZDA 4RZWA 1Z57A 5HOAA 5IKWA 1YOJA 1PXKA 2PMNX 4UMQA 1UKIA 3BBTB 3EQBA 3V5QA 5AUTA 4V0GA 4L68A 3T9TA 3Q2JA 3TJCA 3A4OX 3BYVA 5FTOA 4PDOA 1RQQA 5IMEA 4BF2A 3BRBA 3B2WA 3BE2A 3ETAA 1W83A 4GVAA 4I0RA 4WO5A 3FXZA 2G15A 2UVXA 4FSUA 3RPSA 5AEPA 1H27A 4UMTA 4R3CA 4XG6A 3TV4A 4TZRA 5CEIA 2H96A 3HV6A 5ETCA 1JKKA 2PVJA 5CEKA 3FZTA 4MX9A 4FV2A 5HCYA 3FPMA 3S3IA 4E4LA 5K5XA 2C47A 5CENA 4QQ5A 3VS4A 3VUGA 3ZLSA 4PTGA 5KNJA 4FVRA 3IW4A 1GY3A 3ANRA 3KK9A 2IZUA 1DS5A 3HA8A 4UBAA 4WOVA 1U46A 5T6KA 4UN0C 2B0QA 3HDMA 5DEYA 3POOA 3IW6A 3DFCB 5JK3A 1XR1A 1TZDA 2VTRA 5BVEA 4I6BA 4EK3A 3P5KA 4MXYA 3IS5A 4C4FA 4AQKA 4CG9A 2OBJA 3FZPA 4QP9A 5F20A 5I3OA 2B9IA 1PXLA 4H36A 5BUEA 5A46A 2IW8A 4ORKA 2QU6A 4YBKA 2ITYA 4C57A 2YM6A 5CU6A 2WQNA 4ANBA 2KTYA 2C6KA 4X2KA 5HVYA 3TT0A 1WZYA 4EBVA 4EHZA 5JH6A 2Z7SA 2HZ0A 5G1XA 4NEUA 4F78A 2ITTA 3KKVA 3PPJA 2OSCA 4CFWA 3C0HA 3ZZWA 5CU0A 3RHKA 4JG6A 2W17A 4LGHA 5AR2A 3OTVA 5DEWA 2VZ6A 2W05A 4IX6A 4QTAA 3R9OA 1U54A 3DQXA 1Q61A 2QURA 4IAIA 4G3CA 3UIMA 3VRYA 4M7IA 4YBJA 5ACKA 2B55A 4GYGA 3HUBA 2HY81 3Q4TA 4HYUA 3H3CA 1HCKA 1XHAA 3KXHA 4LFIA 4U97A 2Y4PA 5AMNA 4A4XA 4YC8A 4FTMA 4AOTA 3HV7A 4QPMA 5EDQA 3R1SA 1H1WA 4FZ7A 3VUKA 5AR4A 4BHZA 3TKIA 1CM8A 2PZRA 5DMZA 3N4VA 5BVOA 3CIKA 4CQGA 1LR4A 1OITA 2WMWA 4OTRA 4UZDA 3EN5A 4DFYA 5HG5A 5IQFA 2EB3A 1TQPA 3ULZA 3IDBA 3R7IA 4E4MA 4EUTA 1ZY4A 2HK5A 2VO3A 2Y0AA 4QYHA 3AT3A 5EM8A 4W4YA 4Z55A 1PXJA 4FV6A 4X2NA 2ITPA 1K3AA 4DTKA 4A9YA 5M09A 2QLUA 4I93A 1YXVA 1FINA 1OPLA 2CCIA 1PYEA 4BIBA 2V55A 4BICA 4GCJA 3TIYA 2AQXA 3S1HA 3FMJA 3MH0A 4CFMA 2CKQA 3NUUA 3CD3A 3A7FA 3FSFA 4I92A 3LOKA 4XP2A 4ZTLA 3ZH8A 5DE2A 3ALOA 4ZY6A 4XYFA 2VTHA 2FO0A 2VGOA 4FTKA 2UZOA 4FTNA 5IUHA 3BU6A 4GL9A 1GJOA 2PTKA 2IVSA 1WBVA 3DT1A 4FTQA 2XRWA 3AC8A 2JDTA 4NFMA 2IN6A 3DK7A 4NIFB 3ZMMA 4CRLA 4FEVA 3JS2A 3A7HA 3QX4A 3E93A 3DB6A 3CC6A 4XNEA 3SXSA 4DGMA 3UODA 2C3KA 5EI8A 3KA0A 3QTIA 4AOJA 3DBCA 2GHLA 3IG7A 4GJ3A 4DTAA 5IUIA 4E73A 2J2IB 3ORPA 1LEWA 4PMSA 5KMLA 4OTIA 2J0IA 4BKZA 2BRHA 3ACKA 4BCHA 4RIWB 5AV1A 1QPCA 2XIYA 4FKIA 4FIIA 2ITOA 4HCTA 3KN5A 3U8WA 2AC5A 5AP2A 3NIEA 1URCA 4GK2A 3FMDA 4LOOA 4MUQA 2J5EA 3PA3A 4KBCA 4DH8A 4RQVA 3MJ1A 3TYKA 1WBOA 4IX3A 1WBNA 2HZIA 5E8TA 5LARA 5AAGA 2XKDA 3FKLA 4QMOA 1DAWA 3G6HA 1O6LA 4BDJA 4HNIA 3HRFA 3QZIA 2W4OA 4WUAA 5DR6A 4TWCA 4EEVA 2EVAA 4F9WA 4JG8A 2Z02A 5E8XA 3EQIA 5CT7A 4CZYB 3P5JC 3RTPA 5JFSA 1PXMA 1OPKA 2R3FA 2YIXA 2YWPA 4TN6A 1OMWA 3QLGA 3S2PA 5BUJA 3F5XA 1OIYA 1YXSA 2XJ0A 4IVCA 2C6DA 4AUAA 2GCDA 1IEPA 4FJVA 3COHA 4O7SA 2UW8A 3OT3A 4ACDA 4FKLA 1KWPA 2P2IA 3ZM4A 4OTDA 3QTUA 1JVPP 3P1AA 3TDVA 3BV2A 2XH5A 3GU6A 5IA0A 3OUKA 3LFFA 4JNWA 2GFSA 3A99A 3NCZA 2F57A 5GZ9A 4EQMA 1APME 4UX9A 3QQKA 1H07A 2OGVA 3LMGA 2X8IA 2VX3A 4K0YA 4UYAA 4GVJA 4CEGA 1G8SA 5CNOA 1FGIA 4UWBA 3LE6A 2PVMA 3NUAA 4HYSA 2QNJA 1KV2A 4FOBA 4AGCA 2VNYA 3OXZA 4CGAA 4M69A 3VJOA 1WBPA 4ALUA 5LJJA 4P90A 3KMUA 4KIQA 3ZYAA 5J5TA 4F6UA 3KREA 4FZAB 5M06A 4WIHA 3MY1A 1TFFA 2DQ7X 3OCBA 3ZUTA 3OG7A 3OT8A 3KU2A 3QUPA 3CS9A 4NJDA 4R3RA 5EDRA 2CKOA 2ZAZA 1BYGA 3LFEA 4F70A 2ITVA 2J4ZA 4DEAA 4IH8A 5IMXA 2BPMA 2YITA 3BHVA 3NX8A 3P08A 1P4OA 4FTIA 4L53A 4CSVA 4BRXA 3MTFA 4DFXE 4W8DA 3R2YA 3V6SA 4ASXA 1JLUE 2OJFE 4BTJA 4FKVA 4BCFA 3QYWA 3FL5A 2ZV2A 4HPTE 3UP2A 3PSCA 2XUUA 4M68A 3G2FA 2A98A 4Q5HA 4DFLA 5L4QA 1TKIA 4RJ7A 4IM2A 4EK5A 4CYIA 1YDTE 5IDPA 2PZ5A 4BDCA 4FZFB 4IC8A 4ZTHA 5KZ0A 3ZDIA 3FY2A 3MB6A 4O38A 4OLIA 3CQUA 2VO0A 4R7HA 4IVBA 1G8AA 2WTKB 4D58A 4D2VA 1FPUA 3RM6A 5HU3A 3EOCA 5DI1A 1DM2A 2XVDA 3ZO2A 2PUPA 3MJ2A 2X9FA 4MXOA