2R7BA

Crystal structure of the phosphoinositide-dependent kinase-1 (pdk-1)catalytic domain bound to a dibenzonaphthyridine inhibitor
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
285
structure length
274
Chain Sequence
RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, transferase
molecule keywords Phosphoinositide-dependent protein kinase 1
publication title Discovery of Dibenzo[c,f][2,7]naphthyridines as Potent and Selective 3-Phosphoinositide-Dependent Kinase-1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 274
sequence length 285
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2r7bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2r7bA01
2I0YA 1E1XA 1JKTA 2ZV7A 4L43A 1SNUA 4JIKA 4L42A 4RVLA 4ZSJA 5DT3A 3BYSA 4C4IA 2OH4A 2ESMA 2BR1A 3MTFA 4XV9A 2PVKA 2IWIA 4G9RA 1W83A 5E8VA 3W55A 3RK7A 3QRIA 2XEYA 5DNRA 4DF3A 4DBNA 3LFEA 3Q4ZA 3T9IA 2W9ZB 2VTQA 3UMXA 3VNTA 3RHKA 4LMUA 4OBPA 3NNUA 3VBTA 5CWZA 4BB4A 4F7LA 4V0GB 3VUGA 3CP9A 3ANRA 5A4CA 4CCBA 3ZUTA 5F95A 3I0OA 2EXCX 3U51A 2ETMA 3O7LD 4XMOA 1FVTA 3ZC5A 4ZZMA 3PZEA 3D0EA 3T9TA 5CANA 3C5IA 1H27A 4NEUA 1YI4A 3KL8A 2FSLX 4XJ0A 4U41A 3MB7A 5I4NA 1XHAA 1PW2A 4E4XA 1JKSA 5TOZA 3VHKA 2B9FA 3HV7A 5FXSA 3UQCA 3C4WA 3NUSA 5J9ZA 2VX1A 4OAVB 4BHZA 4OT6A 5A4LA 3P4KA 4JDIA 4WUAA 4O7SA 5AX3A 1KE7A 3AD5A 5T6KA 3M1SA 4RJ3A 4MXOA 3DV3A 3FEGA 3UVRA 4NSTA 2Y0AA 2C0IA 4YZNA 3BQRA 2OF4A 1BLXA 3R1QA 3CE3A 4AOTA 5DIAA 3DAEA 5EI8A 2Z7LA 4RC3A 3G0EA 4ZSAA 3NAYA 2PYWA 1CKIA 3FI8A 2YM4A 2OIDA 2YHVA 2C5OA 3C4CA 2ZJWA 2ITPA 5CAPA 4EZ5A 3TKUA 5CT7A 2JIVA 2VTTA 3D2KA 5ETAA 4EOOA 3MH1A 4WG3A 2R7IA 1BKXA 2XYUA 5ANOA 4HVHA 2SRCA 5ANDA 3PSDA 2GSFA 4D5HA 1YRPA 3QUEA 4HCUA 2Y7JA 5CTPA 2V7OA 5EM8A 3FPQA 3QYZA 1PKDA 1KV2A 4I3ZA 4GMYA 3CSVA 3GU7A 2BROA 2VX0A 4FR4A 2W9FB 1CDKA 3O96A 3DBCA 3GBZA 4M97A 3E92A 4CSVA 3HP5A 2UW0A 4BZOA 3VS1A 2J0MB 4FTIA 5M09A 4E93A 1YXVA 2JAMA 2R3PA 3EHAA 3OWLA 4PMMA 4PPCA 1W82A 5AADA 3NMUF 1IG1A 1T46A 3ZSHA 5K5NA 3C0IA 4GS6A 4IFGA 4K0YA 4BDFA 5BMSA 4DFYA 4OLIA 4G3CA 2RG6A 3MY1A 4F63A 1UV5A 4RC2A 3M2WA 2B55A 4UYAA 4XBRA 4C2VA 5LOHA 5EKOA 4FTLA 3AQVA 2ITUA 4V05A 4FTTA 4H36A 3C50A 2YZLA 3P23A 4QP1A 3ZOSA 4F6SA 4O84A 4DFXE 5C01A 1KSWA 4YPDA 1S9JA 3KMWA 4TZRA 5DI1A 1GZNA 3UP7A 3CXWA 4ASZA 5AR8A 3G33A 4P90A 1FBNA 2UVZA 2G2FA 4TNDA 1PXLA 2VO7A 2I0VA 3GCSA 4QMLA 4Y83A 3TACA 5CX9A 3VS3A 3LCSA 4TWNA 2HW6A 1OI9A 1XH5A 3F2AA 4R7BA 3PWYA 3ULIA 4J8NA 1ND4A 2QOQA 3P5KA 3LAUA 4MNEA 2HK5A 3ZO4A 5GINE 2GNJA 5FRIA 4YLLA 4YSJA 4FKSA 4EHGA 3MIYA 4LOOA 4UY9A 2JLDA 4FTUA 4WOVA 3R9HA 3W2RA 3R2BA 4PV0A 3FL5A 3TKIA 2UW8A 5GZ8A 3OHTA 4ACHA 4YURA 3PDTA 3B2TA 4Q9SA 2OJGA 3L1SA 3AMAA 4QO9A 4DFUA 2X4ZA 5CSWA 5E8ZA 4UWBA 1OKYA 3RAKA 5IMEA 4O7NA 4U7ZA 3OUNB 3IGOA 1YI3A 3FDNA 2QU5A 2J9MA 4I4EA 2QO9A 3Q52A 5L2SA 1G5SA 3MFSA 5BQ0A 3G90X 2UZUE 5CEPA 4K77A 5EW3A 3OOMA 4QTDA 3UOJA 5FM2A 5DOSA 2F7XE 1IA8A 2OFVA 1FVRA 2JKQA 4RIOA 4WA9A 5C27A 2PE2A 3V8SA 1YDSE 5KMIA 1H0WA 2W06A 4E6DA 3VIDA 2C3JA 3E5AA 4O0UA 3L8VA 3PIYA 2QI8A 3A4PA 4PMPA 2V0DA 4PUZA 4YNEA 3ZLSA 2CNQA 2PUPA 4O2PA 5CASA 3R22A 4FNYA 3D5XA 4K1BA 3HRBA 3OS3A 3IO7A 4KA3A 3Q6UA 5BVNA 3P86A 3KA0A 4JI9A 3UG1A 1H1QA 4D5KA 4FEVA 2R3FA 3ZM4A 3H10A 1B6CB 3SHEA 3ZUVA 2HZ0A 4QP6A 4BCKA 4D4YA 3NUYA 4C61A 1Q4LA 3GT8A 2XZSA 1YXUA 4H3BA 3V5WA 3LE6A 4NFMA 1YWRA 5AP6A 5TO8A 4XH6A 2QURA 4RA4A 4YJRA 5J79A 5IUHA 1OIRA 5HTCA 1PXJA 4F64A 3ETAA 3I5NA 2XCHA 2WKMA 4QMVA 3IPHA 5GJGA 1WMKA 3E8NA 5E8UA 4GH2A 4QYHA 2OK1A 4YLKA 3BGZA 4E8AA 4LRMA 4UMQA 4C62A 1H26A 2XKEA 5AV2A 2VUWA 3F9NA 4ZK5A 4OTIA 5CYIA 2UZNA 2BHEA 3OMVA 4A4OA 5L2IA 2XJ0A 3P0MA 4KINA 3ZSGA 4TYGA 4BCNA 4HVGA 2EUFB 1O6KA 3GC8A 3HL7A 4I41A 1Q8TA 1XO2B 4GUBA 1ZWSA 4AXAA 4N6YA 5GJFA 2C0OA 4GFGA 1FVVA 4B8LA 4FKOA 5CAQA 1R3CA 2XJ2A 1YOMA 2W7XA 4FE2A 1RW8A 1OM1A 3U54A 3L9NA 2WU6A 3ZZWA 4GSBA 1V0PA 4JAJA 5HX8A 5E91A 2JIUA 2QOCA 5EYMA 4CV9A 3V5QA 1YHWA 3VHEA 5AUWA 2C5XA 3I4BA 4FICA 5EOBA 1Y8GA 2A1AB 4ONAA 5CEIA 4D55A 3MN3A 4IE9A 3KY2A 4CEGA 3QD0A 2XEZA 3IDCA 5M44A 3C4FA 4PRJA 5EK7A 3BU5A 2R3HA 5D1JA 4ACMA 4C0TA 4X21A 5KMNA 5IQAA 1ZOEA 3LQ8A 4W9XA 4RJ6A 3W2CA 4IAZA 2YITA 4LI5A 3EYGA 3FKNA 5IUIA 3ZBXA 2PMLX 3DBDA 3Q53A 4DH5A 1STCE 3QRTA 5HX6A 3GUBA 3DXPA 4HZRA 3EFKA 5HO6A 3SDJA 4FT9A 2PVNA 4RQVA 2CNVA 4WBOA 4U97A 3ANQA 3MI9A 4H05A 3AOXA 4IM3A 2Z02A 2XNBA 5E1EA 4D58A 2FSMX 2XJ1A 3L8PA 4EJ7A 4IANA 3BWFA 4DAWA 3ENMA 4IJ9A 4IIRA 2O63A 4KKEA 4O1OA 2WPAA 4YPSA 1O6LA 1PXIA 2X2KA 3QZIA 5DT0A 4BTKA 3ORNA 4BN1A 5BYLA 3KMUA 4PY1A 2P33A 2QLQA 4QMQA 5AUTA 2VRXA 4MKCA 1REKA 2PMOX 5D9HA 2ZM4A 3VS5A 3KRLA 4RIXA 2PVFA 3QQJA 3NUXA 3U6IA 4NZWB 4CKIA 5AR3A 3SRVA 4GU9A 2E9UA 4XRJA 3C9WA 5IMXA 4O0RA 3ZFMA 2KULA 2ZDTA 3KVWA 4FTJA 1MQ4A 2WNTA 4ASEA 3MFRA 4X2KA 5IF1A 3F3VA 1HOWA 5ICPA 3R1SA 3A4OX 2WMTA 3QC4A 2BRBA 3TV7A 5JFSA 3R2YA 2R3JA 4BDHA 3JY0A 5HI2A 4RX8A 4HGEA 1LEZA 3WE4A 1FOTA 1U59A 3DAJA 4X6QC 4GT4A 4J1RA 5B2LA 4BWKA 5JKGA 1VZOA 4J7BA 4YJOA 3W2PA 2XYNA 4O1PA 3E63A 3A2CA 1IASA 5DMZA 2G2HA 2C0TA 3F82A 5T3QA 2ITVA 4EJNA 4JX7A 3DKGA 4RPVA 3LCKA 3FMKA 4PDOA 5E8WA 4JQ7A 2WQNA 2Y4PA 4Q5HA 5HZNA 3DB6A 4DEEA 4DINA 2YLEA 4MCVA 3QXOA 4I22A 4OAUC 2JKMA 3CD8A 4ERKA 4OTQA 3I1AA 5A4QA 5DRBA 2V62A 4ERWA 2X7GA 4M3QA 4RC4A 3KXXA 4DTBA 2J2IB 2HY81 2GTMA 3MVJA 1LPUA 3QQKA 4O0WA 3OCBA 4FC0A 3M11A 4F7NA 2JD5A 3OY1A 4XOYA 3GC0A 3VQUA 5DR6A 2E9NA 1ZYCA 2VWIA 3IONA 4M14A 4C3FA 2ZDUA 2CPKE 1J1BA 3OFMA 5KE0A 1WBVA 5M53A 2VTIA 4O0YA 3LXNA 4KS7A 3MPTA 3R1YA 5AR2A 3VUKA 1TQMA 2QD9A 2GS2A 4DFBA 3WZEA 3BHYA 3DGKA 4ZY4A 3EZRA 4EOPA 2ZM3A 2CCHA 2H34A 4Z7GA 4I24A 3DJ7A 2F7EE 2XVDA 3TNPC 4FSUA 3VUMA 2P3GX 3R7GA 3OEZA 3ZYAA 3TDVA 3ODYX 4U0IA 2BRMA 4R5SA 3WZUA 4KS8A 1ZZLA 4RRVA 4IZAA 3DT1A 3ZDUA 2ERKA 4RGJA 4C4JA 4F9CA 5JEBA 3NNWA 4C8BA 1RDQE 4ITHA 3VJNA 4ALWA 3FZPA 3ZS5A 2ITOA 4FZFB 4G1WA 3OXTA 2YIYA 5H8GA 3DJ6A 2R7BA 1OVEA 4GVAA 2I1MA 3G5DA 4CG8A 2E2BA 4F70A 2ZV8A 4AQCA 4WSQA 2HW7A 4BDEA 1WVYA 3MY5A 3OC1A 4PTEA 5KHXA 4O7VA 5M06A 3QQFA 3IOKA 4O0SA 5IEVA 3PXKA 3QCSA 2BIYA 1PY5A 3C51A 3UOKA 4TYIA 2F2UA 2WMSA 4OTDA 3Q6WA 1DAWA 1NY3A 4JG7A 1B38A 2JDVA 2QG7A 2NO3A 3OP5A 5IZFA 3LJ2A 4E6AA 1L8TA 2XNOA 4BCOA 3QXPA 4XG2A 4FL3A 3EQFA 3R9OA 3V5TA 3OCTA 4WNKA 4TYEA 5FWKK 4BIEA 3QYWA 4C3RA 4BVUA 5FXRA 3SD0A 4FYOA 5L6WL 1XH7A 4DHFA 4YTFA 3RM6A 1H00A 4XEYA 3UO4A 2UZTA 3VWAA 4AOJA 4IWQA 4JBOA 2JFLA 2JIIA 4XP2A 5A3XA 4IM0A 4Q9ZA 4I5HA 5CAOA 5M56A 3R30A 4TKSA 3CQWA 3BE9A 5CQWA 4ZS0A 5EW8A 2X8DA 4L01A 4M67A 2QR8A 2ITQA 4W9WA 2AC5A 3EOCA 3A8XA 4BI0A 4IAAA 5BVWA 5CY3A 5HG8A 3QD2B 4E7WA 3KN6A 3JUHA 4F65A 4DH7A 4L9IA 3I6UA 2W5HA 4M68A 4PPBA 4NW6A 3P7BA 1FINA 5JZJA 3FYKX 3ITZA 3NCZA 2UZWE 3F61A 1JPAA 3JS2A 1H0VA 3K5VA 2I40A 4IACA 2VWXA 4TNBA 4U6RA 2B7AA 3UOHA 2KTYA 3MWUA 4LFIA 4DGOA 2GFCA 5GZAA 3S0OA 3IECA 2VTSA 5K0XA 2PVLA 5KHWA 1PMEA 3O8UA 4O81A 3T8OA 3UJGA 4I21A 4PP9A 3LCTA 3RGFA 3EB0A 2OXYA 4DG0E 2HWOA 4C4FA 2IZSA 3D94A 4GG5A 1TKIA 4J99A 4EHZA 4EYMA 4BI1A 1E9HA 3ZHPC 4ZMEA 1Q8WA 1OPJA 1WBOA 1NVSA 4O96A 5HO7A 4F9AA 4FV3A 4IX5A 4NTSA 3FI3A 1U54A 4QP2A 4PMSA 3FQEA 4ASXA 4CRSA 4E5BA 4MBIA 4XS2A 3NAXA 3AG9A 3AC2A 4FKTA 3CPCA 4KRDA 5ETIA 5IA3A 3PPJA 5BUIA 1MRUA 4HZSA 4AW2A 5AAEA 4O7ZA 1BX6A 4ZJJA 4U44A 4Z7HA 4GRBA 2VTMA 4M7IA 3OWJA 2HZ4A 4LGDA 4UB7A 1KV1A 4XG4A 4OBQA 2WMBA 2B9IA 4R1YA 4FSZA 3WF6A 5L8LA 3C0GA 2XM9A 2B4SB 3B2WA 4ANOA 2BHHA 2XK4A 2V22A 2WMVA 4XCUA 1Y91A 1PYEA 5FUTA 4G3FA 3FE3A 4CYJA 3NVKI 4YSMA 4A7CA 2Q0NA 5EYDA 1SZMA 5JFWA 4IB3A 2CDZA 3BYMA 4IB5A 3N4VA 2WELA 3G2FA 3ERKA 3OT3A 4JJRA 1H28A 4A9UA 3LJ0A 4FV5A 1ZY4A 2PZ5A 4FEQA 1Q62A 2JGZA 2Y6OA 5DLSA 5FQDC 2CKQA 3RPOA 3NSZA 2ITWA 4LUEA 2CN8A 2OW3A 1CKPA 3H9RA 4FIHA 3CTHA 5JSMA 2CKEA 2YDKA 3NEWA 2PVMA 3BEAA 3GU6A 4Y73A 4I4FA 2VWUA 2JDOA 3EH9A 3RINA 4R78A 5DWRA 2X2MA 3KF7A 4GKIA 3HP2A 4BDJA 4NKAA 5AP2A 4PDYA 3EN4A 4FZDB 5CNNA 5AMNA 1VR2A 5IQGA 3E3BX 4E1ZA 3IG7A 4QT1A 4D1XA 2YACA 3HV5A 4CV8A 4E6CA 5KX8A 4BCJA 3CGFA 5EQEA 3UIXA 3PTGA 5IA5A 2QVSE 2BFYA 3VUTA 1WVXA 4FA2A 4ZAUA 5HU3A 3IW6A 3O17A 4NK9A 3ZO2A 4Y46A 3BE2A 5FTGA 1YOLA 3QTXA 4G2FA 5HTBA 4YC8A 3N4TA 4CMUA 4W8DA 4AAAA 4LOPA 5HOAA 3VBWA 3FV8A 4AFEA 2CMWA 4NIFB 4PX6A 3ZRKA 5HG9A 3UO6A 4BBMA 3TTIA 3SKCA 5AV1A 3UIBA 4XG8A 4YP8A 2GQSA 2C6OA 4FKWA 4QMOA 3ZLXA 5HBHA 4BZDA 3DQXA 4CKRA 2J51A 4JR7A 3EQBA 2XIYA 2WTCA 3NZ0A 4L3JA 3WILA 2UZVA 3N9XA 3NYNA 1Y8YA 4JRVA 3VF9A 4QMMA 4USEA 4I92A 5AM6A 2C6IA 1OIYA 3RCJA 5BX0A 4C3PA 2YCRA 1BL6A 4AZSA 2ETKA 4DCEA 4XG3A 2P2IA 4C37A 4RWIA 1M14A 2PTKA 1J1CA 4TN6A 5HQ0A 2RFSA 3FMLA 4NTTA 5LXMA 3MBLA 4JDKA 5CU6A 4KB8A 4D2PA 1UKHA 3C1XA 1YXTA 1MUOA 2XNNA 3E3PA 4XUFA 5IKWA 2UW6A 3QCXA 2GNIA 5DA3A 3ZO1A 4JQEA 3E88A 5HNBA 3O7LB 3R9NA 4EKKA 4ZTHA 3GNIB 2X7FA 3NRMA 1WBTA 1HCKA 3QAME 4BY9E 4PPAA 2PL0A 1WBPA 2R3RA 4YJTA 4C36A 5HTIA 3OTUA 3CKXA 4BR3A 3H30A 3VULA 4TRLA 4EQUA 2OKRA 3R0TA 4D9TA 3FMDA 3BLQA 4H1MA 3QWJA 4FNXA 4FV0A 4ZTLA 4AT4A 4CFNA 3BWJA 5HG7A 2O0UA 4NM7A 3Q9ZA 4GIHA 3SG9A 4N4SA 3BHTA 3AC5A 2C69A 1ZRZA 4MXAA 3P1AA 3RM7A 2XRUA 4F1MA 2PUUA 4MNEB 1QL6A 2WU7A 2OJIA 4FKLA 2YERA 3CBLA 4F7SA 4FSQA 4X0MA 3SG8A 2EU9A 5K9IA 4U79A 5CVGA 1V0BA 3EYHA 2XS0A 4EOSA 2UZEA 5ANEA 3QA0A 2QR7A 2R3GA 2GNHA 4R3PA 3BU3A 5L2WA 3A99A 1UWHA 4TPTA 3D7TA 3LW0A 4YHTA 5K3YA 3VVHA 4YO6A 1X8BA 4GT3A 1FPUA 4I6HA 1F3MC 1IAJA 1PHKA 3PG1A 3A7JA 3CQEA 4KAOA 1MP8A 3O50A 4WT6A 3AGMA 4NJDA 4PWNA 5FBNC 2BRGA 4S33A 4XLIA 4AU8A 4APPA 4D2WA 4ZLOA 3DJ5A 1FQ1B 5LCJA 1SVGA 2RFNA 4BCPA 3VRZA 3E87A 1QPCA 4MVFA 3MVLA 3DCVA 3LFAA 1M7NA 3JXWA 2EB3A 1LP4A 2PVJA 3ZFXA 4BTJA 3N51A 3BHHA 2CLQA 4FIGA 2QHNA 4I5PA 5F9EA 1Z9XA 4XV2A 5TF9A 4K6ZA 5CS6A 4QQ5A 2GPHA 3ODZX 3FBVA 3OXIA 4WG4A 1PXNA 4ZMFA 4QTAA 4TTHB 5JMSA 5LMBA 3F66A 5J1VA 5C8NA 3FZSA 3OBGA 4FKPA 4QP8A 3C4XA 4L53A 5D7AA 4C4HA 3CGOA 2YLFA 4PL5A 4FGRA 5C8KA 2Y9QA 2XIXA 3FQHA 3KULA 4YBKA 3EQRA 4JNWA 3QRJA 4RZWA 2OF2A 4BTFA 2XIZA 1H4LA 3D14A 3QA8A 4M0ZA 3ZRLA 3BZ3A 2EXMA 3KCKA 3BYOA 2X2LA 5IEYA 5CNOA 5CVFA 3DFAA 4C33A 1JWHA 1Q99A 4EQMA 1XH4A 3MA3A 2YN8A 1PYXA 4RIWA 5ANGA 3DZQA 2YAKA 3U9NA 4KIKB 3LQ5A 3EN9A 4ZLZA 1JSVA 1OECA 5GNKA 3KXZA 4ZJIA 1U5RA 2XNMA 3ZCLA 1J3HA 2YEXA 3FY0A 5BYYA 2W1ZA 4Y5QA 3BGPA 4XG6A 2YZAA 5HIEA 1H25A 3FMJA 4FL1A 5EFQA 2W5BA 3TN8A 4QD6A 2VD5A 4O83A 4C2WA 3EFWA 4R7IA 1MQBA 1CSNA 1ZLTA 4AT3A 4FSWA 3TTJA 4YZMA 1I09A 4EUUA 4BBEA 3FMHA 4QP9A 3QTRA 4TWOA 4CZTA 1F5QA 2CGUA 3KXMA 2C3IB 5AM7A 3RWPA 3NUNA 1YI6A 5AX9A 2R9SA 3FL4A 2V7AA 3MW1A 1ZYLA 4R8QA 4U5JA 3TT0A 2VTAA 4AA4A 4RFMA 5HICA 1PMUA 2OZAA 4OT5A 4UBAA 1OL1A 1K3AA 3H4JA 5K0KA 3I79A 5EI2A 3L8SA 2WQOA 3GOKA 4KRCA 3TL8A 1ZOHA 3PVUA 4J71A 3RNIA 3A61A 1PKGA 4FX3A 4EOJA 3KCFA 2BAJA 2YM3A 2W5AA 5I9YA 5CZHA 4U3ZA 5GJDA 2OLCA 3ROYA 2WEIA 3FLWA 4BKYA 2XM8A 3PA3A 3COKA 1PRYA 3V6RA 2VO0A 2QU6A 1PMVA 2X9EA 3DDPA 3EQHA 3DLZA 4EBVA 3PWDA 4IAFA 3VN9A 4U3YA 3FLZA 4TWCA 5H3QA 5KMLA 3LPBA 2X81A 4O6LA 3MIAA 2OGVA 4IX6A 2UW7A 5EM5A 2XBAA 5F1ZA 2HAKA 4JL9A 5CU2A 3R63A 2VNWA 2PZRA 1GIIA 3FHRA 2O8YA 4XX9A 1JNKA 4P4CA 1SM2A 2W05A 4XNEA 3A60A 3RALA 4FTRA 3VBQA 1R0EA 4U42A 5AIRA 4EH8A 2WZJA 3QD3A 4DT8A 4EH6A 2WXVA 5D7VA 1U5QA 3PE2A 4V04A 3DXNA 3S2PA 1QPJA 4E73A 4TWPA 4BHNA 4D9UA 2Z8CA 3SRVB 4FV9A 5IH6A 3V6SA 4AA0A 3HKOA 4W4YA 3VJOA 3AXWA 3NYVA 1H24A 3AD4A 3H0YA 5KBQA 1H1SA 5K5XA 3RCDA 4FKVA 4IWPA 4BI2A 1LUFA 4ZSEA 5IUGA 3PLAE 5BNJA 4NM0A 4B8MA 3E8DA 4II5A 2P2HA 2CKPA 5ANKA 4JBPA 3IGGA 2PUIA 1WVWA 3MPAA 3U9CA 4FNWA 2X6DA 2RF9A 2BTRA 3GFEA 5CXHA 1Q5KA 2JEDA 1M2RA 3K3JA 4X3JA 3UPZA 3RTPA 2Y6MA 4M69A 5HHWA 3QWKA 2HCKA 2OG8A 1Q41A 2WTIA 3BIZA 3AT3A 3P78A 3EIDA 3LVPA 4QNAA 3UZPA 3SOAA 2XK6A 4GW8A 4MQ2A 2Z7RA 4RJ4A 4BYIA 3VW8A 4LGGA 1XWSA 3QUPA 4BDBA 2QODA 3BYVA 2UZLA 1AQ1A 5J7BA 4JXFA 3O51A 5CT0A 3D83A 3QQGA 4ALVA 2PVHA 4CVAA 3FZOA 3KK9A 4Q2AA 1W98A 4FEXA 4MHAA 3PFQA 5GIOE 4E5AX 4JG6A 3GCVA 2WMQA 4GT5A 2UVXA 3U8WA 3IKAA 4MBLA 4X2FA 2XK7A 1PXMA 3OT8A 3CJFA 4MK0A 4GK3A 2W1FA 5BYZA 4EH4A 4FTOA 5E90A 4RJ5A 3I60A 4CXAA 4I0RA 4FOBA 4IB1A 4YHJA 5HIBA 4D1ZA 3THBA 3WF9A 4ANQA 2LGCA 3VS0A 4IADA 4OTGA 3MH2A 3HLLA 3UVPA 3MVMA 3HV4A 4V0GA 2OJJA 4FKGA 3U87A 4MH7A 2R3IA 5AV3A 3WF5A 3BLHA 4ACDA 4D2RA 4ZY5A 3ORZA 3TNWA 3PRIA 5D41A 5JH6A 2PZYA 2XRWA 3K54A 3KMMA 3BHVA 3LFFA 4ITIA 1YKRA 2A27A 3NGAA 3Q60A 5KZ0A 3OBJA 4J97A 4YJPA 4OBOA 4J53A 4GG7A 1M52A 2J6MA 3FC1X 3Q5IA 4U81A 3ACKA 4DTAA 3OEFX 2H96A 2C1AA 3TZMA 2R3QA 2XNEA 3RBWA 4YJVA 5CF5A 4EK5A 4NUSA 3JPVA 4F08A 5CI6A 1KE5A 3UIUA 2IPXA 2WFYA 3TNIA 5FDXA 5I9VA 2PU8A 4H58A 5JN2A 4ID7A 4O82A 3LLTA 2XMYA 2XF0A 3LM5A 4D2SA 5ETFA 3HMOA 4G3GA 3GCPA 5M4FA 4AZVA 1XH8A 3R7UA 4W4VA 3AT2A 1ZYSA 3Q9XA 4QRCA 4RVMA 5ETCA 5I3RA 2R3MA 3FWQA 4X7QA 4ANLA 4N57A 2A0CX 5LARA 2OJ9A 2GFSA 3LOKA 4I0TA 1NVRA 4HGSA 3S1HA 3ET7A 1GOLA 3E8CA 3DY7A 3S4QA 3T3UA 5TR6A 5AEPA 2RIOA 5E8XA 1R0PA 4BCHA 2J0LA 4FVPA 2F7ZE 3GVUA 4H39A 5IQDA 3DXQA 5C26A 3KB7A 3ENHA 3EKNA 3L9MA 5LVOA 4B7TA 3WARA 1ERKA 3GC9A 3Q2MA 5L2TA 3AMYA 3IW5A 4QTBA 3GGFA 4QOXA 1Z57A 4R1VA 4FV1A 2JKOA 4BGGA 1YWNA 2X8IA 5J1WA 1BL7A 2BUJA 2H6DA 2B53A 1YHSA 4A4XA 4ZLYA 1BYGA 2IW6A 5GIPE 1QCFA 2YIXA 4HGTA 3TEIA 2HIWA 1YXXA 4NM5A 4WNPA 3QZGA 4FBXA 3TIZA 5HNGA 4DT9A 3QZFA 4ZEGA 4I93A 4ANBA 2QG5A 2WMAA 3LFSA 4AZEA 2O64A 5IQBA 4L7SA 4FOCA 3A7FA 4M8TA 4BICA 4WNMA 1PJKA 2HZIA 4CCUA 4BDGA 3CTJA 2C3KA 4LYNA 3TIYA 5CU3A 3TNHA 3NUAA 4LRKA 1KE9A 2CJMA 3CD3A 4IAYA 2GCDA 4YJQA 2FSTX 4E6QA 5J5SA 4R6VA 1NVQA 4FEWA 4RT7A 3W16A 5B2MA 3FZTA 3LHJA 1JAMA 3CY3A 1SNXA 3EFLA 2QQ7A 1IRKA 4AE6A 5BVOA 2YWPA 1NXKA 2BIKB 4OTPA 2ZVAA 2UVYA 2Q83A 4YLJA 5KMJA 4G6NA 1H1WA 3F5UA 5HNIX 4RMZA 1R1WA 1M17A 2PVRA 3FMEA 4BDCA 4DH1A 5CF4A 3TM0A 2QLUA 4HCVA 1REJA 2G15A 2NP8A 3VQHA 4CMTA 3LMHA 3EMGA 5J5TA 1XQZA 4PTCA 5L6OA 3LMIA 4DGNA 4I5CA 3F3ZA 4XLVA 4E20A 3GC7A 4I20A 4C4EA 4Z16A 1WCCA 1RE8A 3QKMA 4XBUA 5JFVA 3HMMA 5TT7A 3L9LA 1UNGA 1OBDA 1VJYA 5BVDA 3O0GA 5LJJA 2B52A 5HE2A 2BKKA 1A06A 4IZ5A 3OXZA 3ELJA 3CY2A 4U40A 5AR4A 5HVJA 2UZBA 2PWLA 4F6UA 4FF8A 4RA5A 2BCJA 2I0HA 3NPCA 1Y6AA 4C58A 5J8IA 3W32A 3S00A 1Q61A 2UV2A 5A9UA 3POZA 5IA0A 4O7RA 4QPAA 5JRSA 2C47A 2DWBA 2J0JA 2W1IA 2CGVA 2WO6A 4YC3A 3OCGA 4JDJA 5C4KA 3LLAA 2RFEA 5HCZA 3UE4A 3DS6A 4A06A 4UN0C 2YWVA 2YDJA 4JG8A 3VS4A 1PXOA 2X7OA 4K33A 2OO8X 4L44A 1ZYDA 2JDSA 4O7WA 5EOLA 2O65A 2XCKA 3FKOA 4AZTA 5BVFA 4IWDA 3Q3BA 3SW7A 3PUPA 4WG5A 4S32A 2XP2A 2QOFA 2YCSA 3R01A 4FSNA 4FTNA 3WZKA 4IEBA 2WAJA 1W84A 1BI7A 4G5PA 2C6KA 3JR1A 4O27B 4DCAA 1Q8YA 4IVDA 3D9VA 1KWPA 3R21A 1T45A 1FMOE 1Q8ZA 1SVEA 3HDMA 3TUCA 2QO7A 2G9XA 3HA6A 1YHVA 1OUYA 1YQJA 1JVPP 2ACXA 2F57A 2X0GA 3UZRA 3HNGA 4AW1A 3QHRA 3P79A 2CN5A 3OG7A 1CKJA 1SYKA 2BDJA 3COMA 4NJ3A 5AR7A 4S30A 3CS9A 4U45A 4G34A 2FYSA 2X8EA 3GCUA 3TI1A 4B6LA 4WSYA 3DAKA 4DGMA 4CQGA 4P2KA 4B9DA 3ATSA 4UWCA 4CG9A 2Y4IB 5AP3A 5F20A 3FLQA 3FQSA 4RFYA 4AN9A 3CCNA 2P4IA 5LVPA 4ZTMA 3HECA 4DITA 2VX3A 5CSVA 3KEXA 3GENA 4JRNA 2HELA 1VYZA 3UNJA 2NRUA 4IC7A 5CEOA 5IDNA 3QCYA 1IEPA 3H3CA 2BDFA 3LFBA 4YUQA 4BTMA 3RPYA 2RKUA 2IVVA 2NRYA 3TCPA 3SQQA 5FG8A 5AUUA 4GVJA 5I5ZA 3RAHA 3ORMA 4IDVA 4ENYA 3LKMA 1BUHA 4N6ZA 1GY3A 5FP5A 2XKFA 4RIYA 2Q0BA 2UUEA 1ZYJA 3TJDA 4AG8A 3W1FA 2BAKA 4EHVA 4QPSA 1WBNA 2XNPA 4B0GA 3TZ9A 4X3FC 3VBVA 4IHPA 2BZJA 3Q32A 4O0VA 1OL7A 3LM0A 2WQBA 2JITA 4FIJA 1OKVA 3LFQA 4D4SA 3G6HA 2FGIA 4OUCA 5C9CA 3V8WA 5L8KA 2ZB1A 4L46A 2FA2A 3R83A 5FTOA 4EH9A 4H1JA 4ZTNA 4JS8A 3E62A 2WEVA 5FXQA 3WF7A 5HLWA 3KVXA 4DEGA 3F6XA 4WIHA 4XP0A 2YM7A 1H08A 2V55A 4BGQA 4DC2A 3FAAA 2BVAA 2VV9A 2R0UA 3R1NA 5KNJA 3TDWA 4QMTA 1PXKA 4TT7A 3AC3A 4IZ7A 5D11A 5CEQA 4TYHB 2WTWA 2FUMA 3HV6A 5IQEA 3FSFA 3RPSA 1R39A 2UW3A 4ZXTA 4FKRA 3M42A 3Q2JA 2W4OA 3NX8A 3T3VA 4JAIA 2WMXA 5FEQA 4FNZA 4K11A 3BRBA 2HZNA 2ETRA 2IJMA 4MWHA 4CZYB 4DA5A 2B54A 1SVHA 4O91A 4EWHA 3R04A 4LL5A 5FEDA 5AA9A 4HVIA 2ZV2A 3FI2A 4YR8A 3SA0A 3DB8A 4ZZOA 4IJPA 4AWIA 2VO3A 2IZUA 4ORKA 4YNOA 2B9JA 5GZ9A 4OGRA 2GHGA 4KIOA 5DYJA 5JT2A 3NIZA 1ZMVA 3PXFA 4BIDA 3EWHA 4XHKB 3FZ1A 4ASDA 4GCJA 1OIUA 4JBQA 3DQWA 3MFTA 5JRQA 2CGXA 3NW7A 4FT3A 3LJ1A 3RK9A 5EDPA 3UYTA 1Q3WA 4MYGA 5DT4A 3GU8A 5F4NA 3REPA 2WB8A 1GAGA 3CQUA 1URCA 3BI6A 3F7ZA 3RJCA 3V3VA 3TUDA 4IZYA 4G17A 4QQCA 4Y8DA 3DNDA 3PXQA 4LRJA 4F7JA 4G3EA 1UU9A 3ACJA 3UODA 1NT2A 4FZAB 4QNYA 2W4JA 1DM2A 2J50A 2OI4X 4MX9A 3SW4A 4C59A 4HCTA 5D10A 5ITAA 4YZ9A 1G3NA 4IX3A 1P14A 5DHJA 5AUXA 3QL8A 1W0XC 4AF3A 3ZONA 3QQLA 4N70A 2VGOA 3EL8A 3IOPA 4S34A 4UWYA 4X3FB 5DEWA 3S95A 4EHEA 2HXLA 2XK3A 1ZY5A 3LXPA 2BAQA 3G9LX 4ARKA 2G01A 4HPTE 4IB0A 1OKZA 2WIPA 5J87A 3VBYA 3GCQA 2I0EA 1LEWA 4GJ3A 5KCVA 2CCIA 3BCEA 3D2IA 2GNLA 2VTPA 4XV1A 4UZDA 4FTAA 4CD0A 3VUIA 1GJOA 4JR3A 4F0GA 2OXDA 3BPRA 4GYGA 2XK8A 4BCFA 4ZTSA 3RVGA 2JFMA 2RL5A 3KXGA 2VWWA 3PIZA 5HEZA 1PXPA 4BCMA 4A9SA 5CAUA 4EL9A 4CLJA 3NW5A 4MD8E 5B2KA 3LMGA 4EORA 3UO5A 5HE0A 2VNYA 4IX4A 2QKRA 4TYJA 3QQUA 4BBFA 1CMKE 2A4LA 2QC6A 4W8EA 1I44A 4ANNA 5M57A 2A2AA 5HG5A 4FTKA 4O0TA 4EOQA 2QOOA 2OFUA 3PSCA 4DG3E 5JQ8A 2O5KA 3O2MA 2BTSA 3R8LA 5E8TA 4EOLA 2J5EA 3KF4A 2E9VA 4IC8A 4LM5A 4LGHA 4YHFA 4YZCA 2VGPA 3BBWA 3D5UA 1J7UA 3MGYA 4EYJA 3HAVA 4MWIA 5L8JA 1A48A 3R28A 4A9RA 2IZRA 3V01A 4FL2A 3NIEA 2OJFE 2XKCA 1OPLA 2O2UA 3ULZA 4QQTA 2Y8OA 3F69A 1E1VA 4GJ2A 5CSHA 4YO4A 5CSPA 3NUUA 2XIKA 3FXXA 4EOKA 4PNKA 4ZTQA 3TG1A 4XG7A 2DUVA 4JVGA 3AC8A 4RLLA 3QD4A 1XKKA 4OTRA 5LCKA 2LAVA 4U9AA 3GU4A 5AUZA 3RHXA 3ZMMA 3R02A 2YDIA 4BKZA 1U46A 2XIRA 3PVWA 5HD7A 3SXRA 4KABA 3HEGA 4GUEA 4RX9A 3SVVA 4ZY6A 5HGIA 3MSSA 1GZ8A 3H0ZA 4RWKA 4EZ7A 2IVTA 3ZH8A 2BALA 2GDOA 4HYSA 3VS7A 3MFUA 2UZDA 4BGHA 3DBEA 2C4GA 3EL7A 4L8MA 1PMNA 4D1SA 1YDRE 3PE1A 4M66A 3QHWA 2W1DA 2PMIA 3QU0A 2PHKA 1M2QA 2QOBA 3AC4A 3H9FA 5CU0A 2BZIB 3K5UA 2FO0A 3FMMA 2HWPA 5KKRB 4X3FA 2W1HA 3P7AA 3VS6A 4CMOA 5HKMA 5M08A 2PUNA 3A62A 4PDSA 3VRYA 4DEDA 1OBGA 4AOIA 3KREA 4J95A 1JQHA 4FV2A 4F0IA 5B0XA 2F2CB 3QTSA 4L00A 4QP3A 3PJCA 3PA4A 5CALA 2R0IA 2I7QA 4O7LA 3G51A 3DU8A 5AP0A 4K2RA 4NCTC 4GFOA 5DBXA 4E4MA 3MH3A 1QPEA 3PJ8A 4FZ7A 4CFVA 4E4NA 3DK3A 3SXSA 3OZ6A 3JVSA 1ZXEA 2GNGA 3W2QA 4AUAA 1RQQA 4F4PA 5EQPA 4KIQA 2W4KA 5G1XA 3Q5ZA 5EG3A 4U8ZA 4PTGA 1YOJA 4FV4A 4BWXA 4QMUA 5AFVA 4FI1A 3ORPA 2WTKB 2ITTA 4QMNA 4BIBA 5HE1A 4I6FA 4BCQA 1KUTA 4FG8A 1HCLA 4M15A 4QQJA 5HO8A 4J52A 4IW0A 3WZDA 4EWQA 3QRKA 4MD7E 3UMWA 4IFCA 4MXZA 2YJSA 2VWZA 3RWQA 4C7TA 2BRHA 3BHUA 4I6BA 5IDPA 4ZP5A 5CF8A 1UNLA 3LXLA 2PZPA 4M0YA 4XG9A 2CNUA 3QGYA 3V5PA 1IR3A 5H9BA 2XNGA 1OL2A 4Y85A 4O21A 2GNFA 4FKUA 3FC2A 3ZXZA 4P5QA 2GTNA 2C5YA 4DFZE 3BEGA 2W1GA 3GFWA 3R8MA 4YZDA 4RWJA 5HORA 4DEBA 4ZTRA 4CZUA 4BKJA 2P0CA 2YABA 1ZARA 2GS7A 4PF4A 4RQKA 1SMHA 1M2PA 3QQHA 3VW6A 3G6GA 2O3PA 2C6EA 4YJSA 1JSTA 3F3WA 5I9UA 1IAHA 3DPKA 2B1PA 2YIRA 4U43A 4HYUA 4OW8A 1KOAA 2OIBA 2QOIA 4XOZA 3RPRA 4BFMA 1UU7A 1NA7A 1ZMUA 2GS6A 4L67A 3ZBFA 1NW1A 2DS1A 2GHMA 3EN7A 5CF6A 1H1PA 2F49A 5JGBA 5FP6A 3C7QA 4FIEA 4CT1A 3R71A 3R8UA 5LWMA 4KBCA 5TKDA 5M4IA 4FT7A 3CIKA 3TZ8A 4FTQA 4DFNA 4UX9A 3W8LA 2X1NA 4NIFA 3LFDA 2W99B 1OL6A 4IWOA 5DRDA 2DQ7X 3BKBA 4RSSA 4WO5A 4DLJA 2UW9A 2FB8A 5CSXA 4MAOA 3UNZA 5JGAA 5ACBC 4FKIA 2YM8A 3ZM9A 3QTIA 3ZRMA 4USFA 3FKLA 1H8FA 3EQDA 2PZIA 4G16A 1W8CA 5I0BA 5CAVA 5B7VA 3GXLA 4FKQA 2FH9A 5HLPA 5A46A 5IA4A 2RGPA 4JX3A 4TY1A 4C34A 4F0FA 4C02A 2R3KA 3NDMA 3O8PA 3U6JA 1B39A 3BV2A 2C5NA 4R77A 4DBXA 3PJ2A 1S9IA 1JBPE 2OZOA 5HCXA 3UG2A 2B0QA 4DFLA 2DYLA 3Q9YA 3C5UA 3SC1A 4CLIA 4FT5A 3ID6C 5AP1A 3W10A 2IVUA 5IEXA 3LZBA 5KZIA 1UVRA 4EH7A 5IPJA 1OL5A 4G31A 5FM3A 4AA5A 4PQNA 2OSCA 3NNVA 4ZIMA 5CEMA 4L45A 4I1ZA 3EQGA 4Y5HA 2VTLA 3CR0A 4FUYA 4G6OA 4FIFA 5IH5A 4FUXA 4UMPA 4RIXB 5EHOA 2RG5A 3KXHA 4EC8A 4MQ1A 1TQPA 1URWA 4NU1A 4X2NA 4DE4A 2EB2A 2G2IA 4O7YA 5CU4A 5ACKA 5A6NA 5L4QA 3D5VA 3WE8A 4DH8A 3FYJX 1VEBA 3P7CA 3BLRA 2C5VA 4HNIA 4FSYA 3QGWA 3NNXA 4HPUE 3PVBA 4IVBA 1P4FA 4FSMA 4ENXA 3NYXA 2JBPA 4FK6A 4NWMA 4DEHA 3R00A 3D15A 3ZTXA 3F3UA 2W1EA 2YIWA 1UKIA 2BKZA 3ZFYA 2G1TA 3WI6A 2VO6A 4K18A 1QPDA 4NM3A 5H8EA 1A9UA 4UZHA 4QYGA 4AACA 4RZVA 1YVJA 3DLSA 4A9TA 4YMJA 2PE0A 2QKWB 1KOBA 3DA6A 3QX2A 4I0SA 3A7HA 5FLFA 3N4UA 3W33A 3EFJA 2BFXA 4QMPA 5I9WA 3BX5A 2WTVA 3I7BA 3P08A 1OITA 4MXCA 4BDDA 4D0XA 4LV5A 4UXQA 4EQCA 4UV0A 1YW2A 4I23A 4G9CA 1OMWA 4M13A 2JDTA 5J9YA 5M4UA 3NW6A 4F99A 5KO1A 4HNFA 3PVGA 4IDTA 3ZLYA 4L3LA 3QCQA 3DBFA 1XJDA 3IW8A 3BGQA 3Q96A 5AA8A 4MF0A 2EXEA 5DPVA 4FT0A 3DOGA 4QTCA 4MXXA 4EOIA 2ITYA 3W2SA 4NCTA 3VAPA 3QLGA 2YAAA 2HY0A 3F2NA 4GKHA 4CRLA 5K4JA 2QOHA 3OUKA 3SOCA 3TXOA 4CFWA 1Q24A 3DZOA 3P9JA 3RI1A 2HOGA 5L6PA 3QX4A 4ZSGA 2PVYA 3HMPA 3LXKA 3POOA 4O6EA 5BVKA 4EUTA 2EVAA 2YJRA 3RZFA 4CFMA 3R9RA 2VTRA 3NWWA 4R7HA 4WKQA 4ZOGA 4BL1A 2IW9A 4LMNA 5CI7A 2PY3A 1FMKA 5FDPA 1XH6A 2C6LA 3E7VA 4KWPA 3ZDIA 4AGDA 2YM5A 3L8XA 2ONLC 3QTZA 3HA8A 3KN5A 3Q4TA 4OTHA 4E4LA 5IQIA 4XYFA 2VU3A 2W0JA 4NT4A 4QMZA 1XH9A 4LL0A 5IA1A 4C4GA 4EK3A 2BPMA 3R9DA 4YZBA 2X39A 2BZKB 3DK6A 5LQFA 4GIIA 4QYEA 1WAKA 4RFZA 3D7ZA 1MRVA 4NYEA 5HVYA 3VS2A 3KRWA 2AYPA 2C3LA 3OCSA 3ORXA 4YJNA 4KIKA 4QYFA 2ZYBA 3A8WA 3DKCA 4K8AA 4QMXA 4D2TA 3DKOA 3I5ZA 3JY9A 4ZS4A 5AWMA 1QMZA 4MD9E 3R7EA 4Y95A 3MV5A 4AW5A 1KE8A 5M55A 3PJ1A 5EHYA 4AN3A 4BCIA 1IA9A 5JFXA 3AD6A 5KBRA 5LVNA 5L2QA 4E3CA 3TV4A 4FV6A 2H9VA 4HW7A 3PJ3A 4FZ6A 3E7OA 3PPKA 3UP2A 2XBJA 3PIXA 4HYHA 2AUHA 1ZMWA 4J98A 2W1CA 3HUCA 3ZUUA 2WGJA 1DI8A 3PY3A 4B99A 5H8BA 4ITJA 2VZ6A 1P5EA 4KSQA 4GK2A 1TQIA 2IG7A 4LQMA 4NW5A 5JGDA 4JOAA 3RAWA 1OZ1A 5KMMA 4IAKA 1GNGA 3Q4UA 3Q9WA 1EH4A 1JKLA 3AT4A 5EYKA 2YCFA 5IQCA 3IDPA 2CGWA 2X6EA 3PG3A 3QFVA 4IVAA 4KUJA 2R3NA 4RIYB 3MA6A 5A4TA 4I5MA 4G6LA 3IW7A 1OB3A 2P55A 3GB2A 3BELA 4GEOA 3V5JA 4DGLC 2RFDA 4P7EA 3OWPA 3MYGA 1FGKA 4KIPA 5BVEA 3D5WA 3V5LA 2OWBA 3RP9A 4AT5A 5AP7A 5I9ZA 2C1BA 1O6YA 3EQCA 3CLYA 4DN5A 3HVCA 3PXRA 2WQEA 3BBTB 3C13A 4C57A 5HVKA 5DN3A 2I6LA 4K9YA 3TWJA 4UXLA 5DE2A 3JVRA 3SV0A 4AN2A 2FVDA 2VTHA 3NLBA 3OWKA 1L3RE 2CHLA 4WRSA 3QLFA 4EONA 2XUUA 3EZVA 4RLKA 5CENA 3QC9A 3UPXA 3ZSIA 1WBWA 4BDKA 3NS9A 3Q4CA 3R7YA 5JZNA 4XRLA 2IZTA 3KGAA 4IVCA 5BUJA 5H2UA 4X2GA 2WTDA 4F1TA 1WZYA 3U4WA 4D4VA 2J0KA 3RMFA 4HGLA 1O9UA 5BUEA 4L3PA 4F9WA 3GP0A 3I6WA 2R64A 4RJ8A 3HV3A 3OW3A 2PSQA 4FV7A 5KUPA 3BV3A 4GL9A 3FLNC 4KBAA 1CM8A 3S3IA 2ZMCA 1PF8A 1U54B 3BQCA 3F5XA 5IQHA 2QCSA 2Z2WA 4MTAA 3ALOA 5LMKC 3MVHA 3OOGA 4H3PA 4X2JA 3FXZA 4CNHA 4F6WA 1OUKA 5JQ5A 3QUDA 2V5QA 1XR1A 2W17A 5E92A 2YFXA 4R5YA 3F7WA 2WQMA 5EI6A 4IBMA 4AGWA 5FD2A 5HBEA 3V8TA 4F09A 3MJ1A 4O22A 4WUNA 3O8TA 4EZ3A 4FG7A 2C68A 1JOWB 4JIAA 4AX8A 5HU9A 4CTBA 4UMRA 3R7VA 2HENA 2IW8A 2WMRA 4XP3A 1ZOGA 4FSTA 1ZZ2A 2H8HA 2OBJA 4FVRA 3HYHA 3R7OA 4AGUA 4WD5A 4HVDA 3HGKA 4BF2A 3HRCA 5DR2A 3ZEWA 1H01A 2GHLA 4UEUA 3FMNA 2F9GA 3LIJA 1OGUA 3W18A 4O7TA 5HESA 2R5TA 4IXPA 3UDBA 3D4QA 4A4LA 2QOKA 4FK3A 2HXQA 2R3LA 3ALNA 4FYNA 4R3CA 2BRNA 4A9YA 5CEKA 3BYUA 3QTUA 4L6QA 4MBJA 5M4CA 3EQIA 3EKKA 3F88A 1XBCA 4LUDA 4MEDA 2X9FA 3KFAA 1YDTE 4RWLA 2A19B 3KRRA 4CKJA 3SXFA 2CKOA 5E9EA 3K3IA 4CYIA 2YIQA 3E93A 4YJUA 4ZJVA 4IQ6A 4EH3A 3CC6A 5IA2A 3PY0A 4TW9A 2W96B 4XV3A 3ZLWA 4BDIA 5AJQA 4GFMA 3GQIA 5EDQA 2WMUA 3RNYA 3SX9A 5T68A 3II5A 4RVKA 5AP4A 2E9PA 4EI4A 3EQPA 2VWYA 4RX7A 3RKBA 3UQFA 4O2ZA 2CSNA 3HUBA 5G6VA 5C03A 4DYMA 4DG2E 1OPKA 4EK4A 2BDWA 2Y4IC 3G0FA 4KNBA 4PNIA 3UGCA 3WYYA 3UZTA 3QTQA 5FGKA 2ITXA 1GZKA 4GYIA 3G9NA 3KC3A 2XB7A 2ZOQA 3DNEA 3LFCA 3E64A 1DS5A 2ONLA 2ITNA 2OU7A 3QKKA 3VBXA 3COIA 2R2PA 5GHVA 4YTCA 1GZOA 4PL3A 2X4FA 4EBWA 4N0SA 3B8RA 3GU5A 3ORKA 1UA2A 3NVMB 3HX4A 4EH2A 5JK3A 4FEUA 4EOMA 4NFNA 4YU2A 4UYNA 3ZU7A 3OTVA 5E1SA 3HAMA 3COHA 4H3QA 4AZWA 5DG5A 5IG1A 4G5JA 4RJ7A 4S31A 3HZTA 4W4XA 5ANJA 3BU6A 2OXXA 2VTOA 3UC3A 5DFPA 1P4OA 3ZO3A 4PMTA 4BCGA 4ZZNA 4NKSA 2J5FA 2YM6A 2Z7SA 2ZV9A 1FGIA 3MTLA 4CTCA 2PULA 3FJQE 2YISA 3WOWA 1YWVA 2VWVA 2WMWA 4YTHA 3PY1A 4ACCA 4ANSA 4F1OA 3F3TA 3A7IA 5LWNA 2PE1A 5A4EA 3FY2A 4PDPA 3LCOA 5DH3A 4M84A 3VUDA 3MJ2A 2YA9A 5I9XA 3AMBA 2GQRA 3NR9A 4Q5EA 4DH3A 4DLIA 3PP1A 4YBJA 2VTJA 4WHZA 4USDA 4AW0A 5ANIA 2ITZA 4DTKA 4ZSLA 2CLXA 3WIKA 4D4RA 2RSVA 3C4EA 3CKWA 3U4UA 2VN9A 4FIIA 3KKVA 3KQ7A 1AD5A 2XH5A 3PRFA 4NL0A 3ORIA 2UZOA 1Q97A 4LG4A 3UQGA 3FLYA 3AGLA 1UU8A 5TE0A 4EH5A 2QNJA 5CLPA 3CJGA 2JAVA 3LCDA 3ATTA 3FSKA 4KKGA 1JSUA 2WIHA 5M07A 3RK5A 2YCQA 5EYCA 4C35A 4RBLA 2C6DA 4FTCA 5AP5A 4IAIA 3F2RA 2BMCA 2JC6A 3QZHA 3LQ3A 5IQFA 3D7TB 2XA4A 3OVVA 2WD1A 2JKKA 1Q3DA 3R8PA 5AV0A 2QONA 3TV6A 1AGWA 2WOTA 2QOLA 4YTIA 3MDYA 3WBLA 3QKLA 3O71A 5AR5A 2J7TA 1XBAA 5EQYA 3PSBA 3W2OA 5HE3A 4BC6A 1APME 2NNWB 1M7QA 3R8ZA 4BDAA 5A14A 3UIMA 5HBJA 5E8YA 4L7FA 2ZB0A 4GK4A 4BRXA 5IISA 2PK9A 3R8VA 5AAFA 2ZM1A 3RAIA 5F94A 3WF8A 1G8AA 2JBOA 2WHBA 1J7LA 4BYJA 4AFJA 2UW4A 5K4IA 4EK6A 2XKDA 3JYAA 5DGZA 4QYYA 4PL4A 2R4BA 1XBBA 4FTMA 3UYSA 3FZRA 3C4ZA 3UTOA 4AGCA 1Y6BA 2ZAZA 4CGAA 3EN6A 1W7HA 1BI8A 3E8EA 3PLSA 5E7RA 5LMKA 3VUHA 3PP0A 3ORLA 1R78A 3SAYA 2R3OA 4HOKA 1MRYA 4OTWA 5EDRA 5A6OA 2GQGA 2XK9A 1UU3A 3DTWA 2F4JA 1Q8UA 3DTCA 3OD6X 4GU6A 3TKHA 4WRGA 2UW5A 3KULB 4IH8A 4R3RA 3V04A 5HLNA 2IVSA 5CZIA 3F5PA 4Z9LA 4BZNA 5IH4A 3DFCB 4G3DA 4LV8A 3IS5A 3QALE 4QMSA 4AS0A 3FPMA 5LMAA 4TL0A 3ZC6A 1GIJA 3IK3A 4KD1A 4AP7A 4JQ8A 3ZEPA 4QP7A 4Z3VA 4EKLA 4AE9A 3DKFA 2AC3A 5KMOA 1J91A 5AIKA 3U6HA 4AZFA 4E5WA 4RIWB 4QP4A 4UALA 4M12A 3PZHA 5DEYA 1ZAOA 3CPBA 3VF8A 4Z55A 4ACGA 4QTEA 4U80A 3ORTA 5CQUA 1V0OA 2C6MA 4RG0A 4F9BA 4F9YA 3KU2A 3OF0A 5DR9A 4DEIA 3EJ1A 3PXZA 3SGCA 5HCYA 4IMYA 4FGBA 4CQEA 1Y57A 4FG9A 4NH1A 2B9HA 3MESA 3ZXTA 4HYIA 3UBDA 1KE6A 5AV4A 3GEQA 3WZJA 1G8SA 3IQ7A 4O0XA 2JDRA 3RPVA 1OIQA 5L3AA 4D2VA 3DBQA 3K2LA 1U4DA 2OZAB 2WTJA 3IW4A 3R6XA 4P5ZA 3OW4A 5DVRA 3ROCA 4Y72A 3UNKA 2J4ZA 3VC4A 1JLUE 5EW9A 4O86A 4ANMA 5E8SA 4YGAA 3FI4A 4GV1A 2GU8A 4FSRA 4W4WA 5CXZA 5CVHA 2OIQA 3FHIA 2PPQA 4FKJA 4CFXA 3FXWA 2ZMDA 3O23A 4V01A 5LVMA 5E4HA 1GIHA 1TVOA 1UWJA 5AAGA 2VTNA 5J9LA 4MNFA 4KSPA 2BILB 1K9AA 3F5GA 3FUPA 3V51A 4O38A 3PA5A 1YXSA 3L9PA 3DK7A 3UOLA 1JKKA 3C0HA 3UVQA 5C1QB 3KRXA 5D12A 2VAGA 3KK8A 2J90A 2QHMA 3R73A 3PYYA 5EM6A 2PMNX 3GOPA 4QPMA 4X6RA 3TJCA 5BPYA 4PP7A 1UNHA 5C4LA 4JBVA 1RJBA 2E9OA 4HJOA 4KKHA 4D0WA 3LFNA 5FBOA 5M51A 3AC1A 4FV8A 1WFCA 3MH0A 4J8MA 3QRUA 3HRFA 1Z5MA 1CTPE 3PXYA 3KRJA 2HYYA 4EK8A 2EWAA 4CFUA 5C8MA 3I7CA 4DGGA 2OH0E 2WOUA 3GI3A 5HIDA 3OROA 5KKRC 3FLSA 4S2ZA 3OY3A 4B4LA 5FEEA 1K2PA 1DAYA 4WBBB 5A54A 1OKWA 5J95A 2IO6A 3HMIA 2Z7QA 2J0IA 4QMYA 3EN5A 1H1RA 2FSOX 3QTWA 3SLSA 2NPQA 3MY0A 4L52A 3KXNA 3VO3A 5AUYA 4HVSA 4C38A 3ZZEA 2Z60A 4I94A 3I81A 2OICA 3TUBA 3CEKA 5EH0A 5EKNA 3WIGA 3HMNA 3U55A 1BMKA 4KBKA 1DI9A 4JLCA 4OR5A 3H9OA 2BZHB 3DDQA 4FODA 3W8QA 1WBSA 3CTQA 4WNOA 3UC4A 5KMKA 3Q04A 5AUVA 1P2AA 5LVLA 2C30A 3PPZA 5IU2A 4A07A 4DEAA 2IN6A 4D28A 3QBNA 3G15A 3NUPA 2VWBA 4L68A 4FMQA 3GQLA 4LOQA 1ATPE 3IDBA 4M69B 4MF1A 4TYHA 1F0QA 5BMMA 3TZ7A 4BWPA 4CFFA 1J7IA 4EC9A 3B8QA 4EEVA 3NYOA 3QF9A 3WYXA 5EM7A 4J96A 2WTKC 1LR4A 3I0QA 4TXCA 4FVQA 3HDNA 2QO2A 3R7IA 4UMTA 1V1KA 4APCA 2REIA 4JT3A 4CT2A 3RZBA 2C6TA 3MPMA 4I6QA 5I3OA 1VYWA 2ERZE 4OTFA 4RVTA 5EHLA 3NCGA 3MS9A 3TNQB 4RX5A 3A7GA 5HD4A 4YC6A 4IM2A 4JDHA 4ALUA 4UMUA 2GMXA 4E26A 5J7HA 4MXYA 1H07A 4QMWA 5FTQA 3MB6A
chains in the Genus database with same CATH superfamily
2I0YA 1E1XA 1JKTA 2ZV7A 4L43A 1SNUA 4JIKA 4L42A 4RVLA 4ZSJA 5DT3A 3BYSA 4C4IA 2OH4A 2ESMA 2BR1A 3MTFA 4XV9A 2PVKA 2IWIA 4G9RA 1W83A 5E8VA 3W55A 3RK7A 3QRIA 2XEYA 5DNRA 4DF3A 4DBNA 3LFEA 3Q4ZA 3T9IA 2W9ZB 2VTQA 3UMXA 3VNTA 3RHKA 4LMUA 4OBPA 3NNUA 3VBTA 5CWZA 4BB4A 4F7LA 4V0GB 3VUGA 3CP9A 3ANRA 5A4CA 4CCBA 3ZUTA 5F95A 3I0OA 2EXCX 3U51A 2ETMA 3O7LD 4XMOA 1FVTA 3ZC5A 4ZZMA 3PZEA 3D0EA 3T9TA 5CANA 3C5IA 1H27A 4NEUA 1YI4A 3KL8A 2FSLX 4XJ0A 4U41A 3MB7A 5I4NA 1XHAA 1PW2A 4E4XA 1JKSA 5TOZA 3VHKA 2B9FA 3HV7A 5FXSA 3UQCA 3C4WA 3NUSA 5J9ZA 2VX1A 4OAVB 4BHZA 4OT6A 5A4LA 3P4KA 4JDIA 4WUAA 4O7SA 5AX3A 1KE7A 3AD5A 5T6KA 3M1SA 4RJ3A 4MXOA 3DV3A 3FEGA 3UVRA 4NSTA 2Y0AA 2C0IA 4YZNA 3BQRA 2OF4A 1BLXA 3R1QA 3CE3A 4AOTA 5DIAA 3DAEA 5EI8A 2Z7LA 4RC3A 3G0EA 4ZSAA 3NAYA 2PYWA 1CKIA 3FI8A 2YM4A 2OIDA 2YHVA 2C5OA 3C4CA 2ZJWA 2ITPA 5CAPA 4EZ5A 3TKUA 5CT7A 2JIVA 2VTTA 3D2KA 5ETAA 4EOOA 3MH1A 4WG3A 2R7IA 1BKXA 2XYUA 5ANOA 4HVHA 2SRCA 5ANDA 1TFFA 3PSDA 2GSFA 4D5HA 1YRPA 3QUEA 4HCUA 2Y7JA 5CTPA 2V7OA 5EM8A 3FPQA 3QYZA 1PKDA 1KV2A 4I3ZA 4GMYA 3CSVA 3GU7A 2BROA 2VX0A 4FR4A 2W9FB 1CDKA 3O96A 4QDVA 3DBCA 3GBZA 4M97A 3E92A 4CSVA 3HP5A 2UW0A 4BZOA 3VS1A 2J0MB 4FTIA 3UDZA 5M09A 4E93A 1YXVA 2JAMA 2R3PA 3EHAA 3OWLA 4PMMA 4PPCA 1W82A 5AADA 3NMUF 1IG1A 1T46A 3ZSHA 5K5NA 3C0IA 4GS6A 4IFGA 4K0YA 4BDFA 5BMSA 4DFYA 4OLIA 4G3CA 2RG6A 3MY1A 4F63A 1UV5A 4RC2A 3M2WA 2B55A 4UYAA 4XBRA 4C2VA 5LOHA 5EKOA 4FTLA 3AQVA 2ITUA 4V05A 4FTTA 4H36A 3C50A 2YZLA 3P23A 4QP1A 3ZOSA 4F6SA 4O84A 4DFXE 5C01A 1KSWA 4YPDA 1S9JA 3KMWA 4TZRA 5DI1A 1GZNA 3UP7A 3CXWA 4ASZA 5AR8A 3G33A 4P90A 1FBNA 1W2CA 2G2FA 2UVZA 1PXLA 2VO7A 2I0VA 3GCSA 4QMLA 4TNDA 4Y83A 5CX9A 3TACA 3VS3A 3LCSA 4TWNA 2HW6A 1OI9A 1XH5A 3F2AA 4R7BA 3PWYA 3ULIA 4J8NA 1ND4A 2QOQA 3P5KA 3LAUA 4MNEA 2HK5A 3ZO4A 5GINE 2GNJA 5FRIA 4YLLA 4YSJA 4FKSA 4EHGA 3MIYA 4LOOA 4UY9A 2JLDA 4FTUA 4WOVA 3R9HA 3W2RA 3R2BA 4PV0A 3FL5A 3TKIA 2UW8A 5GZ8A 3OHTA 4ACHA 4YURA 3PDTA 3B2TA 4Q9SA 2OJGA 3L1SA 3AMAA 4QO9A 4DFUA 2X4ZA 5CSWA 5E8ZA 4UWBA 1OKYA 3RAKA 5IMEA 4O7NA 4U7ZA 3OUNB 3IGOA 1YI3A 3FDNA 2QU5A 2J9MA 4I4EA 2QO9A 3Q52A 5L2SA 1G5SA 3MFSA 5BQ0A 3G90X 2UZUE 5CEPA 4K77A 5EW3A 3OOMA 4QTDA 3UOJA 5FM2A 5DOSA 2F7XE 1IA8A 2OFVA 1FVRA 2JKQA 4RIOA 4WA9A 5C27A 2PE2A 3V8SA 1YDSE 5KMIA 1H0WA 2W06A 4E6DA 3VIDA 2C3JA 3E5AA 4O0UA 3L8VA 3PIYA 2QI8A 3A4PA 4PMPA 2V0DA 4PUZA 4YNEA 3ZLSA 2CNQA 2PUPA 4O2PA 5CASA 3R22A 4FNYA 3D5XA 4K1BA 3HRBA 3OS3A 3IO7A 4KA3A 3Q6UA 5BVNA 3P86A 3KA0A 4JI9A 3UG1A 1H1QA 4D5KA 4FEVA 2R3FA 3ZM4A 3H10A 1B6CB 3SHEA 3ZUVA 2HZ0A 4QP6A 4BCKA 4D4YA 3NUYA 4C61A 1Q4LA 3GT8A 2XZSA 1YXUA 4H3BA 3V5WA 3LE6A 4NFMA 1YWRA 5AP6A 5TO8A 3P5JC 4XH6A 2QURA 4RA4A 4YJRA 5J79A 5IUHA 1OIRA 5HTCA 1PXJA 4F64A 3ETAA 3I5NA 2XCHA 2WKMA 4QMVA 3IPHA 5GJGA 1WMKA 3E8NA 5E8UA 4GH2A 4QYHA 2OK1A 4YLKA 3BGZA 4E8AA 4LRMA 4UMQA 4C62A 1H26A 2XKEA 5AV2A 4AXCA 2VUWA 3F9NA 4ZK5A 4OTIA 5CYIA 2UZNA 2BHEA 3OMVA 4A4OA 5L2IA 2XJ0A 3P0MA 4KINA 3ZSGA 4TYGA 4BCNA 4HVGA 2EUFB 1O6KA 3GC8A 3HL7A 4I41A 1Q8TA 1XO2B 4GUBA 1ZWSA 4AXAA 4N6YA 5GJFA 2C0OA 4GFGA 1FVVA 4B8LA 4FKOA 5CAQA 1R3CA 2XJ2A 1YOMA 2W7XA 4FE2A 1RW8A 1OM1A 3U54A 3L9NA 2WU6A 3ZZWA 4GSBA 1V0PA 4JAJA 4DHIB 5HX8A 5E91A 2JIUA 2QOCA 5EYMA 4CV9A 3V5QA 1YHWA 3VHEA 5AUWA 2C5XA 3I4BA 4FICA 5EOBA 1Y8GA 2A1AB 4ONAA 5CEIA 4D55A 3MN3A 4IE9A 3KY2A 4CEGA 3QD0A 2XEZA 3IDCA 5M44A 3C4FA 4PRJA 5EK7A 3BU5A 2R3HA 5D1JA 4ACMA 4C0TA 4X21A 5KMNA 2NYAA 1ZOEA 3LQ8A 4W9XA 4RJ6A 3W2CA 4IAZA 2YITA 4LI5A 3EYGA 3FKNA 5IUIA 3ZBXA 2PMLX 3DBDA 3Q53A 4DH5A 1STCE 3QRTA 5HX6A 3GUBA 3DXPA 4HZRA 3EFKA 5HO6A 3SDJA 4FT9A 2PVNA 4RQVA 2CNVA 4WBOA 4U97A 3ANQA 3MI9A 4H05A 3AOXA 4IM3A 2Z02A 2XNBA 5E1EA 3PFYA 4D58A 2FSMX 2XJ1A 3L8PA 4DDGA 4EJ7A 4IANA 3BWFA 4DAWA 3ENMA 4IJ9A 4IIRA 2O63A 4KKEA 4O1OA 2WPAA 4YPSA 1O6LA 1PXIA 2X2KA 3QZIA 5DT0A 4BTKA 3ORNA 4BN1A 5BYLA 3KMUA 4PY1A 2P33A 2QLQA 4QMQA 5AUTA 2VRXA 4MKCA 1REKA 2PMOX 5D9HA 2ZM4A 3VS5A 3KRLA 4RIXA 2PVFA 3QQJA 3NUXA 3U6IA 4NZWB 4CKIA 5AR3A 3SRVA 4GU9A 2E9UA 4XRJA 3C9WA 5IMXA 4O0RA 3ZFMA 2KULA 2ZDTA 3KVWA 4FTJA 1MQ4A 2WNTA 4ASEA 3MFRA 4X2KA 5IF1A 3F3VA 1HOWA 5ICPA 3R1SA 4AXDA 3A4OX 2WMTA 3QC4A 2BRBA 3TV7A 5JFSA 3R2YA 2R3JA 4BDHA 3JY0A 5HI2A 4RX8A 4HGEA 1LEZA 3WE4A 1FOTA 1U59A 3DAJA 4X6QC 4GT4A 4J1RA 5B2LA 4BWKA 5JKGA 1VZOA 2X0QA 4J7BA 4YJOA 3W2PA 2XYNA 4O1PA 3E63A 3A2CA 1IASA 5DMZA 2G2HA 2C0TA 3F82A 5T3QA 2ITVA 4EJNA 4JX7A 3DKGA 3KIOC 4RPVA 3LCKA 3FMKA 4PDOA 5E8WA 4JQ7A 2WQNA 2Y4PA 4Q5HA 5HZNA 3DB6A 4DEEA 4DINA 2YLEA 4MCVA 3QXOA 4I22A 4OAUC 2JKMA 3CD8A 4ERKA 4OTQA 3I1AA 5A4QA 5DRBA 2V62A 4ERWA 2X7GA 4M3QA 4RC4A 3KXXA 4DTBA 2J2IB 2HY81 2GTMA 3MVJA 1LPUA 3QQKA 4O0WA 3OCBA 4FC0A 3M11A 4FJVA 4F7NA 2JD5A 3OY1A 4XOYA 3GC0A 3VQUA 5DR6A 2E9NA 1ZYCA 2VWIA 3IONA 4M14A 4C3FA 2ZDUA 1OGYA 2CPKE 1J1BA 3OFMA 5KE0A 1WBVA 5M53A 2VTIA 4O0YA 3LXNA 3ML1A 4KS7A 3MPTA 3R1YA 5AR2A 3VUKA 1TQMA 2QD9A 2GS2A 4DFBA 3WZEA 3BHYA 3DGKA 4ZY4A 3EZRA 4EOPA 2ZM3A 2CCHA 2H34A 4Z7GA 4I24A 3DJ7A 2F7EE 2XVDA 3TNPC 4FSUA 3VUMA 2P3GX 3R7GA 3OEZA 3ZYAA 3TDVA 3ODYX 4U0IA 2BRMA 4R5SA 3WZUA 4KS8A 1ZZLA 4RRVA 4IZAA 3DT1A 3ZDUA 2ERKA 4RGJA 4C4JA 4F9CA 5JEBA 3NNWA 4C8BA 1RDQE 4ITHA 3VJNA 4ALWA 3FZPA 3ZS5A 2ITOA 4FZFB 3W0MA 4G1WA 3OXTA 2YIYA 5H8GA 3DJ6A 2R7BA 1OVEA 4GVAA 2I1MA 3G5DA 4CG8A 2E2BA 4F70A 2ZV8A 4AQCA 4WSQA 2HW7A 4BDEA 1WVYA 3MY5A 3OC1A 4PTEA 5KHXA 4O7VA 5M06A 3QQFA 3IOKA 4O0SA 5IEVA 3PXKA 3QCSA 2BIYA 1PY5A 3C51A 3UOKA 4TYIA 2F2UA 2WMSA 4OTDA 4DDIA 3Q6WA 1DAWA 1NY3A 4JG7A 1B38A 2JDVA 2QG7A 2NO3A 3OP5A 5IZFA 3LJ2A 4E6AA 1L8TA 2XNOA 4BCOA 3QXPA 4XG2A 4FL3A 3EQFA 3R9OA 3V5TA 3OCTA 4WNKA 4TYEA 5FWKK 4BIEA 3QYWA 4C3RA 4BVUA 5FXRA 3SD0A 4FYOA 5L6WL 1XH7A 4DHFA 4YTFA 3RM6A 4O4BB 1H00A 4XEYA 3UO4A 2UZTA 3VWAA 4AOJA 4IWQA 4JBOA 2JFLA 2JIIA 4XP2A 5A3XA 4IM0A 4Q9ZA 4I5HA 5CAOA 5M56A 3R30A 4TKSA 3CQWA 3BE9A 5CQWA 4ZS0A 5EW8A 2X8DA 4L01A 4M67A 2QR8A 2ITQA 4W9WA 2AC5A 3EOCA 3A8XA 4BI0A 4IAAA 5BVWA 5CY3A 5HG8A 3QD2B 4E7WA 3KN6A 3JUHA 4F65A 4DH7A 4L9IA 3I6UA 2W5HA 4M68A 4PPBA 4NW6A 3P7BA 3PUFC 4O4EA 1FINA 5JZJA 3FYKX 3ITZA 3NCZA 2UZWE 3F61A 1JPAA 3JS2A 1H0VA 3K5VA 2I40A 4IACA 2VWXA 4TNBA 4U6RA 2B7AA 3UOHA 2KTYA 3MWUA 4LFIA 4DGOA 2GFCA 5GZAA 3S0OA 3IECA 2VTSA 5K0XA 2PVLA 5KHWA 1PMEA 3O8UA 4O81A 3T8OA 3UJGA 4I21A 4PP9A 4BJJA 3LCTA 3RGFA 3EB0A 2OXYA 4DG0E 2HWOA 4C4FA 2IZSA 3D94A 4GG5A 1TKIA 4J99A 4EHZA 4EYMA 4BI1A 1E9HA 3ZHPC 4ZMEA 1Q8WA 1OPJA 1WBOA 1NVSA 4O96A 5HO7A 4F9AA 4FV3A 4IX5A 4NTSA 3FI3A 1U54A 4QP2A 4PMSA 3FQEA 4ASXA 4CRSA 4E5BA 4MBIA 4XS2A 3NAXA 3AG9A 3AC2A 4FKTA 3CPCA 4KRDA 5ETIA 5IA3A 3PPJA 5BUIA 1MRUA 4HZSA 4AW2A 5AAEA 4O7ZA 1BX6A 4ZJJA 4U44A 4Z7HA 4GRBA 2VTMA 4M7IA 3OWJA 2HZ4A 4LGDA 4UB7A 1KV1A 4XG4A 4OBQA 2WMBA 2B9IA 4R1YA 4FSZA 3WF6A 5L8LA 3C0GA 2XM9A 2B4SB 3B2WA 4ANOA 2BHHA 2XK4A 2V22A 2WMVA 4XCUA 1Y91A 1PYEA 5FUTA 4G3FA 3FE3A 4CYJA 3NVKI 4YSMA 4A7CA 2Q0NA 5EYDA 1SZMA 5JFWA 4IB3A 2CDZA 3BYMA 4IB5A 3N4VA 2WELA 3G2FA 3ERKA 3OT3A 4JJRA 1H28A 4A9UA 3LJ0A 4FV5A 1ZY4A 2PZ5A 4FEQA 1Q62A 2JGZA 2Y6OA 5DLSA 5FQDC 2CKQA 3RPOA 3NSZA 2ITWA 4LUEA 2CN8A 2OW3A 1CKPA 3H9RA 4FIHA 3CTHA 5JSMA 2CKEA 2YDKA 3NEWA 2PVMA 3BEAA 3GU6A 4Y73A 4I4FA 2VWUA 2JDOA 3EH9A 3RINA 4R78A 5DWRA 2X2MA 3KF7A 4GKIA 3HP2A 4BDJA 4NKAA 5AP2A 4PDYA 3EN4A 4FZDB 5CNNA 5AMNA 1VR2A 5IQGA 3E3BX 4E1ZA 3IG7A 4QT1A 4D1XA 2YACA 3HV5A 4CV8A 4E6CA 5KX8A 4BCJA 3CGFA 5EQEA 3UIXA 3PTGA 5IA5A 2QVSE 2BFYA 3VUTA 1WVXA 4FA2A 4ZAUA 5HU3A 2XAMA 3IW6A 3O17A 4NK9A 3ZO2A 4Y46A 3BE2A 5FTGA 1YOLA 3QTXA 4G2FA 5HTBA 4YC8A 3N4TA 4CMUA 4W8DA 4AAAA 4LOPA 5HOAA 3VBWA 3FV8A 4AFEA 2CMWA 4NIFB 4PX6A 3ZRKA 5HG9A 3UO6A 4BBMA 3TTIA 3SKCA 5AV1A 3UIBA 4XG8A 4YP8A 2GQSA 2C6OA 4FKWA 4QMOA 3ZLXA 5HBHA 4BZDA 3DQXA 4CKRA 2J51A 4JR7A 3EQBA 2XIYA 2WTCA 3NZ0A 4L3JA 3WILA 2UZVA 3N9XA 3NYNA 1Y8YA 4JRVA 3VF9A 4QMMA 4USEA 4I92A 5AM6A 2C6IA 1OIYA 3RCJA 5BX0A 4C3PA 2YCRA 1BL6A 4AZSA 2ETKA 4DCEA 4XG3A 2P2IA 4C37A 4RWIA 1M14A 2PTKA 1J1CA 4TN6A 5HQ0A 2RFSA 3FMLA 4NTTA 5LXMA 3MBLA 4JDKA 5CU6A 4KB8A 4O4DA 1UKHA 3C1XA 1YXTA 1MUOA 2XNNA 3E3PA 4XUFA 5IKWA 2UW6A 3QCXA 2GNIA 5DA3A 3ZO1A 4JQEA 3E88A 5HNBA 3O7LB 3R9NA 4EKKA 4ZTHA 3GNIB 2X7FA 2IF8A 3NRMA 1WBTA 1HCKA 3QAME 4BY9E 4PPAA 2PL0A 1WBPA 2R3RA 4YJTA 4C36A 5HTIA 3OTUA 3CKXA 4BR3A 3H30A 3VULA 4TRLA 4EQUA 2OKRA 3R0TA 4D9TA 3FMDA 3BLQA 4H1MA 3QWJA 4FNXA 4FV0A 4ZTLA 4AT4A 4CFNA 3BWJA 5HG7A 2O0UA 4NM7A 3Q9ZA 4GIHA 3SG9A 4N4SA 3BHTA 3AC5A 2C69A 1ZRZA 4MXAA 3P1AA 3RM7A 2XRUA 4F1MA 2PUUA 4MNEB 1QL6A 2WU7A 2OJIA 4FKLA 2YERA 3CBLA 4F7SA 4FSQA 4X0MA 3SG8A 2EU9A 5K9IA 4U79A 5CVGA 1V0BA 3EYHA 2XS0A 4EOSA 2UZEA 5ANEA 3QA0A 2QR7A 2R3GA 2GNHA 4R3PA 3BU3A 5L2WA 3A99A 1UWHA 4TPTA 3D7TA 3LW0A 4YHTA 5K3YA 3VVHA 4YO6A 1X8BA 4GT3A 1ST4A 1FPUA 4I6HA 1F3MC 1IAJA 1PHKA 3PG1A 3A7JA 3CQEA 4KAOA 1MP8A 3O50A 4WT6A 3O5AA 3AGMA 4NJDA 4PWNA 5FBNC 4LDTA 2BRGA 4S33A 4XLIA 4AU8A 4APPA 4D2WA 4ZLOA 3DJ5A 1FQ1B 5LCJA 1SVGA 2RFNA 4QDEA 4BCPA 3VRZA 3E87A 1QPCA 4MVFA 3MVLA 4AQKA 3DCVA 3LFAA 1M7NA 3JXWA 2EB3A 1LP4A 2PVJA 3ZFXA 4BTJA 3N51A 3BHHA 2CLQA 4FIGA 2QHNA 4I5PA 5F9EA 1Z9XA 4XV2A 5TF9A 4K6ZA 5CS6A 4QQ5A 2GPHA 3ODZX 3FBVA 3OXIA 4WG4A 1PXNA 4ZMFA 4QTAA 4TTHB 5JMSA 5LMBA 3F66A 5J1VA 5C8NA 3FZSA 3OBGA 4FKPA 4QP8A 3C4XA 4L53A 5D7AA 4C4HA 3CGOA 2YLFA 4PL5A 4FGRA 5C8KA 2Y9QA 2XIXA 3FQHA 3KULA 4YBKA 3EQRA 4JNWA 3QRJA 4RZWA 2OF2A 4BTFA 2XIZA 1H4LA 3D14A 3QA8A 4M0ZA 3ZRLA 3BZ3A 2EXMA 3KCKA 3BYOA 2X2LA 5IEYA 5CNOA 5CVFA 3DFAA 4C33A 1JWHA 1Q99A 4EQMA 1XH4A 3MA3A 2YN8A 1PYXA 4RIWA 5ANGA 3DZQA 2YAKA 3U9NA 4KIKB 3LQ5A 3EN9A 4ZLZA 1JSVA 1OECA 5GNKA 3KXZA 4ZJIA 1U5RA 2XNMA 3ZCLA 2XARA 1J3HA 2YEXA 3FY0A 5BYYA 2W1ZA 4Y5QA 3BGPA 4XG6A 2YZAA 5HIEA 1H25A 3FMJA 4FL1A 5EFQA 2W5BA 3TN8A 4QD6A 2VD5A 4O83A 4C2WA 3EFWA 4R7IA 1MQBA 1CSNA 1ZLTA 4AT3A 4FSWA 3TTJA 4YZMA 1I09A 4EUUA 4BBEA 3FMHA 4QP9A 3QTRA 4TWOA 4CZTA 1F5QA 2CGUA 3KXMA 2C3IB 5AM7A 3RWPA 3NUNA 1YI6A 5AX9A 2R9SA 3FL4A 2V7AA 3MW1A 1ZYLA 4R8QA 4U5JA 3TT0A 2VTAA 4AA4A 4RFMA 5HICA 1PMUA 2OZAA 4OT5A 4UBAA 1OL1A 1K3AA 3H4JA 5K0KA 3I79A 5EI2A 3L8SA 2WQOA 3GOKA 4KRCA 3TL8A 1ZOHA 3PVUA 4J71A 3RNIA 3A61A 1PKGA 4FX3A 4EOJA 3KCFA 2BAJA 2YM3A 2W5AA 5I9YA 5CZHA 3NFFB 4U3ZA 5GJDA 2OLCA 3ROYA 2WEIA 3FLWA 4BKYA 2XM8A 3PA3A 3COKA 1PRYA 3V6RA 2VO0A 2QU6A 1PMVA 2X9EA 3DDPA 3EQHA 3DLZA 4EBVA 3PWDA 3W0NA 4IAFA 3VN9A 4U3YA 4D2PA 3FLZA 4TWCA 5H3QA 5KMLA 3LPBA 2X81A 4O6LA 3MIAA 2OGVA 4IX6A 2UW7A 5EM5A 2XBAA 5F1ZA 2HAKA 4JL9A 5CU2A 3R63A 2VNWA 2PZRA 1GIIA 3FHRA 2O8YA 4XX9A 1JNKA 4P4CA 1SM2A 2W05A 4XNEA 3A60A 3RALA 4FTRA 3VBQA 1R0EA 4U42A 5AIRA 4EH8A 2WZJA 3QD3A 4DT8A 4EH6A 2WXVA 5D7VA 1U5QA 3PE2A 4V04A 3DXNA 3S2PA 1QPJA 4E73A 4TWPA 4BHNA 4D9UA 2Z8CA 3SRVB 4FV9A 5IH6A 3V6SA 4AA0A 3HKOA 4W4YA 3VJOA 3AXWA 3NYVA 1H24A 3AD4A 3H0YA 5KBQA 1H1SA 5K5XA 3RCDA 4FKVA 4IWPA 4BI2A 1LUFA 4ZSEA 5IUGA 3PLAE 5BNJA 4NM0A 4B8MA 3E8DA 4II5A 2P2HA 2CKPA 5ANKA 4JBPA 3IGGA 2PUIA 1WVWA 3MPAA 3U9CA 4FNWA 2X6DA 2RF9A 2BTRA 3GFEA 5CXHA 1Q5KA 2JEDA 3AKKA 1M2RA 3K3JA 4X3JA 3UPZA 3RTPA 2Y6MA 4M69A 5HHWA 3QWKA 2HCKA 2OG8A 1Q41A 2WTIA 3BIZA 3AT3A 3P78A 3EIDA 3LVPA 4QNAA 3UZPA 3SOAA 2XK6A 4GW8A 4MQ2A 2Z7RA 4RJ4A 4BYIA 3VW8A 4LGGA 1XWSA 3QUPA 4BDBA 2QODA 3BYVA 2UZLA 1AQ1A 5J7BA 4JXFA 3O51A 5CT0A 3D83A 3QQGA 4ALVA 2PVHA 4CVAA 3FZOA 3KK9A 4Q2AA 1W98A 4FEXA 4MHAA 3PFQA 5GIOE 4E5AX 4JG6A 3GCVA 2WMQA 4GT5A 2UVXA 3U8WA 3IKAA 4MBLA 4X2FA 2XK7A 3UDTA 1PXMA 3OT8A 3CJFA 4MK0A 4GK3A 2W1FA 5BYZA 4EH4A 4FTOA 5E90A 4RJ5A 3I60A 4CXAA 4I0RA 4FOBA 4IB1A 4YHJA 5HIBA 4D1ZA 3THBA 3WF9A 4ANQA 2LGCA 3VS0A 4IADA 4OTGA 3MH2A 3HLLA 3UVPA 3MVMA 3HV4A 4V0GA 2OJJA 4FKGA 3U87A 2XAOA 4MH7A 2R3IA 5AV3A 3WF5A 3BLHA 4ACDA 4D2RA 4ZY5A 3ORZA 3TNWA 2AQXA 3PRIA 5D41A 5JH6A 2PZYA 2XRWA 3K54A 3KMMA 3BHVA 3LFFA 4ITIA 1YKRA 2A27A 3NGAA 3Q60A 5KZ0A 3OBJA 4J97A 4YJPA 4OBOA 4J53A 4GG7A 1M52A 2J6MA 3FC1X 3Q5IA 4U81A 3ACKA 4DTAA 3OEFX 2H96A 2C1AA 3TZMA 2R3QA 2XNEA 3RBWA 4YJVA 5CF5A 4EK5A 4NUSA 3JPVA 4F08A 5CI6A 1KE5A 3UIUA 2IPXA 3TYKA 2WFYA 3TNIA 5FDXA 5I9VA 2PU8A 4H58A 5JN2A 4ID7A 4O82A 3LLTA 2XMYA 2XF0A 3LM5A 4D2SA 5ETFA 3HMOA 4G3GA 3GCPA 5M4FA 4AZVA 2AEGA 1XH8A 3R7UA 4W4VA 3AT2A 1ZYSA 2ZFYA 3Q9XA 4QRCA 4RVMA 5ETCA 5I3RA 2R3MA 3FWQA 4X7QA 4ANLA 4N57A 2A0CX 5LARA 2OJ9A 2GFSA 3LOKA 4I0TA 1NVRA 4HGSA 3S1HA 3ET7A 1GOLA 3E8CA 3DY7A 3S4QA 3T3UA 5TR6A 5AEPA 2RIOA 5E8XA 1R0PA 4BCHA 2J0LA 4FVPA 2F7ZE 3GVUA 4H39A 5IQDA 3DXQA 5C26A 3KB7A 3ENHA 3EKNA 3L9MA 5LVOA 4B7TA 3WARA 1ERKA 3GC9A 3Q2MA 5L2TA 3AMYA 3IW5A 4QTBA 3GGFA 4QOXA 1Z57A 4R1VA 4FV1A 2JKOA 4BGGA 1YWNA 2X8IA 5J1WA 1BL7A 2BUJA 2H6DA 2B53A 1YHSA 4A4XA 4ZLYA 1BYGA 2IW6A 5GIPE 1QCFA 2YIXA 4HGTA 3TEIA 2HIWA 1YXXA 4NM5A 2XALA 4WNPA 3QZGA 4FBXA 3TIZA 5HNGA 4DT9A 3QZFA 4ZEGA 4I93A 4ANBA 2QG5A 2WMAA 3LFSA 4AZEA 2O64A 5IQBA 4L7SA 4FOCA 3A7FA 4M8TA 4BICA 4WNMA 1PJKA 2HZIA 4CCUA 4BDGA 3CTJA 2C3KA 4LYNA 3TIYA 5CU3A 3TNHA 3NUAA 4LRKA 1KE9A 2CJMA 3CD3A 4IAYA 2GCDA 4YJQA 2FSTX 4E6QA 5J5SA 4R6VA 1NVQA 4FEWA 4RT7A 3W16A 5B2MA 3FZTA 3LHJA 1JAMA 3CY3A 1SNXA 3EFLA 4AAYA 2QQ7A 1IRKA 4AE6A 5BVOA 2YWPA 1NXKA 2BIKB 4OTPA 2ZVAA 2UVYA 2Q83A 4YLJA 5KMJA 4G6NA 1H1WA 3F5UA 5HNIX 4RMZA 1R1WA 1M17A 2PVRA 3FMEA 4BDCA 4DH1A 5CF4A 3TM0A 2QLUA 1TZDA 4HCVA 1REJA 2G15A 2NP8A 3VQHA 4CMTA 3LMHA 3EMGA 5J5TA 3AKJA 1XQZA 4PTCA 5L6OA 3LMIA 4DGNA 4I5CA 3F3ZA 4XLVA 4E20A 2A98A 3GC7A 4I20A 4C4EA 4Z16A 1WCCA 1RE8A 3QKMA 4XBUA 5JFVA 3HMMA 5TT7A 3L9LA 1UNGA 1OBDA 1VJYA 5BVDA 3O0GA 5LJJA 2B52A 5HE2A 2BKKA 1A06A 4IZ5A 3OXZA 3ELJA 3CY2A 4U40A 5AR4A 5HVJA 2UZBA 2PWLA 4F6UA 4FF8A 4RA5A 2BCJA 2I0HA 3NPCA 1Y6AA 4C58A 5J8IA 3W32A 3S00A 1Q61A 2UV2A 5A9UA 3POZA 5IA0A 4O7RA 4QPAA 5JRSA 2C47A 2DWBA 2J0JA 2W1IA 2CGVA 2WO6A