2R7BA

Crystal structure of the phosphoinositide-dependent kinase-1 (pdk-1)catalytic domain bound to a dibenzonaphthyridine inhibitor
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
285
structure length
274
Chain Sequence
RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoinositide-dependent protein kinase 1
publication title Discovery of Dibenzo[c,f][2,7]naphthyridines as Potent and Selective 3-Phosphoinositide-Dependent Kinase-1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
total genus 82
structure length 274
sequence length 285
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2r7bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2r7bA01
1L8TA 2WU7A 4QTEA 3UDBA 4BYIA 3N4TA 2XUUA 2UVZA 5E92A 2I40A 4C34A 4EK8A 5FXQA 1XBAA 2B54A 4RFMA 5JFVA 2R3OA 1WBNA 4A9TA 1YWVA 4JJRA 4PMSA 3R1YA 4V0GB 4K6ZA 2PY3A 2VTLA 4FUXA 4YPSA 3R8UA 4MXXA 1IRKA 4A9SA 3I7CA 5IMEA 2B7AA 3FZOA 2W4KA 3MIAA 4G16A 4CTBA 3A99A 4UMTA 3ZC6A 1Q4LA 3FI8A 3E62A 4DG2E 3CS9A 2GTMA 3N9XA 2QHMA 5AP4A 3QLGA 5E1EA 3GQIA 4CQGA 3QRJA 1QMZA 3OOMA 2VWBA 2PUIA 2REIA 4F1MA 1UA2A 3NX8A 1KOAA 3DS6A 4UALA 5CAOA 2QVSE 2F7XE 4HGTA 3W16A 4GIHA 4FGRA 2RG6A 3GCVA 1KV2A 1R0PA 3BYSA 5I9YA 4LYNA 3ERKA 4OTPA 4EQCA 2IZSA 3OVVA 3UYTA 5J1VA 2ZV8A 3F61A 3PVUA 1R3CA 2H34A 3D94A 3QYZA 5CX9A 5EYMA 5I9WA 1TQMA 4FNXA 4RX5A 5CY3A 2Y6MA 4MWHA 2BPMA 3G33A 1BKXA 1CTPE 4AZSA 1OL6A 2ETKA 5H8EA 2XCKA 5EHLA 2PVNA 1KE6A 3O8TA 4DA5A 4MHAA 4V01A 3P4KA 3NIZA 2F9GA 4DC2A 1URCA 3ELJA 4XS2A 1OIRA 4IM0A 3QQHA 4G6LA 3GP0A 4FR4A 1UU8A 2VWYA 2G2FA 2W05A 5HU3A 3LQ3A 1M7QA 2V7AA 4C4GA 3VQUA 3KQ7A 4OW8A 5T68A 3PG1A 4HGEA 1J3HA 4GIIA 4X2NA 3TNQB 1Q99A 5LMKC 3DKFA 3HMNA 3NUSA 5IH6A 3S00A 3C5IA 3NAXA 5JEBA 4LOPA 4NCTC 3AT3A 1Y8YA 3D0EA 2BZJA 4DFXE 3LM5A 4QYHA 3QZIA 4YJQA 2V7OA 3M11A 5CU2A 5ANKA 3T3VA 1H01A 1IG1A 3HX4A 4JG7A 3AXWA 3QUDA 5LOHA 4UZDA 3EQIA 4FOCA 2CKEA 3F5GA 4QTDA 5IEXA 3QTWA 2ZAZA 2R7IA 3QC4A 3ZLXA 1VZOA 2PUPA 3UOHA 4NEUA 5FEEA 4ASZA 3ETAA 4HVGA 4XG6A 5EW8A 3TZMA 2JLDA 3WZDA 2Y6OA 3QTRA 4C7TA 2CLQA 3NCGA 1YDRE 2CHLA 3FMKA 4NYEA 2BILB 2WQBA 3GCUA 4MNEA 3V8TA 2DUVA 2C1BA 5JGAA 3GFEA 4K77A 3KCFA 5BUEA 5KNJA 5AIRA 2WXVA 2W06A 3P0MA 4I4EA 4ALWA 2W1FA 4FT3A 3E3PA 3F2NA 3ORPA 2O3PA 5IH4A 5LQFA 3I0QA 5HU9A 4E93A 3B8RA 3ORLA 4M69B 4O6EA 5JRSA 3ITZA 1OL2A 3P7BA 2R3RA 3VBQA 4ANNA 4D2TA 3NLBA 3PLAE 4I0SA 5EK7A 4DE4A 3AMAA 3U6HA 3EIDA 2X6EA 4EZ3A 2XNNA 3EL8A 1JVPP 3RK7A 4CFFA 4WBBB 5L3AA 5C1QB 3VRZA 1ZRZA 3KA0A 4O1OA 4FSTA 5D11A 1TQPA 3ZHPC 4DGLC 5JN2A 3C7QA 5H2UA 5I9ZA 3R9DA 4IANA 4K18A 4PF4A 3FSFA 2ZM3A 5HCZA 5IDNA 5A4EA 2QC6A 4BC6A 4H3PA 3K5UA 3LFBA 4ZLZA 4JRNA 3ZO3A 3WF8A 2YABA 2ITZA 4I6FA 3EQRA 3DAJA 4XP0A 3VJNA 1MQ4A 4YZMA 4E4NA 4CD0A 3FHRA 3HRFA 2VTHA 5HX6A 5LCKA 3UZRA 4XOYA 3EKNA 3ZU7A 5J7BA 2F2CB 2PU8A 3DNEA 4DGNA 3BLHA 3KF7A 3DBFA 4ZTNA 4FIIA 3ALNA 4DITA 4O0YA 1P5EA 4XEYA 1VYZA 5EI6A 2H96A 2KTYA 1PYEA 4YSJA 2HOGA 3DDPA 4B0GA 1FPUA 3MFTA 4F9CA 3LFCA 3IW8A 3BQRA 3P7CA 2JDRA 4BCIA 2QLQA 2V0DA 1M2PA 2RFDA 3O50A 4KNBA 4O7WA 3COHA 4DFUA 1H07A 2OIQA 4AN2A 2YWPA 1S9JA 5GZ8A 4EQUA 5CALA 2EVAA 4I92A 5M09A 3OCSA 4F9YA 1XH5A 2IVSA 3Q2JA 4FZ6A 4TWOA 4AUAA 1UU3A 2G15A 4FICA 4FGBA 2WTJA 3A7HA 3QX4A 2BTRA 4DGOA 2GNHA 3F5PA 4ONAA 1TKIA 2PZRA 1M17A 2WMQA 3V5LA 2J5EA 3HMPA 4OT6A 4WG5A 1JPAA 5L2SA 1W83A 4DTAA 4LOOA 4H1MA 5J8IA 5CTPA 4AQCA 4M8TA 4IWPA 1Y6BA 3DB8A 3NUAA 2XVDA 2NO3A 5C01A 5AAEA 2BRBA 5AR7A 5AR5A 3UVPA 3QQLA 4M97A 4AZVA 3ET7A 3NUUA 4C37A 2J50A 3UBDA 3W33A 4O2ZA 5CYIA 4ZTHA 3JPVA 4YJSA 5CU3A 4GFOA 1Q41A 4ZSJA 5KMKA 3TUCA 3A8WA 4A9UA 4C4EA 3AC4A 1PF8A 4FTTA 5AUXA 5GZ9A 3UNZA 3ODZX 3LM0A 2OJJA 5KKRC 5J9LA 3LXKA 5AX3A 4U97A 3SV0A 4EOIA 4PL4A 2UW0A 3LZBA 3EL7A 4HYIA 3PJ3A 1NVQA 3SOCA 4BCMA 1ZARA 3A7FA 1UKIA 3PRFA 4UX9A 3LIJA 3MPMA 4OTQA 5KUPA 3R9NA 4IH8A 3CJGA 3UPXA 4RIXB 3FLSA 4UMQA 2Q83A 3REPA 4DEAA 4QPAA 3KRJA 4XYFA 4RVTA 4BDBA 3UVRA 3CTJA 3H3CA 3PXZA 4AN3A 4BWXA 3AD6A 4ARKA 3JUHA 3PJ8A 5IA2A 1KE9A 3R8VA 4J99A 1H1WA 4NWMA 4U81A 4BBEA 3T3UA 2BRHA 2ZV7A 4QP3A 3PG3A 5LJJA 3D5UA 4H36A 1M52A 3I79A 2GS7A 3DZOA 3ORTA 4JX3A 5DA3A 5IPJA 1V0BA 5JQ8A 3HAVA 2W9ZB 5EQYA 2VWWA 4EZ5A 1H1PA 3D5XA 3IKAA 5AP6A 4TTHB 1O6YA 3M2WA 2PL0A 3QQGA 2UZDA 2VAGA 1H1RA 2W9FB 4KIOA 5FBOA 1Q8TA 2C3KA 4AGWA 3OT8A 3F2AA 2VTSA 3E8DA 3QLFA 2Y8OA 1CDKA 3PXRA 3PYYA 5F9EA 4OTHA 4XG2A 4YP8A 5EQEA 4FC0A 5K4IA 4W4VA 2VGOA 1QL6A 3QZGA 3VS4A 4EUUA 2QO2A 4YC6A 3TUBA 3PLSA 1H1SA 2HK5A 4FSQA 5E8WA 4R5SA 5J79A 5FXSA 4FUYA 5CF6A 2P33A 1GZ8A 1QPJA 4ID7A 1PMEA 4MBIA 3QL8A 4C02A 1GOLA 2ZM4A 2XNEA 3SW7A 3IPHA 4FV0A 4MWIA 3SRVA 4U3ZA 5AP3A 4UXLA 1NVRA 2I0EA 4BBMA 4UMUA 4KIKB 4QQJA 5LWMA 2EU9A 2IVTA 5DRBA 3AQVA 2WU6A 5EFQA 5CEPA 3ZO4A 2VV9A 4ACDA 5CZHA 2CNUA 4IB1A 4DLIA 5I3OA 3R8PA 3HUBA 3GU4A 1AQ1A 4YTIA 2RFNA 4KRDA 3I6UA 3KXXA 1CSNA 4RPVA 4U79A 1GIJA 4YJUA 4USDA 4PP7A 4WUNA 4Z7HA 3DJ7A 3R1QA 4IAZA 5IZFA 3L8XA 3PA4A 2CLXA 2GNJA 4CZUA 3UPZA 3K5VA 3CKWA 2JIVA 4UYNA 4UN0C 4ZIMA 3R28A 4L52A 4JI9A 5BVKA 1Q24A 3W2QA 5E9EA 1JQHA 5LCJA 5CVHA 2CNQA 4TYEA 3PA5A 5TE0A 4AW5A 4E1ZA 3A61A 3EHAA 4Q9SA 1O9UA 4J52A 2VTPA 1P2AA 5EKOA 2UZVA 1PJKA 3OW4A 4N6YA 4X2FA 2CKQA 3SXRA 4WRGA 3CTHA 4AGUA 4QQTA 2B9HA 2QOOA 3C0HA 2OGVA 2J5FA 2Z7QA 3ENMA 3F3TA 3QFVA 4RIYA 4ZEGA 5A4LA 1OL7A 4R7HA 2XKEA 4KIQA 4LV8A 3PPZA 3PVGA 2F57A 2WKMA 2YHVA 2OBJA 4WHZA 5DOSA 3UO4A 1H28A 3QX2A 3E87A 3ROYA 4EK3A 1Q5KA 3RMFA 2JDSA 3QRUA 2CDZA 5C8NA 5KO1A 2YDKA 4MNFA 3LJ2A 3MPTA 3O96A 1T45A 5J5TA 1F0QA 3GC7A 2OK1A 3ROCA 3PVWA 3QQUA 3FMNA 2JIUA 2YA9A 3VS0A 2IWIA 3TKHA 3FC1X 3ZSHA 2QONA 4FT0A 1UNHA 4M66A 5DN3A 4CVAA 4OBOA 4O7ZA 3Q5ZA 2B9JA 1DM2A 4YBKA 4AOJA 3LXNA 3Q53A 3NNUA 1YOMA 5FP6A 4WNOA 5JGBA 4G34A 4X3JA 5HG8A 3PJ1A 3TXOA 3RM6A 5M4IA 5AR2A 4BIDA 3UNKA 2R3JA 3FQSA 3KREA 3MY0A 4DT9A 2JAVA 3QU0A 3R1NA 3QQKA 4G5JA 3F88A 2B55A 3CJFA 4J98A 4L68A 4AX8A 3ZSIA 3FLZA 2PVRA 3ZCLA 5DR2A 2W4JA 3R1SA 4GK3A 4GCJA 3UC3A 4QPSA 3V5JA 3PSDA 4WD5A 2ZMCA 4GYIA 3IOPA 4D2SA 4DCAA 3DK3A 1FGIA 4RC4A 1SVEA 3E93A 1FVTA 3MGYA 3TV7A 4RWJA 5AX9A 2PVKA 3QZHA 4AW2A 4W8EA 3OMVA 5CEOA 2HELA 3GU7A 4Z9LA 5F4NA 2BR1A 4JBPA 3LFDA 5TO8A 4F0FA 4L45A 1Q3DA 4M14A 5IQGA 3G51A 2J9MA 4NM7A 4EOKA 3DLSA 3OCTA 3SHEA 4D4SA 4CSVA 2W5HA 1KE5A 2CGUA 3GOPA 3UO6A 3JY9A 1YHVA 4XG7A 3L9PA 1ZYCA 5BYLA 4W8DA 4DF3A 2PMNX 4FKGA 4TPTA 5HTIA 2FO0A 2C69A 4AU8A 3EN5A 4BIEA 3R9OA 5TR6A 2XKCA 2ZDTA 3NPCA 5BVNA 1BMKA 4YZ9A 4FZ7A 5BUIA 4Q5EA 4QRCA 1JKKA 3BGPA 5C27A 4IC7A 3EB0A 5L6WL 4EHGA 3K54A 3JR1A 4L3JA 2OXDA 3LLTA 1PW2A 5HNGA 3H9RA 3ZOSA 4FA2A 3MTFA 3NIEA 3KF4A 3QXPA 4FIEA 2QD9A 3R8ZA 1PXJA 3ZUVA 4AF3A 5CAPA 2I7QA 2VO6A 5EYKA 2FVDA 4WG3A 3R9HA 2JDTA 4TNDA 3VF9A 1W7HA 4BKJA 2Z7RA 2J2IB 2F2UA 2FH9A 4HGSA 4FSYA 3QWKA 1PXOA 2UVXA 2C4GA 4UWCA 5FM2A 2KULA 2W1CA 3KRXA 2QOBA 4UWYA 5BMSA 3VWAA 3TWJA 3HMOA 1P4FA 3PWDA 3R02A 4CQEA 1OPLA 3Q96A 4JG8A 5JFSA 4AZWA 2DS1A 2JAMA 4I93A 3I0OA 2Y4PA 3QGYA 4NTSA 3TEIA 2VX0A 4G9RA 5ANIA 5ACBC 3L9LA 4GEOA 3UQFA 1STCE 2PE1A 5HZNA 4NJ3A 3ORMA 3O17A 4IJPA 5FP5A 3ZTXA 5LVOA 3I60A 3OWJA 3VULA 2B52A 4EH8A 4BCQA 4TN6A 2XK3A 3FKOA 1OZ1A 3F5UA 4N70A 4EUTA 4GKHA 2RL5A 1YOLA 3TUDA 4FI1A 3A7IA 5IDPA 4CMOA 3EN9A 4J7BA 2R3QA 4TYJA 4PV0A 2UW9A 3ORZA 5HEZA 3CIKA 3EN6A 4FKJA 5HQ0A 4FTOA 5E8UA 4Y8DA 3EQCA 4JOAA 4RJ4A 5AUZA 4EQMA 4NT4A 3CE3A 4TYHA 4YLKA 2WGJA 3PZHA 4KRCA 4LGGA 4KUJA 2BTSA 4GG5A 1DAYA 2OZAB 3BPRA 2IZTA 3IGOA 1Y8GA 2Z8CA 3OBGA 3RAKA 4C38A 2QO7A 3KMWA 3U4WA 2QOHA 3BYOA 2VWZA 3P86A 4TYGA 2LAVA 1H0VA 2XKDA 4YJNA 3D14A 4BL1A 4L43A 2XKFA 3SVVA 2PPQA 4BICA 4FSRA 4FEVA 4HYSA 2WD1A 4FTKA 3AC3A 4NK9A 2ONLC 3PFQA 4U5JA 5K5NA 2JKQA 4XV3A 1G8AA 3RWPA 3DJ6A 5I0BA 3DKOA 3DQXA 3FKLA 3RTPA 2H9VA 2PMOX 2X7FA 3ZRLA 3F3ZA 4FKLA 4AZEA 4CTCA 2AC5A 3BU5A 4DH7A 1HOWA 2HCKA 4E73A 1OITA 1SNXA 3OUKA 5AA9A 3FAAA 4WT6A 2J0IA 2XNGA 4GU9A 3KN5A 3P5KA 3C4EA 5LMBA 4KSQA 4ACCA 3ZUTA 3ORIA 3R30A 3SAYA 4I5CA 4AACA 3UYSA 2NNWB 4O84A 2VTOA 3KMMA 1SVGA 2OH0E 4JBQA 3O23A 2GCDA 5IQDA 4F7JA 3FLQA 1ZYDA 1LEZA 4BKZA 2YIYA 4FNZA 3CQEA 4RX8A 5DT3A 4I4FA 4RQKA 4CFVA 1PXLA 2PE2A 3FI2A 3ZRKA 3II5A 4KBKA 5A4TA 4ASDA 4E8AA 2YISA 3GC8A 3WZJA 2ITOA 4FEUA 4R8QA 3SLSA 4QO9A 4LG4A 4EORA 4DBNA 4E3CA 2YAKA 4C0TA 3ZLSA 4CV8A 3NVMB 2WTCA 2Z7SA 5AV3A 3MVMA 3C4FA 2X6DA 4XBUA 2PZIA 3F9NA 3IK3A 3BWFA 4R77A 5GJDA 5IH5A 2UZLA 1ND4A 4ENYA 5K5XA 3FKNA 3TZ7A 1WAKA 3ATSA 3O2MA 2BDJA 2GPHA 2EWAA 2GNIA 4DH3A 5KCVA 5KX8A 2J4ZA 1WMKA 4CKIA 1Y6AA 3O8UA 4O21A 3R7EA 4BB4A 3HV5A 3I5ZA 3RK5A 4ZK5A 4FIGA 4KIPA 4BTJA 2IZRA 4RFZA 1BX6A 3DBEA 4DAWA 1Y57A 1WBOA 3FE3A 3HLLA 3LQ5A 4XHKB 4XRJA 4FEQA 1WBTA 3BYMA 2VTNA 5E8TA 3C4ZA 2PUUA 2BDWA 4JDJA 4HPTE 2UV2A 4Y83A 4A7CA 4Y5HA 4YZDA 3ZFYA 4CLIA 3QTQA 3MTLA 3C13A 3VVHA 3VUIA 1VJYA 3BGZA 4IC8A 4S30A 4X7QA 1ZYJA 2CN8A 3NR9A 4W4XA 2XNOA 4IM2A 4CRLA 4CKRA 4F0GA 4XP2A 4ANBA 2VTRA 5AUTA 4ZS4A 3KVWA 4RIWA 4FYNA 4I0RA 2BZHB 4X0MA 3EQBA 5ANDA 1V0OA 2PZYA 4EH4A 4AE9A 3UIUA 4Q9ZA 3RPVA 2EXCX 3C0IA 1NT2A 3OROA 2R3IA 4FMQA 1H8FA 4AW0A 2WMAA 4U6RA 3E63A 4GMYA 2R3MA 5LWNA 4GU6A 3I6WA 2HZIA 3JY0A 3E3BX 3FUPA 5ETFA 2E9VA 3QF9A 4D0XA 4EOPA 5E4HA 1JKLA 4JBOA 4EH3A 4ASXA 4BDDA 3RI1A 3C50A 1Z57A 2BROA 2CGWA 2Z7LA 5A4QA 4PL5A 1W84A 5D9HA 5AUVA 1TVOA 4NIFA 3H9OA 1W82A 1OIYA 2YIQA 1Q8ZA 2VO0A 4BYJA 3ZZWA 5A9UA 3PY0A 1LR4A 3ULZA 3AOXA 5GHVA 4BCKA 4QMVA 3BELA 4GKIA 3BRBA 1WCCA 4CYIA 5CANA 3UOKA 2B4SB 3N51A 4N6ZA 3DY7A 4C59A 4C4FA 4OAVB 2WMRA 3AC1A 5IISA 3LCSA 3ZM4A 4FSMA 2VWVA 3BV2A 3NWWA 3R21A 1KWPA 5ACKA 4CG9A 3DZQA 1BLXA 2AUHA 3SD0A 2WQMA 4LMNA 2A2AA 5CSXA 3RJCA 1A06A 3CGFA 2JKOA 4J1RA 4QMPA 3QRKA 4ITIA 3QUPA 2VTTA 4ZY6A 1KE8A 3DA6A 4YR8A 5CF4A 5LVLA 1BI8A 4I22A 4EOJA 3GU6A 4FV5A 2J90A 2W1DA 4IFGA 4J71A 4G3GA 4Y72A 4QMNA 2PVFA 5CF5A 3IS5A 4FT7A 4BTKA 3PDTA 4FL1A 3IDPA 1J1CA 1FQ1B 4PTGA 4TZRA 3MFRA 2C3IB 2JEDA 3WF5A 3PE2A 2ITTA 2PVYA 3JVRA 3JVSA 2VNWA 4FKOA 5EH0A 2X39A 3UP2A 3S3IA 3RPSA 2BRGA 3AMYA 4ZXTA 2EXMA 4G6NA 5E7RA 2XJ1A 4BHNA 3KU2A 4FVQA 4FV8A 3CR0A 4UEUA 5I4NA 5CVFA 4C3RA 5ANEA 2GQGA 3V01A 4FTMA 3GB2A 1Q8UA 1OUKA 5BVOA 2R3GA 4GSBA 3S4QA 2IVUA 4TY1A 4IB3A 4O7YA 4EWHA 3PA3A 5BYYA 1ZOEA 3HMIA 1EH4A 4H3BA 4QMWA 2C3LA 2YCQA 2PE0A 2BFYA 2A19B 4DYMA 4DINA 3NAYA 5J87A 5EHOA 4K8AA 5L6PA 1PRYA 4ZJIA 4PNKA 5H8GA 3LCDA 2W1GA 4BCNA 4HW7A 3ORKA 3Q4UA 4E6QA 3BU6A 2PVHA 4PDSA 2O8YA 1Q97A 4Q5HA 5AWMA 1REKA 4IX5A 4BCOA 5A46A 1ZMWA 2QI8A 3AC8A 2V22A 2XF0A 3KN6A 1ZOGA 2JGZA 4ZS0A 3L8PA 5EDPA 2JBOA 3QRIA 4OGRA 3ZFXA 2HIWA 5JFXA 5E90A 2OFUA 3R6XA 1GZNA 4KABA 3QYWA 4JAJA 3MS9A 4DG3E 5IUGA 5IQFA 4NUSA 2ITPA 2ITWA 3ODYX 3VBXA 4MF0A 1CKJA 1JSVA 4GFGA 5D7VA 4Y46A 2VX3A 5HE2A 4EEVA 4F7NA 3GFWA 2YCSA 2A27A 3BHYA 4AFEA 5FRIA 4UXQA 3RK9A 3V04A 2Z60A 4MK0A 4ZY4A 2QOFA 2QR8A 4O7RA 4R5YA 3I4BA 4MD7E 4IAYA 3MVLA 5HE3A 3D2KA 3KK9A 4FV4A 4CYJA 2QU6A 3CP9A 4QNAA 1PXNA 4EOOA 2C5NA 4MCVA 4ZZNA 2XCHA 4CRSA 2P2IA 2PZPA 4YJTA 3BYVA 3DKGA 3MW1A 2PMLX 2ZVAA 4FOBA 5DBXA 3GU5A 2RGPA 2BZIB 3GXLA 2W17A 2IG7A 4Y85A 4RA4A 2C30A 3UQCA 5FD2A 3DCVA 5IA5A 3G6HA 3P08A 1A9UA 4FX3A 4LUEA 3BHHA 5BVWA 4GT3A 5ANJA 3WF6A 4BVUA 3TZ8A 3Q9YA 4J96A 4G3FA 4EZ7A 2BVAA 3Q32A 2V5QA 3FDNA 4HCVA 4FVPA 2YZLA 5CU4A 3TNIA 3TV4A 4BF2A 3CEKA 1WBSA 4R3RA 3RHKA 2CNVA 4I21A 2HY81 2VTAA 2X1NA 4OTGA 3PIXA 3R71A 3S95A 3DBDA 5EOLA 4GUBA 3A8XA 4F65A 4IVDA 2YFXA 4MXZA 3R0TA 3VHEA 4ANLA 2YIXA 4ANSA 3TNPC 4CT1A 5J9ZA 1FGKA 3PSCA 2C0TA 4XCUA 2ESMA 5LVMA 3O8PA 5HO8A 4KWPA 4C35A 3QC9A 3DNDA 3GCSA 3MSSA 5CSPA 3SDJA 5LMKA 4X3FB 4IMYA 4LFIA 5AA8A 3OF0A 4PMTA 5CAUA 3LVPA 4J97A 1IR3A 2Y9QA 3D7TB 4GG7A 1ZY5A 2GMXA 3VUHA 3AMBA 4M84A 4NCTA 1WZYA 5E91A 3NW6A 4FSWA 3CGOA 5CWZA 4KD1A 2XK9A 3W10A 4NM3A 3GENA 4IX6A 4IW0A 4UYAA 4X6RA 4XLVA 3CLYA 5A6NA 2XJ2A 3VS7A 2XNBA 4A4OA 1URWA 3HMMA 4TT7A 5DLSA 3O0GA 3TT0A 5KHXA 3D83A 1H08A 3KMUA 4MX9A 4W4WA 4YJPA 4E6AA 4EH7A 1ZZLA 4EL9A 3GUBA 4IX4A 5JKGA 3F66A 4DGMA 4F70A 2RIOA 4YJRA 4II5A 2HW7A 4I23A 3BGQA 2BAKA 4FKIA 4WNMA 3NNXA 4EI4A 2HZ4A 4WNPA 5AADA 3Q4CA 4IAAA 4LM5A 4DHFA 4MXCA 2GNFA 2H6DA 4O91A 2QODA 4ALVA 3PE1A 5CNNA 4ITJA 1OPJA 3MWUA 4RZWA 1A48A 1LUFA 3NUXA 3DJ5A 3FZ1A 4WO5A 5F95A 5E8YA 5FG8A 5M44A 1YXXA 2P2HA 4D1ZA 4BCHA 1WBWA 5DWRA 4A9RA 3I5NA 4PQNA 3GC0A 4FTJA 3FEGA 2ITQA 4FIFA 4GJ3A 1K2PA 3PP0A 3FZPA 5CASA 3TIZA 3PXKA 2YM8A 4LGDA 4DLJA 5BNJA 2BDFA 3FI3A 2WAJA 2X8IA 4O0VA 4YTHA 5C8KA 3R7VA 3U51A 3U6IA 5D1JA 2QKRA 3KRWA 4EONA 2GHLA 5ITAA 2BUJA 3NNWA 5JT2A 4QYEA 4ITHA 2YITA 2PULA 3WZEA 5M06A 3NUNA 3UP7A 2B0QA 3R7UA 2GHMA 3IW6A 2VTJA 3CY3A 4QMLA 4CLJA 2ITVA 3KXMA 3EKKA 3R00A 3NRMA 4L6QA 2WMTA 4RLLA 5HBHA 3R83A 1IAJA 3E64A 4CFNA 4PDYA 5HKMA 3TNHA 3VS5A 4R1VA 3FL4A 5EI8A 5B2LA 4FTAA 2UW3A 2IPXA 3ZRMA 1KUTA 4ZTLA 5K3YA 4BTMA 1BI7A 4BBFA 5CAQA 4UZHA 4PDPA 3A4OX 4RG0A 4CFMA 3POOA 4IDTA 3VAPA 2GFSA 3EJ1A 4JL9A 5EHYA 2C0IA 5EDQA 4ZTQA 2J0MB 3VC4A 3W1FA 2QO9A 4IAFA 1U5QA 3HV6A 3RHXA 5IEYA 4G17A 2HZ0A 4FZDB 2GSFA 5FGKA 4K1BA 3R8LA 3UIBA 4OBPA 4GJ2A 4FTLA 1G3NA 5EW3A 5L2WA 1UWHA 5L2IA 2OW3A 4FODA 4FTQA 2DYLA 3B2WA 2Y0AA 4M0ZA 5AV0A 3G9NA 5HE0A 3S0OA 1T46A 2BAQA 3NUPA 3ZBFA 3DB6A 4DGGA 3BKBA 4JR7A 3ORNA 3R2YA 3EQGA 2WIPA 3QD3A 4WUAA 4L8MA 5JZNA 1YXUA 3OD6X 3QTZA 2LGCA 1J1BA 4FKTA 5DEYA 5CEIA 1KSWA 2YLFA 5DNRA 5CXHA 5A14A 2FGIA 4FKSA 4YBJA 5AEPA 4ZP5A 1XR1A 3U4UA 3MVJA 2X9FA 3JXWA 4M12A 4I6HA 3SOAA 3MESA 1BYGA 4YLLA 5TKDA 3KULB 4F7SA 3CY2A 4FYOA 1E9HA 3EOCA 2GNGA 2HY0A 4S2ZA 4ANMA 4NJDA 3IW4A 4R7IA 3ZUUA 4WA9A 5ANGA 4CMTA 1Q8WA 4U41A 4S32A 3CCNA 3HP2A 2WOUA 3NYOA 3VS2A 1JKSA 3V5WA 3EQPA 4QD6A 2VWIA 5DFPA 3COKA 3FQHA 4MH7A 4YZCA 5TOZA 3COIA 3WI6A 1CM8A 1SM2A 1K3AA 3TJDA 4QMOA 2HAKA 2C5VA 3EFKA 4FKWA 4KA3A 3HDMA 5BMMA 4AXAA 3D2IA 4FZFB 3TDWA 2OG8A 3BLQA 5EG3A 1YWNA 4EHEA 4GV1A 1Z9XA 1B6CB 1YXSA 3WYYA 4OAUC 1KE7A 3LCKA 5CLPA 4XX9A 2F4JA 2OF2A 3PJ2A 3VBTA 4BR3A 4V0GA 3DTWA 5CEMA 4IJ9A 2HXQA 2W99B 4RWIA 4YO4A 4O96A 1NVSA 4QP1A 4OBQA 3IW5A 3ZBXA 1PXMA 2P0CA 3UOJA 3OWPA 4RIWB 2RFEA 3ACJA 5GJFA 5D10A 3VUMA 2XH5A 3QCXA 4NSTA 4PX6A 2PVLA 4HYHA 1DI9A 3EMGA 4XG9A 3T9TA 2VRXA 2VTMA 1HCKA 4L01A 3V51A 4AGCA 5F20A 5FLFA 5KBQA 2BALA 4NKAA 1G5SA 4FIJA 3MFSA 2WEVA 4FG7A 4IVAA 2QQ7A 2E9NA 2RF9A 5IQCA 3QA0A 4YTFA 5HICA 4O22A 4ZSGA 2XRUA 5IA1A 5AR4A 4ZAUA 5KMIA 3VIDA 4F7LA 3B8QA 4R6VA 4F9BA 2ZB0A 4BCGA 1REJA 4KSPA 4CCBA 4D2PA 1B38A 2QOCA 4U45A 5J95A 3SGCA 1M14A 2WQOA 3RZFA 4IE9A 4S31A 5DYJA 3W2PA 4HZSA 2WIHA 5AP1A 2CN5A 3QQFA 4S33A 5HGIA 4NM5A 4PDOA 3AGMA 2FB8A 1H1QA 4N57A 3W2CA 2J7TA 4HYUA 2XIXA 2QKWB 4ANQA 3UC4A 4W9XA 2BRNA 1H25A 4TWNA 2XIRA 4RFYA 5BVEA 2B53A 4X3FC 1SMHA 4QMTA 2B9IA 3E92A 4XV1A 2YM5A 4P5QA 5F1ZA 4BDIA 5FQDC 3WF7A 2I0HA 5DG5A 5J9YA 4JNWA 5CSVA 4D4VA 2Y4IB 3MB7A 5GZAA 2X8EA 4IACA 3DK7A 1VEBA 4JIKA 4KAOA 4UWBA 3ZXTA 4YUQA 3PP1A 4QP7A 3DV3A 4NKSA 3WZKA 2ZDUA 4LQMA 5CAVA 3RPYA 2QR7A 4XRLA 5I9UA 2EUFB 4EHZA 3LFSA 4O7SA 1M7NA 2GS2A 5C26A 2VX1A 3G6GA 3R63A 4V05A 2CCHA 3BBTB 4RX9A 1OB3A 4U43A 3WIKA 3KEXA 4BI0A 5BVFA 5L4QA 3RAWA 3V8SA 4YNOA 1DS5A 3IECA 4YURA 4R3PA 2PVMA 3M42A 1XH7A 4G3EA 5EW9A 3OCBA 3WILA 5I9VA 5JH6A 5FUTA 2JD5A 3EFJA 2VD5A 3LXPA 4JAIA 4JQEA 3DLZA 3I81A 1QPEA 5AMNA 4U42A 4HCUA 4E6DA 4LV5A 5A54A 2ACXA 5KMOA 4IZYA 3Q6UA 4W4YA 3LJ0A 4ZOGA 4C3PA 3NW7A 2F7ZE 2RSVA 4LRJA 2J6MA 1UKHA 1UV5A 4EOSA 2PYWA 2ZM1A 3Q60A 4IBMA 2VU3A 3ATTA 2ZV9A 3MA6A 3G0FA 5HI2A 2QU5A 4FL3A 3FZRA 2WO6A 4CCUA 4QPMA 4Z55A 5JK3A 3HP5A 4AE6A 2VN9A 2W1EA 3BX5A 2PTKA 3FJQE 4IXPA 1MRUA 3EZRA 4FNYA 3TI1A 3VBVA 1XQZA 2G2IA 3UIMA 4ZTMA 4D4YA 3KY2A 5FWKK 1XH4A 2BRMA 1U4DA 3AG9A 4FV2A 4FV9A 4DFYA 1OIQA 3HUCA 3VUKA 4CFUA 2CKOA 3CD3A 4H3QA 5JZJA 4L46A 2F49A 2UW6A 4MNEB 4USEA 4MYGA 3FMJA 3P23A 5KMLA 4CZYB 3WARA 3TCPA 4E6CA 1UU7A 4L7SA 4RSSA 5HESA 5B2MA 3F7WA 4QMZA 3SG9A 4B99A 2G01A 3LFNA 4FEXA 5BPYA 1WVWA 1KOBA 3SKCA 4O82A 2G2HA 2JDOA 3L8SA 3QCSA 3IW7A 4XV2A 2VO3A 5BYZA 3IOKA 2UW7A 5CNOA 2JFMA 4DEHA 3T9IA 2XB7A 2OO8X 1MRVA 3IG7A 3MI9A 1ZYLA 3RWQA 3UTOA 1J91A 4HNFA 3G2FA 1PXIA 4YC8A 5HG5A 3HKOA 3RCDA 4JQ8A 3RPOA 4L67A 4D58A 3LQ8A 1JLUE 3MA3A 4RBLA 3EWHA 2OJ9A 3FMLA 4RJ3A 4DH5A 1UU9A 5AUYA 3WZUA 5C4LA 3QHWA 4C4IA 5AIKA 3UJGA 3OEZA 3DDQA 4MD9E 3AGLA 4WOVA 4C62A 4QP4A 4F09A 4NW5A 5C9CA 4E5WA 4BHZA 3VS3A 4RX7A 2X4ZA 3Q4ZA 1YW2A 5HTCA 4XH6A 2X8DA 3TDVA 3F7ZA 1X8BA 4C8BA 4QNYA 2EB3A 4KS8A 2UZUE 3DFCB 3KXZA 2YZAA 2OIDA 3QGWA 2W1HA 4KKEA 4DCEA 4OTDA 5LVNA 5M56A 3M1SA 3NDMA 3F5XA 1WVXA 2RFSA 4I6QA 4JX7A 5FEQA 2W7XA 4B7TA 4B8LA 5HVYA 5IUHA 2WMSA 4M67A 4FTUA 3W8LA 3U54A 4IAKA 2GU8A 5I9XA 4N0SA 2C5YA 4EK6A 3EQFA 2P4IA 4QP2A 5GJGA 4CZTA 2YM4A 3K2LA 4MD8E 3RNYA 4H39A 4UMPA 4IX3A 4N4SA 2I1MA 4EH5A 2X4FA 2QLUA 2J0JA 4RJ7A 3RAIA 1UWJA 2Z02A 4FSNA 5L2QA 3TZ9A 3MPAA 4D1XA 4EJ7A 1LP4A 1JNKA 4RQVA 5J1WA 1YI3A 2W1ZA 2OI4X 4A4XA 4C4HA 4DFNA 4EHVA 3SA0A 1E1VA 4BI1A 4EOLA 4BDFA 2YM7A 3E7VA 4AA0A 5L2TA 5CSHA 4EYJA 4GT4A 3OHTA 2QNJA 2HYYA 1B39A 3SQQA 1IA8A 2GHGA 1J7LA 4XOZA 2BHHA 4FKRA 3KXNA 4HJOA 3E5AA 4IVCA 3F2RA 4O7TA 4JVGA 2VTQA 3A62A 1OPKA 3LXLA 4JBVA 2QURA 4TYIA 5FBNC 4ZZOA 5DRDA 5CU0A 3LE6A 4UV0A 1R0EA 5CT7A 3FWQA 3TKIA 4XG3A 1F5QA 4RJ6A 5IMXA 5BUJA 3DGKA 3LCTA 4WNKA 1OKZA 1OKYA 3D9VA 3FQEA 3QHRA 4UB7A 3IO7A 3ZLWA 4K11A 4YPDA 2PHKA 3Q4TA 3RP9A 1OBGA 4YMJA 5HIBA 4XJ0A 3VHKA 4OT5A 1R1WA 3LMIA 5K4JA 4LRMA 4C3FA 1JAMA 1P14A 2HENA 5IKWA 5HG9A 5HOAA 1LEWA 3HL7A 4I3ZA 3SC1A 3EQDA 5IF1A 2WMVA 4YJVA 3Q9ZA 2X9EA 4P4CA 3ZEWA 3HAMA 3D5VA 3C9WA 4WRSA 3GT8A 4I5PA 3OTVA 5HHWA 3DPKA 2WTKB 2A1AB 5DHJA 5HCXA 4DEEA 3DXPA 4JS8A 3MB6A 2BKKA 3G0EA 3IONA 4RMZA 2XK4A 1YXTA 4FV1A 3FZTA 3QKKA 3N4VA 4U80A 2XNPA 3TJCA 4O2PA 4D9UA 2UW4A 1XKKA 1SNUA 2R64A 5CZIA 4A06A 5FM3A 4D5HA 3C5UA 5AV2A 3R8MA 3Q9XA 2P3GX 2C6IA 3LOKA 4YJOA 3RVGA 4EYMA 2R3FA 3KKVA 4QT1A 3TV6A 4AT5A 3C4XA 2JKKA 4M68A 5EM7A 4YGAA 3TACA 3O71A 3FHIA 4ZSAA 4RZVA 3UMXA 2ONLA 4ALUA 4LUDA 3NW5A 4OTRA 5DIAA 3MH3A 4AFJA 4BTFA 4CKJA 1F3MC 3A7GA 4FTIA 2R0UA 2C5OA 2XIKA 4FK3A 3W32A 3SW4A 3OS3A 3L8VA 4BN1A 4NH1A 3F6XA 3H0ZA 4MXOA 5EM6A 5BQ0A 4CGAA 4CEGA 2VNYA 3GGFA 2DQ7X 2WEIA 2UZTA 3QKMA 3OW3A 4IZAA 1FVRA 4XP3A 4ACGA 1U59A 3P1AA 3CD8A 3P79A 4AZFA 2R5TA 4O0RA 4R3CA 4YU2A 3V5PA 3MY1A 1FMKA 2WQNA 4E5AX 2E9UA 3TM0A 1GZOA 2IW6A 3ZLYA 4BCFA 4BWKA 4PL3A 4BDJA 2XBAA 2R3PA 1FINA 4IM3A 1IA9A 2A4LA 2WTDA 2WQEA 2RKUA 3SG8A 1SVHA 4BDEA 2ITXA 2O65A 4FSUA 4BCPA 3LKMA 3CQUA 5DH3A 5L8JA 3SRVB 3TN8A 5M08A 4F63A 5TT7A 4FZAB 3NVKI 3MJ2A 3RCJA 4F08A 4WIHA 1OMWA 4F64A 2UZEA 2WHBA 4E4MA 4MTAA 4K33A 4L44A 4WG4A 1PMVA 2QCSA 5HD7A 4DEBA 4ZJVA 1APME 4FV6A 2Y7JA 4JDHA 4QTCA 4RGJA 3QTSA 4EWQA 5CF8A 3L1SA 1ZWSA 3ZO1A 4J8MA 3QA8A 2GQRA 4FKVA 4BZOA 4V04A 2CKPA 5IQBA 3PRIA 5E8XA 4PUZA 1YI4A 3NCZA 4MEDA 5KKRB 3FMHA 3LW0A 3R7OA 3FV8A 3HEGA 2BIKB 1QPDA 4IWQA 1XH8A 4G3DA 2H8HA 1PXKA 2R3NA 2XS0A 4Y5QA 4GK2A 5LARA 2Q0NA 2UW8A 3FBVA 3KXHA 4IWDA 4D2VA 4FF8A 3RINA 4M15A 1UNGA 4K0YA 1DI8A 3EN4A 5KHWA 2UZWE 3TNWA 4O38A 3ANQA 2YJRA 5FTOA 2XRWA 4AG8A 4P5ZA 5FTGA 3V5TA 3EFLA 5IA4A 2FSMX 4PRJA 3DU8A 4IQ6A 4IHPA 4ZZMA 4EOQA 5HLNA 4R7BA 5CT0A 4D28A 4RIYB 2WZJA 4TRLA 5D41A 4C61A 5IQHA 4PPBA 1YQJA 3ZDUA 4IB5A 2WFYA 3VF8A 2PK9A 2XK8A 2IW8A 3V8WA 2ETMA 2ZMDA 4G3CA 5F94A 1WVYA 4PMMA 3VUTA 5K0XA 1L3RE 4DBXA 1IEPA 3FLYA 2HWOA 3NSZA 2PVJA 1W8CA 2ZV2A 3HV3A 3PZEA 1YWRA 4GVJA 4OR5A 3LHJA 3R7YA 4R78A 3O7LD 4ZSEA 2I0VA 3NMUF 1JOWB 1ZZ2A 4QP9A 5GIPE 4BZDA 4NU1A 4O1PA 4U8ZA 2O63A 3LFQA 4JLCA 5CQWA 4GUEA 4NL0A 1OL1A 3LCOA 4MQ2A 4BDGA 4FKUA 5C03A 4CT2A 2NRYA 2CJMA 2I0YA 4HVDA 2ITNA 4QMXA 2UZNA 4I24A 3FI4A 3CQWA 1QCFA 4F0IA 2X7OA 2YDJA 2C6TA 2XA4A 1YDTE 4UY9A 5IA3A 2XJ0A 1QPCA 2IVVA 4QQ5A 3QCQA 2OXYA 3CTQA 5IU2A 4E20A 4AS0A 2C6KA 4QMUA 2CCIA 3KC3A 1ERKA 3BHUA 5DR9A 3W55A 1OECA 3V5QA 3W2RA 3R22A 2OJIA 2XIZA 3KXGA 4C58A 4AGDA 4FBXA 3LAUA 5AR3A 3H9FA 2GFCA 2YCRA 3VS1A 2DWBA 5CI6A 4BGGA 5L8KA 3T8OA 1BL6A 4X2KA 5AAGA 3IQ7A 5C4KA 1YKRA 4CV9A 3K3IA 5CI7A 4AZTA 4KBAA 2JFLA 4KINA 4DEGA 3OZ6A 1AGWA 4J8NA 2W5AA 4PPCA 5K9IA 3NYXA 3R01A 5H9BA 3ID6C 3F3VA 3VQHA 1RE8A 4HCTA 1M2RA 4BKYA 3EZVA 4EK5A 1OVEA 2QOIA 2UVYA 1DAWA 1PMUA 4FG9A 4XG4A 2WOTA 2Z2WA 4MBJA 3ZFMA 1YXVA 4FKPA 4MBLA 2X2LA 3KB7A 1YOJA 1CKIA 2V62A 3L9MA 3MH0A 2XYUA 3OG7A 1O6KA 1CKPA 2FSTX 4QYYA 5EYDA 5AV4A 3AC2A 1GNGA 4KS7A 3QAME 4JXFA 1H00A 2A0CX 2YCFA 2WTKC 4TWPA 4RJ8A 4YTCA 3D5WA 3GVUA 2J0KA 3OP5A 4I5MA 2F7EE 4A07A 3WF9A 3A2CA 1OUYA 4MXAA 2WTWA 1FOTA 4RIOA 4RT7A 2W5BA 4X2GA 5KE0A 4BWPA 5IA0A 2OZAA 3QD2B 3VBYA 4K2RA 1OIUA 2WB8A 3ZC5A 3RZBA 3RNIA 5HCYA 4DFBA 3PXYA 4QOXA 5AP0A 2FSLX 5HNBA 4C4JA 3EN7A 5H3QA 4EBWA 4DT8A 5FTQA 4BDAA 2G9XA 4RRVA 4GH2A 3THBA 4M7IA 3PPJA 5KZ0A 2YIWA 2WPAA 3AD4A 4YNEA 5LVPA 2OLCA 4LMUA 3UQGA 1I09A 3LFEA 5DT0A 3U8WA 3Q3BA 4JDKA 4WBOA 4AA4A 2QOKA 4YHJA 4L3LA 4DEDA 2JIIA 2J51A 4YZBA 5M07A 5M51A 2C0OA 3Q2MA 3G9LX 5ETIA 5E8SA 5AR8A 2X2MA 3QALE 1WBVA 3DXQA 3MV5A 1YDSE 4A4LA 4HVIA 5E8ZA 3BI6A 3MIYA 1TQIA 4NZWB 4QMQA 2R3HA 1JSTA 2C6OA 2R3LA 4PNIA 1W98A 2GQSA 3ZM9A 3E8CA 4RWLA 3BYUA 3UODA 1W0XC 3HRBA 4HPUE 4HVHA 2J0LA 3RGFA 5DMZA 4IDVA 2ETRA 2JKMA 4RC2A 4EC8A 2SRCA 3OOGA 3R7GA 3R2BA 5EYCA 3UGCA 3E88A 4D0WA 3C4CA 5IQEA 3HZTA 4TYHB 3EH9A 4ZSLA 2JITA 3BCEA 3HV4A 4L53A 5HLPA 4PY1A 1NY3A 3G90X 4GT5A 4XG8A 1SYKA 2CGVA 2E9OA 3ULIA 3W2SA 3WIGA 1ATPE 3FLNC 2XNMA 2QHNA 3QTXA 3VW6A 4E7WA 4L42A 4TWCA 4LL0A 2QOLA 3BE9A 4AA5A 2IZUA 5FDPA 2JBPA 2QG7A 2EB2A 2UW5A 3GBZA 3PVBA 3QBNA 5ANOA 5AP2A 4ZLYA 3C4WA 3P9JA 4BY9E 3MH2A 4L3PA 5IQAA 4X6QC 3PSBA 5CVGA 3S2PA 3R7IA 4ERKA 5A3XA 3POZA 4GYGA 3MDYA 3UMWA 4CG8A 2PSQA 3RKBA 3P78A 2C1AA 3I7BA 3OY3A 4I41A 4TXCA 1FBNA 3NYNA 4IIRA 4BI2A 4XBRA 3ZZEA 5KBRA 4G1WA 3GQLA 4F99A 1GZKA 3DK6A 3WOWA 2QOQA 1Q3WA 4DFZE 1H4LA 3LLAA 3TTIA 2GS6A 4U40A 3OTUA 4XNEA 1MRYA 4IZ5A 3WE8A 3PWYA 4KKGA 4L7FA 2OFVA 2YERA 5HO6A 1Q61A 2NP8A 2OWBA 4LL5A 3ZONA 4AN9A 5M4FA 4PP9A 4NFMA 3ZH8A 5D7AA 3UNJA 4J53A 4F9WA 2P55A 1XH6A 3DKCA 4P2KA 5E8VA 5FDXA 3U87A 4EK4A 3R9RA 4PMPA 3UE4A 3OC1A 3BQCA 4GK4A 4O6LA 3E8NA 4TKSA 3UOLA 3VUGA 5CQUA 4F6UA 3UZTA 4FE2A 2C6MA 2W4OA 4B4LA 1PKDA 4FNWA 3HECA 4G31A 4U0IA 2WNTA 3RBWA 3QXOA 3F69A 4YO6A 5ICPA 4AT3A 3FYKX 3C51A 3SX9A 4BIBA 5M4UA 4JRVA 3MY5A 1U54A 1ZMVA 4HOKA 3GCPA 4E4LA 3H4JA 5AV1A 3JS2A 4GL9A 4IVBA 2R0IA 2X2KA 3MYGA 5D12A 3TTJA 3HDNA 3ZDIA 2C47A 2OSCA 5M53A 1M2QA 2OZOA 4OTWA 2IW9A 4ORKA 5HE1A 1V0PA 4OTFA 2C6DA 4PWNA 4O86A 2OJFE 3Q04A 2YEXA 3W8QA 5M4CA 2VWUA 4KKHA 1ZYSA 2ZB1A 3DTCA 3NNVA 4I5HA 4TW9A 4HVSA 3IDCA 2ERKA 5CEQA 4L00A 1H27A 3KRRA 3NYVA 4DN5A 4EKLA 3O51A 5H8BA 3E7OA 4BDKA 4MF1A 4F6WA 4LI5A 4MKCA 5E1SA 5T6KA 5I5ZA 4FL2A 4I0TA 4OTIA 1S9IA 3P7AA 1JWHA 4DH1A 5KMMA 3OWLA 3DBCA 2VZ6A 4RC3A 5K0KA 1K9AA 2HXLA 3MFUA 2YM6A 1OKVA 4BGHA 5G6VA 5TF9A 4RVMA 3FL5A 5CS6A 3U9CA 5ETCA 2YDIA 1YHSA 2WMUA 3BZ3A 3OEFX 4QP6A 4GS6A 4QTBA 4B6LA 4RWKA 3FLWA 3ZS5A 3LMHA 3NZ0A 5ETAA 4F1TA 4MQ1A 3DFAA 4Q2AA 3TIYA 3IDBA 3U55A 3QZFA 3HNGA 3VUDA 2AC3A 5KMJA 1FVVA 1MQBA 2YIRA 5B0XA 1OKWA 1UNLA 3GCQA 5JGDA 5HTBA 5L8LA 3GC9A 3U9NA 2VO7A 5DE2A 1OGUA 2PMIA 1H24A 4J95A 2X7GA 4O0SA 3RAHA 3F82A 4XMOA 3CSVA 4FTCA 3FMMA 3QTUA 5KZIA 2XEZA 4FG8A 4NIFB 1IASA 4B8MA 3FY0A 4JQ7A 1PHKA 5HIDA 3VS6A 4CNHA 5HBJA 3PTGA 3QWJA 4AW1A 2BIYA 4O7NA 1YVJA 4ZTSA 5I3RA 2YJSA 3ZYAA 2HWPA 4XLIA 3KGAA 3OCGA 4D9TA 1I44A 2WMXA 4G6OA 2XP2A 3PY3A 5C8MA 3MBLA 1R78A 3WYXA 1Q8YA 2B1PA 1O6LA 3HA6A 3UG1A 5HD4A 2XM9A 4QP8A 5M55A 3R73A 2XK7A 3NGAA 1H0WA 4Y73A 4EH2A 3DAEA 2YAAA 2VTIA 3H10A 4GRBA 4QYFA 5DR6A 5LMAA 4ENXA 5HIEA 4QTAA 1E1XA 2FUMA 3EQHA 3QQJA 3UG2A 3FMEA 4DEIA 3GOKA 3Q5IA 2ERZE 3OXZA 4BDCA 4YC3A 1SZMA 2WMBA 3G15A 1YI6A 2B9FA 5GNKA 3BHVA 1WBPA 1GIIA 3C1XA 4EC9A 4MAOA 5EI2A 1VR2A 3ZEPA 4AP7A 4MVFA 4EBVA 2C68A 4RLKA 3GU8A 3OXIA 4FIHA 5T3QA 3FXXA 2R4BA 3HYHA 3LJ1A 4QMYA 4HGLA 4A9YA 3BWJA 4D55A 4TL0A 3ZSGA 1GAGA 4NM0A 3N4UA 2HW6A 2E2BA 3G5DA 5CENA 4O7VA 3SXSA 4O0XA 3D7ZA 2BHEA 4DTKA 5DPVA 4C2WA 4Z3VA 5GIOE 3FXWA 1GY3A 3VJOA 3OFMA 3GNIB 2X81A 3LMGA 5FXRA 3K3JA 2RG5A 4FV3A 4R1YA 4KBCA 3ACKA 4I94A 4DFLA 2BCJA 3QRTA 4M69A 3MH1A 3LPBA 3KL8A 3KRLA 4ASEA 4G9CA 4HNIA 4U7ZA 2XYNA 2O0UA 2W96B 1JKTA 4IAIA 4FTRA 4CFXA 4FEWA 5HX8A 3Q52A 4Z7GA 4I6BA 4QMSA 1OBDA 2OIBA 2NPQA 3NUYA 5FEDA 3TL8A 1XBBA 5HLWA 4ZLOA 3FMDA 4QQCA 3OXTA 3QD0A 4JG6A 4G2FA 1H26A 3FYJX 4CFWA 1OI9A 3EFWA 3DBQA 1XO2B 3KFAA 5HG7A 5AUUA 2BFXA 3PY1A 3FPQA 2XEYA 4BDHA 4FT5A 3W2OA 4IEBA 2JDVA 4HZRA 5G1XA 1MP8A 3RALA 1MUOA 2FA2A 4F1OA 3PIZA 3DAKA 3UVQA 4Y95A 4C2VA 3BEGA 5B2KA 4O7LA 5JMSA 2HZNA 2C3JA 4O0UA 3CBLA 1Q62A 5L6OA 3IGGA 4D2RA 3DXNA 4FK6A 1G8SA 2O64A 4GVAA 4FTNA 1HCLA 3CXWA 4ACMA 4FT9A 5IUIA 3ENHA 2JC6A 2XIYA 3TG1A 1U5RA 4JIAA 4ERWA 4X3FA 2XZSA 2WTIA 3HV7A 4TNBA 4WKQA 3D7TA 2CMWA 1GJOA 3Q9WA 1NW1A 5DVRA 2ZYBA 5LXMA 4E26A 3HVCA 3WE4A 4D5KA 2XBJA 1XH9A 3D15A 4U9AA 4IB0A 1NXKA 2W0JA 3PJCA 4DH8A 4NW6A 4C33A 4YHFA 3PIYA 4PTEA 4LRKA 3PUPA 2O5KA 3A7JA 4BGQA 4KB8A 3CKXA 1ZAOA 5JQ5A 4CMUA 3L9NA 1PY5A 4PPAA 4IFCA 2BMCA 4IWOA 5AFVA 2I6LA 3WBLA 4ZMFA 3BEAA 5EOBA 3W18A 4F4PA 1J7UA 3VBWA 4BRXA 1PMNA 2CGXA 3BV3A 5EDRA 2C6EA 2C5XA 3DT1A 1ZY4A 1NA7A 2ITUA 3AC5A 3LFFA 3GEQA 4FSZA 4H1JA 3EYGA 3V3VA 4C57A 1OM1A 5BVDA 4ZJJA 5AM7A 5HO7A 2BZKB 3QD4A 2W1IA 4NFNA 4S34A 4GFMA 4D2WA 1P4OA 3HGKA 3V6SA 4USFA 5HNIX 3MN3A 5EKNA 5CXZA 1WFCA 2R9SA 4OLIA 4QMMA 5KMNA 3PPKA 3QCYA 4UBAA 4APPA 5GINE 4L9IA 3NS9A 3ZXZA 4PTCA 4WSQA 4P7EA 4FKQA 1XHAA 1RW8A 2XMYA 3BHTA 3FC2A 1KV1A 2ZOQA 5DGZA 5EM8A 4RVLA 2XK6A 4YSMA 4BCJA 4U3YA 2YN8A 2WMWA 3F3UA 1PYXA 4RA5A 3EYHA 2VUWA 4E5BA 1AD5A 3FPMA 5BX0A 4X2JA 4C36A 2NRUA 3KK8A 3U6JA 3KCKA 4LOQA 2GNLA 4D4RA 2CSNA 3VO3A 3RPRA 4M13A 3FSKA 4BZNA 2EXEA 1R39A 3ZO2A 4EH9A 1PKGA 4NTTA 2ZJWA 1JBPE 2FSOX 5HBEA 5M57A 3F3WA 4QYGA 1OL5A 1FMOE 2R3KA 2C6LA 4JT3A 2PUNA 5IQIA 2YACA 4K9YA 3BU3A 4RIXA 1UVRA 4IZ7A 5AP7A 3QKLA 2G1TA 1U46A 2PWLA 3MJ1A 4JDIA 3FY2A 4BFMA 3QTIA 3HRCA 5AM6A 5HORA 5JFWA 2OICA 3OWKA 3Q6WA 4IADA 3OUNB 3CPCA 4AOIA 2V55A 2OJGA 3H30A 3TKUA 4ZY5A 5DI1A 4H58A 4GW8A 4I1ZA 3FXZA 1Z5MA 3AD5A 3E8EA 2YWVA 4O83A 4ZMEA 4M3QA 4I20A 4F6SA 4CXAA 1RDQE 4XUFA 2OU7A 4YLJA 4AWIA 1RJBA 2WTVA 3UIXA 3RM7A 4AT4A 1CMKE 2GDOA 2CPKE 2UZBA 3PXFA 4EH6A 4YZNA 2IO6A 1IAHA 5IEVA 1XWSA 3BE2A 5CSWA 1Y91A 5A6OA 3VRYA 2OF4A 5AP5A 4LGHA 2ITYA 3SXFA 2R2PA 4RJ5A 5DEWA 4U44A 3CPBA 3VN9A 2IN6A 3DQWA 2PZ5A 1VYWA 4ANOA 3VW8A 2R7BA 3NEWA 1V1KA 3KULA 3PXQA 5CEKA 2BAJA 4F9AA 4O0TA 3KVXA 2O2UA 5B7VA 3GI3A 5IG1A 4M0YA 3UZPA 4EJNA 4FVRA 1ZMUA 5A4CA 4E4XA 1XJDA 3LFAA 2UUEA 1JSUA 1PXPA 1ZXEA 2Y4IC 2BKZA 3AT2A 4YHTA 4ZTRA 2E9PA 3I1AA 4KIKA 2FYSA 3VNTA 3FZSA 1BL7A 5J7HA 3ANRA 4H05A 2OXXA 2XM8A 4G5PA 4O81A 3MVHA 3JYAA 5HVJA 2AYPA 2Q0BA 3COMA 4MXYA 4ACHA 2IJMA 3C0GA 4OUCA 5AAFA 4AOTA 3S1HA 3CC6A 5DT4A 5HVKA 3D4QA 4DG0E 2GTNA 5CU6A 5J5SA 4Z16A 2OKRA 3ORXA 1GIHA 2UZOA 3ZMMA 3DOGA 3O7LB 3OY1A 4O0WA 4W9WA 4JR3A 4X21A 4B9DA 3ALOA 3R04A 4P90A 1LPUA 2OH4A 1BUHA 3BIZA 3A4PA 2YLEA 3HA8A 2YM3A 4XV9A 4O27B 5AUWA 2VGPA 1YHWA 4D1SA 3BBWA 2X0GA 3A60A 3BLRA 4APCA 4EKKA 2WELA 4AAAA 4EOMA 1J7IA 1U54B 2QG5A 3B2TA 3H0YA 4UMRA 1YRPA 4FV7A 3OT3A 5EM5A 5EQPA 2VWXA 3V6RA 5AJQA 3OBJA 4RVKA 5JSMA 3QUEA 4DTBA 1RQQA 4WSYA 5JRQA 3AT4A 1ZOHA 1ZLTA 1XBCA 3UO5A
chains in the Genus database with same CATH superfamily
1L8TA 2WU7A 4QTEA 3UDBA 4BYIA 3N4TA 2XUUA 2UVZA 5E92A 2I40A 4C34A 4EK8A 5FXQA 1XBAA 2B54A 4RFMA 5JFVA 2R3OA 1WBNA 4A9TA 1YWVA 4JJRA 4PMSA 3R1YA 4V0GB 4K6ZA 2PY3A 2VTLA 4FUXA 4YPSA 3R8UA 4MXXA 1IRKA 4A9SA 3I7CA 5IMEA 2B7AA 3FZOA 2W4KA 3MIAA 4G16A 4CTBA 3A99A 4UMTA 3ZC6A 1Q4LA 3FI8A 3E62A 4DG2E 3CS9A 2GTMA 3N9XA 2QHMA 5AP4A 3QLGA 5E1EA 3GQIA 4CQGA 3W0SA 3QRJA 1QMZA 3OOMA 2VWBA 2PUIA 2REIA 4F1MA 1UA2A 3NX8A 1W2CA 1KOAA 3DS6A 4UALA 5CAOA 2QVSE 2F7XE 4HGTA 3W16A 4GIHA 4FGRA 2RG6A 3GCVA 1KV2A 1R0PA 3BYSA 5I9YA 4LYNA 3ERKA 4OTPA 4EQCA 2IZSA 3OVVA 3UYTA 5J1VA 2ZV8A 3F61A 3PVUA 1R3CA 2H34A 3D94A 3QYZA 5CX9A 5EYMA 5I9WA 1TQMA 4FNXA 4RX5A 5CY3A 2Y6MA 4MWHA 2BPMA 3G33A 1BKXA 1CTPE 4AZSA 1OL6A 2ETKA 5H8EA 2XCKA 5EHLA 2PVNA 1KE6A 3O8TA 4DA5A 4MHAA 4V01A 3P4KA 3NIZA 2F9GA 4DC2A 1URCA 3ELJA 4XS2A 1OIRA 4IM0A 3QQHA 4G6LA 3GP0A 4FR4A 3W0QA 1UU8A 2VWYA 2G2FA 2W05A 5HU3A 3LQ3A 1M7QA 2V7AA 4C4GA 3VQUA 3KQ7A 4OW8A 5T68A 3PG1A 4HGEA 1J3HA 4GIIA 4X2NA 3TNQB 1Q99A 5LMKC 3DKFA 3HMNA 3NUSA 5IH6A 3S00A 3C5IA 3NAXA 5JEBA 4LOPA 4NCTC 3AT3A 1Y8YA 3D0EA 2BZJA 4DFXE 3LM5A 4QYHA 3QZIA 4YJQA 2V7OA 3M11A 5CU2A 5ANKA 3T3VA 1H01A 1IG1A 3HX4A 4JG7A 3AXWA 3QUDA 5LOHA 4UZDA 3EQIA 4FOCA 2CKEA 3F5GA 4QTDA 5IEXA 3QTWA 2ZAZA 2R7IA 3QC4A 3ZLXA 1VZOA 2PUPA 3UOHA 4NEUA 5FEEA 4ASZA 3ETAA 4HVGA 4XG6A 5EW8A 3TZMA 2JLDA 3WZDA 2Y6OA 3QTRA 4C7TA 2CLQA 3NCGA 1YDRE 2CHLA 3FMKA 4NYEA 2BILB 2WQBA 3GCUA 4MNEA 3V8TA 2DUVA 2C1BA 5JGAA 3GFEA 4K77A 3KCFA 5BUEA 5KNJA 5AIRA 2WXVA 2W06A 3P0MA 4I4EA 4ALWA 2W1FA 4FT3A 3E3PA 3F2NA 3ORPA 2O3PA 5IH4A 5LQFA 3I0QA 5HU9A 4E93A 3B8RA 3ORLA 4M69B 4O6EA 5JRSA 3ITZA 1OL2A 3P7BA 2R3RA 3VBQA 4ANNA 4D2TA 3NLBA 3PLAE 4I0SA 5EK7A 4DE4A 3AMAA 3U6HA 3EIDA 3AKJA 2X6EA 4EZ3A 2XNNA 3EL8A 1JVPP 3RK7A 4CFFA 4WBBB 5L3AA 5C1QB 3VRZA 1ZRZA 3KA0A 4O1OA 4FSTA 5D11A 1TQPA 3ZHPC 4DGLC 5JN2A 3C7QA 5H2UA 5I9ZA 3R9DA 4IANA 4K18A 4PF4A 3FSFA 2ZM3A 5HCZA 5IDNA 5A4EA 2QC6A 4BC6A 4H3PA 3K5UA 3LFBA 4ZLZA 4JRNA 3ZO3A 3WF8A 2YABA 2ITZA 4I6FA 3EQRA 3DAJA 4XP0A 3VJNA 1MQ4A 2AEGA 4YZMA 4E4NA 4CD0A 3FHRA 3HRFA 2VTHA 5HX6A 5LCKA 3UZRA 4XOYA 3EKNA 3ZU7A 5J7BA 2F2CB 2PU8A 3DNEA 4DGNA 3BLHA 3KF7A 3DBFA 4ZTNA 4FIIA 3ALNA 4DITA 4O0YA 1P5EA 4XEYA 1VYZA 5EI6A 2H96A 2KTYA 1PYEA 4YSJA 2HOGA 3DDPA 4B0GA 1FPUA 3MFTA 4F9CA 3LFCA 4DHJA 3IW8A 3BQRA 3P7CA 2JDRA 4BCIA 2QLQA 2V0DA 1M2PA 2RFDA 3O50A 4KNBA 4O7WA 3COHA 4DFUA 1H07A 2OIQA 4AN2A 2YWPA 1S9JA 5GZ8A 4EQUA 5CALA 2EVAA 4I92A 5M09A 3OCSA 4F9YA 1XH5A 2IVSA 3Q2JA 4FZ6A 4TWOA 4AUAA 1UU3A 2G15A 4FICA 4FGBA 2WTJA 3A7HA 3QX4A 2BTRA 4DGOA 2GNHA 3F5PA 4ONAA 2X0PA 3UDTA 1TKIA 2PZRA 1M17A 2WMQA 3V5LA 1G8KA 2J5EA 3HMPA 4OT6A 4WG5A 3W0MA 1JPAA 5L2SA 1W83A 4DTAA 4LOOA 4H1MA 5J8IA 5CTPA 4AQCA 4M8TA 4IWPA 1Y6BA 3DB8A 3NUAA 2XVDA 2NO3A 5C01A 5AAEA 2BRBA 5AR7A 5AR5A 3UVPA 3QQLA 4M97A 4AZVA 3ET7A 3NUUA 4C37A 2J50A 3UBDA 3W33A 4O2ZA 5CYIA 4ZTHA 3JPVA 4YJSA 5CU3A 4QDEA 4GFOA 1Q41A 4ZSJA 5KMKA 3TUCA 3A8WA 4A9UA 4C4EA 3AC4A 1PF8A 4FTTA 5AUXA 5GZ9A 3UNZA 3ODZX 3LM0A 2OJJA 5KKRC 5J9LA 3LXKA 5AX3A 4U97A 3SV0A 4EOIA 4PL4A 2UW0A 3LZBA 3EL7A 4HYIA 3PJ3A 1NVQA 3SOCA 4BCMA 1ZARA 3A7FA 1UKIA 3PRFA 4UX9A 3W0OA 3LIJA 3MPMA 4OTQA 5KUPA 3R9NA 4IH8A 3CJGA 3UPXA 4RIXB 3FLSA 4UMQA 2Q83A 3REPA 4DEAA 4QPAA 3KRJA 4XYFA 4RVTA 4BDBA 3UVRA 3CTJA 3H3CA 3PXZA 4AN3A 4BWXA 3AD6A 4ARKA 3JUHA 3PJ8A 5IA2A 1KE9A 3R8VA 4J99A 1H1WA 4NWMA 4U81A 4BBEA 3T3UA 2BRHA 2ZV7A 4QP3A 3PG3A 5LJJA 3D5UA 4H36A 1M52A 3I79A 2GS7A 3DZOA 3ORTA 4JX3A 5DA3A 5IPJA 1V0BA 5JQ8A 3HAVA 2W9ZB 5EQYA 2VWWA 4EZ5A 1H1PA 3D5XA 3IKAA 5AP6A 4TTHB 1O6YA 3M2WA 2PL0A 3QQGA 2UZDA 2VAGA 1H1RA 2W9FB 4KIOA 5FBOA 1Q8TA 2C3KA 4AGWA 3OT8A 3F2AA 1OGYA 2VTSA 3E8DA 3QLFA 2Y8OA 1CDKA 3PXRA 3PYYA 5F9EA 4OTHA 4XG2A 4YP8A 5EQEA 4FC0A 5K4IA 4W4VA 2VGOA 1QL6A 3QZGA 3VS4A 4EUUA 2QO2A 4YC6A 3TUBA 3PLSA 1H1SA 2HK5A 4FSQA 5E8WA 4R5SA 5J79A 5FXSA 4FUYA 5CF6A 2P33A 1GZ8A 1QPJA 4ID7A 1PMEA 4MBIA 3QL8A 4C02A 1GOLA 2ZM4A 2XNEA 3SW7A 3IPHA 4FV0A 4MWIA 3SRVA 4U3ZA 5AP3A 4UXLA 1NVRA 2I0EA 4BBMA 4UMUA 4KIKB 4QQJA 5LWMA 2EU9A 2IVTA 5DRBA 3AQVA 2WU6A 5EFQA 5CEPA 3ZO4A 2VV9A 4ACDA 5CZHA 2CNUA 4IB1A 4DLIA 5I3OA 3R8PA 3HUBA 3GU4A 1AQ1A 4YTIA 2RFNA 4KRDA 3I6UA 3KXXA 1CSNA 4RPVA 4U79A 1GIJA 4YJUA 4USDA 4PP7A 4WUNA 4O4DA 3DJ7A 3R1QA 4IAZA 4Z7HA 3L8XA 3PA4A 5IZFA 2CLXA 2GNJA 4CZUA 3UPZA 3K5VA 3CKWA 2JIVA 4UYNA 4UN0C 4ZIMA 3R28A 4L52A 4JI9A 5BVKA 1Q24A 3W2QA 5E9EA 1JQHA 5LCJA 5CVHA 2CNQA 4TYEA 3PA5A 5TE0A 4AW5A 4E1ZA 3A61A 3EHAA 4Q9SA 1O9UA 4J52A 2VTPA 1P2AA 5EKOA 2UZVA 1PJKA 3OW4A 4N6YA 4X2FA 2CKQA 3SXRA 4WRGA 3CTHA 4AGUA 4QQTA 2B9HA 2QOOA 3C0HA 2OGVA 2J5FA 2Z7QA 3ENMA 3F3TA 3QFVA 4RIYA 4ZEGA 5A4LA 1OL7A 4R7HA 2XKEA 4KIQA 4LV8A 3PPZA 3PVGA 2F57A 2WKMA 2YHVA 2OBJA 4WHZA 5DOSA 3UO4A 1H28A 3QX2A 3E87A 3ROYA 4EK3A 1Q5KA 3RMFA 2JDSA 3QRUA 2CDZA 5C8NA 5KO1A 2YDKA 4MNFA 3LJ2A 3MPTA 3O96A 1T45A 5J5TA 1F0QA 3GC7A 2OK1A 3ROCA 3PVWA 3QQUA 3FMNA 2JIUA 2YA9A 3VS0A 2IWIA 3TKHA 3FC1X 3ZSHA 2QONA 4FT0A 1UNHA 4M66A 5DN3A 4CVAA 4OBOA 4O7ZA 3Q5ZA 2B9JA 1DM2A 4YBKA 4AOJA 3LXNA 3Q53A 3NNUA 1YOMA 5FP6A 4WNOA 5JGBA 4G34A 4X3JA 5HG8A 3PJ1A 3TXOA 3RM6A 5M4IA 5AR2A 4BIDA 3UNKA 2R3JA 3FQSA 3KREA 3MY0A 4DT9A 2JAVA 3QU0A 3R1NA 3QQKA 4G5JA 3F88A 2B55A 3CJFA 4J98A 4L68A 4AX8A 3ZSIA 3FLZA 2PVRA 3ZCLA 5DR2A 2W4JA 3R1SA 4GK3A 4GCJA 3UC3A 4QPSA 3V5JA 3PSDA 4WD5A 2ZMCA 4GYIA 3IOPA 4D2SA 4DCAA 4DHIB 3DK3A 1FGIA 4RC4A 1SVEA 3E93A 1FVTA 3MGYA 3TV7A 4RWJA 5AX9A 2PVKA 3QZHA 4AW2A 4W8EA 3OMVA 5CEOA 2HELA 3GU7A 4Z9LA 5F4NA 2BR1A 4JBPA 3LFDA 5TO8A 4F0FA 4L45A 1Q3DA 4M14A 5IQGA 3G51A 2J9MA 3AKKA 4NM7A 4EOKA 3DLSA 3OCTA 3SHEA 4D4SA 4CSVA 2W5HA 1KE5A 2CGUA 3GOPA 3UO6A 3JY9A 1YHVA 3TYKA 4XG7A 3L9PA 1ZYCA 5BYLA 4W8DA 4DF3A 2PMNX 4FKGA 4TPTA 5HTIA 2FO0A 2C69A 4AU8A 3EN5A 4BIEA 3R9OA 5TR6A 2XKCA 2ZDTA 3NPCA 5BVNA 1BMKA 4YZ9A 4FZ7A 5BUIA 4Q5EA 4QRCA 1JKKA 3BGPA 5C27A 4IC7A 3EB0A 5L6WL 4EHGA 3K54A 3JR1A 4L3JA 4MUQA 2OXDA 3LLTA 1PW2A 5HNGA 3H9RA 3ZOSA 4FA2A 3MTFA 3NIEA 3KF4A 3QXPA 4FIEA 2QD9A 3R8ZA 1PXJA 3ZUVA 4AF3A 5CAPA 2I7QA 2VO6A 5EYKA 2FVDA 4WG3A 3R9HA 2JDTA 4TNDA 3VF9A 1W7HA 4BKJA 2Z7RA 2J2IB 2F2UA 2FH9A 4HGSA 4FSYA 3QWKA 1PXOA 2UVXA 2C4GA 4UWCA 1ST4A 5FM2A 2KULA 2W1CA 3KRXA 2QOBA 4UWYA 5BMSA 3VWAA 3TWJA 3HMOA 1P4FA 3PWDA 3R02A 4CQEA 1OPLA 3Q96A 4JG8A 5JFSA 4AZWA 2DS1A 2JAMA 4I93A 3I0OA 2Y4PA 3QGYA 4NTSA 3TEIA 2VX0A 4G9RA 5ANIA 5ACBC 3L9LA 4GEOA 3UQFA 1STCE 4AXCA 2PE1A 5HZNA 4NJ3A 3ORMA 3O17A 4IJPA 5FP5A 3ZTXA 5LVOA 3I60A 3OWJA 3VULA 2B52A 4EH8A 4BCQA 4TN6A 2XK3A 3FKOA 1OZ1A 3F5UA 4N70A 4EUTA 4GKHA 2RL5A 1YOLA 3TUDA 4FI1A 3A7IA 5IDPA 4CMOA 3EN9A 4J7BA 2R3QA 4TYJA 4PV0A 2UW9A 3ORZA 5HEZA 3CIKA 3EN6A 4FKJA 5HQ0A 4FTOA 5E8UA 4Y8DA 3EQCA 4JOAA 4RJ4A 5AUZA 4EQMA 4NT4A 3CE3A 4TYHA 4YLKA 2WGJA 3PZHA 4KRCA 4LGGA 4KUJA 2BTSA 4GG5A 1DAYA 2OZAB 3BPRA 2IZTA 3IGOA 1Y8GA 2Z8CA 3OBGA 3RAKA 4C38A 2QO7A 3KMWA 3U4WA 2QOHA 1W2DA 3BYOA 2VWZA 3P86A 4TYGA 2LAVA 1H0VA 2XKDA 4YJNA 3D14A 4BL1A 4L43A 2XKFA 3SVVA 2PPQA 4BICA 4FSRA 4FEVA 4HYSA 2WD1A 4FTKA 3AC3A 4NK9A 2ONLC 3PFQA 4U5JA 5K5NA 2JKQA 4XV3A 1G8AA 3RWPA 3DJ6A 5I0BA 3DKOA 3DQXA 3FKLA 3RTPA 2H9VA 2PMOX 2X7FA 3ZRLA 3F3ZA 4FKLA 4AZEA 4CTCA 2AC5A 3BU5A 4DH7A 1HOWA 2HCKA 4E73A 1OITA 1SNXA 3OUKA 5AA9A 3FAAA 4WT6A 2J0IA 2XNGA 4GU9A 3KN5A 3P5KA 3C4EA 5LMBA 4KSQA 4ACCA 3ZUTA 3ORIA 3R30A 3SAYA 4I5CA 4AACA 3UYSA 2NNWB 4O84A 2VTOA 3KMMA 1SVGA 2OH0E 4JBQA 3O23A 2GCDA 5IQDA 4F7JA 3FLQA 1ZYDA 3PUFC 1LEZA 4BKZA 2YIYA 4FNZA 3CQEA 4RX8A 5DT3A 4I4FA 4RQKA 4CFVA 1PXLA 2PE2A 3FI2A 3ZRKA 3II5A 4KBKA 5A4TA 4ASDA 4E8AA 2YISA 3GC8A 3WZJA 2ITOA 4FEUA 4R8QA 3SLSA 4QO9A 4LG4A 4EORA 4DBNA 4E3CA 2YAKA 4C0TA 3ZLSA 4CV8A 3NVMB 2WTCA 2Z7SA 5AV3A 3MVMA 3C4FA 2X6DA 4XBUA 2PZIA 3F9NA 3IK3A 3BWFA 4R77A 5GJDA 5IH5A 2UZLA 1ND4A 4ENYA 5K5XA 3FKNA 3TZ7A 1WAKA 3ATSA 3O2MA 2BDJA 2GPHA 2EWAA 2GNIA 4DH3A 5KCVA 5KX8A 2J4ZA 1WMKA 4CKIA 1Y6AA 3O8UA 4O21A 3R7EA 4BB4A 3HV5A 3I5ZA 3RK5A 4ZK5A 4FIGA 4KIPA 4BTJA 2IZRA 4RFZA 1BX6A 3DBEA 4DAWA 1Y57A 1WBOA 3FE3A 3HLLA 3LQ5A 4XHKB 4XRJA 4FEQA 1WBTA 3BYMA 2VTNA 5E8TA 3C4ZA 2PUUA 2BDWA 4JDJA 4HPTE 2UV2A 4Y83A 4A7CA 4Y5HA 4YZDA 3ZFYA 4CLIA 3QTQA 3MTLA 3C13A 3VVHA 3VUIA 1VJYA 3BGZA 4IC8A 4S30A 4X7QA 1ZYJA 2CN8A 3NR9A 4W4XA 2XNOA 4IM2A 4CRLA 4CKRA 4F0GA 4XP2A 4ANBA 2VTRA 5AUTA 4ZS4A 3KVWA 4RIWA 4FYNA 4I0RA 2BZHB 4X0MA 3EQBA 5ANDA 1V0OA 2PZYA 4EH4A 4AE9A 3UIUA 4Q9ZA 3RPVA 2EXCX 3C0IA 1NT2A 3OROA 2R3IA 4FMQA 1H8FA 4AW0A 2WMAA 4U6RA 3E63A 4GMYA 2R3MA 5LWNA 4GU6A 3I6WA 2HZIA 3JY0A 3E3BX 3FUPA 5ETFA 2E9VA 3QF9A 4D0XA 4EOPA 5E4HA 1JKLA 4JBOA 4EH3A 4ASXA 4BDDA 3RI1A 3C50A 1Z57A 2BROA 2CGWA 2Z7LA 5A4QA 4PL5A 1W84A 5D9HA 5AUVA 1TVOA 4NIFA 3H9OA 1W82A 1OIYA 2YIQA 4O4FA 1Q8ZA 2VO0A 4BYJA 3ZZWA 5A9UA 3PY0A 1LR4A 3ULZA 3AOXA 5GHVA 4BCKA 4QMVA 3BELA 4GKIA 3BRBA 1WCCA 4CYIA 5CANA 3UOKA 2B4SB 3N51A 4N6ZA 3DY7A 4C59A 4C4FA 4OAVB 2WMRA 3AC1A 5IISA 3LCSA 3ZM4A 4FSMA 2VWVA 3BV2A 3NWWA 3R21A 1KWPA 5ACKA 4CG9A 3DZQA 1BLXA 2AUHA 3SD0A 2WQMA 1TZDA 4LMNA 2A2AA 5CSXA 3RJCA 1A06A 3CGFA 2JKOA 4J1RA 4QMPA 3QRKA 4ITIA 3QUPA 2VTTA 4ZY6A 1KE8A 3DA6A 4YR8A 5CF4A 5LVLA 1BI8A 4I22A 4EOJA 3W0PA 3GU6A 4FV5A 2J90A 2W1DA 4IFGA 4J71A 4G3GA 4Y72A 4QMNA 2PVFA 5CF5A 3IS5A 4FT7A 4BTKA 4BJJA 3PDTA 4FL1A 3IDPA 1J1CA 1FQ1B 4PTGA 4TZRA 3MFRA 2C3IB 2JEDA 3WF5A 3PE2A 2ITTA 2PVYA 3JVRA 3JVSA 2VNWA 4FKOA 5EH0A 2X39A 3UP2A 3S3IA 3RPSA 2BRGA 3AMYA 4ZXTA 2EXMA 4G6NA 5E7RA 2XJ1A 4BHNA 3KU2A 4FVQA 4FV8A 3CR0A 4UEUA 5I4NA 5CVFA 4C3RA 5ANEA 2GQGA 3V01A 4FTMA 3GB2A 1Q8UA 1OUKA 5BVOA 2R3GA 4GSBA 3S4QA 2IVUA 4TY1A 4IB3A 4O7YA 4EWHA 3PA3A 5BYYA 1ZOEA 3HMIA 1EH4A 4H3BA 4QMWA 2C3LA 2YCQA 3BL7A 2PE0A 2BFYA 2A19B 4DYMA 4DINA 3NAYA 5J87A 5EHOA 4K8AA 5L6PA 1PRYA 4ZJIA 4PNKA 5H8GA 3LCDA 2W1GA 4BCNA 4HW7A 3ORKA 3Q4UA 4E6QA 3BU6A 2PVHA 4PDSA 2O8YA 1Q97A 4Q5HA 5AWMA 1REKA 4IX5A 4BCOA 5A46A 1ZMWA 2QI8A 3AC8A 2V22A 2XF0A 3KN6A 1ZOGA 2JGZA 4ZS0A 3L8PA 5EDPA 2JBOA 3QRIA 4OGRA 3ZFXA 2HIWA 5JFXA 5E90A 2OFUA 3R6XA 1GZNA 4KABA 3QYWA 4JAJA 3MS9A 4DG3E 5IUGA 5IQFA 4NUSA 2ITPA 2ITWA 3ODYX 3VBXA 4MF0A 1CKJA 1JSVA 4GFGA 5D7VA 4Y46A 2VX3A 5HE2A 4EEVA 4F7NA 3GFWA 3UDZA 2YCSA 2A27A 3BHYA 4AFEA 5FRIA 4UXQA 3RK9A 3V04A 2Z60A 4MK0A 4ZY4A 2QOFA 2QR8A 4O7RA 4R5YA 3I4BA 4MD7E 4IAYA 3MVLA 5HE3A 3D2KA 3KK9A 4FV4A 4CYJA 2QU6A 3CP9A 4QNAA 1PXNA 4EOOA 2C5NA 4MCVA 4ZZNA 2XCHA 4CRSA 2P2IA 2PZPA 4YJTA 3BYVA 3DKGA 3MW1A 2PMLX 2ZVAA 4FOBA 5DBXA 3GU5A 2RGPA 2BZIB 3GXLA 2W17A 2IG7A 4Y85A 4RA4A 2C30A 3UQCA 5FD2A 3DCVA 5IA5A 3G6HA 3P08A 1A9UA 4FX3A 4LUEA 3BHHA 5BVWA 4GT3A 2X0OA 5ANJA 3WF6A 4BVUA 3TZ8A 3Q9YA 4J96A 4G3FA 4EZ7A 3NFFB 2BVAA 3Q32A 2V5QA 3FDNA 4HCVA 4FVPA 2YZLA 5CU4A 3TNIA 3TV4A 4BF2A 3CEKA 1WBSA 4R3RA 3RHKA 2CNVA 4I21A 2HY81 2VTAA 2X1NA 4OTGA 3PIXA 3R71A 3S95A 3DBDA 4AQKA 5EOLA 4GUBA 3A8XA 4F65A 4IVDA 2YFXA 4MXZA 3R0TA 3VHEA 4ANLA 2YIXA 4ANSA 3TNPC 4CT1A 5J9ZA 1FGKA 3PSCA 2C0TA 4XCUA 2ESMA 5LVMA 3O8PA 5HO8A 4KWPA 4C35A 3QC9A 3DNDA 3GCSA 3MSSA 5CSPA 3SDJA 5LMKA 4X3FB 4IMYA 4LFIA 5AA8A 3OF0A 4PMTA 5CAUA 3LVPA 4J97A 1IR3A 2Y9QA 3D7TB 4GG7A 1ZY5A 2GMXA 3VUHA 3AMBA 4M84A 4NCTA 1WZYA 5E91A 3NW6A 4FSWA 3CGOA 5CWZA 4KD1A 2XK9A 3W10A 4NM3A 3GENA 4IX6A 4IW0A 4UYAA 4X6RA 4XLVA 3CLYA 5A6NA 2XJ2A 3VS7A 2XNBA 4A4OA 1URWA 3HMMA 4TT7A 5DLSA 3O0GA 3TT0A 5KHXA 3D83A 1H08A 3KMUA 4MX9A 4W4WA 4YJPA 4E6AA 4EH7A 1ZZLA 4EL9A 3GUBA 4IX4A 5JKGA 3F66A 4DGMA 4F70A 2RIOA 4YJRA 4II5A 2HW7A 4I23A 3BGQA 2BAKA 4FKIA 4WNMA 3NNXA 4EI4A 2HZ4A 4WNPA 5AADA 3Q4CA 4IAAA 4LM5A 4DHFA 4MXCA 2GNFA 2H6DA 4O91A 2QODA 4ALVA 3PE1A 5CNNA 4ITJA 1OPJA 3MWUA 4RZWA 1A48A 1LUFA 3NUXA 3DJ5A 3FZ1A 4WO5A 5F95A 5E8YA 5FG8A 5M44A 2XARA 1YXXA 2P2HA 4D1ZA 4BCHA 1WBWA 5DWRA 4A9RA 3I5NA 4PQNA 3GC0A 4FTJA 3FEGA 2ITQA 4FIFA 4GJ3A 1K2PA 3PP0A 3FZPA 5CASA 3TIZA 3PXKA 2YM8A 4LGDA 4DLJA 5BNJA 2BDFA 3FI3A 2WAJA 2X8IA 4O0VA 4YTHA 5C8KA 3R7VA 3U51A 3U6IA 5D1JA 2QKRA 3KRWA 4EONA 2GHLA 5ITAA 2BUJA 3NNWA 5JT2A 4QYEA 4ITHA 2YITA 2PULA 3WZEA 5M06A 3NUNA 3UP7A 2B0QA 3R7UA 2GHMA 3IW6A 2VTJA 3CY3A 4QMLA 4CLJA 2ITVA 3KXMA 3EKKA 3R00A 3NRMA 4L6QA 2WMTA 4RLLA 5HBHA 3R83A 1IAJA 3E64A 4CFNA 4PDYA 5HKMA 3TNHA 3VS5A 4R1VA 3FL4A 5EI8A 5B2LA 4FTAA 2UW3A 2IPXA 3ZRMA 1KUTA 4ZTLA 5K3YA 4BTMA 3ML1A 1BI7A 4BBFA 5CAQA 4UZHA 4PDPA 3A4OX 4RG0A 4CFMA 3POOA 4IDTA 3VAPA 2GFSA 3EJ1A 4JL9A 5EHYA 2C0IA 5EDQA 4ZTQA 2J0MB 3VC4A 3W1FA 2IF8A 2QO9A 1U5QA 3HV6A 4IAFA 3RHXA 5IEYA 4G17A 2HZ0A 4FZDB 2GSFA 5FGKA 4K1BA 3R8LA 3UIBA 4OBPA 4GJ2A 4FTLA 1G3NA 5EW3A 5L2WA 1UWHA 5L2IA 2OW3A 4FODA 4FTQA 2DYLA 3B2WA 2Y0AA 4M0ZA 5AV0A 3G9NA 5HE0A 3S0OA 1T46A 2BAQA 3NUPA 3ZBFA 3DB6A 4DGGA 3BKBA 4JR7A 3ORNA 3R2YA 3EQGA 2WIPA 3QD3A 4WUAA 4F78A 4L8MA 5JZNA 1YXUA 3OD6X 3QTZA 2LGCA 1J1BA 4FKTA 5DEYA 5CEIA 1KSWA 2YLFA 5DNRA 5CXHA 5A14A 2FGIA 4FKSA 4YBJA 5AEPA 4ZP5A 1XR1A 3U4UA 3MVJA 2X9FA 3JXWA 4M12A 4I6HA 3SOAA 3MESA 1BYGA 4YLLA 5TKDA 3KULB 4F7SA 3CY2A 4FYOA 1E9HA 3EOCA 2GNGA 2HY0A 4S2ZA 4ANMA 4NJDA 3IW4A 4R7IA 3ZUUA 4WA9A 5ANGA 4CMTA 1Q8WA 4U41A 4S32A 3CCNA 3HP2A 2WOUA 3NYOA 3VS2A 1JKSA 3V5WA 3EQPA 4QD6A 2VWIA 5DFPA 3COKA 3FQHA 4MH7A 4YZCA 5TOZA 3COIA 3WI6A 1CM8A 1SM2A 1K3AA 3TJDA 4QMOA 2HAKA 2C5VA 3EFKA 4FKWA 4KA3A 3HDMA 5BMMA 4AXAA 3D2IA 4FZFB 3TDWA 2OG8A 3BLQA 5EG3A 1YWNA 4EHEA 4GV1A 1Z9XA 1B6CB 1YXSA 3WYYA 4OAUC 1KE7A 3LCKA 5CLPA 4XX9A 2F4JA 2OF2A 3PJ2A 3VBTA 3KIOC 4BR3A 4V0GA 3DTWA 5CEMA 4IJ9A 2HXQA 2W99B 4RWIA 4YO4A 4O96A 1NVSA 4QP1A 4OBQA 3IW5A 3ZBXA 1PXMA 2P0CA 3UOJA 3OWPA 4RIWB 2RFEA 3ACJA 5GJFA 1XMMA 5D10A 3VUMA 2XH5A 3QCXA 4NSTA 4PX6A 2PVLA 4HYHA 1DI9A 3EMGA 4XG9A 3T9TA 2VRXA 2VTMA 1HCKA 4L01A 3V51A 4AGCA 5F20A 5FLFA 5KBQA 2BALA 4NKAA 1G5SA 4FIJA 3MFSA 2WEVA 4FG7A 4IVAA 2QQ7A 2E9NA 2RF9A