2R7BA

Crystal structure of the phosphoinositide-dependent kinase-1 (pdk-1)catalytic domain bound to a dibenzonaphthyridine inhibitor
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
285
structure length
274
Chain Sequence
RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoinositide-dependent protein kinase 1
publication title Discovery of Dibenzo[c,f][2,7]naphthyridines as Potent and Selective 3-Phosphoinositide-Dependent Kinase-1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
total genus 82
structure length 274
sequence length 285
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2r7bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2r7bA01
3ZFXA 1MQBA 4R6VA 3ZONA 4DFYA 4EH4A 3Q9ZA 3QCXA 5M44A 4NL0A 4D28A 4YC3A 4BDDA 3CY3A 2B55A 5HICA 3QD4A 4YLKA 4UMQA 1OZ1A 2PVYA 2WTVA 3HMMA 4DAWA 3KVWA 2C6MA 3UZRA 4NFMA 5HLWA 3FAAA 4I4FA 4D0WA 3AC3A 3PJCA 2YACA 4IWDA 3C4FA 3LE6A 3NYOA 3OXTA 4Y95A 3AD5A 3JY0A 1QPEA 4QMVA 1OIQA 3PY0A 4RLKA 2C47A 5EW9A 5TOZA 4D1SA 4RIXA 1LR4A 5LVOA 5IQGA 2HWPA 3UNKA 4GVAA 3QD3A 3TJCA 5AIKA 2F9GA 2ZAZA 1ZXEA 1U4DA 3A8XA 5HG7A 3VUMA 3D2IA 3GC8A 3GC0A 3LPBA 5CSVA 3VUKA 4APPA 3U6JA 3SOCA 4FV1A 4PL3A 4MQ2A 1CMKE 4BWXA 3GP0A 1ZLTA 1IAJA 2RFNA 3RPOA 3VS0A 5IMXA 4IVDA 2HAKA 4BY9E 5CASA 5E92A 4KBKA 5KE0A 5T68A 3L8VA 3I7BA 3O17A 2GS2A 4M15A 3RPYA 4H3PA 3ULZA 3GUBA 3W2PA 4TNBA 3VRZA 5FM2A 3RVGA 3MA6A 3KQ7A 4KA3A 3A7JA 5F9EA 3A2CA 2E9PA 4FKJA 5I9YA 2ZM1A 3S3IA 4XV2A 4QP7A 2RF9A 3F69A 2HWOA 3MWUA 3PPJA 3VQHA 4JAJA 4RWKA 5DT3A 1BUHA 3CS9A 3OBGA 3DKGA 4P7EA 3GQLA 2QOBA 5HTCA 2JGZA 3GVUA 4F0GA 1M7NA 3NVMB 1FMOE 3DTWA 4DH3A 4JS8A 1WBSA 5GJFA 3VBYA 4BCPA 2RL5A 1Q8WA 2O5KA 5LCJA 3S0OA 2BHHA 3TDWA 2JD5A 5HCXA 1KE6A 4QQTA 2HZNA 5K4IA 2HIWA 1J91A 4HYUA 3NGAA 2XH5A 3ZSGA 3KF7A 2VWWA 5AV4A 3ZO2A 3WE8A 5AV1A 1PRYA 5GZ8A 4O0TA 3K54A 3II5A 2WEIA 2Q0BA 2X7FA 5KMNA 5C1QB 2BRHA 4CYJA 1UNHA 4GK2A 3GQIA 5I9XA 4QMNA 4ASZA 5CF6A 4O7YA 3PG1A 3PTGA 1GY3A 4WG5A 2WTKB 2XZSA 3OXIA 3U87A 3LFAA 3DNDA 1UU8A 2V5QA 3RZFA 4MTAA 5HE3A 3NUYA 3TCPA 3BYUA 3KMUA 3KRWA 4CRLA 3DQWA 3ZLWA 1VZOA 4RX8A 2UV2A 3NYXA 1H07A 2CCIA 3BHHA 5J5SA 2R2PA 1F5QA 3M42A 4UMPA 2OIBA 4AT5A 3GFEA 3BRBA 4ASEA 4CXAA 3D83A 4M3QA 4MQ1A 2QQ7A 5DWRA 4WNOA 2VU3A 5JEBA 3Q4CA 5BVWA 2CGWA 1ZYLA 3BHUA 4TPTA 3N4TA 3ZC6A 3KGAA 5FTOA 4XS2A 4F1MA 2HOGA 4FIIA 4O1OA 1S9JA 1YOLA 4L3LA 5FTQA 4MK0A 4FEUA 2WFYA 3A8WA 2WZJA 4PDOA 1OGUA 3SV0A 4MVFA 1NW1A 4U9AA 3RK7A 3KXNA 4I5PA 5K5NA 3BKBA 4NCTC 2VO3A 5HBHA 1OITA 3Q6UA 4MXCA 1FVTA 2YISA 3BBWA 5HLPA 4O82A 5JRSA 5IDPA 4JX7A 2IW6A 2BDFA 4C58A 1XJDA 3OOGA 3QRUA 2HYYA 4MKCA 4RJ4A 2J0IA 4GRBA 4UWYA 4TW9A 3ZUVA 4R1VA 5HESA 3LMHA 4LMUA 2GNLA 3BEAA 4JG8A 4EH3A 3QQHA 3U55A 2X39A 2VTAA 2C3IB 2Z7RA 4D0XA 5CEKA 4RJ8A 5EQEA 5M06A 3QRJA 2W05A 3TN8A 3PWYA 2YHVA 2C3JA 2O3PA 3OS3A 4HCTA 5KMJA 4FSRA 4BI1A 5AR8A 4AGCA 3MFUA 2UW4A 4YP8A 5IKWA 4TL0A 5A6OA 3MVLA 3KN5A 4KIKB 3P4KA 3OT3A 4TT7A 4PNKA 2GMXA 2CKOA 4MAOA 4WUAA 3HLLA 4NU1A 4B9DA 4FT0A 3FQEA 3I0QA 1UWJA 3DKCA 1W7HA 3K5VA 3V8TA 1SVEA 5K9IA 4JXFA 4O6LA 2C1BA 3F2AA 2UZTA 3BCEA 4FTUA 4MNEB 3E63A 5FXSA 3G9LX 4O7ZA 2X2LA 4DBXA 1OIRA 1VYWA 2YA9A 4L7FA 3QFVA 5DMZA 4AW1A 2PY3A 3GCSA 2QODA 4D4VA 3GBZA 4U43A 1OIYA 2PUNA 3TKIA 4FA2A 4PDSA 3ZEWA 1XH8A 3CGOA 4FNWA 3DT1A 4Z55A 3D5UA 2DQ7X 2YDIA 4ALVA 3BWJA 4PWNA 2VNYA 4RWJA 3SC1A 4BIBA 2Y6MA 3EZVA 4ONAA 2H8HA 3WZUA 4E6CA 2QLUA 4X3FC 1XKKA 1H1SA 5HD4A 3LKMA 4KS8A 5C26A 3SXSA 4IB0A 3ZFMA 4R3RA 3U8WA 3TEIA 4X21A 1SVHA 3VIDA 3AXWA 3ZMMA 4JJRA 4NH1A 3IG7A 2WMSA 4DC2A 3QTSA 4JLCA 3CP9A 4O7TA 4KIPA 4XRLA 4ZLOA 3DLSA 5ANIA 2E9VA 4WBBB 2IVSA 5EW8A 4IVBA 4EZ7A 3UQGA 3EN6A 3TL8A 4JDKA 2VWBA 5FEQA 2OZAB 4CFXA 4F09A 4J8NA 4QYFA 4QQ5A 3Q52A 3RWQA 4GSBA 2QOQA 2Y8OA 2R3OA 4DEEA 4E5WA 1VEBA 2UW0A 4FEWA 2PVLA 3RALA 3COMA 3OMVA 5K4JA 3VHKA 4GL9A 3TG1A 1WBNA 3Q4TA 5BPYA 1FOTA 2NO3A 3PFQA 4BDKA 3FPQA 3NUNA 4FTMA 4K1BA 3FMKA 4J7BA 2ZV7A 3O0GA 4J71A 4G9RA 4LRKA 2ZB1A 3GU4A 1RJBA 2GNHA 2V7OA 5FBOA 2V22A 2QD9A 1G8SA 2GNIA 5CTPA 2B0QA 4HYSA 4Y73A 2X8DA 4MWIA 3QL8A 3R7OA 4PMPA 2ITZA 2ETMA 4EK8A 3VBVA 5EOBA 2FSLX 4O0RA 3EQRA 4WO5A 5BVEA 4NTTA 3R73A 2X0GA 2ITWA 4RBLA 4YLLA 3W16A 3OUKA 4IDTA 4U3YA 3RAKA 4N4SA 3PVBA 4BGQA 2AUHA 3NIZA 2BZJA 4JDIA 4A9YA 4AUAA 3U6IA 4F1OA 4FT7A 4GYGA 4P90A 4FK3A 4ITHA 2YN8A 4R5SA 2B9FA 5ANDA 3SG9A 2HCKA 5IEYA 1R3CA 2BKKA 4F08A 2XK4A 3UYSA 3GENA 3VHEA 4Z16A 5J9LA 1BX6A 4PV0A 5LCKA 4QYYA 5IQHA 4G6NA 3ZSIA 5FQDC 5DEWA 4IXPA 5ETAA 2G15A 4WNPA 4EH8A 5CAVA 4IM2A 2XMYA 1ZOEA 2IZRA 4KINA 4Z7HA 2CPKE 2WIPA 2WMTA 5C27A 3DBDA 1J1BA 2E9NA 3OW3A 4WRSA 3CEKA 4ASXA 3E93A 2HK5A 4QYHA 2W1FA 2JDSA 5CXZA 4EJNA 4TKSA 3RPRA 3DK6A 1JVPP 4QNYA 5E7RA 5HORA 3C4XA 2P4IA 4YJPA 4AZEA 2EVAA 4EJ7A 3OEZA 2ITOA 1YOJA 5L8JA 2O64A 5AA8A 5HX6A 3TTJA 2QHNA 5CQUA 4DH1A 3BBTB 5ANJA 5M53A 4BGGA 3PE1A 4YHJA 5AUXA 4O7RA 2GNGA 2ERKA 2WMWA 2F7ZE 3NCGA 5ETIA 3LFSA 5GJDA 4C61A 3EN4A 3ORKA 4YR8A 3L9PA 5C8KA 5T3QA 5DGZA 1PXKA 3ACKA 3SHEA 3D5VA 3CD8A 3REPA 3V01A 3CTHA 3ZS5A 4EWHA 3P23A 3ENHA 5C01A 2E9OA 4GS6A 1M2RA 4B6LA 4YNEA 3PLAE 3R30A 3L8XA 1XO2B 3F3ZA 4DYMA 4EK4A 1Z9XA 2BROA 3CJFA 3BLHA 4L3JA 4TYIA 3PZEA 5I3OA 1WBVA 3FYKX 5AM6A 4DEIA 3H3CA 3VBWA 2Z8CA 4FSTA 4G5PA 1REJA 3DZOA 5A4LA 4MF1A 4NM3A 2YCRA 2BFXA 3A7GA 3I1AA 2IZSA 3P9JA 3DK3A 4FTCA 2YIYA 5IZFA 1YXTA 5FDPA 3BYOA 1ATPE 4FEVA 3EFKA 3P86A 5E9EA 1PYXA 1YWNA 1ZZLA 2BRNA 4MH7A 4V0GB 4EI4A 5HIEA 5IF1A 2BUJA 4DF3A 1GZNA 3RAIA 3KXHA 3LM5A 1GZOA 3TV4A 3IW4A 3K3IA 4L3PA 4DBNA 2F7XE 4R8QA 3R28A 4X3FB 1SM2A 3PPKA 3LFFA 4GU9A 2F7EE 4ZS4A 2XNBA 1PY5A 3R8LA 1U5RA 3FLZA 1H8FA 3QWKA 4X3JA 3GU5A 3V3VA 3EQIA 3JR1A 4XEYA 4FTKA 1Y6BA 5KMLA 3MH0A 4RX7A 1U59A 3EWHA 3LMGA 4I0SA 1FMKA 3V8WA 5BVKA 2FYSA 3FE3A 2JEDA 4O0UA 4XG3A 3C5IA 3OFMA 2XIYA 4C4HA 4BVUA 4QP9A 3FQSA 4U0IA 3C1XA 4JX3A 2C3KA 4AW2A 2BIKB 4CFVA 2R3KA 4V05A 4JI9A 5AP3A 1U54B 2V0DA 4ZSJA 1CKJA 3PIZA 3ROYA 4YTHA 4MF0A 3ODYX 4BTKA 1M14A 2JKQA 3KEXA 1KUTA 3E8CA 3PA4A 2KTYA 5KMKA 4EHZA 1LPUA 2VAGA 2WQEA 5E8XA 4QPAA 4ZTQA 3F3VA 3TKHA 3LCDA 4F9WA 2J90A 3KXZA 2R5TA 4NWMA 3I0OA 5CZIA 5B2LA 2GS7A 5ITAA 3IQ7A 4O86A 4GK4A 4A9SA 4UN0C 3TKUA 4QP2A 4I5MA 3GU8A 3LJ1A 4RVMA 5EM7A 5E8VA 2QKRA 2OXYA 4QPSA 3P1AA 1OM1A 4U80A 4UXLA 4C4JA 3D4QA 1TQMA 4S30A 4DINA 2KULA 3VJNA 3SW7A 5L3AA 4WG4A 4I6HA 4BTJA 2PMOX 2XRUA 4JQ8A 4TRLA 3H0YA 1P2AA 4GCJA 5KZ0A 1P4FA 3MFSA 2CNVA 1H4LA 3I5NA 5EDPA 1CKPA 2WELA 4ITIA 3OT8A 5F20A 1OIUA 2JAMA 2WO6A 3EQPA 3AD4A 3I5ZA 4FI1A 4KNBA 1I09A 4U79A 5B2KA 1R0PA 2P0CA 3LXNA 4NW6A 4O6EA 3AC1A 4TWPA 4BCGA 1FVRA 3QD0A 3WBLA 3FC1X 4AZSA 3DAJA 4M66A 4QMSA 2VO0A 3OCBA 5IH5A 4E4MA 4UV0A 4EQMA 3MW1A 3FLQA 5CX9A 3F5UA 4LV5A 2PUUA 4L46A 5DEYA 5BNJA 4FV9A 4DITA 2ZM4A 4ENXA 3LXPA 3P7BA 1ZY5A 3VUIA 1PMUA 4F9CA 2QO9A 5JGAA 2BHEA 5GJGA 3BGZA 1WFCA 3ORTA 1G3NA 3EIDA 2R0UA 4FK6A 4FKIA 3QCYA 4IM3A 4C0TA 3Q5ZA 4J52A 3ALOA 4TWOA 3GC9A 1YOMA 4IAKA 4JT3A 3R0TA 4GJ2A 4WUNA 2LGCA 3W55A 4BI2A 4O1PA 5A3XA 3UPZA 5G6VA 3HV3A 3CQEA 5J1VA 5FD2A 3KULB 4ZK5A 3TT0A 3DAKA 4DGLC 2DYLA 5HKMA 2UZDA 3C4EA 5M51A 2C1AA 1ZOGA 2ONLA 4M14A 3SDJA 4IWOA 1SNUA 4K33A 4JAIA 2VX3A 3D2KA 2YM3A 3Q3BA 3QHRA 1IAHA 1ZOHA 3FMNA 4WOVA 1GIJA 5H2UA 3AT4A 4ANBA 3BHTA 4BL1A 3E7VA 5IA5A 3TZ8A 4CLJA 1YQJA 3QTIA 3TNHA 4LI5A 4QNAA 3VUGA 5TKDA 4ANQA 5IUGA 5AUYA 3W2SA 3KREA 4RVTA 1XH6A 3UG1A 3IDCA 1OPJA 4EOJA 1YI3A 5HG8A 4EC8A 5HQ0A 3TM0A 4CT1A 3VULA 5IEXA 4FZAB 2IVUA 3R1YA 3LQ8A 3MS9A 2I6LA 3R8MA 5CU0A 4YZBA 1QPCA 2C5OA 4HVSA 1H24A 4FTTA 2VWYA 3MTFA 3S00A 3ZRLA 5IQAA 3RNYA 4RIYB 4KAOA 2R9SA 5DFPA 5IA1A 1PKDA 1SVGA 4KKHA 1R39A 4PMTA 1KOBA 3HNGA 3LFQA 3PVGA 3Q4UA 4IAZA 3RP9A 3SX9A 4D1ZA 4USFA 5HLNA 3DB6A 2WQOA 3H10A 2ITYA 4IZ7A 5KKRC 4F63A 3KF4A 2W17A 4WG3A 2CKQA 1G5SA 4IM0A 2YAKA 2GQSA 1G8AA 2J5FA 1E1XA 3R6XA 4OBQA 4RJ7A 2YFXA 1B6CB 3FHRA 2PZPA 4IAIA 3O8PA 1Y6AA 3QLGA 5IISA 2A27A 2X4FA 5CU6A 4FTOA 4ACHA 4DTKA 4RWLA 1OKYA 5KZIA 3OY3A 2R3RA 5AX9A 4UMTA 4GIIA 2JBOA 3VW8A 2UW3A 1YDSE 1U46A 5HCYA 1A48A 4RPVA 2HW6A 4J53A 4P4CA 4BCOA 5KUPA 1XH9A 1FVVA 3LJ2A 4C3PA 4FV3A 3FZ1A 3L8PA 1OPKA 2QHMA 3OC1A 1QPDA 1MP8A 3SD0A 4MX9A 4ERWA 3WF7A 4F0FA 4GYIA 4IFGA 4PL4A 2VGPA 4FTAA 2C68A 4FG8A 4RZVA 1U5QA 1ZMUA 4OBOA 4BCMA 5C4LA 2QU5A 3HAMA 4AXAA 1Y91A 4Y72A 4FTQA 4LUEA 3AGLA 2XA4A 4I1ZA 2PZ5A 4W9XA 4FGRA 4JBVA 2OJIA 3Q4ZA 3UVPA 5CVFA 1Y57A 2GHGA 3PZHA 4D2VA 5JFXA 2BDWA 3NX8A 3PXFA 3RMFA 4RC4A 3SLSA 4Q5HA 2RG5A 4QMXA 5CSPA 2JBPA 2BAQA 4EOMA 3GNIB 4A9RA 5H3QA 5BVNA 3NNXA 3CQUA 5D10A 2W1IA 1KV1A 1OKVA 1IG1A 3WF6A 4IX6A 2Z7SA 4OAUC 3FXXA 4JDJA 4NKSA 4QTBA 3ETAA 5HTIA 3VS1A 4KBCA 1W0XC 2X8EA 2HW7A 4ITJA 4BCIA 4LOPA 4QMTA 3LFNA 4IB3A 4R5YA 3TXOA 2B9HA 4DEAA 2UW7A 1R1WA 4I4EA 4BB4A 3OZ6A 2J5EA 3G0EA 1DM2A 4P5ZA 3BEGA 3NIEA 3VS7A 3ERKA 3O96A 4YJTA 4ZIMA 3IDBA 1W84A 3VNTA 4AFEA 2XM8A 4XP0A 4BIDA 3LCSA 3FXWA 4AOIA 3QXOA 4A4XA 4ZJVA 2W5HA 3HX4A 4J1RA 4YJUA 3MSSA 2ZV9A 3E92A 3FBVA 4LRMA 3H0ZA 4YUQA 4C3RA 2O65A 4CMUA 2X6EA 3FMMA 3NNVA 3A62A 3HV7A 4DTAA 3ET7A 2J0KA 3PJ8A 3R8ZA 3HDMA 4LGHA 4O81A 1H1RA 2RG6A 3RHKA 1Q97A 5DVRA 3BGQA 1J3HA 3RPSA 3UVQA 4FIEA 4PMSA 2JIUA 5DG5A 3AMBA 4PPAA 4A07A 1YVJA 4BYJA 4GIHA 1A9UA 5HOAA 5HVYA 4DGNA 3V5PA 5M56A 2C0OA 1QCFA 4O83A 5FG8A 3F5XA 4O7VA 5M09A 4UMUA 3UQFA 4M69B 3ZDIA 2R3NA 4GG7A 2OZOA 2QOKA 3W2RA 4BF2A 5I9ZA 3EFLA 1XBAA 2W0JA 4XP2A 3R9OA 3I79A 5GZAA 2VNWA 5IDNA 1NVQA 4R3PA 3POOA 3H9RA 4TYHA 4L42A 1ND4A 4WKQA 4FG7A 4UMRA 2GPHA 3Q5IA 1NVSA 4NEUA 2WOTA 3ZU7A 3NVKI 3VRYA 2HXLA 4L53A 4WRGA 5CNNA 5IQEA 5DOSA 4Z9LA 2ZDUA 4CFFA 3QUPA 2OJ9A 2VTNA 2YAAA 3NWWA 4HJOA 4E73A 4O7SA 5AADA 3QX2A 3UNZA 2C6EA 4ZMFA 2XK7A 3A7HA 3ROCA 2H96A 2EU9A 5CAOA 4RVLA 3V04A 4DEDA 3QALE 4NFNA 5JFSA 1SYKA 3QD2B 3UP7A 4HCVA 3D7TA 4O96A 3DXNA 4BCKA 3F5PA 3V6SA 5CEIA 1YXXA 2XNPA 4NKAA 4FKGA 4W4XA 4IWPA 4XBRA 3W2QA 4BZDA 3NPCA 2VN9A 1B39A 3G2FA 3FJQE 1UKIA 2VO6A 2O8YA 4HZSA 2VUWA 3B8RA 4V01A 2R3LA 2YCQA 4UB7A 2Z7LA 5KKRB 4JBPA 3C0IA 4M0ZA 3BX5A 3Q2MA 4R1YA 5HE0A 1L8TA 5HI2A 1ZAOA 4DLJA 3IW5A 3PSDA 5EW3A 5DN3A 4TN6A 4AT3A 2FSMX 4BRXA 3Q04A 4Y5HA 1APME 4MCVA 1JQHA 2C6OA 2YIQA 4IW0A 3QC4A 5J9YA 4CZTA 4D9TA 4EOOA 2GFCA 1PMNA 2X4ZA 3WOWA 1ZRZA 4ID7A 4AA4A 2XJ2A 3IK3A 4ZS0A 4DH7A 4FSZA 5JGBA 5IQBA 4L68A 4OBPA 3PA3A 1Q3DA 4I0RA 2W7XA 3WF9A 4F1TA 3BYVA 3NUSA 4JNWA 2J0LA 3WZEA 5AAEA 3BLQA 5L4QA 3UOJA 3QYWA 3DS6A 3PVWA 3ZDUA 3DV3A 4KBAA 4OGRA 3R7IA 4NT4A 3D94A 4P5QA 3GCPA 5CT0A 4FTIA 4BI0A 3FL4A 3I4BA 3F2NA 4HGSA 1E1VA 4GEOA 3FY2A 4K6ZA 5L6WL 3RZBA 3SXRA 3HV6A 4B99A 2PULA 4IVCA 4LFIA 3LFEA 4UBAA 4XG8A 5EM5A 5HO8A 4K2RA 4HPTE 4AG8A 4ZSLA 2H6DA 3AT2A 3FSKA 5BMSA 5BVOA 2OJGA 3GU6A 3KL8A 4RIXB 5DBXA 5FDXA 2BZIB 5GNKA 4IDVA 4D55A 3LIJA 3IOPA 2VZ6A 5C8NA 4C38A 4NM7A 5LWNA 4KKGA 5EFQA 4RRVA 5A6NA 1J1CA 3U6HA 3GI3A 5IA2A 2YM5A 4FV2A 2XRWA 4EQCA 3QHWA 4NIFA 2Z2WA 3JUHA 4YZDA 3B8QA 1BL6A 2XNGA 3FWQA 3Q53A 4YZCA 5LMKA 3FY0A 4ANSA 4L7SA 5J7HA 1YHWA 4K8AA 3DLZA 3UIMA 2C4GA 1FINA 4S34A 2C6LA 3CTQA 4E26A 1Q3WA 2YABA 2IVTA 1JWHA 2OFUA 2B4SB 4I5HA 4IJ9A 4CNHA 5JK3A 3I6UA 4YBJA 3A7FA 5E8ZA 3IPHA 4R3CA 3ZYAA 2QC6A 4IE9A 3SVVA 2X1NA 5EYDA 3R7GA 2XF0A 2OICA 3FZRA 3VO3A 2O2UA 4I41A 2QVSE 2CNQA 2NRUA 4HNIA 2J4ZA 1R0EA 2A1AB 3C51A 2PHKA 3ZM4A 4ZTSA 1O6YA 4FG9A 4FODA 3S4QA 3UNJA 1CTPE 1URWA 1Q8UA 5F1ZA 4AOTA 3RHXA 2UVZA 5LQFA 4YPDA 5JT2A 3ZUUA 5AUWA 3DK7A 2GCDA 4RG0A 2DUVA 3MTLA 3POZA 1FGIA 4MXOA 4AW5A 3ITZA 4DG3E 4EOKA 5EK7A 1P5EA 1KOAA 3WILA 5M07A 2C0TA 4ORKA 4ZY4A 4B8MA 4YC8A 1ZYDA 3L8SA 4XMOA 1KE9A 3CTJA 1EH4A 2WIHA 2XKEA 4J95A 5IA3A 3BV2A 4F6SA 3BPRA 4ASDA 4AAAA 3EB0A 4AU8A 3TNWA 4EKLA 3NYVA 5CSHA 3WZJA 3UE4A 3CJGA 4EORA 3W8LA 4W8EA 2UZNA 4A9TA 3PY1A 3IW6A 3AGMA 3ATTA 4CQEA 3QTUA 3UYTA 5CAQA 4JL9A 2I0EA 3P7CA 4A06A 2WTDA 3RJCA 2YJRA 3ORIA 4YHTA 2ZB0A 4QTCA 4DGOA 2VWVA 2G2IA 2VTJA 5EM6A 4UYAA 4FKVA 4CKRA 2XVDA 5M4CA 4E4NA 3BU6A 3NZ0A 2W4OA 3OUNB 3QRIA 4FUYA 3V5WA 4FV4A 2Y6OA 3QZFA 1WZYA 3VAPA 4X2GA 4G16A 4N57A 2VTOA 3FLSA 4J8MA 3CGFA 4QP4A 2J51A 5AP2A 4XRJA 1BL7A 2BFYA 4EQUA 1OI9A 3D7ZA 3KXMA 5D7VA 3TJDA 3SOAA 4BDEA 5EQYA 1UNGA 3FMLA 4RJ5A 1FBNA 3Q9XA 3N9XA 2OJJA 3QKKA 5CLPA 3SRVA 2YIXA 2IVVA 1PKGA 4QYGA 4AS0A 4EH9A 4YURA 2F57A 4FVQA 3PA5A 5BYZA 5CSXA 4BDHA 4D2WA 3NAXA 4TYGA 2YLEA 4ARKA 1JAMA 3NSZA 5CAPA 4BKZA 1XBBA 3ODZX 1HCLA 4NJ3A 5FUTA 4FTJA 1YXSA 3HMOA 4EH2A 4D1XA 5J1WA 2JFMA 3S95A 3HA6A 4AOJA 2UZOA 2X7GA 3R2BA 4BTFA 4IIRA 3OHTA 3CLYA 3EHAA 3M1SA 3QKLA 4ZTNA 3UOKA 3EL7A 4FUXA 4DEGA 5B0XA 4B4LA 5KNJA 3GB2A 4AN2A 4A4LA 1GZ8A 5E8YA 2QOCA 2B9IA 3DQXA 3V8SA 4O2PA 3NNWA 4L8MA 5A54A 2CNUA 1LEWA 4O91A 3QXPA 4K9YA 4QTAA 3P7AA 3MPMA 2VTIA 3R02A 2F2CB 5EM8A 4BICA 3CPCA 1T46A 3KRRA 3DZQA 4CFWA 4FEXA 4HYHA 3EH9A 4KKEA 3U51A 3C0GA 1OL6A 3PXRA 3V5TA 5KHXA 3AMYA 5L2SA 4H58A 4G5JA 5ETCA 3UMWA 2PL0A 3TNPC 3D0EA 4KRCA 2CCHA 4DGGA 5FXRA 3FUPA 4XNEA 3V6RA 5L6PA 4FTNA 2W1GA 4TWCA 1BKXA 2OXDA 4GFGA 5DRBA 3MH2A 2XEYA 5A46A 2Z02A 2ITPA 2R3IA 2VTHA 1ERKA 1VJYA 5AWMA 2LAVA 1V0PA 4BHNA 1H00A 1JKKA 4MNFA 5CU3A 4EOQA 4AQCA 2YIRA 4BCNA 2C6IA 1PHKA 1JBPE 2ITVA 3KB7A 4H36A 4LUDA 1UA2A 1QL6A 1UVRA 2OO8X 3EYHA 3QF9A 3EZRA 3GFWA 4NM0A 1YHVA 4AA0A 4UX9A 4EUUA 4FR4A 3BI6A 4J99A 4RVKA 5JMSA 2PMLX 2WHBA 4M68A 2AC5A 5C4KA 2F2UA 2BILB 2XUUA 2WTJA 4G3GA 4O7NA 3OF0A 4FIGA 4XYFA 2XNOA 4U44A 4O7LA 5EHOA 3TIYA 2WMUA 5J5TA 4EKKA 5IMEA 2QNJA 1O6KA 1WVYA 2WTWA 3IDPA 3QTZA 4L00A 2J0MB 1PMVA 2BZHB 4DCAA 5FEEA 5BYYA 5IH4A 3OWJA 3NW5A 5HNGA 3G33A 3Q6WA 4O38A 3TI1A 5AP5A 5IQIA 3HA8A 3UODA 5J79A 4G6OA 5FRIA 3BIZA 4KSQA 4NJDA 3EOCA 3JY9A 3MESA 3A61A 3WE4A 1PXLA 3ZOSA 1IEPA 1PXJA 4IWQA 4NYEA 2IWIA 3RKBA 2JDRA 4KABA 3QQKA 1JLUE 3G0FA 2PMIA 4E3CA 5ICPA 3W8QA 5LVMA 1H1QA 3VS2A 4ZMEA 3QQJA 5TO8A 3UBDA 4M8TA 5HX8A 4XV1A 2H9VA 5JKGA 5AP0A 4CTBA 1M52A 4QYEA 3MH1A 2GHLA 4G6LA 5M4IA 3UVRA 3KMMA 4KUJA 4EOLA 2CDZA 2G2HA 1V0OA 2WB8A 3DDQA 3DFCB 3O8TA 4HZRA 4YZ9A 4DA5A 3QA8A 4FX3A 5AR3A 2WMQA 4IZAA 2W9ZB 4IACA 4ACGA 2EXCX 3MJ1A 4G31A 3UIXA 2QG7A 2ITUA 4PQNA 4XV3A 1WCCA 2X9FA 4TWNA 5E1SA 4WA9A 4CSVA 2XKCA 5LXMA 3GC7A 1WVXA 2R3QA 3TUBA 4FIFA 1YKRA 2PVJA 5JZNA 4FMQA 2VO7A 4FF8A 4QRCA 2C5YA 5AR5A 4OTPA 4PF4A 4IB5A 2WNTA 3OXZA 5C9CA 4DG2E 3LHJA 3QGWA 3SW4A 3CY2A 3KXGA 4WNMA 3D14A 3E3PA 5AUZA 4F7SA 5EKNA 4CCUA 4Z7GA 2WAJA 3UGCA 3PRIA 5IA0A 3DXQA 2OLCA 1R78A 1DAWA 4I6BA 2VGOA 4JG7A 3FI3A 5AR7A 3U9NA 4U81A 4A7CA 3L9NA 3RCJA 4OT5A 2HZ4A 5J9ZA 5GIOE 3FQHA 1CSNA 3EQDA 3G6GA 3C9WA 1Q62A 5D41A 3RWPA 5D12A 5CXHA 4U5JA 4CLIA 2ACXA 1W98A 2J50A 3QGYA 2JLDA 5HO7A 5CYIA 2ONLC 5CEPA 4F6WA 4RMZA 2CHLA 4IAAA 4BDBA 4XHKB 1IR3A 3FKNA 4C3FA 2XKFA 1GAGA 3NR9A 5EG3A 4WT6A 3RAWA 4CTCA 3ZLSA 1OKZA 3DFAA 3KMWA 5I0BA 2QCSA 5A4QA 2CJMA 4O7WA 4KWPA 4IBMA 4KS7A 2JIIA 3ZFYA 5HBEA 4QMLA 3PSCA 3R01A 2BR1A 5C03A 4FV7A 3K5UA 5AEPA 2YM8A 3Q60A 1J7IA 4RA4A 4JG6A 3RI1A 2G2FA 1RW8A 4EK6A 3SG8A 4EONA 4II5A 1XWSA 2ZDTA 5I4NA 3NNUA 4YJOA 5JFWA 4GKHA 1OKWA 3DJ5A 3SXFA 2UZVA 3F66A 4MYGA 4PUZA 3VS4A 4G17A 4HVDA 1L3RE 5IU2A 4MBLA 5B7VA 4GJ3A 4JBQA 3ORPA 3VW6A 2XK6A 2XK8A 2GNFA 3ZLXA 5JZJA 3CD3A 3F7WA 4I5CA 2R0IA 2EUFB 4ANOA 4FICA 3ZEPA 4D5KA 4BDAA 4AFJA 5KX8A 2RGPA 4GMYA 2BCJA 4GT4A 5EYCA 4DFUA 2OFVA 3MN3A 2R7IA 3MY0A 3UQCA 4USDA 2OWBA 3QCSA 3R1NA 4ZEGA 4BR3A 5EYKA 2YLFA 4DH8A 4G3CA 2YM6A 2JITA 3UDBA 5ANKA 4FL2A 2VV9A 2R3HA 3ORZA 1MUOA 2PK9A 4C57A 4RFMA 3C50A 4FV6A 5D11A 4C62A 4IC8A 4K0YA 3ORNA 4U97A 4D4YA 4DH5A 3R21A 3ZSHA 4BBMA 3C0HA 3QU0A 3OG7A 1TQPA 5I3RA 3NYNA 1H1PA 2BRGA 5EDRA 1OBDA 4DT9A 1K2PA 3E8NA 4L44A 1TKIA 3BGPA 2PU8A 5FWKK 5JQ5A 3IOKA 3QRTA 4OTRA 4XV9A 3O7LD 2YDKA 4IANA 1MRVA 1OL1A 3MB7A 1JKTA 4BCHA 4C8BA 4X2NA 4HCUA 5HE2A 4F7LA 1K9AA 2XIXA 2C5NA 3COKA 3KK8A 4GH2A 3UO6A 5L2WA 2XKDA 3EYGA 3ANRA 1GIIA 4PL5A 5HHWA 5ACBC 4C02A 1NT2A 4HGEA 3PE2A 5TT7A 4WBOA 4WHZA 4W9WA 5CEOA 3FZOA 2WEVA 2FO0A 2WMVA 2HENA 5FP5A 4XX9A 3ZUTA 5DR2A 3CIKA 4BFMA 1XH7A 4QTDA 2XK9A 3E5AA 3R9DA 3T9TA 3R9NA 1MRUA 5L2QA 1M2PA 3LCTA 5CU2A 3DY7A 4I94A 4R7IA 3E87A 5GHVA 4B7TA 4R7HA 4FKUA 5HU3A 3ELJA 2OIDA 3TWJA 2PUIA 1H26A 2O0UA 2X8IA 4CMTA 4EH5A 3MDYA 5M08A 2BTRA 2W4JA 2ETKA 3ULIA 1GNGA 2F4JA 4F9BA 4BHZA 2IN6A 4X6QC 5JH6A 3HV5A 3E88A 3PJ1A 3QTWA 1OL2A 2BPMA 4BKJA 3MFTA 3PLSA 2IPXA 4GUEA 2XBAA 1AGWA 4O0VA 4RGJA 3R7YA 4C37A 4E7WA 3BQRA 5KO1A 5HZNA 3TTIA 3EN9A 2IW9A 4E1ZA 4CKJA 2QOLA 2Z7QA 3VF8A 3EQFA 2EXEA 3EQBA 3OWLA 4IMYA 4PY1A 3MY5A 2P2HA 3AC8A 3VN9A 2PVMA 3QC9A 5AUUA 5IH6A 2W9FB 2YM7A 3F6XA 4ZSGA 4N6YA 2ITQA 3E3BX 3DNEA 3QTXA 2UZBA 4W8DA 1OUKA 4C33A 4S32A 4CFUA 2EB2A 3PIYA 1UNLA 3WIKA 2ERZE 2QU6A 4IHPA 4CG8A 4DN5A 2XYUA 5DE2A 4HVIA 3ZH8A 4FSUA 3S2PA 3K2LA 2CLQA 4UZHA 3RGFA 4ZZOA 3U4UA 4ALUA 3KKVA 5CWZA 4FSNA 2PYWA 1V1KA 3MIYA 3OWKA 3HUCA 5CF5A 4IZ5A 3ZZWA 4E5BA 2QURA 5HGIA 3ATSA 2BMCA 1Q8YA 2OSCA 4RIWA 4HGTA 4BWKA 1YWVA 3NUPA 1SZMA 1DI8A 5CVHA 4E20A 4IAYA 5DT0A 3UP2A 4QP3A 3FYJX 4ZXTA 4RJ3A 5HIBA 4GV1A 5CENA 4AF3A 5A14A 1OUYA 4O0WA 3DOGA 3I60A 4JOAA 3W2OA 4ZZMA 4BTMA 4AWIA 3P5KA 3KRXA 4LMNA 2Y9QA 4ERKA 2CMWA 3M2WA 3N51A 4U6RA 4EWQA 3EQGA 2B9JA 4BDCA 3QZGA 4F4PA 3R7UA 4UEUA 4CV8A 1OVEA 2G01A 2GDOA 2OF4A 2XS0A 4M12A 3ANQA 4RFZA 4JVGA 3R7VA 4B8LA 4MXXA 3OVVA 4AGUA 2WGJA 4Q2AA 5CT7A 3RTPA 2UZWE 4E6AA 1Y8GA 2GQRA 1GZKA 3E7OA 5DT4A 3FDNA 3F82A 3KVXA 3LLTA 3EQHA 5I9UA 1XHAA 4XG4A 4D2RA 3O51A 3DU8A 4RZWA 4X7QA 3UIBA 3COHA 2YZAA 2Z60A 4KSPA 5A4EA 2R64A 3NCZA 1UU9A 4N6ZA 5HVJA 3WF5A 3LQ3A 5A4CA 2JKOA 2I40A 5HCZA 2JDOA 3OWPA 5G1XA 3GOPA 2QG5A 3HUBA 3OEFX 4DFNA 4EYMA 3TACA 5IA4A 2BTSA 2PMNX 2NP8A 3HMNA 4FEQA 2C69A 4KRDA 5F4NA 3RBWA 2J0JA 5KBRA 3R9HA 5AM7A 5HG9A 4EUTA 1YI4A 3UMXA 3QRKA 4PTEA 3EMGA 4MWHA 3MYGA 2W4KA 4H3BA 4QQCA 5E1EA 4HNFA 4QTEA 2XIZA 4ZY6A 2C6TA 2PE1A 2QOHA 4JBOA 4ZZNA 3B2TA 5DHJA 3H9OA 1OL7A 4I0TA 4IX5A 5E8UA 4JRNA 1XH5A 4I6FA 5AUVA 3SA0A 3LXLA 4X0MA 4O27B 2OW3A 3JXWA 4RWIA 2PZRA 5LMAA 4Y85A 3TZ9A 3HMPA 4JDHA 3DBQA 2VD5A 1TQIA 5EI8A 4TYEA 3JPVA 4QP1A 5HU9A 3G6HA 3CBLA 4IH8A 4O2ZA 3HVCA 1E9HA 1I44A 5BUIA 4QMPA 5HG5A 5KMIA 4J98A 1DS5A 4WSYA 1BMKA 5CEMA 1OB3A 4L9IA 4JRVA 4DFZE 5DR9A 4C7TA 2YDJA 3QZIA 4QMQA 2HY81 4XG2A 3V51A 4E6QA 5GIPE 5FGKA 3R8VA 1RE8A 2W1HA 3BE9A 1P14A 3G5DA 3PXYA 5BUEA 3F61A 2BKZA 3T8OA 1P4OA 3QTRA 2PPQA 3EFJA 3OCGA 4EBWA 3VQUA 2C5XA 3BLRA 1MQ4A 3EKKA 3QKMA 4Y83A 2Y0AA 3VBTA 2OJFE 4UY9A 2VTQA 3VVHA 2VWXA 2OG8A 3LQ5A 2ZMDA 3RK9A 5KMOA 2OIQA 4I23A 2P33A 2JC6A 2J6MA 3LFCA 4IQ6A 4YSMA 4C59A 3LVPA 4FKQA 3R1SA 4D58A 2WQNA 4AZWA 4PPBA 2BRMA 4FIHA 5A4TA 3I6WA 4RQKA 2GFSA 3HAVA 1FQ1B 2EWAA 2P2IA 2XCHA 3MI9A 3TIZA 5CS6A 1PW2A 2OXXA 4FZDB 4OR5A 4BZOA 5LMKC 3DCVA 3KXXA 5E8SA 3ZRKA 4F6UA 3QUEA 1BYGA 4RX5A 5E4HA 3T3VA 1WBOA 3FLWA 3BHYA 3SAYA 4CEGA 3PWDA 3P78A 5IUIA 3FI2A 3WZKA 3TUCA 2A19B 4FT9A 4K18A 5AAGA 2A4LA 3R71A 5IQFA 3OD6X 2WD1A 1YRPA 3AC5A 1H01A 2QO2A 2YCSA 4LGDA 1CKIA 3RK5A 3TV7A 4U3ZA 3IO7A 5AP7A 2YM4A 4PX6A 4E4LA 4CFNA 1M17A 4E6DA 2VTTA 5DR6A 4FV0A 5ETFA 4BZNA 5LMBA 2C6KA 3T3UA 3R22A 5HD7A 5E8TA 3UIUA 1IRKA 2VRXA 2V55A 2A2AA 2IO6A 3CE3A 4V04A 2XEZA 1J7LA 4BN1A 3C7QA 3KC3A 4G1WA 3ZM9A 3F5GA 5CEQA 4X2JA 4EYJA 1H25A 2WQBA 2UVYA 4Z3VA 3R83A 4QOXA 4C4FA 3FLYA 1AD5A 4FVRA 3VWAA 3LJ0A 4NSTA 4TYHB 3OBJA 5H8EA 2CKEA 1KE5A 3RAHA 1SNXA 2QKWB 3AQVA 2H34A 3HECA 2JDVA 3NUXA 4KIKA 3V5QA 4YSJA 3DXPA 2YIWA 3CSVA 4GT5A 1B38A 3WYYA 3BU5A 4OAVB 1NVRA 3N4VA 4YO4A 3GU7A 4C4IA 4GFOA 3R7EA 1URCA 3Q96A 5I5ZA 4IX4A 3LXKA 4YTFA 5K3YA 4MNEA 3PJ2A 1ZARA 4G3FA 2BALA 5AUTA 4NW5A 3H4JA 4HW7A 2PVHA 2X6DA 4A9UA 3D7TB 3PG3A 3TZMA 3GT8A 3PYYA 3NMUF 1REKA 4LG4A 4DEHA 3ORLA 2FSOX 3GXLA 4PNIA 3R2YA 4YLJA 4O0SA 3BU3A 5CQWA 2VX1A 4I20A 4JR3A 1HOWA 4H1MA 5CY3A 1RDQE 4ZTMA 3HRBA 3O8UA 2YEXA 2GHMA 4FNXA 4UXQA 4XG7A 3MBLA 4IX3A 2OK1A 3QYZA 5FP6A 4AGDA 3DBEA 4TTHB 3FI8A 3R8PA 2XP2A 1ZMVA 2RKUA 4MBJA 3W1FA 4M13A 2OU7A 2Q0NA 5HTBA 4XLVA 5L2IA 4GU6A 3VS5A 2XK3A 3V5JA 2ZM3A 1OMWA 5HE1A 2C3LA 3RINA 4BCQA 2R3PA 4C35A 3OCSA 3VUDA 5AA9A 5HIDA 1KSWA 3PY3A 4CCBA 5J7BA 3A4OX 5GZ9A 4UWCA 1BLXA 4U42A 4YJVA 4B0GA 4RLLA 3KN6A 5M55A 1OECA 2UZLA 2VTPA 4EHGA 1UKHA 4C36A 2OH0E 3CC6A 4LOQA 3VS6A 4ANLA 1SMHA 3C13A 5M4FA 3HKOA 4YMJA 1QPJA 1H28A 4WD5A 3IS5A 1T45A 3UOHA 1WMKA 4D2PA 3TNQB 1Q99A 5TF9A 4E8AA 3PSBA 5LJJA 2OZAA 2GS6A 5LWMA 4F9YA 2HZIA 1JSTA 3UOLA 2DWBA 3PIXA 2I0VA 2REIA 3BV3A 4QP6A 4F64A 4OTWA 4MD8E 3C5UA 2PVNA 3ZHPC 2P3GX 2GTMA 4QT1A 3VC4A 1X8BA 3LCKA 2IJMA 4GG5A 4YZMA 4FNYA 2ITNA 3QUDA 1S9IA 5EQPA 5DA3A 3JYAA 4FIJA 4FZ7A 3FMEA 4HVGA 4K11A 3G51A 5CI6A 5FLFA 5B2MA 5GINE 3AT3A 3H30A 2A0CX 4XH6A 3B2WA 4CKIA 5CNOA 3VJOA 5CF8A 2PSQA 2XM9A 5L8KA 2X9EA 3P08A 1A06A 2BVAA 2OI4X 2ITTA 5FEDA 3L1SA 3MPAA 4FKPA 1IA8A 4AGWA 1Q41A 1ZWSA 2NNWB 5L2TA 3D5WA 2GSFA 4YGAA 2UW5A 3OY1A 1GIHA 4NIFB 4D9UA 4PMMA 2FH9A 4FZFB 4IAFA 4RC3A 4O84A 4CG9A 4KIOA 2EB3A 4Q9SA 2WMRA 3W10A 4EZ3A 5K5XA 2BRBA 3C4WA 4KIQA 2R3GA 5F95A 4JQ7A 4DTBA 1NA7A 2ZOQA 3VUTA 4EK5A 3BHVA 3FC2A 3MGYA 2UZEA 2AC3A 5ANOA 5T6KA 3HL7A 3F7ZA 4EH6A 4RSSA 5K0KA 3UJGA 4EOIA 5IUHA 4GUBA 3U9CA 1YXVA 4FNZA 5AAFA 2WU6A 3RM7A 4A4OA 3IECA 2ETRA 4RA5A 2XB7A 4YJQA 2E9UA 5BQ0A 2PZYA 4I21A 3QBNA 3HDNA 4NCTA 1J7UA 3L9MA 1JKLA 1M7QA 2BIYA 3H9FA 4RIOA 3IGOA 5TR6A 2VX0A 4D2SA 4EBVA 3Q32A 3PXQA 4G2FA 2GTNA 2R4BA 5A9UA 2PWLA 3IONA 5LOHA 4GFMA 2C6DA 3FSFA 4OTFA 2RFDA 4CZYB 5DYJA 2FVDA 3ACJA 3I7CA 2W5BA 4APCA 4QQJA 1W8CA 3EN7A 3PJ3A 4O21A 4YZNA 2JDTA 2HELA 2OKRA 4AN9A 4CZUA 4W4VA 3VF9A 3UZTA 3CCNA 3ORMA 4H39A 3DBFA 4AZTA 4R77A 5AV0A 4DE4A 1O6LA 3ZCLA 3DJ6A 1PXMA 1Y8YA 5AX3A 1ZY4A 2XBJA 1M2QA 4ZTRA 4Q9ZA 3W18A 1H0VA 2PE2A 3G15A 4XG9A 1PYEA 5DIAA 1VYZA 4Y8DA 2QOOA 5AIRA 1Q8ZA 2CGVA 3GCQA 4MXZA 3M11A 2XIKA 4USEA 1WAKA 3IW7A 2W96B 1K3AA 4IC7A 1KE7A 4OTQA 4GK3A 4MBIA 3U4WA 4CRSA 1UU7A 1IA9A 5M4UA 3AD6A 4I3ZA 3LFDA 4PRJA 2V62A 2WMXA 3UO4A 3BZ3A 2B1PA 2WTCA 2GQGA 2VTLA 1F3MC 4M7IA 3RPVA 3COIA 4C2VA 4DFXE 4HPUE 5HVKA 5D1JA 1KE8A 4YJNA 2W06A 3BYSA 4NUSA 4TZRA 3F88A 3JVRA 3L9LA 5JFVA 4J96A 4V0GA 2FGIA 3KRJA 1YDRE 4AZFA 3ZBFA 3D15A 3ENMA 5C8MA 2XYNA 5I9VA 2Q83A 2YCFA 4EH7A 5IQDA 3TDVA 3QZHA 2J7TA 1PMEA 4BBFA 3ALNA 4DFBA 4OW8A 4I92A 4X3FA 3Q9WA 4BBEA 3SRVB 3BQCA 3R1QA 4FKSA 3G90X 3Q2JA 4UWBA 2XNEA 4DLIA 5EI6A 5IG1A 4LRJA 4X2KA 4O0YA 3IW8A 3VBQA 3W2CA 4NZWB 3GEQA 3WI6A 5EKOA 4C4GA 4QMUA 4IZYA 4FL1A 5CVGA 1OL5A 5HNBA 2HY0A 4G34A 4BCFA 1BI8A 1JOWB 4BDJA 4YU2A 4CV9A 3R9RA 4FL3A 5EI2A 3D9VA 4N70A 2RSVA 4EC9A 3AC2A 2WXVA 3HRCA 4OUCA 2WOUA 3KA0A 4YNOA 3UG2A 2HZ0A 5BVDA 4FSYA 4KB8A 2E2BA 5HBJA 2X81A 1UWHA 1O9UA 2IZTA 4ACCA 2VWUA 3C4CA 3LM0A 5KCVA 2QLQA 1U54A 3F2RA 4U40A 3PXZA 4MEDA 2XJ1A 3LAUA 2XCKA 4LM5A 3MIAA 4TY1A 4FOBA 2CGUA 3TZ7A 2IW8A 2SRCA 4YO6A 4L45A 3QQLA 5AP1A 4QMZA 5EOLA 4UYNA 4OT6A 4E5AX 3E62A 1YI6A 3AOXA 4YC6A 4GT3A 3P79A 4EZ5A 3PRFA 1DAYA 3PDTA 3CKWA 3AMAA 3ZO3A 4TXCA 1H27A 4WNKA 2PTKA 4FSQA 5AP6A 3CKXA 5BYLA 2YWPA 4JR7A 3HYHA 3HEGA 2YERA 3GCVA 4YJRA 1XH4A 3AC4A 5K0XA 4AN3A 1XBCA 4QPMA 4FSWA 1Q8TA 4GVJA 3P0MA 4HOKA 4D4SA 1W82A 1H0WA 3MVJA 4X6RA 4ZAUA 3LZBA 4OTIA 4DFLA 4QMWA 3KFAA 4M97A 3LMIA 4EHVA 2W1EA 4BGHA 1YDTE 4AA5A 2QR7A 3FMHA 4PTCA 3ORXA 5JQ8A 2AYPA 5I9WA 2WMAA 4CMOA 3A99A 3FEGA 2C5VA 3F3TA 5AJQA 2B53A 5AR2A 1PXPA 2R3FA 3RM6A 3UC3A 3MY1A 4FOCA 3HP5A 5CSWA 3QTQA 4IB1A 1YW2A 3SQQA 1DI9A 2BAKA 4D2TA 4MHAA 2PZIA 4ZY5A 5KHWA 2ITXA 3E8DA 3O50A 3ZRMA 4C2WA 4I22A 4AE6A 3PXKA 4FVPA 3OROA 5ACKA 3ZXZA 3MVHA 5TE0A 4O0XA 2F49A 2JAVA 5IQCA 1Q5KA 4JIAA 4MD9E 1PJKA 2NRYA 3QWJA 2HXQA 4FZ6A 4YPSA 3O71A 4XLIA 4CFMA 4FKRA 5HEZA 4F0IA 4PP9A 1BI7A 3W32A 2UW6A 3NW7A 5ANEA 2QO7A 3C4ZA 4FT5A 5AMNA 2Y7JA 4Q5EA 5EHYA 3NUAA 3R63A 3KULA 4BCJA 2VTRA 3EQCA 3GCUA 3PPZA 3FZSA 2X2KA 4ZSAA 1YHSA 1GJOA 1H1WA 4XP3A 4IFCA 5DI1A 3TV6A 4IJPA 1QMZA 2RFSA 5D7AA 4G3DA 2VWIA 4AACA 4BIEA 5AP4A 5BX0A 1FGKA 2XIRA 3SKCA 4RQVA 3D5XA 3K3JA 3IGGA 4BKYA 5AV3A 4CQGA 4EEVA 5FTGA 4ZSEA 2ZV8A 1V0BA 2B54A 3I81A 4YBKA 1ZYCA 3KCFA 2FB8A 5FM3A 2CKPA 2W1ZA 3BYMA 2YZLA 2CGXA 3MB6A 4I93A 4U41A 4UZDA 4YTIA 3EJ1A 4I6QA 4FBXA 4K77A 2WPAA 5KMMA 1NY3A 4NM5A 4D4RA 4DCEA 4J97A 3MFRA 2UW8A 3DGKA 4FKLA 3LOKA 3FI4A 4L6QA 3OCTA 3NAYA 4D5HA 4CGAA 1H08A 3O7LB 4QMYA 4CD0A 2BZKB 4F9AA 3FZTA 3KK9A 3QAME 5HNIX 2XJ0A 4FKTA 1ZYJA 4MXAA 5LVNA 3NUUA 2EXMA 4ALWA 4RIYA 2Y4IC 4QMOA 3BELA 4XCUA 5DNRA 3TNIA 4RJ6A 3O2MA 3PUPA 4S33A 1Q4LA 2X2MA 4E4XA 1LUFA 4P2KA 3HZTA 2CLXA 4RFYA 3TUDA 5E90A 2QOIA 4E93A 4F7NA 3ZC5A 5CAUA 2OGVA 4AW0A 4H3QA 3OTVA 4FV8A 4FKOA 4H05A 3MJ2A 3FV8A 4N0SA 4ZJJA 3FPMA 3PVUA 4ACDA 5H8GA 2PE0A 1PXNA 3R00A 1LEZA 3CR0A 5JRQA 2WKMA 2ZVAA 3A4PA 4PDYA 4QMMA 3UO5A 2P55A 2YITA 3HMIA 3LCOA 5AR4A 2UZUE 3CQWA 4FYOA 1VR2A 3UPXA 3IKAA 1STCE 2UVXA 1AQ1A 1HCKA 2WU7A 4IVAA 3UZPA 3VUHA 5LVPA 2GU8A 3ID6C 1RQQA 4AZVA 3A7IA 4AT4A 5H8BA 5M57A 3DA6A 5H9BA 4FGBA 1TVOA 2X7OA 5CU4A 4EOSA 3S1HA 3WIGA 3CPBA 5CF4A 2R7BA 3MPTA 1UU3A 3DAEA 4TNDA 4U45A 5DPVA 4U8ZA 2ZV2A 1UV5A 4NK9A 3RNIA 2WMBA 4C34A 3SGCA 4ANMA 1JSVA 3QX4A 4XOYA 4FTLA 3HRFA 3MVMA 2O63A 2OF2A 1FPUA 3DJ7A 4WIHA 4L67A 1CM8A 4U7ZA 4G3EA 4I24A 2YWVA 3PP1A 4IEBA 2CN5A 5EHLA 3FKLA 4MXYA 3QQUA 4FKWA 4ZTHA 5J8IA 3E64A 3QCQA 4FC0A 1Z5MA 4OTHA 4GW8A 4HGLA 4LL5A 3NDMA 4ANNA 4R78A 3N4UA 4RX9A 4H1JA 2ZMCA 4BC6A 4BDGA 4FTRA 1MRYA 4O22A 4YHFA 3QQFA 3OTUA 3NLBA 4JIKA 4PTGA 5CI7A 3DBCA 5BMMA 4LL0A 4ENYA 1Q61A 4F7JA 5JN2A 1W83A 3EL8A 1IASA 2FUMA 2OH4A 2VTSA 4HYIA 4L43A 4X2FA 5JGDA 5CALA 2NPQA 3DTCA 3EN5A 1ZZ2A 4M0YA 3EKNA 4CT2A 1PXIA 4YJSA 4DGMA 3OOMA 4M67A 2Y4PA 2PUPA 4R7BA 4JQEA 1F0QA 3FXZA 3WZDA 4C4EA 4BDIA 3ZLYA 4ZLYA 4PDPA 1NXKA 4CYIA 5BUJA 3NRMA 5CZHA 2RFEA 3Q9YA 2J9MA 5LVLA 3LW0A 3G9NA 3CXWA 4Y46A 1JSUA 3MA3A 4XG6A 5EYMA 4AE9A 2YJSA 1CDKA 3UTOA 3VS3A 3DKFA 2XNNA 1GOLA 4DT8A 1Q24A 2QONA 3BWFA 3FMDA 1KWPA 4EOPA 4XUFA 2IG7A 4L52A 4NTSA 4W4YA 4HVHA 2PVKA 4IADA 3FLNC 1YXUA 1WBPA 3QQGA 1OPLA 5HO6A 5J95A 4AX8A 2JIVA 4RT7A 2W5AA 4FE2A 4PP7A 3HGKA 3ZZEA 2JKKA 2W99B 1WVWA 4LOOA 1PF8A 5IPJA 4M84A 2ZYBA 4WSQA 5D9HA 2I1MA 5F94A 4BDFA 4RC2A 3GOKA 3NEWA 4LGGA 4UALA 3RCDA 5L6OA 4LV8A 3KU2A 4M69A 4CVAA 3THBA 3F3UA 2JFLA 3T9IA 2WQMA 1WBTA 3OW4A 3R04A 3WARA 2WTKC 5FBNC 3WF8A 4EHEA 4LQMA 1XR1A 5BVFA 3DPKA 2CSNA 5ANGA 2C0IA 3E8EA 4F70A 3QLFA 5IEVA 2G1TA 3O23A 4W4WA 4QD6A 4ZOGA 5LARA 4Y5QA 1OBGA 2RIOA 4OTDA 3PP0A 3OP5A 3A60A 3FMJA 4TYJA 4FSMA 5AFVA 3F3WA 3MV5A 1JKSA 2FSTX 2BAJA 4OTGA 3DDPA 4XJ0A 5J87A 3R8UA 4AP7A 3ZTXA 4G9CA 2BDJA 4QO9A 3DKOA 2QOFA 5DH3A 2B7AA 2PVRA 3W33A 3ZO1A 4BYIA 3AG9A 2JKMA 5DRDA 1JPAA 4XBUA 2I0HA 1JNKA 5JSMA 2UUEA 3FKOA 3NW6A 5AV2A 3U54A 4MD7E 5DLSA 2XNMA 3ZO4A 2Y4IB 4BWPA 2C30A 2ZJWA 2QI8A 5EDQA 4ZTLA 4DG0E 2W1DA 1XQZA 3JS2A 3KRLA 3LFBA 4S2ZA 1PXOA 2I0YA 2W1CA 5E91A 3KY2A 2R3MA 2J2IB 3NS9A 3LLAA 4LYNA 4QP8A 4PPCA 4ZJIA 2QR8A 2CN8A 3FZPA 3ZBXA 2R3JA 3ZXTA 1YWRA 2ESMA 4FYNA 4FV5A 3JVSA 3QA0A 5EH0A 4F99A 2VWZA 1KV2A 2WTIA 3HV4A 4GKIA 1Z57A 3DB8A 4FT3A 2GNJA 2OBJA 4DEBA 3KCKA 3FL5A 2V7AA 4L01A 5KBQA 3EFWA 3FHIA 4RIWB 2VTMA 4ZP5A 3WYXA 3HP2A 4S31A 1LP4A 4EK3A 5CANA 2PVFA 4XOZA 3V5LA 1ZMWA 4OLIA 2DS1A 2G9XA 2FA2A 5E8WA 3MH3A 2B52A 5FXQA 4ZLZA 3VBXA 4ACMA 3F9NA 1ZYSA 4DHFA 3BE2A 5L8LA 3GGFA 4EL9A 4KD1A 2I7QA 3UC4A 4F65A 4YTCA 2UW9A 2IZUA 1WBWA
chains in the Genus database with same CATH superfamily
3ZFXA 1MQBA 4R6VA 3ZONA 4DFYA 4EH4A 3Q9ZA 3QCXA 5M44A 4NL0A 4D28A 4YC3A 4BDDA 3CY3A 2B55A 5HICA 3QD4A 4YLKA 4UMQA 1OZ1A 2PVYA 2WTVA 3HMMA 4DAWA 3KVWA 2C6MA 3UZRA 4NFMA 5HLWA 3FAAA 4I4FA 4D0WA 3AC3A 3PJCA 2YACA 4IWDA 3C4FA 3LE6A 3NYOA 3OXTA 4Y95A 3AD5A 3JY0A 1QPEA 4QMVA 1OIQA 3PY0A 4RLKA 2C47A 5EW9A 5TOZA 4D1SA 4RIXA 1LR4A 5LVOA 5IQGA 2HWPA 3UNKA 4GVAA 3QD3A 3TJCA 5AIKA 2F9GA 2ZAZA 1ZXEA 1U4DA 3A8XA 5HG7A 3VUMA 3D2IA 3GC8A 3GC0A 3LPBA 5CSVA 3VUKA 4APPA 3U6JA 3SOCA 4FV1A 4PL3A 4MQ2A 1CMKE 4BWXA 3GP0A 1ZLTA 1IAJA 2RFNA 3RPOA 3VS0A 5IMXA 4IVDA 2HAKA 4BY9E 5CASA 5E92A 4KBKA 5KE0A 5T68A 3L8VA 3I7BA 3O17A 2GS2A 4M15A 3RPYA 4H3PA 3ULZA 3GUBA 3W2PA 4TNBA 3VRZA 5FM2A 3RVGA 3MA6A 3KQ7A 4KA3A 3A7JA 5F9EA 3A2CA 2E9PA 4FKJA 5I9YA 2ZM1A 3S3IA 4XV2A 4QP7A 2RF9A 3F69A 2HWOA 3MWUA 3PPJA 3VQHA 4JAJA 4RWKA 5DT3A 1BUHA 3CS9A 3OBGA 3DKGA 4P7EA 3GQLA 2QOBA 5HTCA 2JGZA 3GVUA 4F0GA 1M7NA 3NVMB 1FMOE 3DTWA 4DH3A 4JS8A 1WBSA 5GJFA 3VBYA 4BCPA 2RL5A 1Q8WA 2O5KA 5LCJA 3S0OA 2BHHA 3TDWA 2JD5A 5HCXA 1KE6A 4QQTA 2HZNA 5K4IA 2HIWA 1J91A 4HYUA 3NGAA 2XH5A 3ZSGA 3KF7A 2VWWA 5AV4A 3ZO2A 3WE8A 5AV1A 1PRYA 5GZ8A 4O0TA 3K54A 3II5A 2WEIA 2Q0BA 2X7FA 5KMNA 5C1QB 2BRHA 4CYJA 1UNHA 4GK2A 3GQIA 5I9XA 4QMNA 4ASZA 5CF6A 4O7YA 3PG1A 3PTGA 1GY3A 4WG5A 2WTKB 2XZSA 3OXIA 3U87A 3LFAA 3DNDA 1UU8A 2V5QA 3RZFA 4MTAA 5HE3A 3NUYA 3TCPA 3BYUA 3KMUA 3KRWA 4CRLA 3DQWA 3ZLWA 1VZOA 4RX8A 2UV2A 3NYXA 1H07A 2CCIA 3BHHA 5J5SA 2R2PA 1F5QA 3M42A 4UMPA 2OIBA 4AT5A 3GFEA 3BRBA 4ASEA 4CXAA 3D83A 4M3QA 4MQ1A 2QQ7A 5DWRA 4WNOA 2VU3A 5JEBA 3Q4CA 5BVWA 2CGWA 1ZYLA 3BHUA 4TPTA 3N4TA 3ZC6A 3KGAA 5FTOA 4XS2A 4F1MA 2HOGA 4FIIA 4O1OA 1S9JA 1YOLA 4L3LA 5FTQA 4MK0A 4FEUA 2WFYA 3A8WA 2WZJA 4PDOA 1OGUA 3SV0A 4MVFA 1NW1A 4U9AA 3RK7A 3KXNA 4I5PA 5K5NA 3BKBA 4NCTC 2VO3A 5HBHA 1OITA 3Q6UA 4MXCA 1FVTA 2YISA 3BBWA 5HLPA 4O82A 5JRSA 5IDPA 1TFFA 4JX7A 2IW6A 2BDFA 4C58A 1XJDA 3OOGA 3QRUA 2HYYA 4MKCA 4RJ4A 2J0IA 4GRBA 4UWYA 4TW9A 3ZUVA 4R1VA 5HESA 3LMHA 4LMUA 2GNLA 3BEAA 4JG8A 4EH3A 3QQHA 3U55A 2X39A 2VTAA 2C3IB 2Z7RA 4D0XA 5CEKA 4RJ8A 5EQEA 5M06A 3QRJA 2W05A 3TN8A 3PWYA 2YHVA 2C3JA 2O3PA 3OS3A 4HCTA 3W0MA 5KMJA 4FSRA 4BI1A 5AR8A 4AGCA 3MFUA 2UW4A 4YP8A 5IKWA 4TL0A 5A6OA 3MVLA 3KN5A 4KIKB 3P4KA 3OT3A 4TT7A 4PNKA 2GMXA 2CKOA 4MAOA 4WUAA 3HLLA 4NU1A 4B9DA 4FT0A 3FQEA 3I0QA 1UWJA 3DKCA 1W7HA 3K5VA 3V8TA 1SVEA 5K9IA 4JXFA 4O6LA 2C1BA 3F2AA 2UZTA 3BCEA 4FTUA 4MNEB 3E63A 5FXSA 3G9LX 4O7ZA 2X2LA 4DBXA 1OIRA 1VYWA 2YA9A 4L7FA 3QFVA 5DMZA 4AW1A 2PY3A 3GCSA 2QODA 4D4VA 3GBZA 4U43A 1OIYA 2PUNA 3TKIA 4FA2A 4PDSA 3ZEWA 1XH8A 3CGOA 4FNWA 3DT1A 4Z55A 3D5UA 2DQ7X 2YDIA 4ALVA 4O4EA 3BWJA 4PWNA 2VNYA 4RWJA 3SC1A 4BIBA 2Y6MA 3EZVA 4ONAA 2H8HA 3WZUA 4E6CA 2QLUA 4X3FC 1XKKA 1H1SA 5HD4A 3LKMA 4KS8A 5C26A 3SXSA 4IB0A 3ZFMA 4R3RA 3U8WA 3TEIA 4X21A 1SVHA 3VIDA 4AXEA 3AXWA 3ZMMA 4JJRA 4NH1A 3IG7A 2WMSA 4DC2A 3QTSA 4JLCA 3CP9A 4O7TA 4KIPA 4XRLA 4ZLOA 3DLSA 5ANIA 2E9VA 4WBBB 2IVSA 5EW8A 4IVBA 4EZ7A 3UQGA 3EN6A 3TL8A 4JDKA 2VWBA 5FEQA 2OZAB 4CFXA 4F09A 4J8NA 4QYFA 4QQ5A 3Q52A 3RWQA 4GSBA 2QOQA 2Y8OA 2R3OA 4DEEA 4E5WA 1VEBA 2UW0A 4FEWA 1XMLA 2PVLA 3RALA 2X0QA 3COMA 3OMVA 5K4JA 3VHKA 4GL9A 3TG1A 1WBNA 3Q4TA 5BPYA 1FOTA 2NO3A 3PFQA 4BDKA 3FPQA 3NUNA 4FTMA 4K1BA 3FMKA 4J7BA 2ZV7A 3O0GA 4J71A 4G9RA 4LRKA 2ZB1A 3GU4A 1RJBA 2GNHA 2V7OA 5FBOA 2V22A 3KIOC 2QD9A 1G8SA 2GNIA 5CTPA 2B0QA 4HYSA 4Y73A 2X8DA 4MWIA 3QL8A 3R7OA 4PMPA 2ITZA 2ETMA 4EK8A 3VBVA 5EOBA 2FSLX 4O0RA 3EQRA 4WO5A 5BVEA 4NTTA 3R73A 2X0GA 2ITWA 2X0PA 4RBLA 4YLLA 3W16A 3OUKA 4IDTA 4U3YA 3RAKA 4N4SA 3PVBA 4BGQA 2AUHA 3NIZA 2BZJA 4JDIA 4A9YA 4AUAA 3U6IA 4F1OA 4FT7A 4GYGA 4P90A 4FK3A 4ITHA 2YN8A 4R5SA 2B9FA 5ANDA 3SG9A 2HCKA 5IEYA 1R3CA 2BKKA 4F08A 2XK4A 3UYSA 3GENA 3VHEA 4Z16A 5J9LA 1BX6A 4PV0A 5LCKA 4QYYA 5IQHA 4G6NA 3ZSIA 5FQDC 5DEWA 4IXPA 5ETAA 2G15A 4WNPA 4EH8A 5CAVA 4IM2A 2XMYA 1ZOEA 2IZRA 4KINA 4Z7HA 2CPKE 2WIPA 2WMTA 5C27A 3DBDA 1J1BA 2E9NA 3OW3A 4WRSA 3CEKA 4ASXA 3E93A 2HK5A 4QYHA 2W1FA 2JDSA 5CXZA 1W2CA 4EJNA 4TKSA 3RPRA 3DK6A 1JVPP 4QNYA 5E7RA 5HORA 3C4XA 2P4IA 4YJPA 4AZEA 2EVAA 4EJ7A 3OEZA 2ITOA 1YOJA 5L8JA 2O64A 5AA8A 5HX6A 3TTJA 2QHNA 5CQUA 4DH1A 3BBTB 5ANJA 5M53A 4BGGA 3PE1A 4YHJA 5AUXA 4O7RA 2GNGA 2ERKA 2WMWA 2F7ZE 3NCGA 5ETIA 3LFSA 5GJDA 4C61A 3EN4A 3ORKA 4YR8A 3L9PA 5C8KA 5T3QA 5DGZA 1PXKA 3ACKA 3SHEA 3D5VA 3CD8A 3REPA 3V01A 3CTHA 3ZS5A 4EWHA 3P23A 3ENHA 5C01A 2E9OA 4GS6A 1M2RA 4B6LA 4YNEA 3PLAE 3R30A 3L8XA 1XO2B 3F3ZA 4DYMA 4EK4A 1Z9XA 2BROA 3CJFA 3BLHA 4L3JA 4TYIA 3PZEA 5I3OA 1WBVA 3FYKX 5AM6A 4DEIA 3H3CA 3VBWA 2Z8CA 4FSTA 4G5PA 1REJA 3DZOA 5A4LA 4MF1A 4NM3A 2YCRA 2BFXA 3A7GA 3I1AA 2IZSA 3P9JA 3DK3A 4FTCA 2YIYA 5IZFA 1YXTA 5FDPA 3BYOA 1ATPE 4FEVA 3EFKA 3P86A 5E9EA 1PYXA 1YWNA 1ZZLA 2BRNA 4MH7A 4V0GB 4EI4A 5HIEA 5IF1A 2BUJA 3W0PA 1GZNA 4DF3A 3RAIA 3KXHA 3LM5A 1GZOA 3TV4A 3IW4A 3K3IA 4L3PA 4DBNA 2F7XE 4R8QA 3R28A 4X3FB 1SM2A 3PPKA 3LFFA 4GU9A 2F7EE 4ZS4A 2XNBA 1PY5A 3R8LA 1U5RA 3FLZA 1H8FA 3QWKA 4X3JA 3GU5A 3V3VA 3EQIA 3JR1A 4XEYA 4FTKA 1Y6BA 5KMLA 3MH0A 4RX7A 1U59A 3EWHA 3LMGA 4I0SA 1FMKA 3V8WA 5BVKA 2FYSA 3FE3A 2JEDA 4O0UA 4XG3A 4BJJB 3C5IA 3OFMA 2XIYA 4C4HA 4BVUA 4QP9A 3FQSA 4U0IA 3C1XA 4JX3A 2C3KA 4AW2A 2BIKB 4CFVA 2R3KA 4V05A 4JI9A 5AP3A 1U54B 2V0DA 4ZSJA 1CKJA 3PIZA 3ROYA 4YTHA 4MF0A 3ODYX 4BTKA 1M14A 2JKQA 3KEXA 1KUTA 3E8CA 3PA4A 2KTYA 5KMKA 4EHZA 1LPUA 2VAGA 2WQEA 5E8XA 4QPAA 4ZTQA 3F3VA 3TKHA 3LCDA 4F9WA 2J90A 3KXZA 3P5JC 2R5TA 4NWMA 3I0OA 5CZIA 5B2LA 2GS7A 5ITAA 3IQ7A 4O86A 4GK4A 4A9SA 4UN0C 3TKUA 4QP2A 4I5MA 3GU8A 3LJ1A 4RVMA 5EM7A 5E8VA 2QKRA 2OXYA 4QPSA 3P1AA 1OM1A 4U80A 4UXLA 4C4JA 3D4QA 1TQMA 4S30A 4DINA 2KULA 3VJNA 3SW7A 5L3AA 4WG4A 4I6HA 4BTJA 2PMOX 2XRUA 4JQ8A 4TRLA 3H0YA 1P2AA 4GCJA 5KZ0A 1P4FA 3MFSA 2CNVA 1H4LA 3I5NA 5EDPA 1CKPA 2WELA 4ITIA 3OT8A 5F20A 1OIUA 2JAMA 2WO6A 3EQPA 3AD4A 3I5ZA 4FI1A 4KNBA 1I09A 4U79A 5B2KA 1R0PA 2P0CA 3LXNA 4NW6A 4O6EA 3AC1A 4TWPA 4BCGA 1FVRA 3QD0A 3WBLA 3FC1X 4AZSA 3DAJA 4M66A 4QMSA 2VO0A 3OCBA 5IH5A 4E4MA 4UV0A 4EQMA 3MW1A 3FLQA 5CX9A 3F5UA 4LV5A 2PUUA 4L46A 5DEYA 5BNJA 4FV9A 4DITA 2ZM4A 4ENXA 3LXPA 3P7BA 1ZY5A 3VUIA 1PMUA 4F9CA 2QO9A 5JGAA 2BHEA 5GJGA 3BGZA 1WFCA 3ORTA 1G3NA 3EIDA 2R0UA 4FK6A 4FKIA 1G8KA 3QCYA 4IM3A 4C0TA 3Q5ZA 4J52A 3ALOA 4TWOA 3GC9A 1YOMA 4IAKA 4JT3A 3R0TA 4GJ2A 4WUNA 2LGCA 3W55A 4BI2A 4O1PA 5A3XA 3UPZA 5G6VA 3HV3A 3CQEA 5J1VA 5FD2A 3KULB 4ZK5A 3TT0A 3DAKA 4DGLC 2DYLA 5HKMA 2UZDA 3C4EA 5M51A 2C1AA 1ZOGA 2ONLA 4M14A 3SDJA 4IWOA 1SNUA 4K33A 4JAIA 2VX3A 3D2KA 2YM3A 3Q3BA 3QHRA 1IAHA 1ZOHA 3FMNA 4WOVA 1GIJA 5H2UA 3AT4A 4ANBA 3BHTA 4BL1A 3E7VA 5IA5A 3TZ8A 4CLJA 1YQJA 3QTIA 3TNHA 4LI5A 4QNAA 3VUGA 5TKDA 4ANQA 5IUGA 5AUYA 3W2SA 3KREA 4RVTA 1XH6A 3UG1A 3IDCA 1OPJA 4EOJA 1YI3A 5HG8A 4EC8A 5HQ0A 3TM0A 4CT1A 3VULA 5IEXA 4FZAB 2IVUA 3R1YA 3LQ8A 3MS9A 2I6LA 3R8MA 5CU0A 4YZBA 1QPCA 2C5OA 4HVSA 1H24A 4FTTA 2VWYA 3MTFA 3S00A 3ZRLA 5IQAA 3RNYA 4RIYB 4KAOA 2R9SA 5DFPA 5IA1A 1PKDA 1SVGA 4KKHA 1R39A 4PMTA 1KOBA 3HNGA 3LFQA 3PVGA 3Q4UA 4IAZA 3RP9A 3SX9A 4D1ZA 4USFA 5HLNA 3DB6A 2WQOA 3H10A 2ITYA 3O5AA 4IZ7A 5KKRC 4F63A 3KF4A 2W17A 4O4FA 4WG3A 2CKQA 1G5SA 4IM0A 2YAKA 2GQSA 1G8AA 2J5FA 1E1XA 3R6XA 4OBQA 4RJ7A 2YFXA 1B6CB 3FHRA 2PZPA 4IAIA 3O8PA 1Y6AA 3QLGA 5IISA 2A27A 2X4FA 5CU6A 4DHZA 4FTOA 4DHJA 4ACHA 4DTKA 4RWLA 1OKYA 5KZIA 3OY3A 2R3RA 4FJVA 5AX9A 4UMTA 4GIIA 2JBOA 3VW8A 2UW3A 1YDSE 1U46A 5HCYA 1A48A 4RPVA 2HW6A 4J53A 4P4CA 4BCOA 5KUPA 1XH9A 1FVVA 3LJ2A 4C3PA 4FV3A 1W2DA 3FZ1A 3L8PA 1OPKA 2QHMA 3OC1A 1QPDA 1MP8A 3SD0A 4LV7A 4MX9A 4ERWA 3WF7A 2XANA 4F0FA 4GYIA 4IFGA 4PL4A 2VGPA 4FTAA 2C68A 4FG8A 4RZVA 1U5QA 1ZMUA 4OBOA 4BCMA 5C4LA 2QU5A 3HAMA 4AXAA 1Y91A 4Y72A 3PFYA 4FTQA 4LUEA 3AGLA 2XA4A 4I1ZA 2PZ5A 4W9XA 4FGRA 4JBVA 2OJIA 3Q4ZA 3UVPA 5CVFA 1Y57A 2GHGA 3PZHA 4D2VA 5JFXA 2BDWA 1TZDA 3NX8A 3PXFA 3RMFA 4RC4A 3SLSA 4Q5HA 2RG5A 4QMXA 5CSPA 2JBPA 2BAQA 4EOMA 3GNIB 4A9RA 5H3QA 5BVNA 3NNXA 3CQUA 5D10A 2W1IA 1KV1A 1OKVA 1IG1A 3WF6A 4IX6A 2Z7SA 4OAUC 3FXXA 4JDJA 4NKSA 4QTBA 3ETAA 5HTIA 3VS1A 4KBCA 1W0XC 2X8EA 2HW7A 4ITJA 4BCIA 4LOPA 4QMTA 3LFNA 4IB3A 4R5YA 3TXOA 2B9HA 4DEAA 2UW7A 1R1WA 4I4EA 4BB4A 3OZ6A 2J5EA 3G0EA 1DM2A 4P5ZA 3BEGA 3NIEA 3VS7A 3ERKA 3O96A 4YJTA 4ZIMA 3IDBA 1W84A 3VNTA 4AFEA 2XM8A 4XP0A 4BIDA 3LCSA 3FXWA 4AOIA 3QXOA 4A4XA 4ZJVA 2W5HA 3HX4A 4J1RA 4YJUA 3MSSA 2ZV9A 3E92A 3FBVA 4LRMA 3H0ZA 4YUQA 4C3RA 2O65A 4CMUA 2X6EA 3FMMA 3NNVA 3A62A 3HV7A 4DTAA 3ET7A 3W0OA 2J0KA 3PJ8A 3R8ZA 3HDMA 4LGHA 4O81A 1H1RA 2RG6A 3RHKA 1Q97A 5DVRA 3BGQA 1J3HA 3RPSA 3UVQA 4FIEA 4PMSA 2JIUA 5DG5A 3AMBA 4PPAA 4A07A 1YVJA 4BYJA 4GIHA 1A9UA 5HOAA 5HVYA 4DGNA 3V5PA 5M56A 2C0OA 1QCFA 4O83A 5FG8A 3F5XA 4O7VA 5M09A 4UMUA 3UQFA 4M69B 3ZDIA 2R3NA 4GG7A 2OZOA 2QOKA 3W2RA 4BF2A 5I9ZA 3EFLA 1XBAA 2W0JA 4XP2A 3R9OA 3I79A 5GZAA 2VNWA 5IDNA 1NVQA 4R3PA 3POOA 3H9RA 4TYHA 4L42A 1ND4A 4WKQA 4FG7A 4UMRA 2GPHA 3Q5IA 1NVSA 4NEUA 2WOTA 3ZU7A 3NVKI 3VRYA 2HXLA 4L53A 4WRGA 5CNNA 5IQEA 5DOSA 4Z9LA 2ZDUA 4CFFA 3QUPA 2OJ9A 2VTNA 2YAAA 3NWWA 4HJOA 4E73A 4O7SA 5AADA 3QX2A 3UNZA 2C6EA 4ZMFA 2XK7A 3A7HA 3ROCA 2H96A 2EU9A 5CAOA 4RVLA 3V04A 4DEDA 3QALE 4NFNA 5JFSA 3AKJA 1SYKA 3QD2B 3UP7A 4HCVA 3D7TA 4O96A 3DXNA 4BCKA 3F5PA 3V6SA 5CEIA 1YXXA 2XNPA 4NKAA 4FKGA 4W4XA 4IWPA 4XBRA 3W2QA 4BZDA 3NPCA 2VN9A 1B39A 3G2FA 3FJQE 1UKIA 2VO6A 2O8YA 4HZSA 2VUWA 3B8RA 4V01A 2R3LA 2YCQA 4UB7A 2Z7LA 5KKRB 4JBPA 3C0IA 4M0ZA 3BX5A 3Q2MA 4R1YA 5HE0A 1L8TA 5HI2A 1ZAOA 4DLJA 3IW5A 3PSDA 5EW3A 5DN3A 4TN6A 4AT3A 2FSMX 4BRXA 3Q04A 4Y5HA 1APME 4MCVA 1JQHA 2C6OA 2YIQA 4IW0A 3QC4A 5J9YA 4CZTA 4D9TA 4EOOA 2GFCA 1PMNA 2X4ZA 3WOWA 1ZRZA 4ID7A 4AA4A 2XJ2A 3IK3A 4ZS0A 4DH7A 4FSZA 5JGBA 5IQBA 4L68A 4OBPA 3PA3A 1Q3DA 4I0RA 2W7XA 3WF9A 4F1TA 3BYVA 3NUSA 4JNWA 2J0LA 3WZEA 5AAEA 3BLQA 5L4QA 3UOJA 3QYWA 3DS6A 3PVWA 3ZDUA 3DV3A 4KBAA 4OGRA 3R7IA 4NT4A 3D94A 4O4DA 4P5QA 3GCPA 5CT0A 4FTIA 4BI0A 3FL4A 3I4BA 3F2NA 4HGSA 1E1VA 4GEOA 3FY2A 4K6ZA 5L6WL 3RZBA 3SXRA 3HV6A 4B99A 2PULA 4IVCA 4LFIA 3LFEA 4UBAA 4XG8A 5EM5A 5HO8A 4K2RA 4HPTE 4AG8A 4QDEA 4ZSLA 2H6DA 3AT2A 3FSKA 5BMSA 4DDIA 5BVOA 2OJGA 3GU6A 3KL8A 4RIXB 5DBXA 5FDXA 2BZIB 5GNKA 4IDVA 4D55A 3LIJA 3IOPA 2VZ6A 5C8NA 4C38A 4NM7A 5LWNA 4KKGA 5EFQA 4RRVA 5A6NA 1J1CA 3U6HA 3GI3A 5IA2A 2YM5A 4FV2A 2XRWA 4EQCA 3QHWA 4NIFA 2Z2WA 3JUHA 4YZDA 3B8QA 1BL6A 2XNGA 3FWQA 3Q53A 4YZCA 5LMKA 3FY0A 4ANSA 4L7SA 5J7HA 1YHWA 4K8AA 3DLZA 3UIMA 2C4GA 1FINA 4S34A 2C6LA 3CTQA 4E26A 1Q3WA 2YABA 2IVTA 1JWHA 2OFUA 2B4SB 4I5HA 4IJ9A 4CNHA 5JK3A 3I6UA 4YBJA 3A7FA 5E8ZA 3IPHA 4R3CA 3ZYAA 2QC6A 4IE9A 3SVVA 2X1NA 5EYDA 3R7GA 2XF0A 2OICA 3FZRA 3VO3A 2O2UA 4I41A 2QVSE 2CNQA 2NRUA 4HNIA 2J4ZA 1R0EA 2A1AB 3C51A 2PHKA 3ZM4A 4ZTSA 1O6YA 4FG9A 4FODA 3S4QA 3UNJA 1CTPE 1URWA 1Q8UA 5F1ZA 4AOTA 3RHXA 2UVZA 5LQFA 4YPDA 5JT2A 3ZUUA 5AUWA 3DK7A 2GCDA 4RG0A 2DUVA 3MTLA 3POZA 1FGIA 4MXOA 4AW5A 3ITZA 4DG3E 4EOKA 5EK7A 1P5EA 1KOAA 3WILA 5M07A 2C0TA 4AXCA 4ORKA 4ZY4A 4B8MA 4YC8A 1ZYDA 3L8SA 4XMOA 1KE9A 3CTJA 1EH4A 2WIHA 2XKEA 4J95A 5IA3A 3BV2A 2XAMA 4F6SA 3BPRA 4ASDA 4AAAA 3EB0A 4AU8A 3TNWA 4EKLA 3NYVA 5CSHA 3WZJA 3UE4A 3CJGA 4EORA 3W8LA 4W8EA 2UZNA 4A9TA 3PY1A 3IW6A 3AGMA 3ATTA 4CQEA 3QTUA 3UYTA 5CAQA 4JL9A 2I0EA 3P7CA 4A06A 3BLAA 2WTDA 3RJCA 2YJRA 3ORIA 4YHTA 2ZB0A 4QTCA 4DGOA 2VWVA 2G2IA 2VTJA 5EM6A 4UYAA 4FKVA 4CKRA 3AKKA 2XVDA 5M4CA 4E4NA 3BU6A 3NZ0A 2W4OA 3OUNB 3QRIA 4FUYA 3V5WA 4FV4A 2Y6OA 3QZFA 1WZYA 3VAPA 4X2GA 4G16A 4N57A 2VTOA 3FLSA 4J8MA 3CGFA 4QP4A 2J51A 5AP2A 4XRJA 1BL7A 2BFYA 4EQUA 1OI9A 3D7ZA 3KXMA 5D7VA 3TJDA 3SOAA 4BDEA 5EQYA 1UNGA 3FMLA 4DDGA 4RJ5A 1FBNA 3Q9XA 3N9XA 2OJJA 3QKKA 5CLPA 3SRVA 2YIXA 2IVVA 1PKGA 4QYGA 4AS0A 4EH9A 4YURA 2F57A 4FVQA 3PA5A 5BYZA 5CSXA 4BDHA 4D2WA 3NAXA 4TYGA 2YLEA 4ARKA 1JAMA 3NSZA 5CAPA 4BKZA 1XBBA 3ODZX 1HCLA 4NJ3A 5FUTA 4FTJA 1YXSA 3HMOA 4EH2A 4D1XA 5J1WA 1G8JA 2JFMA 3S95A 3HA6A 4AOJA 2UZOA 2X7GA 3R2BA 4BTFA 4IIRA 3OHTA 3CLYA 3EHAA 3M1SA 3QKLA 4ZTNA 3UOKA 3EL7A 4FUXA 4DEGA 5B0XA 4B4LA 5KNJA 3GB2A 4AN2A 4A4LA 1GZ8A 5E8YA 2QOCA 2B9IA 3DQXA 3V8SA 4O2PA 3NNWA 4L8MA 5A54A 2CNUA 1LEWA 4O91A 3QXPA 4K9YA 4QTAA 3P7AA 3MPMA 2VTIA 3R02A 2F2CB 5EM8A 4BICA 3CPCA 1T46A 3KRRA 3DZQA 4CFWA 4FEXA 4AAYA 4HYHA 3EH9A 4KKEA 3U51A 3C0GA 1OL6A 3PXRA 3V5TA 5KHXA 3AMYA 5L2SA 4H58A 4G5JA 5ETCA 3UMWA 2PL0A 3TNPC 3D0EA 4KRCA 2CCHA 4DGGA 5FXRA 3FUPA 4XNEA 3V6RA 5L6PA 4FTNA 2W1GA 4TWCA 1BKXA 2OXDA 4GFGA 5DRBA 3MH2A 2XEYA 5A46A 2Z02A 2ITPA 2R3IA 2VTHA 1ERKA 1VJYA 5AWMA 2LAVA 1V0PA 4BHNA 1H00A 1JKKA 4MNFA 5CU3A 4EOQA 4AQCA 2YIRA 4BCNA 2C6IA 1PHKA 1JBPE 2ITVA 3KB7A 4H36A 4LUDA 1UA2A 1QL6A 1UVRA 2OO8X 3EYHA 3QF9A 3EZRA 3GFWA 4NM0A 1YHVA 4AA0A 4UX9A 4EUUA 4FR4A 3BI6A 4J99A 4RVKA 5JMSA 2PMLX 2WHBA 4M68A 2AC5A 5C4KA 3TYKA 2F2UA 2BILB 2XUUA 2WTJA 4G3GA 4O7NA 3OF0A 4FIGA 4XYFA 2XNOA 4U44A 4O7LA 5EHOA 3TIYA 2WMUA 5J5TA 4EKKA 5IMEA 2QNJA 1O6KA 1WVYA 2WTWA 3IDPA 3QTZA 4L00A 2J0MB 1PMVA 2BZHB 4DCAA 5FEEA 5BYYA 5IH4A 3OWJA 3NW5A 5HNGA 3G33A 3Q6WA 4O38A 3TI1A 5AP5A 4QDVA 5IQIA 3HA8A 3UODA 5J79A 4G6OA 5FRIA 3BIZA 4KSQA 3UDSA 4NJDA 3EOCA 3JY9A 3MESA 3A61A 3WE4A 1PXLA 3ZOSA 1IEPA 1PXJA 4IWQA 4NYEA 2IWIA 3RKBA 2JDRA 4KABA 3QQKA 1JLUE 3G0FA 2PMIA 4E3CA 5ICPA 3W8QA 5LVMA 1H1QA 3VS2A 4QEBA 4ZMEA 3QQJA 5TO8A 3UBDA 4M8TA 5HX8A 4XV1A 2H9VA 5JKGA 5AP0A 4CTBA 1M52A 1ST4A 4QYEA 3NFFB 3MH1A 2GHLA 2AQXA 4G6LA 5M4IA 3UVRA 3KMMA 4KUJA 4EOLA 2CDZA 2G2HA 1V0OA 2WB8A 3DDQA 3DFCB 3O8TA 4HZRA 4YZ9A 4JMQA 3QA8A 4DA5A 4FX3A 5AR3A 2WMQA 4IZAA 2W9ZB 4IACA 4ACGA 2EXCX 3MJ1A 4G31A 3UIXA 2QG7A 2ITUA 4PQNA 4XV3A 1WCCA 2X9FA 4TWNA 5E1SA 4WA9A 4CSVA 2XKCA 5LXMA 3GC7A 1WVXA 2R3QA 3TUBA 4FIFA 1YKRA 2PVJA 5JZNA 4FMQA 2VO7A 4FF8A 4QRCA