4QP1A

Crystal structure of erk2 in complex with n-cyclohexyl-9h-purin-6-amine
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
349
structure length
342
Chain Sequence
EMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFDDLPKEKLKELIFEETARFQPGYRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Fragment-based discovery of potent ERK2 pyrrolopyrazine inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 103
structure length 342
sequence length 349
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qp1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qp1A01
1PXKA 2W96B 4RG0A 5GZ9A 2UZTA 2BRHA 3FZSA 3FC1X 4XJ0A 4C8BA 4H3QA 4EHZA 2OFUA 2Y8OA 2JDVA 2VTTA 3QX2A 4WOVA 5IQAA 1P4OA 3CJFA 4FT7A 4ASXA 2QC6A 4BBFA 2O63A 2CKQA 1VYWA 3AQVA 5CASA 4FV6A 4XLIA 2PU8A 5IQFA 5BMMA 2YM7A 3R8ZA 4R7BA 4OT6A 5H8GA 2C3JA 1KE8A 3PLAE 2WEVA 3H4JA 4ASEA 4N6YA 5F9EA 3E63A 1CKIA 3S00A 3NW5A 3EFKA 4XP3A 3AD6A 3Q32A 3TI1A 3UVQA 4WG5A 2YZAA 4RA4A 5JFSA 3BRBA 4M14A 2ITVA 2VWXA 2VWIA 5M55A 1SVEA 1QPJA 3BEGA 2BAKA 1M7NA 4V05A 1OPKA 5DA3A 4AW2A 1ZZ2A 5LOHA 3ZFMA 4PL5A 4XV2A 3TZ7A 4M69A 3CPCA 2PZYA 5G6VA 2QOOA 2ERKA 4D28A 5LCJA 2YFXA 4RJ7A 3BYOA 3R2BA 4QYGA 4AXAA 5E91A 4V01A 2ZV8A 3PFQA 5EYKA 4C34A 3M11A 4OTQA 4WNOA 3RK9A 4A4XA 4AGUA 3UG2A 2X2MA 2GDOA 4AUAA 1J7LA 2CGWA 3PRFA 4HGEA 2PZPA 4O0UA 4RGJA 4UBAA 5DH3A 3KXHA 5CEIA 3RK7A 4EUUA 4EZ7A 1IAJA 3DAEA 5J8IA 2R3NA 5HIBA 2ITZA 3QA0A 4FL3A 2E9PA 1U5QA 4RVLA 5L8KA 3DKOA 4EH3A 2QOLA 2X8IA 1O6YA 3O8TA 2IZUA 1VR2A 4GIIA 4S31A 4EOOA 4UX9A 2OJFE 2UZBA 3MVJA 4NKAA 5E90A 4RFYA 2C6KA 3K5UA 4YC8A 4Q9ZA 4BTMA 4XG6A 2UZEA 2YWVA 5B7VA 4FG7A 5DBXA 3WYXA 1STCE 3KU2A 4YMJA 5M57A 5K0KA 3CD8A 3KXXA 3QZGA 4GFOA 3GC7A 4RC3A 5H8BA 4F6UA 2R4BA 4LOOA 3MVMA 3OF0A 4QMNA 5KMLA 4HYIA 4I5HA 2AC5A 1OZ1A 3C7QA 3OVVA 4PMMA 4K1BA 5LWNA 3O96A 2VTQA 4IVAA 5AA8A 4O1PA 2VWVA 2J90A 4RIYA 4TZRA 4ZTQA 4YTFA 2WMAA 3A62A 4PX6A 3SXRA 1WCCA 2CCHA 2VTJA 2F2UA 5J5SA 5ANGA 4PY1A 2BZHB 2V5QA 4RWLA 3GC8A 5CU3A 5BVKA 3BQCA 3CTQA 4G2FA 4AGDA 5FDPA 3F2RA 3Q04A 4X3FB 3WZEA 4KIPA 4WBOA 2YIRA 3DZQA 1ZYSA 3ERKA 2HY81 3FYKX 4PTGA 5I5ZA 4IAIA 3FDNA 3GQLA 5L2IA 3A7JA 2UVZA 4PTCA 3BZ3A 3RALA 3HNGA 4ALVA 3KXZA 4DGOA 4AT3A 5BMSA 2FSLX 4X3JA 3QTUA 5EI8A 3KL8A 3VBWA 5FTGA 5HX8A 3R7UA 3ZC6A 3PSDA 4DEBA 5EK7A 4LMNA 4PTEA 2J6MA 4EK6A 5CY3A 2NNWB 4BHZA 5BQ0A 3CQUA 4DGNA 4IVCA 1PXJA 3VQUA 2CJMA 3O71A 2J5EA 2OIBA 3A61A 3GCUA 3HVCA 3LFEA 5K4JA 2C5XA 2FH9A 4UMUA 5F94A 2VAGA 4GEOA 3HX4A 4U79A 2JKQA 3B8QA 4FG8A 1O6KA 4P90A 4IXPA 4DCEA 4O7VA 3LIJA 4IZ5A 4IFCA 4C3PA 3QLGA 3CGOA 4J1RA 4P4CA 4APCA 3QQHA 1G8SA 2R7BA 3EKNA 4IAAA 3BHUA 4IM2A 4FSUA 4PF4A 3BLQA 4HYUA 2RFSA 3O0GA 4IB5A 5JQ5A 2E9VA 4FTAA 5HTIA 2JKOA 3NGAA 3WE4A 3BGQA 3OZ6A 3GOPA 4HYSA 3WF5A 4B99A 1I09A 3DDQA 4KB8A 4K11A 1CM8A 2B0QA 5FDXA 2YIWA 4RJ8A 4LUEA 3MVLA 3QTIA 3E62A 3Q9XA 5ACBC 3R8LA 2BKKA 4RC4A 3VS1A 4DFYA 2DYLA 1ZYLA 3HA6A 2B1PA 3CBLA 4RX8A 4AWIA 4IZYA 3IW4A 4KUJA 2W99B 1G3NA 3QD2B 4JG7A 3ACKA 4QQTA 3POOA 5A4EA 3PXRA 1QPEA 3DJ5A 2OO8X 2GQGA 1YI4A 1LUFA 1CKJA 4BC6A 4D4SA 4ZLOA 1JAMA 2XK4A 4FV3A 2E9NA 4EBVA 4C37A 2QVSE 1K3AA 3BKBA 4DTBA 3ZLYA 2CKOA 2R2PA 4WNKA 3H9FA 3CLYA 2PVJA 3DNEA 4FKGA 1W84A 2QI8A 3UC3A 5AP0A 2C5OA 4IHPA 1M17A 5IDPA 5AA9A 4MD8E 3SV0A 3PG1A 4RFMA 5JGAA 3PIXA 1S9JA 2OJGA 4ZY5A 2E9UA 3DAJA 3ROYA 2Y6MA 4U44A 5J9ZA 5EHOA 2YITA 5GJDA 3VQHA 3BYUA 3PPZA 1Q3DA 2UV2A 3E87A 4S34A 1P14A 5FM2A 4FNYA 2CN8A 2VZ6A 3NVKI 3L8PA 5F95A 1R1WA 3IW7A 1RJBA 1XQZA 3FXWA 4H58A 3Q53A 3II5A 2QONA 4BVUA 3PJ3A 4HZRA 5HG8A 2XMYA 3OWLA 1RDQE 2JDRA 2JIUA 5K3YA 2VO6A 4FKLA 1Q8WA 4PWNA 2GNHA 4DEAA 4X6QC 2WMWA 4CVAA 5C01A 3QRJA 5FM3A 3DXQA 5DLSA 2HW6A 1B6CB 4ORKA 1H8FA 4YC3A 5L6WL 4C0TA 3RZFA 2HAKA 4OT5A 4BCOA 4DCAA 3QRKA 4BDFA 2A4LA 3EQBA 5L8JA 3PIZA 4UWBA 5C4KA 3TDVA 2GTNA 4I6FA 2OG8A 1WBNA 4RWJA 3P78A 4MF1A 3FLQA 1ZY5A 1BX6A 3NNWA 2A0CX 3QD0A 4BGGA 4UV0A 3DKFA 5HESA 1GNGA 3AC4A 5E8VA 3C50A 2ZMCA 2JGZA 3EFWA 3LAUA 2OF4A 4HPUE 4IVDA 5FEQA 2X4ZA 5AM7A 3UMWA 5M51A 3GU4A 4UN0C 1IG1A 3QGYA 4ALUA 4B8LA 5I9UA 1H1QA 4UMTA 4D5KA 2JKMA 3ZLSA 2ETMA 2F7XE 3TACA 3QX4A 4TYEA 3LLAA 1RW8A 3ORTA 2EXCX 3NNVA 3PA4A 1M2RA 4EOKA 1FGKA 4O27B 5DEYA 2UUEA 1MP8A 4JQ8A 5EOLA 1H4LA 4G6NA 3A8XA 3OS3A 5E7RA 5EYDA 1NXKA 3GBZA 5KZ0A 3ORKA 2C5VA 4C61A 5BUJA 1JSVA 4KIKA 4C36A 3ZRKA 1P2AA 3VUIA 3QTXA 4FL2A 3BCEA 4N6ZA 3VW6A 4DG3E 3BI6A 4GS6A 4QP8A 3L9MA 4L8MA 3N51A 2RFDA 4FC0A 3GT8A 4YSMA 4I0TA 2W1ZA 4RSSA 3VIDA 4DEIA 4F9CA 4Y73A 5CNNA 3BHTA 3UYSA 4NM5A 3V8TA 1G8AA 2LGCA 4I5MA 5I9WA 4M12A 5M53A 4ZMFA 2XM8A 4V0GB 5A4CA 5JZJA 3JY0A 2YDIA 1JKLA 4UZDA 2R3KA 2KULA 3BV2A 1CSNA 3R8MA 4K6ZA 3U9CA 4B9DA 5EM8A 4IB3A 3K3JA 2JDOA 1H25A 3TNIA 3G6HA 4TYHA 4ITHA 5CSXA 4GIHA 4EHVA 3QTWA 5FRIA 2W4KA 4QRCA 4CV8A 3BHVA 5LMBA 2P0CA 4H1MA 4BGQA 3JYAA 5D1JA 3SOCA 3PJCA 4QMZA 1KE6A 5AIRA 4C2WA 2R3IA 3GQIA 3RPRA 2W5HA 5A6NA 2JITA 4L67A 4GT5A 3F82A 3LMHA 1HCKA 4DF3A 5CQUA 3TXOA 2XK6A 4YHTA 5JEBA 4IC7A 3WZKA 3BPRA 3FLSA 4USFA 2X7FA 4FYOA 2BFYA 2OH4A 3ZZWA 4IANA 3REPA 2IG7A 5EDQA 4A9UA 3W8QA 3TZ9A 3ENHA 3WARA 4AA0A 4WNMA 5IH6A 4NFMA 3LJ1A 3GU8A 1BYGA 5LJJA 1WBVA 5E92A 5J7BA 2XIXA 3IGOA 4TWPA 1BUHA 4X0MA 3DTCA 4FIGA 1BMKA 3QYWA 5KKRB 3LFDA 1YW2A 4M7IA 4XG9A 5B2KA 4K8AA 5HHWA 4C4FA 1H08A 1F3MC 3F3UA 4D2SA 4NUSA 3QBNA 4W4XA 3JR1A 4O0VA 3F66A 2HELA 4CKJA 2QLQA 5HBEA 4PQNA 2XK9A 4NYEA 4O0SA 1NVRA 5ANKA 5EG3A 3DOGA 4DE4A 1SVGA 3D0EA 3TIYA 4BTKA 2WMRA 3BHYA 4IWQA 3FPQA 2IZSA 2OGVA 1R3CA 2H9VA 4JBOA 4AF3A 2UZUE 3ZDIA 5E4HA 4E4LA 4EONA 4EWHA 2PUPA 1YI3A 3P7AA 3HRBA 4MNEA 1OIYA 2OJIA 2PMLX 1KWPA 3I6WA 4YNEA 4L9IA 3PE2A 2YM5A 5AR5A 4TWCA 4DGGA 3R1SA 4F1MA 3HP2A 3LZBA 4ANOA 2IN6A 5AV1A 5C26A 3GVUA 2WMVA 2XYUA 1MQ4A 3BWJA 4JR7A 3FQHA 4U80A 3EYHA 3LFQA 4WHZA 5HE3A 1U5RA 4X3FC 3MWUA 1K2PA 3S1HA 2P55A 4LGHA 4MH7A 4JDIA 4NJ3A 4FZDB 2ACXA 4QTDA 2V55A 3I5ZA 3ZM4A 4M13A 5FWKK 4JX3A 4WG4A 2XNEA 4BTFA 3HV6A 2ZVAA 2Z02A 1Q97A 4E6CA 3IGGA 3NW6A 2ZV7A 4HCVA 4XS2A 5CWZA 3LXKA 1JSTA 5HG7A 4EORA 4YSJA 4AU8A 4F9YA 2VTPA 3PA5A 4W8EA 4YTCA 5L3AA 2OU7A 5KHXA 4IM3A 1PYEA 4UMRA 1H1SA 4B8MA 4RLKA 5ETAA 3GC0A 3F88A 4BWPA 5DT0A 3OROA 5FXQA 3ZO3A 5BYYA 2EXEA 4NH1A 2QU5A 3CD3A 5BVEA 5HKMA 3H30A 4JXFA 2YCFA 3MS9A 4J97A 4GK4A 3A7GA 5IA0A 5C9CA 1ZAOA 3GENA 2I7QA 4U6RA 2C1AA 2BKZA 4IM0A 3FMJA 4PNKA 5EFQA 4W8DA 2VNYA 2W1CA 5CAOA 4ZEGA 1FVVA 4FV2A 4C38A 4F0GA 3T9IA 3OCSA 1H01A 2BHHA 4D58A 5AADA 4PPCA 5L8LA 4C58A 4ERWA 4TKSA 3F3ZA 4ZTLA 1U54A 2BHEA 3BELA 3FSKA 3QZHA 4FT3A 2PZRA 2R3PA 3RI1A 3SKCA 3U55A 4OLIA 5M09A 2EVAA 2YLEA 4X2KA 2H6DA 1OB3A 1R39A 3LXLA 3V6RA 5KBQA 1QPDA 4N57A 3COHA 2C0TA 4YJRA 4DHFA 2BPMA 5HCXA 4FT5A 1UU3A 4BIEA 3H9RA 3UOLA 4E8AA 3ZONA 3NUYA 4A4LA 3ORZA 4GYIA 3QRUA 5CAUA 4MXAA 2JFLA 4F09A 4U9AA 4ACMA 4BCQA 4LI5A 2NP8A 2W0JA 3BGZA 5DIAA 3R9OA 1OIUA 3P9JA 2I0VA 3RKBA 5M06A 2EU9A 3VHKA 4F4PA 4GKIA 5AR3A 4I4EA 2XIZA 3FKLA 3V5TA 4FV1A 1WBSA 5HORA 4AT4A 2BFXA 4DLJA 4U45A 4XG8A 5I9XA 2IPXA 2YIYA 3Q2MA 3HZTA 4WSQA 4Y5QA 1PHKA 5IQEA 2IVTA 3LOKA 4IX6A 5HGIA 1RE8A 3O7LB 4QMMA 4J99A 4RIXB 1JKSA 5F1ZA 3WI6A 1OUKA 4OTGA 4BRXA 3QD4A 5CEKA 3GOKA 1FGIA 1PXMA 4FKPA 4CTBA 1U59A 3ZRLA 2ZB0A 3QA8A 1H0WA 4QMLA 4KABA 2XCHA 4QOXA 5LVPA 5IU2A 4FUYA 4QYFA 4BCGA 2ONLC 4OR5A 3QUDA 3D2KA 4BCJA 3ZFXA 2OF2A 2UW0A 3CQEA 3PYYA 3O51A 4DC2A 4LGGA 2BIYA 3DDPA 5DYJA 5E9EA 3GC9A 2VTRA 4KKGA 3RNYA 4CG8A 5FEEA 3RCDA 2P3GX 3DLSA 3ZDUA 5AV4A 5CVHA 1S9IA 3CPBA 4FV0A 4FOCA 1XH5A 4CQGA 2Z7SA 4U5JA 3D7ZA 3FPMA 3DBDA 4ZOGA 4XRLA 5ITAA 4QMPA 5T6KA 1M14A 2PE0A 4HZSA 5AR8A 1OI9A 2YEXA 1YXUA 4TYGA 5IISA 3PWYA 4BY9E 3C4FA 4Y85A 4BCFA 5DR2A 1H27A 3QHRA 3E5AA 1PKDA 2ZDTA 2OJJA 3VBYA 4FSZA 3KQ7A 3QQLA 4KKHA 4ENYA 2O8YA 4LFIA 2C5NA 5I3OA 3LJ0A 1B39A 4C33A 5A54A 3RTPA 4XV1A 5AUUA 3LHJA 4QPSA 5AWMA 4JIKA 1CMKE 1OPLA 3UODA 3LMGA 2C3LA 3DFCB 2ITNA 4YURA 5CEPA 3QTQA 2ZYBA 2BMCA 1UU7A 2HENA 2C6DA 3FXXA 4CT1A 3TM0A 4UB7A 4W4VA 1L3RE 3I4BA 2VWBA 2WQEA 4IWPA 3NUSA 4ANQA 4V04A 4YLJA 1V0BA 4O7TA 4MBJA 5EM5A 1OKYA 2ZM4A 5A3XA 4ACGA 3IW8A 3MJ2A 2CGUA 3ULIA 1IEPA 4J52A 4ONAA 2VTNA 3FI3A 5AUZA 3I7CA 3IOPA 5EDPA 3D5XA 2XIRA 2ITPA 3QUEA 4WRSA 5B0XA 5FTOA 2VD5A 2W17A 4M15A 1ZLTA 3UDBA 4BWXA 1M7QA 4BB4A 3F7ZA 4C4HA 3R30A 3F5UA 1WBTA 1H24A 3A8WA 3QGWA 3FMLA 4JDHA 3TJDA 3W16A 4DBXA 3NYXA 3VUHA 5IQHA 4O96A 3NLBA 2UZLA 4F0FA 1M2QA 3FQSA 3M2WA 4L3JA 5HE0A 4FIFA 2QOKA 5GJGA 4KSPA 4EJNA 3NYNA 4LMUA 3MTLA 4CZUA 4DBNA 3LFBA 2VWWA 1LEWA 3Q60A 4ZTHA 4CGAA 3UJGA 4Y8DA 4L53A 2HYYA 3C9WA 4CYJA 5HI2A 2JIVA 3D2IA 4FG9A 3MI9A 1J7UA 4BDGA 2Z2WA 3VUKA 3SW7A 5IPJA 4CLJA 2FVDA 3HKOA 3NAXA 3R28A 2F57A 3KKVA 2X9EA 2XBAA 4LQMA 4XG2A 2XK8A 4NKSA 4OTFA 2BALA 1OUYA 3RWPA 4QMXA 4FIHA 4RRVA 5JZNA 3SQQA 3TZ8A 4ZS4A 1SNXA 3V5PA 2QO2A 4U8ZA 4RT7A 4PMPA 4HCUA 2YHVA 3BYVA 3QD3A 2VO3A 4WBBB 1OIQA 2HZNA 3N9XA 3WZDA 2WB8A 4IMYA 3Q5IA 4G16A 3FMKA 2VX3A 4QP7A 5M07A 2R3RA 2EUFB 3MN3A 4G3DA 3HAVA 5F4NA 5AUYA 4IX3A 3IO7A 3OOMA 3MY5A 4GKHA 2EB2A 4MD9E 1REJA 2YA9A 4JJRA 4PRJA 2BTSA 1W0XC 3R7YA 3RAKA 3ZEWA 4A9SA 3K3IA 4E7WA 4DTAA 4F1TA 3DBQA 5IMEA 1U4DA 3JVSA 3TEIA 3MFTA 5IUHA 3F2NA 4IZAA 3FE3A 3VO3A 2VU3A 2O64A 2YIQA 3BYSA 3FKOA 4YLLA 2PY3A 3Q96A 4Y5HA 4C4JA 2QR8A 3S2PA 3U51A 1YDRE 2OZOA 4RLLA 5KKRC 1OM1A 4QPAA 3P5KA 4QYEA 3UIUA 5EYMA 5JT2A 4OAUC 2GQSA 3Q2JA 4L45A 2CGXA 4N0SA 5J9YA 3PA3A 2CKEA 2WELA 1UWHA 4XG7A 3NUXA 4WUNA 3WE8A 5M56A 3BHHA 2WMTA 2VRXA 4XHKB 1PF8A 3LFNA 3UIXA 5IZFA 2WU7A 4FKSA 1ND4A 4DAWA 5J9LA 3DK7A 4GK3A 1PJKA 1WVXA 1ZOHA 4O0RA 4NL0A 1BKXA 3HRCA 1Y8YA 5FG8A 1UU9A 2C5YA 3D94A 4MNFA 5HD7A 1ZZLA 1J91A 4NU1A 4R5SA 3UNZA 4I0SA 4A4OA 1PRYA 4DH1A 4QMVA 2PVNA 4I94A 1Q4LA 3BIZA 2V0DA 4EH9A 3FMDA 3L8VA 3MJ1A 3SG9A 2XK7A 5CSHA 2WD1A 2ONLA 3EN7A 4D4RA 2VTLA 4C7TA 2C3IB 2V7AA 3RM6A 5M4FA 3VF9A 4Q5EA 4FKJA 3FZOA 2X2KA 4IEBA 3KY2A 4M68A 3BE9A 3B2WA 2DWBA 5CXHA 3EL8A 4PDYA 4ACHA 5D7AA 2BZKB 3TTJA 4APPA 2OIQA 3ALNA 1EH4A 2ZB1A 5DI1A 3W2OA 2BR1A 5KCVA 3Q4ZA 3D83A 3HP5A 2Q83A 1R0EA 1SZMA 3NEWA 4FKUA 3R7OA 3SRVB 2HK5A 3NUAA 4OUCA 4ZIMA 1H0VA 2IZTA 3UP2A 3BGPA 2R3HA 2C6LA 2XNBA 3P7CA 1UNGA 4QTCA 5DVRA 5EQEA 3GUBA 4PPBA 4RZWA 4I5CA 3CEKA 3UVRA 3ZO2A 4FEUA 3ID6C 3FLNC 4XCUA 3PG3A 4EOSA 3IDCA 1WBOA 4AN9A 1V1KA 5AP4A 1PXNA 4CEGA 4FEXA 3HMNA 5A9UA 3ZXTA 4ANMA 3VS4A 5H2UA 5GZAA 2RL5A 3OEZA 3R83A 5AV0A 4FICA 4G9CA 2VGPA 4ALWA 2HZ4A 4H3PA 3ELJA 1O6LA 4CTCA 2BRNA 4RVTA 3AGMA 3GFWA 3QC4A 4GG5A 1OKVA 4FKRA 4L01A 4O7LA 2QD9A 3DBFA 4U0IA 4UMPA 4DT9A 5AP5A 4ZJVA 2HWOA 3H0ZA 3V8SA 3E88A 3MW1A 3TT0A 3MYGA 4FKVA 2XJ1A 3EQPA 4BDHA 5I0BA 4C35A 5DEWA 2BTRA 1Y91A 4L3PA 4U40A 3V5QA 3GU7A 2ESMA 2C68A 3DFAA 4FTJA 4RVMA 5AUTA 1Y8GA 4ZY4A 1YDTE 3I60A 3R22A 3MA6A 4TT7A 4MBLA 3LFAA 2UW5A 3R1QA 5CAPA 2VN9A 3KXNA 4TY1A 1HCLA 1ZARA 5ETIA 3RAWA 3V5JA 3TV4A 3W18A 4KBCA 5JRSA 4AAAA 2WHBA 3P86A 4BI0A 4BFMA 2WIHA 4V0GA 3E64A 4K2RA 2ZMDA 4WIHA 2UW8A 4GJ3A 5CALA 4QNYA 1T45A 2PUIA 1ZMVA 3PJ1A 1ERKA 1FVRA 2XH5A 3I81A 4LM5A 4ZJIA 3UG1A 3VULA 4J53A 5IA3A 5B2MA 3C4ZA 3I79A 1OMWA 1ZOGA 3IW5A 2JBPA 3MH3A 5HG9A 3L9LA 2BZJA 4RIOA 4BL1A 4AZVA 3NNXA 3U8WA 3F5XA 4HVIA 1DS5A 2GNLA 2QQ7A 3N4TA 3FQEA 2HIWA 5T3QA 3EH9A 4FNZA 2Z60A 5CF6A 5B2LA 4XUFA 3OD6X 2XCKA 3W2QA 2GFSA 4F70A 3ALOA 4RMZA 5CU2A 4F65A 2GFCA 4G3EA 5C03A 1OKWA 3SA0A 3KRRA 4JS8A 3ZLWA 4QD6A 1XH7A 2HZIA 3CY2A 3FL4A 4YLKA 2YN8A 5AEPA 4ZZOA 2Y0AA 2W4OA 3QUPA 2YJRA 5CVGA 4H39A 4ZXTA 4WA9A 2J0JA 4FIIA 5CU6A 1CDKA 1YXSA 4GFMA 3UVPA 2R7IA 4DITA 5M08A 2QO7A 1HOWA 4UYAA 2B54A 3O17A 4FNWA 2VO0A 3HMOA 2UW6A 1Q8YA 2G2HA 1BLXA 2W4JA 4FF8A 3F5PA 4O38A 5IEYA 5KMOA 4KBKA 3BEAA 2WQMA 1UNHA 4U97A 4QP9A 2JLDA 3TV7A 1NY3A 4PDOA 4RIWB 4L6QA 5HICA 5J79A 3CTHA 2A27A 3LQ3A 5BYLA 3OT3A 2I0YA 3Q4UA 4C4IA 3G51A 2QKWB 4QMSA 3RWQA 2C47A 2GNJA 2I40A 3E7OA 1XH9A 4ID7A 2IZRA 1YKRA 4CFWA 4D9UA 2IW8A 4EKLA 3M1SA 1WMKA 3R9HA 3ACJA 3CQWA 3RPVA 3VRZA 5TT7A 3S0OA 2PWLA 2WZJA 1NVSA 3DJ7A 3O8UA 4L44A 2VTMA 4F08A 4CCUA 3ZBXA 3MVHA 3AT4A 2BCJA 1J1BA 3FLWA 3V04A 2PVKA 3C0IA 3R1NA 3JVRA 4IQ6A 3DB6A 3LJ2A 4YPDA 2AUHA 3KK8A 4BCNA 4OBPA 4AQCA 5CTPA 3OP5A 2CNUA 3SAYA 3R71A 4F0IA 3HDMA 3NZ0A 4MWHA 1KOBA 3R00A 4F7LA 2BAJA 4FEQA 1F5QA 2XNNA 1Y6BA 3CP9A 2J0KA 1XBCA 1UA2A 4FSQA 4A07A 4DGMA 2QHMA 4EZ5A 4TXCA 2ZAZA 4S32A 2R64A 3R01A 3E8EA 3SOAA 3EYGA 4E4XA 2C3KA 3W2SA 2PVHA 2VTOA 4BF2A 3HA8A 1URCA 1YXTA 4I93A 5HD4A 3ODZX 5AUWA 4TRLA 4UY9A 4I92A 1F0QA 5HU3A 3EN9A 4XNEA 5IQCA 1YOJA 2C0OA 1A06A 3H0YA 3ZZEA 5CAVA 4F7JA 3DQWA 5HIEA 2W1EA 3C1XA 3GFEA 2VO7A 5IQBA 1H1WA 4FUXA 5LWMA 4FSTA 3FY0A 4FX3A 5JGBA 4O2PA 4DLIA 4OAVB 5EW8A 4OTWA 2IW6A 3NW7A 5IMXA 3DB8A 5TF9A 1FMOE 2C6MA 3R21A 4NCTC 4YP8A 2F7ZE 2WQOA 4MXZA 3VF8A 4DT8A 2CSNA 4P7EA 4YJVA 1SYKA 3I6UA 3AT3A 4XV3A 3ZYAA 2ITUA 3U4UA 4BKYA 5DRDA 3LPBA 3D15A 3LKMA 3VUMA 5KMKA 5M4IA 3EHAA 4A7CA 2XJ0A 2GS6A 3RAHA 2XRUA 3MIYA 3L9PA 2XA4A 4P2KA 2YISA 3ZRMA 4R3PA 3ZO4A 4GT4A 3UGCA 3CXWA 4YTHA 3SVVA 5LXMA 1Q41A 3KVXA 4E5BA 4MYGA 4XLVA 1H07A 3MESA 5HNIX 4QTAA 2A19B 2XJ2A 4JBVA 4UEUA 3OUKA 5J95A 1OIRA 2QNJA 4YJSA 5J7HA 3TTIA 4EEVA 3O2MA 3PLSA 3FHIA 2WKMA 2PYWA 4FT0A 4GYGA 4M3QA 2SRCA 3R8PA 3UMXA 3OT8A 4A9YA 4RJ6A 2C6OA 2Z7QA 3F3TA 3VJNA 2NRYA 4YJQA 3QXOA 1E9HA 4R5YA 3ZSIA 5CAQA 3E8DA 5DN3A 3ULZA 4M67A 5M44A 2RSVA 1KSWA 4TL0A 4Z55A 2G01A 4XRJA 4BI1A 3DA6A 5ICPA 1FINA 4O86A 2PULA 3AD4A 3GCQA 4R3RA 3ORIA 1ATPE 2A2AA 5DFPA 2AC3A 2Y7JA 4YTIA 3CJGA 4BDJA 4D9TA 4B6LA 3BLRA 3D5VA 1Q24A 4G34A 2CGVA 4D55A 5L6OA 2F49A 1MQBA 3DS6A 1YHWA 4ARKA 2UVYA 2R3MA 3R7VA 4RIXA 5FBOA 4ZZNA 3U6IA 3PZHA 4PDSA 4IDTA 5JFWA 4QYHA 1H00A 3NDMA 2CCIA 2P2IA 5AP6A 2R5TA 5K0XA 4GRBA 5ANEA 3GCSA 3TJCA 4CMOA 2YJSA 4MX9A 4RFZA 3RM7A 5TOZA 2R0UA 2UW4A 3ODYX 3TZMA 4USEA 3FMHA 5D10A 3IK3A 3AC2A 3ZSGA 3IW6A 1JNKA 2W5BA 2HXLA 3V51A 4AN2A 3FV8A 4X6RA 4PL4A 5EHLA 2R0IA 4IWOA 5KHWA 2PZIA 1JOWB 3H10A 3DJ6A 5BUIA 5I4NA 2ERZE 3GP0A 1JKTA 3DBEA 3QQJA 4CFMA 3QZIA 5C1QB 4ZS0A 3NVMB 4QMYA 4O6EA 1PMUA 1LEZA 3CC6A 3PXFA 2JEDA 3PTGA 3PVGA 1IR3A 4FBXA 4EZ3A 3KULB 5CF8A 2O2UA 2YM3A 4I3ZA 3TUBA 4Y95A 2ITOA 3SGCA 4ACDA 1OBGA 2CMWA 2HXQA 4RZVA 5K5XA 1ZOEA 4XG4A 2XKFA 4CFXA 3GEQA 3COKA 1T46A 3W55A 4YR8A 2BDWA 1RQQA 3A7HA 4F1OA 5AV3A 1A48A 3SD0A 4ZY6A 4YO4A 2VX0A 4CG9A 5AP3A 2H8HA 2XIYA 2GMXA 4U3YA 3WF6A 3VVHA 4M97A 3P0MA 2JAVA 3ATSA 3FL5A 5I9YA 4FTLA 4BDIA 3F3WA 3HUCA 1R0PA 1YQJA 3RJCA 4RC2A 5FP5A 4JVGA 2R3FA 2UZNA 3FKNA 4S30A 3Q9ZA 3QFVA 4BI2A 4FA2A 3KXGA 5F20A 3UIBA 2CPKE 4AE6A 5E8YA 4UZHA 2X39A 2XKEA 5KX8A 4D1SA 3WILA 2XM9A 2BZIB 1OECA 3UNKA 3A4PA 4FV8A 1XH4A 5CNOA 3WZJA 2PMIA 3Q9YA 1UWJA 4AZWA 2I0HA 2XEYA 4EH4A 4G3CA 2JIIA 2PVFA 4GMYA 3FY2A 3IKAA 4IACA 5HVKA 3R7IA 3ANRA 1KE5A 3TKUA 4DFLA 5BVOA 4Q9SA 5GINE 3EFLA 3LFSA 4XYFA 4NEUA 3OXIA 4NCTA 2JKKA 4MK0A 4XMOA 3VS2A 3QTRA 1IASA 4C3RA 4EJ7A 4FZFB 4PP7A 4HW7A 4RQVA 2BDJA 1DAYA 4D0XA 2Q0NA 5CX9A 2IJMA 5AR4A 4U41A 3H9OA 3VS6A 3UTOA 4GU6A 5IEVA 4IB0A 4AS0A 1UVRA 4EOLA 4MQ1A 4J8NA 2H34A 3NR9A 4FTIA 5J5TA 2ITQA 3DZOA 1IRKA 5KBRA 3NYOA 3EN4A 3IPHA 3KVWA 3V3VA 3VN9A 4FMQA 4J96A 3DK6A 1KE7A 4G5JA 1J1CA 2RG6A 3LCSA 4IW0A 4F6SA 5HZNA 5IQGA 3KRWA 3RHKA 5A14A 4FSRA 1K9AA 5ANDA 3VBXA 3RPSA 4IJ9A 2GPHA 3GCPA 3EQGA 3Q6WA 2BUJA 3JUHA 1KOAA 2IVSA 2IWIA 4AFEA 2HZ0A 4FV4A 1SMHA 1PXOA 3I0QA 3RP9A 2O3PA 5DR6A 2NPQA 4J8MA 4X2GA 4AZEA 5A4TA 2YCQA 2GHLA 3KMUA 4RX5A 2YERA 2F9GA 4MCVA 2WMXA 2QOIA 5H8EA 2QOFA 3MY1A 2WTWA 5C8MA 3QQGA 1P4FA 4DTKA 2JDSA 2QLUA 2XK3A 3FMEA 4ZP5A 2X4FA 2GHGA 2LAVA 3AMBA 4WRGA 2G15A 5JFXA 3ENMA 3UO6A 5CI7A 3DU8A 3OEFX 4AOTA 4E4MA 3MPMA 4ZLYA 5ANOA 4GG7A 4CT2A 4Y46A 4BBEA 3NX8A 1W8CA 3QALE 3QWJA 4Z16A 4NWMA 4PMTA 4IAYA 2PVRA 3FZTA 3PVWA 5HLWA 2VTAA 4CFFA 3C5UA 4L00A 2OKRA 5AMNA 3DPKA 4BDDA 2QR7A 4AFJA 3T3UA 2WMBA 3NUUA 5KMIA 3G0EA 3TN8A 4HPTE 4G6LA 5DPVA 4A9TA 3G5DA 4J7BA 4GJ2A 4GT3A 3AG9A 1Q62A 4BYJA 1NW1A 3VS0A 4JBPA 4ANBA 4Z7HA 4TN6A 5DRBA 3WIGA 5HE2A 4O7RA 4E6QA 1GAGA 3G9LX 4QP1A 4FVQA 3SRVA 4PMSA 5FEDA 2OJ9A 3F61A 2OXDA 3SXFA 1G5SA 3U54A 3GCVA 3TKIA 4ERKA 5I9VA 4DFBA 3V5WA 3RNIA 3I7BA 3RHXA 2YDKA 1H1PA 1JVPP 4O0TA 4LYNA 4NM7A 4QT1A 5LVLA 3DBCA 2IW9A 3VBVA 3W32A 3UYTA 5M4UA 5J1VA 3CTJA 4EI4A 4O7NA 4ZJJA 3PXYA 4F63A 3PWDA 4OTDA 2Y4PA 4MBIA 4BR3A 4O82A 4DFXE 3VRYA 3COIA 3UZRA 5AIKA 3G15A 4KIOA 3UO5A 4JDKA 4I22A 5CF5A 3FI8A 4GUBA 5CQWA 4QTEA 2XVDA 4AN3A 3HV7A 5FUTA 5CVFA 4DEGA 3FI2A 5AR2A 5CS6A 5AX9A 4QP6A 3VW8A 3RINA 4AACA 4QMQA 5CZIA 3ZCLA 4F9BA 5A4QA 2YAAA 5IH4A 3R73A 2R3LA 3KMWA 4E26A 3UZTA 1Y57A 3ITZA 4FKWA 4AA5A 4Y83A 5EYCA 3LFFA 2XNOA 4QP3A 3EOCA 2B7AA 2F2CB 4JOAA 3UE4A 3ZMMA 2PUUA 4I6BA 4BKJA 3VHEA 3GGFA 4GK2A 2VWUA 1OL1A 4FGBA 3MH1A 4ACCA 3W1FA 4EOPA 4FEVA 3R2YA 1O9UA 2CNVA 2ZM3A 3QHWA 1SNUA 3QQFA 4XOYA 4O1OA 4NTSA 4NZWB 4DH3A 3KGAA 4LRKA 2C30A 5T68A 4GVJA 3N4VA 4ZZMA 3QAME 3TV6A 3IOKA 4ZTRA 3LMIA 3G2FA 5IEXA 2Z8CA 3ORMA 2B9JA 2QOBA 3FLZA 4OTRA 4FV9A 2GNGA 4IIRA 3AOXA 3UC4A 4DFUA 2RFNA 3P23A 4L46A 4DGLC 5CZHA 2WGJA 3BBTB 1XR1A 3MSSA 3VJOA 3ZUVA 3NNUA 4CFUA 4J98A 4RBLA 3TNWA 2UZOA 3OCBA 1JBPE 2VWZA 4D2VA 2RIOA 4ZSLA 3D4QA 1VYZA 4LOPA 1UNLA 3NMUF 5E1SA 2EWAA 2XP2A 2RF9A 3BU5A 5FBNC 3TNPC 5AAGA 2J0LA 1YWVA 3EQFA 3ZXZA 3HMIA 3R9RA 4CFVA 2OBJA 2JBOA 5EH0A 2WTIA 4HGSA 4I1ZA 4CKIA 4QQCA 4FT9A 4IBMA 1BL6A 1TQPA 4Y72A 3VUDA 4BIDA 4ZK5A 4C3FA 3RGFA 1M52A 3ETAA 2QURA 3D7TB 4RIWA 2PVYA 3HUBA 4QQJA 4DH5A 4KKEA 3HL7A 2JC6A 4ANNA 1DI9A 5DNRA 5HTCA 1I44A 4D4VA 4IZ7A 3UQCA 2QOHA 1VZOA 4WNPA 3EWHA 2UW9A 3PPKA 2GNIA 3PY3A 4CQEA 5BUEA 5HTBA 4EWQA 2WTKB 3ZC5A 3PXZA 4C4EA 4CXAA 2GU8A 1TQMA 5CSWA 2NRUA 3FXZA 3PZEA 4CMTA 5J87A 3UQGA 5CYIA 4JI9A 4OBQA 1LPUA 5JH6A 2W5AA 3EKKA 5I9ZA 4S2ZA 3A7FA 4O81A 3A99A 5CT0A 4EH2A 5GIPE 2GSFA 4FZ6A 4FTRA 1OL6A 1OITA 3DKCA 2VTHA 3KEXA 2J4ZA 4LUDA 4NK9A 3W33A 2HY0A 4OTPA 2G2FA 4U7ZA 3TNHA 1Q8ZA 4TPTA 4KD1A 4YPSA 2VTSA 2RFEA 4O7SA 3SHEA 3OOGA 4MKCA 5KE0A 2J0IA 2ZDUA 4BCKA 3U6JA 5A46A 3CCNA 4D4YA 5CENA 4DG0E 3AGLA 3AC3A 3C4WA 4IX5A 5TR6A 4BTJA 3Q9WA 4HVHA 3PXKA 2WTDA 5DMZA 2W9ZB 4C59A 2G1TA 3R6XA 1PKGA 3EQIA 3MFSA 3NIEA 4BDKA 5AAFA 4H1JA 4D5HA 4BWKA 1KV1A 4IX4A 4MVFA 3R9NA 5C8KA 4IVBA 2X0GA 2YDJA 1UV5A 4EKKA 3NUPA 4II5A 4DYMA 5JMSA 3I5NA 1PMEA 4NJDA 4W9WA 4TNBA 3C4XA 5EQPA 3O23A 1XO2B 4G17A 4KAOA 4W4YA 3C5IA 2CNQA 3F5GA 3ZO1A 2YWPA 4BICA 2Y6OA 4UYNA 5TO8A 4YHFA 5JRQA 3QCQA 2Y9QA 4G31A 2Q0BA 4ASDA 2EXMA 4YZDA 4RX7A 3R04A 4X21A 2XEZA 4AX8A 5HU9A 4D2RA 5EW9A 3M42A 4PP9A 3UBDA 4JQ7A 2PUNA 3R02A 2YZLA 2BVAA 3KRJA 3ZEPA 3AXWA 4JRVA 5HO6A 3QCYA 3ZUUA 4FSWA 3DQXA 1KUTA 3KREA 4AG8A 1W7HA 4L43A 2UZDA 2GS7A 2BRMA 4MXYA 4KA3A 5FD2A 3CKXA 2X2LA 4A9RA 5A4LA 1GIHA 1XKKA 4A06A 4D0WA 1J3HA 3EZRA 3QKMA 4O21A 4C2VA 4UXLA 1APME 4G6OA 4BCHA 4U42A 4FOBA 5ETFA 5HCZA 4DH8A 4EBWA 4K33A 3KRLA 5BX0A 3SG8A 3AT2A 4QP4A 2WAJA 2BDFA 2X1NA 1PW2A 3E8CA 3MDYA 5IQDA 4CNHA 4MHAA 2FSMX 4FIEA 2JAMA 4BZNA 5BNJA 1YWRA 4EH7A 2ZV2A 3W10A 1IA8A 4JQEA 1QCFA 2R3OA 2XZSA 4CSVA 4EH8A 4FSMA 5FXSA 1UKHA 4D2PA 4EHEA 1MRUA 3OC1A 5AAEA 4ZTMA 1AQ1A 3CY3A 3KRXA 1GIIA 4KBAA 3TUDA 3A60A 5DGZA 4HVDA 2WMQA 4OGRA 4IH8A 3BLHA 5KO1A 1ZYDA 5IF1A 4EK3A 1W82A 5AFVA 4FVPA 4FZ7A 2C69A 2YACA 2QOCA 3KF7A 4HYHA 4JR3A 4R78A 4YZCA 1QPCA 4FKIA 5IA5A 4QNAA 1YDSE 4XX9A 3ATTA 3LCTA 3MBLA 5EDRA 3VUTA 4AOIA 4CMUA 4IE9A 4O91A 3MV5A 4FIJA 5LVNA 4LRJA 3U6HA 2V7OA 4KWPA 5E8SA 3EZVA 4OTIA 4O0XA 5H9BA 3HECA 3DKGA 5EW3A 1SVHA 4JBQA 4EL9A 5L2WA 4JRNA 3WBLA 4I6QA 4F64A 4QPMA 4WT6A 4CD0A 5AM6A 1PY5A 5JQ8A 3E92A 2J0MB 4FSNA 1Y6AA 2QHNA 3GI3A 4BCIA 3ZM9A 3U9NA 1OL2A 2GHMA 3MTFA 4E4NA 5IDNA 3OY3A 3UPZA 3AC8A 3EIDA 5KNJA 3LXPA 4XP0A 3HMMA 4NIFB 2PZ5A 1GZKA 2B55A 3IDBA 4W9XA 3UOKA 3HRFA 3TUCA 4L7SA 1YI6A 5DR9A 5L2SA 4ZSJA 3ZTXA 1Z57A 4PL3A 2ITYA 1JWHA 1QL6A 3FAAA 3FBVA 3EQDA 4G5PA 3AC5A 2FYSA 5KZIA 4CYIA 4EOMA 2ITTA 3OHTA 3QCXA 1R78A 2GNFA 4JAJA 3LE6A 3DXPA 2WNTA 1H28A 1ZY4A 2OK1A 4CKRA 2B4SB 3FLYA 1WBPA 2HW7A 4KRCA 3CS9A 1AD5A 4JX7A 3KULA 4D2TA 3OWJA 4R3CA 4HNFA 4O83A 2OZAB 2YABA 4DEHA 5IA1A 5LVOA 3ZOSA 4KRDA 4E73A 1YWNA 4E3CA 2X7GA 4RWIA 1NT2A 2IVUA 3S4QA 5FLFA 2C1BA 3THBA 4JT3A 4DG2E 3KN5A 1Q5KA 2R3JA 2X6DA 4NM3A 4QMWA 4RX9A 4BBMA 4RJ5A 2REIA 4ANSA 4F7SA 3KCFA 4E20A 5EM7A 4F9AA 4M0ZA 2W7XA 4F7NA 3ZS5A 4IAZA 3KCKA 4YO6A 3LLTA 3VUGA 4BIBA 5HX6A 3PVUA 5HE1A 2PE2A 5CEOA 3W2RA 2VUWA 1ZMWA 3FI4A 3TG1A 2J50A 4OBOA 4E6AA 3SLSA 3NRMA 4GH2A 3NIZA 4KS7A 4NFNA 5TKDA 4JL9A 2VNWA 4EOIA 5K4IA 3R0TA 3MB7A 3MPTA 4DFZE 3U87A 2XYNA 4Q2AA 2J7TA 2W06A 2WFYA 4Q5HA 2WU6A 5C27A 4Z3VA 4IFGA 5EQYA 3KK9A 3BV3A 2E2BA 3G6GA 3WF7A 3OW3A 3PRIA 5KUPA 5H3QA 2X8DA 2XF0A 4LL0A 3NCGA 4QP2A 4DEEA 5ACKA 3DCVA 2JDTA 3COMA 2QKRA 3F9NA 1JSUA 4H36A 4XBUA 2I0EA 1VJYA 3TIZA 4QMTA 5G1XA 2XNMA 3Q6UA 1ZYCA 3CKWA 4ANLA 4K9YA 4F9WA 4AP7A 5EKNA 4M8TA 3RAIA 4DN5A 5BVNA 2W1IA 5K9IA 4HGLA 4K18A 2X9FA 3RPYA 1FPUA 2VWYA 1Q61A 1MUOA 3JS2A 3WIKA 3D5UA 2ITXA 4E1ZA 1XBBA 3ORLA 3HGKA 4R7HA 1YXXA 3NWWA 2A1AB 1UKIA 4DEDA 3OG7A 3QRTA 5HCYA 2O5KA 2QG7A 3E7VA 5JKGA 2CN5A 3OWPA 5DT3A 2OW3A 2OI4X 3D5WA 3Q52A 4H05A 4CV9A 3EN6A 3QTZA 4TW9A 3PIYA 1XHAA 4DINA 5AUVA 4RA5A 4ITJA 1Z9XA 3TDWA 2B9FA 4WG3A 4WSYA 3P4KA 5FGKA 2WIPA 5CLPA 3BBWA 3LW0A 1DAWA 2BIKB 4R8QA 3CIKA 3EN5A 3OTUA 2WQNA 5DT4A 3TCPA 2FUMA 4M69B 4B0GA 2JFMA 1J7IA 3BQRA 2CHLA 2R3GA 2NO3A 3PP0A 4YHJA 1L8TA 2B53A 4AA4A 4IDVA 4C57A 1XH8A 4LV8A 4YU2A 4FSYA 3KA0A 4I21A 5HLPA 2I1MA 4JIAA 1X8BA 1Q3WA 1W83A 2OIDA 2XUUA 2YAKA 3BU6A 4R6VA 3ZBFA 3S3IA 3GU6A 2WTKC 3OBGA 3E3PA 3OCGA 3PSCA 3Q5ZA 4H3BA 4FTUA 1FQ1B 3FWQA 5IUIA 4EC8A 2V22A 4G1WA 1GIJA 2CDZA 2YLFA 2F7EE 2GCDA 2W05A 1ZMUA 1GY3A 2YM4A 3EFJA 3I1AA 3LCKA 3POZA 4U43A 5D7VA 2W1GA 4BCPA 4EHGA 5HG5A 3VS7A 1WVYA 3ZHPC 3HAMA 4BDAA 2QG5A 5IA2A 2UW3A 5E1EA 3I0OA 3OWKA 4GFGA 4HVGA 2GTMA 4G9RA 3L9NA 3RMFA 3S95A 4PDPA 4FK6A 4MWIA 4AZSA 2G9XA 3OCTA 4JG6A 1URWA 3LQ8A 5HQ0A 1Q8TA 5AV2A 4FGRA 1MRYA 4L52A 3HLLA 4FTKA 2O65A 2OLCA 3OBJA 3UO4A 3KC3A 3NCZA 3QKLA 5FTQA 2BRBA 4ZTNA 3QXPA 3QWKA 2WTJA 3KMMA 4BCMA 4FTTA 4CCBA 3G9NA 4WO5A 2RGPA 1H1RA 2FO0A 1OL7A 4CLIA 4RIYB 3F7WA 4HCTA 5LCKA 3ET7A 4FODA 5GHVA 4AZTA 4AW5A 4LV5A 3JXWA 4CFNA 3EQCA 1WFCA 5LMKC 2OH0E 4ZSGA 2PE1A 5E8ZA 3W2CA 2DS1A 3NSZA 4FL1A 4JDJA 4KINA 1M2PA 4X2JA 5FP6A 3MPAA 2FGIA 2H96A 4XEYA 4AW1A 1B38A 2XNPA 4FZAB 4BN1A 2BROA 3A4OX 3IDPA 3HYHA 4QTBA 3EB0A 4HVSA 3TKHA 5IH5A 1XWSA 5L4QA 4Z7GA 2VGOA 1XH6A 1OPJA 5ANIA 3MFUA 4M0YA 4FE2A 5L6PA 1WVWA 1IAHA 3MB6A 2W1DA 4FKOA 3EMGA 5HNBA 2CKPA 4GW8A 4PUZA 5EKOA 4GCJA 4C02A 4XP2A 1ZXEA 4AW0A 4EQUA 2FA2A 5C8NA 4IAFA 4QQ5A 3E3BX 2X8EA 4CZTA 3D9VA 2WOTA 4X2FA 5TE0A 5BVFA 1OBDA 5HBJA 2YM8A 4BZDA 2HCKA 5EI2A 4ZMEA 3ZU7A 3UOJA 5FQDC 5ETCA 1V0OA 5GIOE 1W98A 2PK9A 3NAYA 4KSQA 4TYIA 1YXVA 4YZMA 4JG8A 5HEZA 4FEWA 3DNDA 1BL7A 1CTPE 2GS2A 3DLZA 3NYVA 4PV0A 3WOWA 2XS0A 3TWJA 3JY9A 4I6HA 2ITWA 4K0YA 3OY1A 3QCSA 4ITIA 5E8UA 4BYIA 4YZ9A 4HGTA 2B9HA 1DI8A 3AD5A 4RPVA 2Y4IB 3PSBA 3DY7A 4YBJA 5JSMA 2XRWA 3C13A 3FYJX 4FTNA 3RK5A 1IA9A 4ZSEA 5GZ8A 4YZNA 5D12A 4BDEA 4R7IA 4D2WA 3FZ1A 2ETRA 2WMSA 4O7ZA 5HVJA 5LQFA 5CI6A 1JQHA 2UW7A 3VNTA 3B8RA 4YGAA 1U46A 2OXXA 4O6LA 3H3CA 1YOMA 3FC2A 2IO6A 4D1XA 2G2IA 3C51A 2QODA 1PMVA 1XJDA 2C6EA 3A7IA 3V6SA 3PY0A 4NSTA 4BGHA 3FZRA 3LM0A 2PVLA 5JN2A 3R8UA 5EM6A 4ASZA 3QF9A 4LG4A 3PXQA 2WMUA 1YHSA 4M66A 5EHYA 3VBTA 5BPYA 1A9UA 4HNIA 2C6IA 5CEQA 3T8OA 1REKA 1LP4A 1KE9A 3DGKA 4L3LA 5ANJA 2FSTX 3ZH8A 2KTYA 3U4WA 4EOQA 4EOJA 5IUGA 4EK8A 1XBAA 2PMOX 4YBKA 4YUQA 3E8NA 3RCJA 4I5PA 5GNKA 3NPCA 4IB1A 4LL5A 3C4CA 3LVPA 1V0PA 4N4SA 3FSFA 4X7QA 3D7TA 1GOLA 3EQHA 3KN6A 4MAOA 4PPAA 5D9HA 4FTOA 3ORNA 4GVAA 4D1ZA 4ZAUA 5HO7A 1PXLA 3Q4TA 5CF4A 4PNIA 2WXVA 2B9IA 4O0WA 2QO9A 1Q99A 4MEDA 3L8XA 3QQKA 4J95A 3FMMA 4QO9A 2OFVA 1DM2A 5HBHA 2VTIA 3PP1A 4BDCA 4K77A 2QCSA 4MXCA 4MXOA 4EQMA 4USDA 3V5LA 3P7BA 2RKUA 2R3QA 1OGUA 4U81A 1PXPA 4QMOA 5CSVA 3TNQB 3ZLXA 2XIKA 4FI1A 4GL9A 4MD7E 5EOBA 3BU3A 3PJ2A 3VS3A 5BVWA 2RG5A 1FVTA 3AC1A 3VWAA 4G3GA 4FVRA 3W8LA 3QQUA 4FK3A 5M4CA 4EK5A 4TNDA 5KMJA 3RVGA 2ZJWA 3IS5A 3PVBA 5JK3A 3FJQE 3Q3BA 4O0YA 4XOZA 1E1XA 2JD5A 4XBRA 3FEGA 1JLUE 1FMKA 3EQRA 4G3FA 4F99A 3G33A 5IKWA 1JKKA 4TWOA 3UQFA 4I41A 3LFCA 2P33A 4B7TA 4XH6A 4CRSA 5LVMA 2YCRA 4KNBA 3OFMA 3UIMA 3E93A 3LQ5A 3P08A 3WF9A 4L68A 1OL5A 3F3VA 4M84A 5K5NA 2GQRA 3R7GA 1BI8A 1PMNA 1AGWA 2BRGA 4O7WA 4WUAA 3F6XA 3QL8A 4IAKA 1YRPA 3UOHA 5BVDA 1Z5MA 2P4IA 3WYYA 4I20A 5CANA 2ZV9A 2XNGA 3FUPA 3LXNA 3P79A 2OXYA 5LMAA 2OSCA 3R1YA 5BYZA 3IQ7A 3VC4A 4AE9A 5LMKA 3BE2A 4IC8A 4NTTA 5JGDA 4BDBA 3FMNA 4KIKB 3MH2A 3SXSA 3F69A 3BX5A 3OTVA 3KXMA 2YCSA 2HOGA 5AJQA 4FV7A 5HVYA 4N70A 2WQBA 5AP1A 4XG3A 4EQCA 1WAKA 3BYMA 4FV5A 4AT5A 2PPQA 3R9DA 1PXIA 2WPAA 4P5ZA 2W1HA 4X2NA 2DQ7X 1VEBA 4UALA 3CSVA 3T3VA 3V01A 3QC9A 3WF8A 3MGYA 4C4GA 3Q4CA 3HMPA 2PL0A 4GUEA 2VV9A 1WZYA 3PY1A 4HOKA 5DHJA 3LCOA 4TYHB 4AZFA 4WD5A 4GSBA 2R9SA 1OKZA 3MA3A 4S33A 1UU8A 4NW5A 4UWCA 2ETKA 4YJUA 2PHKA 5AUXA 4FR4A 5D41A 5AX3A 5HNGA 1GZ8A 3ZUTA 3ZSHA 2O0UA 2XKDA 3OW4A 3KF4A 3QU0A 3NS9A 2CLQA 3UNJA 3SW4A 4MF0A 2Z7RA 2UZWE 4JAIA 3TL8A 3UPXA 2CLXA 3CE3A 4MTAA 2WOUA 4NT4A 4U3ZA 4ENXA 3OXZA 4R77A 2J51A 3K54A 2WO6A 3QTSA 4JLCA 2QOQA 3DXNA 3HV5A 3VBQA 2PSQA 3ORPA 3C0HA 4TYJA 3WZUA 3ZFYA 4EUTA 5IA4A 4FTMA 1JPAA 3F2AA 2Z7LA 3PUPA 4EYMA 4E6DA 4LOQA 4Z9LA 5IG1A 5JFVA 5J1WA 3R63A 5DOSA 5E8WA 2V62A 4TWNA 5C4LA 1QMZA 4FYNA 5KMNA 4OTHA 4GV1A 4YJNA 3P1AA 2UVXA 2F4JA 4YJTA 5HIDA 1KV2A 4YJPA 4E93A 4EYJA 1NA7A 1P5EA 4C62A 4TTHB 4RWKA 3UZPA 3ORXA 3PDTA 5CEMA 5IQIA 4OW8A 3K2LA 2YM6A 3HV4A 2WEIA 3O8PA 4KIQA 3QZFA 4R1VA 5E8XA 3CR0A 2OICA 1ZRZA 2HWPA 1BI7A 4AOJA 3ANQA 2C6TA 2W1FA 4I24A 3KFAA 3DAKA 4LRMA 5DE2A 3ROCA 4ZSAA 3OUNB 1CKPA 3KB7A 4QMUA 4O2ZA 3D14A 2C0IA 3LCDA 4CZYB 3PJ8A 1GZOA 1MRVA 3HDNA 1TKIA 4NIFA 2J2IB 3G90X 4FKQA 4MNEB 4J71A 4X3FA 5AP7A 5D11A 2PMNX 4AGWA 2QU6A 3CGFA 3MY0A 4E5AX 2WTVA 1SM2A 5L2QA 1OVEA 1FBNA 4I0RA 2XBJA 2B52A 1GZNA 2BILB 3NUNA 3O7LD 4WKQA 3OMVA 5LARA 4IJPA 3C0GA 4JNWA 4W4WA 3W2PA 4O84A 4UXQA 4L7FA 3GXLA 4P5QA 2FSOX 1Q8UA 3EL7A 4RQKA 5AR7A 4I23A 3SC1A 3R7EA 3L1SA 2J9MA 2ZM1A 4QYYA 4DH7A 3A2CA 3RZBA 5A6OA 5E8TA 2E9OA 3AMYA 3PE1A 2OZAA 1YOLA 3FZPA 5GJFA 4O7YA 2EB3A 3DK3A 3MH0A 2WTCA 2DUVA 1YHVA 2XB7A 5DG5A 5EI6A 5CXZA 4B4LA 5DWRA 2XKCA 3IG7A 4UWYA 3UP7A 3VS5A 4O22A 4EC9A 4RJ4A 2OWBA 4F6WA 3QLFA 3JPVA 3OXTA 2IVVA 3T9TA 4UMQA 3G0FA 1GJOA 3DV3A 4EH6A 2FB8A 2W9FB 4IWDA 3IECA 4R1YA 4I4FA 2I6LA 2PVMA 4MXXA 5FXRA 3MIAA 3PPJA 4YC6A 3BWFA 1FOTA 4DFNA 1NVQA 3HEGA 1PYXA 2X7OA 4NM0A 1TVOA 2ZOQA 4NW6A 3VAPA 4AGCA 4FNXA 2P2HA 4BKZA 1LR4A 4FTQA 3B2TA 4CRLA 2AYPA 3SX9A 4E5WA 1E1VA 3EJ1A 3SDJA 4EK4A 3N4UA 2UZVA 3QRIA 1YVJA 4IADA 5HOAA 2X6EA 3RPOA 3O50A 5CU4A 2VX1A 3DTWA 5CT7A 1ZWSA 5CSPA 5L2TA 2YIXA 4RJ3A 2BAQA 4XV9A 3RBWA 3QYZA 4RVKA 4GU9A 3DT1A 4ZLZA 4FTCA 5HO8A 3GNIB 3HV3A 4HJOA 3QKKA 2J5FA 3R8VA 4BHNA 1U54B 4L42A 2Y4IC 1WBWA 3FHRA 3AMAA 3GU5A 5KMMA 3GB2A 4YZBA 4FKTA 5I3RA 4YNOA 4DA5A 4ZTSA 1TQIA 4EH5A 3MFRA 2C4GA 4KS8A 1ZYJA 1H26A 5AP2A 3IONA 3L8SA 4MQ2A 4YJOA 5CU0A 2PTKA 2X81A 3K5VA 3V8WA 4LGDA 3C4EA 4BZOA 5HLNA 3LM5A
chains in the Genus database with same CATH superfamily
1PXKA 2W96B 4RG0A 5GZ9A 2UZTA 2BRHA 3FZSA 3FC1X 4XJ0A 4C8BA 4H3QA 4EHZA 2OFUA 2Y8OA 2JDVA 2VTTA 3QX2A 4WOVA 5IQAA 1P4OA 3CJFA 4FT7A 4ASXA 2QC6A 4BBFA 2O63A 2CKQA 1VYWA 3AQVA 5CASA 4FV6A 4XLIA 2PU8A 5IQFA 5BMMA 2YM7A 3R8ZA 4R7BA 4OT6A 2NYAA 5H8GA 2C3JA 1KE8A 3PLAE 2WEVA 3H4JA 4ASEA 4N6YA 5F9EA 2XALA 3E63A 1CKIA 3S00A 3NW5A 3EFKA 4XP3A 3AD6A 3Q32A 3TI1A 3UVQA 4WG5A 2YZAA 2AEGA 4RA4A 5JFSA 3BRBA 4M14A 2ITVA 2VWXA 2VWIA 5M55A 1SVEA 1QPJA 3BEGA 2BAKA 1M7NA 4V05A 1OPKA 5DA3A 4AW2A 1ZZ2A 5LOHA 3ZFMA 4PL5A 4XV2A 3TZ7A 4M69A 3CPCA 2PZYA 5G6VA 2QOOA 2ERKA 4D28A 5LCJA 2YFXA 1W2DA 4RJ7A 3BYOA 3R2BA 4QYGA 4AXAA 5E91A 4V01A 2ZV8A 3PFQA 5EYKA 4C34A 3M11A 4OTQA 4WNOA 3RK9A 4A4XA 4AGUA 3UG2A 2X2MA 2GDOA 4AUAA 1J7LA 2CGWA 3PRFA 4HGEA 2PZPA 4O0UA 4RGJA 4UBAA 5DH3A 3KXHA 5CEIA 3RK7A 4EUUA 4EZ7A 1IAJA 3DAEA 5J8IA 2R3NA 5HIBA 2ITZA 3QA0A 4FL3A 2E9PA 1U5QA 4RVLA 5L8KA 3DKOA 4EH3A 2QOLA 2X8IA 1O6YA 3O8TA 2IZUA 1VR2A 4GIIA 4S31A 4EOOA 4UX9A 2OJFE 2UZBA 3MVJA 4NKAA 5E90A 4RFYA 2C6KA 3K5UA 4YC8A 4Q9ZA 4BTMA 4XG6A 2UZEA 2YWVA 5B7VA 4FG7A 5DBXA 3WYXA 1STCE 3KU2A 4YMJA 5M57A 5K0KA 3CD8A 3KXXA 3QZGA 4GFOA 3GC7A 4RC3A 5H8BA 4F6UA 2R4BA 4LOOA 3MVMA 3OF0A 4QMNA 5KMLA 4HYIA 4I5HA 2AC5A 1OZ1A 3C7QA 3OVVA 4PMMA 4K1BA 5LWNA 3O96A 2VTQA 4IVAA 5AA8A 4O1PA 2VWVA 2J90A 4RIYA 4TZRA 4ZTQA 4YTFA 2WMAA 3A62A 4PX6A 3SXRA 1WCCA 2CCHA 2VTJA 2F2UA 5J5SA 5ANGA 4PY1A 2BZHB 2V5QA 4RWLA 3GC8A 5CU3A 5BVKA 3BQCA 3CTQA 4G2FA 4AGDA 5FDPA 3F2RA 3Q04A 4X3FB 3WZEA 4KIPA 4WBOA 2YIRA 3DZQA 1ZYSA 3ERKA 2HY81 3FYKX 4PTGA 5I5ZA 4IAIA 3W0QA 3FDNA 3GQLA 5L2IA 3A7JA 2UVZA 4PTCA 3BZ3A 3RALA 3HNGA 4ALVA 3KXZA 4DGOA 4AT3A 5BMSA 2FSLX 4X3JA 3QTUA 5EI8A 3KL8A 3VBWA 5FTGA 5HX8A 3R7UA 3ZC6A 3PSDA 4DEBA 5EK7A 4LMNA 4PTEA 2J6MA 4EK6A 4O4EA 5CY3A 2NNWB 4BHZA 5BQ0A 3CQUA 4DGNA 4IVCA 1PXJA 3VQUA 2CJMA 3O71A 2J5EA 2OIBA 3A61A 3GCUA 3HVCA 3LFEA 5K4JA 2C5XA 2FH9A 4UMUA 5F94A 2VAGA 4GEOA 3HX4A 4U79A 2JKQA 3B8QA 4FG8A 1O6KA 4P90A 4IXPA 4DCEA 4O7VA 3LIJA 4IZ5A 4IFCA 4C3PA 3QLGA 3CGOA 4J1RA 4P4CA 4APCA 3QQHA 1G8SA 2R7BA 3EKNA 4IAAA 3BHUA 4IM2A 4FSUA 4PF4A 3BLQA 4HYUA 2RFSA 3O0GA 4IB5A 5JQ5A 2E9VA 4FTAA 5HTIA 2JKOA 3NGAA 3WE4A 3BGQA 3OZ6A 3GOPA 4HYSA 3WF5A 4B99A 1I09A 2X0PA 3DDQA 4KB8A 4K11A 1CM8A 2B0QA 5FDXA 2YIWA 4RJ8A 4LUEA 3MVLA 3QTIA 3E62A 3Q9XA 5ACBC 3R8LA 2BKKA 4RC4A 3VS1A 4DFYA 2DYLA 1ZYLA 3HA6A 2B1PA 3CBLA 4RX8A 4AWIA 4IZYA 3IW4A 4KUJA 2W99B 1G3NA 3QD2B 4JG7A 3ACKA 4QQTA 3POOA 5A4EA 3PXRA 1QPEA 3DJ5A 2OO8X 2GQGA 1YI4A 1LUFA 1CKJA 4BC6A 4D4SA 4ZLOA 1JAMA 2XK4A 4FV3A 2E9NA 4EBVA 4C37A 2QVSE 1K3AA 3BKBA 4DTBA 3ZLYA 2CKOA 2R2PA 4WNKA 3H9FA 3CLYA 2PVJA 3DNEA 4FKGA 1W84A 2QI8A 3UC3A 5AP0A 2C5OA 4IHPA 1M17A 5IDPA 5AA9A 4MD8E 3SV0A 3PG1A 4RFMA 5JGAA 3PIXA 1S9JA 2OJGA 4ZY5A 2E9UA 3DAJA 3ROYA 2Y6MA 4U44A 5J9ZA 5EHOA 2YITA 5GJDA 3VQHA 3BYUA 3PPZA 1Q3DA 2UV2A 3E87A 4S34A 1P14A 2X0QA 5FM2A 4FNYA 2CN8A 2VZ6A 3NVKI 3L8PA 5F95A 1R1WA 3IW7A 1ST4A 1RJBA 1XQZA 3FXWA 4H58A 3Q53A 3II5A 2QONA 4BVUA 3PJ3A 4HZRA 5HG8A 2XMYA 3OWLA 1RDQE 2JDRA 2JIUA 5K3YA 2VO6A 4FKLA 3P5JC 1Q8WA 4PWNA 2GNHA 4DEAA 4X6QC 2WMWA 4CVAA 5C01A 3QRJA 5FM3A 3DXQA 5DLSA 2HW6A 1B6CB 4ORKA 1H8FA 4YC3A 5L6WL 4C0TA 3RZFA 2HAKA 4OT5A 4BCOA 4DCAA 3QRKA 4BDFA 2A4LA 3EQBA 5L8JA 3PIZA 4UWBA 5C4KA 3TDVA 2GTNA 4I6FA 2OG8A 1WBNA 4O4BB 4RWJA 3P78A 4MF1A 3FLQA 1XMMA 1ZY5A 1BX6A 3NNWA 2A0CX 3QD0A 4BGGA 4UV0A 3DKFA 5HESA 1GNGA 3AC4A 5E8VA 3C50A 2ZMCA 2JGZA 3EFWA 3LAUA 2OF4A 4HPUE 4IVDA 5FEQA 3O5AA 2X4ZA 5AM7A 3UMWA 5M51A 3GU4A 4UN0C 1IG1A 3QGYA 4ALUA 4B8LA 5I9UA 1H1QA 4UMTA 4D5KA 2JKMA 3ZLSA 1TFFA 2ETMA 2F7XE 3TACA 3QX4A 4TYEA 3LLAA 1RW8A 3ORTA 2EXCX 3NNVA 3PA4A 1M2RA 4EOKA 1FGKA 4O27B 5DEYA 2UUEA 1MP8A 4JQ8A 5EOLA 1H4LA 4G6NA 3A8XA 3OS3A 5E7RA 5EYDA 1NXKA 3GBZA 5KZ0A 3ORKA 2C5VA 4C61A 5BUJA 1JSVA 4KIKA 4C36A 3ZRKA 1P2AA 3VUIA 3QTXA 4FL2A 3BCEA 4N6ZA 3VW6A 4DG3E 3BI6A 4GS6A 4QP8A 3L9MA 4L8MA 3N51A 2RFDA 4FC0A 3GT8A 4YSMA 4I0TA 2W1ZA 4RSSA 3VIDA 4DEIA 4F9CA 4Y73A 5CNNA 3BHTA 3UYSA 4NM5A 3V8TA 1G8AA 2LGCA 4I5MA 5I9WA 4M12A 5M53A 4ZMFA 2XM8A 4V0GB 5A4CA 5JZJA 3JY0A 2YDIA 1JKLA 4UZDA 2R3KA 2KULA 3BV2A 1CSNA 3R8MA 4K6ZA 3U9CA 4B9DA 5EM8A 4IB3A 3K3JA 2JDOA 1H25A 3TNIA 3G6HA 4TYHA 4ITHA 5CSXA 4GIHA 4EHVA 3QTWA 5FRIA 2W4KA 4BJJA 4QRCA 4CV8A 3BHVA 5LMBA 2P0CA 4H1MA 4BGQA 3JYAA 5D1JA 3SOCA 3PJCA 4QMZA 1KE6A 5AIRA 4C2WA 2R3IA 3GQIA 3RPRA 2W5HA 5A6NA 2JITA 4L67A 4GT5A 3F82A 3LMHA 1HCKA 4DF3A 5CQUA 3TXOA 2XK6A 4YHTA 5JEBA 4IC7A 3WZKA 3BPRA 3FLSA 4USFA 2X7FA 4FYOA 2BFYA 2OH4A 3ZZWA 4IANA 3REPA 2IG7A 2ZFYA 5EDQA 4A9UA 3W8QA 3TZ9A 3ENHA 3WARA 4AA0A 4WNMA 5IH6A 4NFMA 3LJ1A 3GU8A 1BYGA 5LJJA 1WBVA 5E92A 5J7BA 2XIXA 3IGOA 4TWPA 1BUHA 4X0MA 3DTCA 4FIGA 1BMKA 3QYWA 5KKRB 3LFDA 1YW2A 4M7IA 4XG9A 5B2KA 4K8AA 5HHWA 4C4FA 1H08A 1F3MC 3F3UA 4D2SA 4NUSA 3QBNA 4W4XA 3JR1A 4O0VA 3F66A 2HELA 4CKJA 2QLQA 5HBEA 4PQNA 2XK9A 4NYEA 4O0SA 1NVRA 5ANKA 5EG3A 3DOGA 4DE4A 1SVGA 3D0EA 3TIYA 4BTKA 2WMRA 3BHYA 4IWQA 3FPQA 2IZSA 2OGVA 1R3CA 2H9VA 4JBOA 4AF3A 2UZUE 3ZDIA 5E4HA 4E4LA 4EONA 4EWHA 2PUPA 1YI3A 3P7AA 3HRBA 4MNEA 1OIYA 2OJIA 2PMLX 1KWPA 3I6WA 4YNEA 4L9IA 3PE2A 2YM5A 5AR5A 4TWCA 4DGGA 3R1SA 4F1MA 3HP2A 3LZBA 4ANOA 2IN6A 5AV1A 5C26A 3GVUA 2WMVA 2XYUA 1MQ4A 3BWJA 4JR7A 3FQHA 4U80A 3EYHA 3LFQA 4WHZA 5HE3A 1U5RA 4X3FC 3MWUA 1K2PA 3S1HA 2P55A 4LGHA 4MH7A 4JDIA 4NJ3A 4FZDB 2ACXA 4QTDA 2V55A 3I5ZA 3ZM4A 4M13A 5FWKK 4JX3A 4WG4A 2XNEA 4BTFA 3HV6A 2ZVAA 2Z02A 1Q97A 4E6CA 3IGGA 3NW6A 2ZV7A 4HCVA 4XS2A 5CWZA 3LXKA 1JSTA 5HG7A 4EORA 4YSJA 4AU8A 4F9YA 2VTPA 3PA5A 4W8EA 4YTCA 5L3AA 2OU7A 5KHXA 4IM3A 1PYEA 4UMRA 1H1SA 4B8MA 4RLKA 5ETAA 3VONA 3GC0A 3F88A 4BWPA 5DT0A 3OROA 5FXQA 3ZO3A 5BYYA 2EXEA 4NH1A 2QU5A 3CD3A 5BVEA 5HKMA 3H30A 4JXFA 2YCFA 3MS9A 4J97A 4GK4A 3A7GA 5IA0A 5C9CA 1ZAOA 3GENA 2I7QA 4U6RA 2C1AA 2BKZA 4IM0A 3FMJA 4PNKA 5EFQA 4W8DA 2VNYA 2W1CA 5CAOA 4ZEGA 1FVVA 4FV2A 4C38A 4F0GA 3T9IA 3OCSA 1H01A 2BHHA 4D58A 5AADA 4PPCA 5L8LA 4C58A 4ERWA 4TKSA 3F3ZA 4ZTLA 1U54A 2XANA 2BHEA 3BELA 3FSKA 3PUFC 3QZHA 4FT3A 2PZRA 2R3PA 3RI1A 3SKCA 3U55A 4OLIA 5M09A 2EVAA 2YLEA 4X2KA 2H6DA 1OB3A 1R39A 3LXLA 3V6RA 5KBQA 1QPDA 4N57A 3COHA 2C0TA 4YJRA 4DHFA 2BPMA 5HCXA 4FT5A 1UU3A 4BIEA 3H9RA 3UOLA 4E8AA 3ZONA 3NUYA 4A4LA 3ORZA 4GYIA 3QRUA 5CAUA 4MXAA 2JFLA 4F09A 4U9AA 4ACMA 4BCQA 4LI5A 2NP8A 2W0JA 3BGZA 5DIAA 3R9OA 1OIUA 3P9JA 2I0VA 3RKBA 5M06A 2EU9A 3VHKA 4F4PA 4GKIA 5AR3A 4I4EA 2XIZA 3FKLA 3V5TA 4FV1A 1WBSA 5HORA 4AT4A 2BFXA 4DLJA 4U45A 4XG8A 5I9XA 2IPXA 2YIYA 3Q2MA 3HZTA 4WSQA 4Y5QA 1PHKA 5IQEA 2IVTA 3LOKA 4IX6A 5HGIA 1RE8A 3O7LB 4QMMA 4J99A 4RIXB 1JKSA 5F1ZA 3WI6A 1OUKA 4OTGA 4BRXA 3QD4A 5CEKA 3GOKA 1FGIA 1PXMA 4FKPA 4CTBA 1U59A 3ZRLA 2ZB0A 3QA8A 1H0WA 4QMLA 4KABA 2XCHA 4QOXA 5LVPA 5IU2A 4FUYA 4QYFA 4BCGA 2ONLC 4OR5A 3QUDA 3D2KA 4BCJA 3ZFXA 2OF2A 2UW0A 3CQEA 3PYYA 3O51A 4DC2A 4LGGA 2BIYA 3DDPA 5DYJA 5E9EA 3GC9A 2VTRA 4KKGA 3RNYA 4CG8A 5FEEA 3RCDA 2P3GX 3DLSA 3ZDUA 5AV4A 5CVHA 1S9IA 3CPBA 4FV0A 4FOCA 1XH5A 4CQGA 2Z7SA 4U5JA 3D7ZA 3FPMA 3DBDA 4ZOGA 4XRLA 5ITAA 4QMPA 5T6KA 1M14A 2PE0A 4HZSA 5AR8A 1OI9A 2YEXA 1YXUA 4TYGA 3UDSA 5IISA 3PWYA 4BY9E 3C4FA 4Y85A 4BCFA 5DR2A 1H27A 3QHRA 3E5AA 1PKDA 2ZDTA 2OJJA 3VBYA 4FSZA 3KQ7A 3QQLA 4KKHA 4ENYA 2O8YA 4LFIA 2C5NA 5I3OA 3LJ0A 1B39A 4C33A 5A54A 3RTPA 4XV1A 5AUUA 3LHJA 4QPSA 5AWMA 4JIKA 1CMKE 1OPLA 3UODA 3LMGA 2C3LA 3DFCB 2ITNA 4YURA 5CEPA 3QTQA 2ZYBA 2BMCA 1UU7A 2HENA 2C6DA 3FXXA 4CT1A 1VLRA 3TM0A 4UB7A 4W4VA 1L3RE 3I4BA 2VWBA 2WQEA 4IWPA 3NUSA 4ANQA 4V04A 4YLJA 3AKJA 1V0BA 4O7TA 4MBJA 5EM5A 1OKYA 2ZM4A 5A3XA 4ACGA 3IW8A 3MJ2A 2CGUA 3ULIA 1IEPA 4J52A 4ONAA 2VTNA 3FI3A 5AUZA 3I7CA 3IOPA 5EDPA 3D5XA 2XIRA 2ITPA 3QUEA 4WRSA 5B0XA 5FTOA 2VD5A 2W17A 4M15A 1ZLTA 3UDBA 4BWXA 1M7QA 4BB4A 3F7ZA 4C4HA 3R30A 3F5UA 1WBTA 1H24A 3A8WA 3QGWA 3FMLA 4JDHA 3TJDA 3W16A 4DBXA 3NYXA 3VUHA 5IQHA 4O96A 3NLBA 2UZLA 4F0FA 1M2QA 3FQSA 3M2WA 4L3JA 5HE0A 4FIFA 2QOKA 5GJGA 4KSPA 4EJNA 3NYNA 4LMUA 3MTLA 4CZUA 4DBNA 3LFBA 2VWWA 1LEWA 3Q60A 4ZTHA 4CGAA 3UJGA 4Y8DA 4L53A 2HYYA 3C9WA 4CYJA 5HI2A 2JIVA 3D2IA 4FG9A 3MI9A 1J7UA 4BDGA 2Z2WA 3VUKA 3SW7A 5IPJA 4CLJA 2FVDA 3HKOA 3NAXA 3R28A 2F57A 3KKVA 2X9EA 2XBAA 4LQMA 4XG2A 2XK8A 4NKSA 4OTFA 2BALA 1OUYA 3RWPA 4QMXA 4FIHA 4RRVA 5JZNA 3SQQA 3TZ8A 4ZS4A 1SNXA 3V5PA 2QO2A 4U8ZA 4RT7A 4PMPA 4HCUA 2YHVA 3BYVA 3QD3A 2VO3A 4WBBB 1OIQA 2HZNA 3N9XA 3WZDA 2WB8A 4IMYA 4O4CA 3Q5IA 4G16A 3FMKA 2VX3A 4QP7A 5M07A 2R3RA 2EUFB 3MN3A 4G3DA 3HAVA 5F4NA 5AUYA 4IX3A 3IO7A 3OOMA 3MY5A 4GKHA 2EB2A 4MD9E 1REJA 2YA9A 4JJRA 4PRJA 2BTSA 1W0XC 3R7YA 3RAKA 3ZEWA 4A9SA 3K3IA 4E7WA 4DTAA 4F1TA 4AAYA 3DBQA 5IMEA 1U4DA 3JVSA 3TEIA 3MFTA 5IUHA 3F2NA 4IZAA 3FE3A 3VO3A 2VU3A 2O64A 2YIQA 3BYSA 3FKOA 4YLLA 2PY3A 4MUQA 3Q96A 4Y5HA 4C4JA 2QR8A 3S2PA 3U51A 1YDRE 2OZOA 4RLLA 5KKRC 1OM1A 4QPAA 3P5KA 4QYEA 3UIUA 5EYMA 5JT2A 4OAUC 2GQSA 3Q2JA 4L45A 2CGXA 4N0SA 5J9YA 3PA3A 2CKEA 2WELA 1UWHA 4XG7A 3NUXA 4WUNA 3WE8A 5M56A 3BHHA 2WMTA 2VRXA 4XHKB 1PF8A 3LFNA 3UIXA 5IZFA 2WU7A 4FKSA 1ND4A 4DAWA 5J9LA 3DK7A 4GK3A 1PJKA 1WVXA 1ZOHA 4O0RA 4NL0A 1BKXA 3HRCA 1Y8YA 5FG8A 1UU9A 2C5YA 3D94A 4MNFA 5HD7A 1ZZLA 1J91A 4NU1A 4R5SA 3UNZA 4I0SA 4A4OA 1PRYA 4DH1A 4QMVA 2PVNA 4I94A 1Q4LA 3BIZA 2V0DA 4EH9A 3FMDA 3L8VA 3MJ1A 3SG9A 2XK7A 5CSHA 2WD1A 2ONLA 3EN7A 4D4RA 2VTLA 4C7TA 2C3IB 2V7AA 3RM6A 5M4FA 3VF9A 4Q5EA 4FKJA 3FZOA 2X2KA 4IEBA 3KY2A 4M68A 3BE9A 3B2WA 2DWBA 5CXHA 3EL8A 4PDYA 4ACHA 5D7AA 2BZKB 3TTJA 4APPA 2OIQA 3ALNA 1EH4A 2ZB1A 5DI1A 3W2OA 2BR1A 5KCVA 3Q4ZA 3D83A 3HP5A 2Q83A 1R0EA 1SZMA 3NEWA 4FKUA 3R7OA 3SRVB 2HK5A 3NUAA 4OUCA 4ZIMA 1H0VA 2IZTA 3UP2A 3BGPA 2R3HA 2C6LA 2XNBA 3P7CA 1UNGA 4QTCA 5DVRA 5EQEA 3GUBA 4PPBA 4RZWA 4I5CA 3CEKA 3UVRA 3ZO2A 4FEUA 3ID6C 3FLNC 4XCUA 3PG3A 4EOSA 3IDCA 1WBOA 4AN9A 1V1KA 5AP4A 1PXNA 4CEGA 4FEXA 3HMNA 5A9UA 3ZXTA 4ANMA 3VS4A 5H2UA 5GZAA 2RL5A 3OEZA 3R83A 5AV0A 4FICA 4G9CA 2VGPA 4ALWA 2HZ4A 4H3PA 3UDTA 3ELJA 1O6LA 4CTCA 2BRNA 4RVTA 3AGMA 3GFWA 3QC4A 4GG5A 1OKVA 4FKRA 4L01A 4O7LA 2QD9A 3DBFA 4U0IA 4UMPA 4DT9A 5AP5A 4ZJVA 2HWOA 3H0ZA 3V8SA 3E88A 3MW1A 3TT0A 3MYGA 4FKVA 2XJ1A 3EQPA 4BDHA 5I0BA 4C35A 5DEWA 2BTRA 1Y91A 4L3PA 4U40A 3V5QA 3GU7A 2ESMA 2C68A 3DFAA 4FTJA 4RVMA 5AUTA 1Y8GA 4ZY4A 1YDTE 3I60A 3R22A 3MA6A 4TT7A 4MBLA 4AXEA 3LFAA 2UW5A 3R1QA 5CAPA 2VN9A 3KXNA 4TY1A 1HCLA 1ZARA 5ETIA 3RAWA 3V5JA 3TV4A 3W18A 4KBCA 5JRSA 4AAAA 2WHBA 3P86A 4BI0A 4BFMA 2WIHA 4V0GA 3E64A 4K2RA 2ZMDA 4WIHA 2UW8A 4GJ3A 5CALA 4QNYA 1T45A 2PUIA 1ZMVA 3PJ1A 1ERKA 1FVRA 2XH5A 3I81A 4LM5A 4ZJIA 3UG1A 3VULA 4J53A 5IA3A 5B2MA 3C4ZA 3I79A 1OMWA 1ZOGA 3IW5A 2JBPA 3MH3A 5HG9A 3L9LA 2BZJA 4RIOA 4BL1A 4AZVA 3NNXA 3U8WA 3F5XA 4HVIA 1DS5A 2GNLA 2QQ7A 3N4TA 3FQEA 2HIWA 5T3QA 3EH9A 4FNZA 2Z60A 5CF6A 5B2LA 4XUFA 3OD6X 2XCKA 3W2QA 2GFSA 4F70A 3ALOA 4RMZA 5CU2A 4F65A 2GFCA 4G3EA 5C03A 1OKWA 3SA0A 3KRRA 4JS8A 3ZLWA 4QD6A 1XH7A 2HZIA 3CY2A 3FL4A 4YLKA 2YN8A 5AEPA 4ZZOA 2Y0AA 2W4OA 3QUPA 2YJRA 5CVGA 4H39A 4ZXTA 4WA9A 2J0JA 4FIIA 5CU6A 1CDKA 1YXSA 4GFMA 3UVPA 2R7IA 4DITA 5M08A 2QO7A 1HOWA 4UYAA 2B54A 3O17A 4FNWA 2AQXA 2VO0A 3HMOA 2UW6A 1Q8YA 2G2HA 1BLXA 2W4JA 4FF8A 3F5PA 4O38A 5IEYA 5KMOA 4KBKA 3BEAA 2WQMA 1UNHA 4U97A 4QP9A 2JLDA 3TV7A 1NY3A 4PDOA 4RIWB 4L6QA 5HICA 5J79A 3CTHA 2A27A 3LQ3A 5BYLA 3OT3A 2I0YA 3Q4UA 4C4IA 3G51A 2QKWB 4QMSA 3RWQA 2C47A 2GNJA 2I40A 3E7OA 1XH9A 4ID7A 2IZRA 1YKRA 4CFWA 4D9UA 2IW8A 4EKLA 3M1SA 1WMKA 3R9HA 3ACJA 3CQWA 3RPVA 3VRZA 5TT7A 3S0OA 2PWLA 2WZJA 1NVSA 3DJ7A 3O8UA 4L44A 2VTMA 4F08A 4CCUA 3ZBXA 3MVHA 3AT4A 3W0NA 2BCJA 1J1BA 3FLWA 3V04A 2PVKA 3C0IA 3R1NA 3JVRA 4IQ6A 3DB6A 3LJ2A 4YPDA 2AUHA 3KK8A 4BCNA 4OBPA 4AQCA 5CTPA 3OP5A 2CNUA 3SAYA 3R71A 4F0IA 3HDMA 3NZ0A 4MWHA 1KOBA 3R00A 4F7LA 2BAJA 4FEQA 1F5QA 2XNNA 1Y6BA 3CP9A 2J0KA 1XBCA 1UA2A 4FSQA 4A07A 4DGMA 2QHMA 4EZ5A 4TXCA 2ZAZA 4S32A 2R64A 3R01A 3E8EA 3SOAA 3EYGA 4E4XA 2C3KA 3W2SA 2PVHA 2VTOA 4BF2A 3HA8A 1URCA 1YXTA 4I93A 5HD4A 3ODZX 5AUWA 4TRLA 4UY9A 4I92A 1F0QA 5HU3A 3EN9A 4XNEA 5IQCA 1YOJA 2C0OA 1A06A 3H0YA 3ZZEA 5CAVA 3PFYA 4F7JA 3DQWA 5HIEA 2W1EA 3C1XA 3GFEA 2VO7A 5IQBA 1H1WA 4FUXA 5LWMA 4FSTA 3FY0A 4FX3A 5JGBA 4O2PA 4DLIA 4OAVB 5EW8A 4OTWA 2IW6A 3NW7A 5IMXA 3DB8A 5TF9A 1FMOE 2C6MA 3R21A 4NCTC 4YP8A 2F7ZE 2WQOA 4MXZA 3VF8A 4DT8A 2CSNA 4P7EA 4YJVA 1SYKA 3I6UA 3AT3A 4XV3A 3ZYAA 4DHZA 2ITUA 3U4UA 4BKYA 5DRDA 3LPBA 3D15A 3LKMA 3VUMA 5KMKA 5M4IA 3EHAA 4A7CA 2XJ0A 2GS6A 3RAHA 2XRUA 3MIYA 3L9PA 2XA4A 4P2KA 2YISA 3ZRMA 4R3PA 3ZO4A 4GT4A 3UGCA 3CXWA 1W2CA 4YTHA 3SVVA 5LXMA 1Q41A 3KVXA 4E5BA 4MYGA 4XLVA 1H07A 3MESA 5HNIX 4QTAA 2A19B 2XJ2A 4JBVA 4UEUA 3OUKA 5J95A 1OIRA 2QNJA 4YJSA 5J7HA 3TTIA 4EEVA 3O2MA 3PLSA 3FHIA 2WKMA 2PYWA 4FT0A 4GYGA 4M3QA 2SRCA 3R8PA 3UMXA 3OT8A 4A9YA 4RJ6A 2C6OA 2Z7QA 3F3TA 3VJNA 2NRYA 4YJQA 3QXOA 1E9HA 4R5YA 3ZSIA 5CAQA 3E8DA 5DN3A 3ULZA 4M67A 5M44A 2RSVA 1KSWA 4TL0A 4Z55A 2G01A 4XRJA 4BI1A 3DA6A 5ICPA 4DHJA 1FINA 4O86A 2PULA 3AD4A 3GCQA 4R3RA 3ORIA 1ATPE 2A2AA 5DFPA 2AC3A 2Y7JA 4YTIA 3CJGA 4BDJA 4D9TA 4B6LA 3BLRA 3D5VA 1Q24A 4G34A 2CGVA 4D55A 5L6OA 2F49A 1MQBA 3DS6A 4JMQA 1YHWA 4ARKA 2UVYA 2R3MA 3R7VA 4RIXA 5FBOA 4ZZNA 3U6IA 3PZHA 4PDSA 4IDTA 5JFWA 4QYHA 1H00A 3NDMA 2CCIA 2P2IA 5AP6A 2R5TA 5K0XA 4GRBA 5ANEA 3GCSA 3TJCA 4CMOA 2YJSA 4MX9A 4RFZA 3RM7A 5TOZA 2R0UA 2UW4A 3ODYX 3TZMA 4USEA 3FMHA 5D10A 3IK3A 3AC2A 3ZSGA 3IW6A 1JNKA 2W5BA 2HXLA 3V51A 4AN2A 3FV8A 4X6RA 4PL4A 5EHLA 2R0IA 4IWOA 3TYKA 5KHWA 2PZIA 1JOWB 3H10A 3DJ6A 5BUIA 5I4NA 2ERZE 3GP0A 1JKTA 3DBEA 3QQJA 4CFMA 3QZIA 5C1QB 4ZS0A 3NVMB 4QMYA 4O6EA 1PMUA 1LEZA 3CC6A 3PXFA 2JEDA 3PTGA 3PVGA 1IR3A 4FBXA 4EZ3A 3KULB 5CF8A 2O2UA 2YM3A 4I3ZA 3TUBA 4Y95A 2ITOA 3SGCA 4ACDA