4QP1A

Crystal structure of erk2 in complex with n-cyclohexyl-9h-purin-6-amine
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
349
structure length
342
Chain Sequence
EMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFDDLPKEKLKELIFEETARFQPGYRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
publication title Fragment-based discovery of potent ERK2 pyrrolopyrazine inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 342
sequence length 349
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qp1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qp1A01
3LVPA 3V5QA 1H8FA 3F3UA 3MFRA 4O7NA 2R0IA 4Y5QA 5BVKA 4YTIA 1PKGA 2FB8A 4TZRA 3NCGA 5ETCA 5CENA 3ZHPC 1TKIA 2PZPA 4LRMA 3L9LA 3Q60A 3VUHA 4DGOA 5FBOA 2XNMA 4Z55A 3E92A 3EWHA 3QUPA 2QKRA 4HZSA 4O0VA 3OWPA 2C4GA 3QQJA 4U97A 3BHUA 2ZAZA 3DFAA 3OY1A 4BGHA 3LCTA 3ODZX 3W32A 3ET7A 5HE0A 1ZYJA 5CY3A 2I0HA 4YJOA 2XNNA 4M68A 1MRVA 1OBGA 3A7IA 2QR7A 3PE1A 3PSBA 2ZDUA 3BU5A 3QD4A 3SKCA 4IQ6A 2ITVA 1G8SA 3ZFYA 4GUBA 2WMAA 1LR4A 2ZV2A 4FSNA 5D41A 5DT4A 5C8MA 5T3QA 5GNKA 1O6KA 3QKMA 4C8BA 2GS2A 2WMUA 3LW0A 2OIDA 2W5HA 1A06A 4RLLA 5AP3A 4EHZA 4CKJA 1PXPA 4O7YA 2OJGA 4CYIA 4BDCA 1NXKA 3FMLA 4C58A 5LVMA 4L67A 4CMOA 5DLSA 4FUYA 4D4RA 3QQKA 3ZLXA 3W2RA 1TQPA 3O71A 2WB8A 5D9HA 3COIA 5FGKA 2PZ5A 5GIPE 3TIYA 5KNJA 3FI8A 3CQUA 2J7TA 2X0GA 4ACDA 3DBEA 4D2TA 3W55A 1SNUA 2BZJA 3U54A 1VZOA 4O0UA 5CX9A 4AZVA 3VUDA 5D7VA 3GGFA 2A2AA 1R0EA 3F3TA 4X0MA 1WAKA 1Q8YA 4MAOA 4UYNA 5HVJA 5IMEA 4H3BA 2CCIA 4NZWB 2VX1A 4FIIA 1Y91A 2F9GA 2YM4A 4CQEA 1T45A 4PL5A 4U79A 4AZTA 4O7RA 4E20A 3LPBA 1TQMA 3F3ZA 3G33A 3WZUA 3QWKA 3KL8A 4XEYA 4BDKA 5FXRA 2XZSA 5L8LA 2JC6A 4IJPA 3OT3A 1PMVA 3U6JA 4R7BA 2BKKA 3QRTA 5LOHA 3KF7A 3ORTA 2BVAA 1GJOA 4MD8E 1YWNA 4QT1A 5LXMA 4RIXB 2BFXA 2YM6A 3OT8A 3OY3A 4BTJA 3LZBA 3PPJA 4IXPA 3DAEA 4PQNA 1XBAA 2QKWB 3C4EA 3V8WA 5HX8A 1H1RA 2WTJA 3FLZA 5AUUA 3E64A 4WNPA 4QMXA 4KWPA 3RK9A 3TUBA 3RPYA 3THBA 4F08A 4ZZOA 3KU2A 5AX3A 4AUAA 4AGWA 4WHZA 3OS3A 4D2WA 4NCTC 3FPQA 4C3RA 5A4QA 3QCYA 1PXNA 3RBWA 1YHSA 3OMVA 4XS2A 5LCJA 4OBQA 2W5AA 3ZU7A 3R83A 4H36A 3TJDA 3W2OA 3VULA 3ZFXA 3PP1A 5HG8A 3LJ0A 2XYNA 3K5VA 2CNVA 1XBBA 3OCGA 3FMDA 3ZLWA 2W17A 3HMOA 4IANA 4KD1A 5HI2A 2CKEA 4BCIA 4CMTA 2VTIA 4O6LA 4U42A 3PJ2A 3GOKA 2VTAA 4G6LA 4BDDA 3H0YA 4L01A 3D5UA 2B9FA 3OWJA 4U43A 2EXEA 4F7LA 2V5QA 4FZ7A 4D0WA 4FL3A 3RAWA 3PDTA 2PL0A 3D15A 3EIDA 1YDRE 2O0UA 2EB2A 2W1ZA 2W1DA 3TNPC 4D9UA 4IAZA 5FEQA 3L9MA 1OIUA 4K2RA 3GT8A 4P2KA 3W18A 4RWKA 4RIYB 3UIBA 3PY1A 2GTMA 1UKHA 3V5TA 4BR3A 4BL1A 2J90A 4DFBA 3MJ2A 4FIFA 5AR2A 3UDBA 4EI4A 2XCHA 3IDBA 3PRFA 4P5ZA 2XCKA 4ZJJA 3FMMA 4BWKA 1Z9XA 4O7WA 3LLTA 4HVGA 3AC5A 1WBPA 2CCHA 3AT3A 2VWYA 3DLSA 4BHZA 5CEIA 3UQCA 1Z5MA 1ERKA 2WMWA 3KY2A 4TRLA 4JDHA 4MNFA 4F9AA 3VS4A 4IM3A 2DQ7X 3OG7A 4GH2A 2JDVA 2OKRA 3TTJA 4LM5A 3LHJA 2GNJA 4BKYA 2VGOA 2XK9A 5KO1A 4C4HA 1OKZA 2WMQA 4IAAA 3AGLA 1P4OA 2QOKA 3VHKA 1CKPA 4YURA 2YCQA 4E6QA 2OIQA 3TZMA 3CPCA 4EH6A 3E8CA 3VVHA 3W2QA 3ROCA 4A9YA 4WG3A 3M1SA 4WSQA 4JDJA 5FTQA 5EOBA 3TG1A 4BYJA 4EOIA 5HVKA 1OBDA 3HZTA 4K9YA 5CYIA 3O96A 2ZV7A 5JK3A 2Q83A 4PTCA 4X2GA 4ENYA 5AUZA 1R1WA 2H6DA 3KGAA 4JQ7A 3L8PA 5EQYA 5CEKA 4ZMFA 4MX9A 3QHRA 4HYSA 4X21A 3GU5A 2HELA 1H1PA 4FMQA 4E4LA 3DXPA 3R2YA 2IWIA 4QD6A 4BKJA 5FDPA 1XKKA 5DFPA 2HXLA 2Y4IC 3A7FA 1Y6BA 2R2PA 4ZOGA 5E91A 3BGQA 2BAKA 4X2FA 4L00A 5DG5A 5DEYA 4TYHA 1FOTA 3KXHA 5AP6A 3KCFA 5L8KA 2CDZA 4MNEA 3E93A 3MVMA 2YJSA 3QALE 3KRLA 5E8ZA 2X9EA 3HYHA 5EQEA 3QF9A 1AQ1A 1FGIA 5E8SA 5AM7A 3FL5A 5JGDA 3EOCA 2R9SA 2ERZE 3F66A 2JIVA 5TF9A 1W83A 4OTWA 2X39A 4AOJA 4WIHA 1SNXA 2YHVA 4O7ZA 2XNEA 3NNVA 4M66A 4GVAA 1PMUA 3NWWA 5HG7A 5HG5A 4XCUA 5I3OA 5IA1A 5LMKC 1R39A 4LV5A 2QU5A 3BLRA 5JFVA 2XK3A 3L9PA 3UYSA 4BYIA 4F4PA 5FTOA 2HZIA 5AP2A 4O96A 5D11A 5A46A 3OCTA 1ZMVA 2G2IA 1P5EA 1MP8A 1XWSA 2B55A 4GFOA 5BPYA 4Y95A 2VUWA 3C0IA 4L3PA 5AAGA 4FNXA 1UU9A 4QMMA 3F2RA 3FZ1A 3M2WA 3EQDA 5A3XA 2Y6MA 4IE9A 4RRVA 3KXMA 3UBDA 2W96B 3UYTA 4FNZA 4D1SA 4C37A 4JL9A 5FM2A 4DFZE 2JFLA 1PXLA 4QYGA 3MWUA 4XV1A 5HE2A 4DCEA 3MVLA 4Q9SA 3MJ1A 3WYYA 4IWOA 1KE5A 5LCKA 5JGAA 5F95A 5CF4A 3SW7A 5CNNA 5IMXA 4HZRA 3CTHA 4GU6A 5EHYA 3SXFA 2C68A 3ZC5A 2WTKC 2QOLA 4J8MA 5IEXA 3UO5A 1WZYA 3F6XA 4DGNA 5EKOA 2RKUA 2BRBA 5HNBA 4FV2A 4NIFA 4RX5A 1JSUA 1JLUE 3R7VA 3OD6X 1UWHA 3UPZA 5CEMA 4NL0A 2EXMA 2XP2A 3HA8A 4FSZA 3C4ZA 5M06A 4EOQA 4D9TA 5HTBA 4RIWA 4CLJA 3FYKX 4E93A 4GIIA 4K6ZA 3NYXA 2CGWA 4C59A 4OTIA 2XIYA 5B0XA 3RWQA 3QLFA 4PDPA 2PVYA 4H1MA 4PDOA 3NW6A 5IA5A 4AT3A 2CSNA 3QQLA 2UW9A 2C3KA 3Q6UA 2JKMA 2IW6A 4AOTA 4DLIA 3PPZA 1RDQE 3I4BA 4PNKA 4QNAA 2BAJA 3FAAA 4YHTA 4I6HA 3U51A 3RZFA 4XG9A 4XLVA 2HCKA 5CXHA 5AX9A 1WBWA 3D5XA 2DS1A 4O38A 2G15A 4J52A 3F3VA 3F88A 3HLLA 5F20A 4DG0E 5DE2A 3R9RA 4U7ZA 3I5ZA 3QUDA 4O0RA 5D10A 4E6AA 5L2SA 4O7VA 5BQ0A 1E1VA 3EN7A 5CEOA 3R7EA 4FTAA 1PYXA 3E7VA 4IDVA 1SVGA 4I4EA 3G0FA 4BDHA 4D2PA 1I09A 5IQFA 1GAGA 4CCBA 5FRIA 5AV1A 2OGVA 3GC7A 4RVTA 4HVHA 4B8LA 3BE2A 4BB4A 3DBFA 4RG0A 4WG5A 4CFFA 2H96A 4FV5A 1ND4A 4F99A 3V8SA 3HECA 4JBPA 3ACKA 4EHEA 3KRJA 3Q9YA 1ZWSA 4BDEA 4BCNA 4JG7A 4JQEA 2QR8A 5AP7A 3TXOA 3VIDA 2QURA 1ZMUA 3QGYA 4G5JA 4GCJA 4N4SA 4D1XA 1PXJA 4GW8A 1JNKA 4IAFA 5TR6A 3N4TA 4TWOA 4ZTQA 4ZXTA 3P9JA 5EI8A 1YRPA 2GDOA 2VWZA 4JXFA 2JDOA 4M0YA 2WTDA 3U87A 4ACCA 3IONA 4EKKA 1IAHA 4L46A 3RNIA 5AP0A 3UGCA 3BGZA 3PVUA 4FK6A 4G6OA 4CTBA 3G5DA 1DAYA 3FSFA 3LXNA 4IX6A 5FEEA 4YP8A 4DTBA 4HCVA 5HBHA 3Q4TA 3SXSA 4C62A 4C02A 2XH5A 3MA3A 4KINA 3W2CA 3BIZA 4HW7A 3BGPA 4YPDA 4X2NA 4W4YA 3LCOA 5CI7A 2PZRA 2FSOX 3EB0A 3F69A 2GQGA 3TKUA 4ALUA 5J7BA 3DCVA 5J5SA 3UNKA 5J7HA 4TYJA 2B0QA 3OF0A 4QP6A 1OL1A 3P08A 5KMIA 4IX3A 1V0OA 3I0OA 4ARKA 3CJFA 2NNWB 3Q04A 3VQUA 2JDTA 4FTMA 5HX6A 1ZYSA 3VUTA 3CSVA 3EL8A 4KAOA 3I5NA 3V5PA 2XKCA 1OITA 3QWJA 4FTQA 4LFIA 4EH9A 2ETRA 4GT3A 3ZMMA 4M12A 5J1VA 2HYYA 3CP9A 3IW7A 5HKMA 1BUHA 2XIZA 3FKLA 2W1HA 3HMMA 1M52A 3HEGA 2JAMA 4KKEA 5CQWA 2QC6A 3OTUA 4ANQA 4FEQA 4BWXA 3BU6A 2WKMA 3Q96A 1IR3A 2C6MA 2LAVA 4IB3A 5GJDA 1YWRA 3UZPA 2J50A 3NYNA 4MBLA 4NEUA 3BRBA 2WD1A 2WGJA 1OPLA 4IAKA 3ODYX 4B9DA 2E9PA 3FMNA 3FZOA 1JWHA 3MPAA 4DN5A 2GMXA 4R8QA 5LMAA 4IJ9A 4PMSA 3MH2A 5IEYA 4OTFA 2BDWA 2Y4IB 4NW6A 1Y8YA 2REIA 4YLKA 5EW8A 5IEVA 4MHAA 5KMMA 4P5QA 2BROA 2XK4A 3IOKA 4ZSEA 3NDMA 4FKGA 3K54A 5AP4A 3F2AA 3IECA 3PIYA 1ZY4A 4F9BA 4RFZA 4DG3E 2I0EA 5KZ0A 3OCSA 1JPAA 3NW5A 4G6NA 4P7EA 4AE6A 5ANGA 2PVRA 3D5WA 4D5KA 1LPUA 2HW7A 3DTWA 5HNGA 2CKPA 2UZEA 2X1NA 3NYVA 4DEBA 4KBCA 3H3CA 4IFCA 3VJNA 3QTQA 5DMZA 4FSWA 2WU7A 3VS5A 5IH4A 2AYPA 3RVGA 5LQFA 2VTJA 2QO2A 4GYGA 3A99A 5EM6A 4JRVA 4KKGA 4CV8A 4O91A 4NKSA 2O64A 3FY0A 2OJJA 4GG7A 3TV7A 4TWNA 1PW2A 4F1TA 1U5QA 2QOHA 2Y9QA 3QQFA 2PTKA 4S33A 1G3NA 3CS9A 5AMNA 1OB3A 2UVXA 5HZNA 4IH8A 3ZLYA 4JX3A 1BI7A 4XYFA 4E8AA 5IQCA 2YERA 4QQ5A 2WAJA 3N4UA 2Y4PA 4N0SA 5I9WA 5LMBA 4E5BA 4EWQA 1SM2A 2Z7RA 4BCHA 2O65A 3FE3A 1PJKA 4CFMA 3OROA 4Q9ZA 1KE7A 1W8CA 2XIRA 4U9AA 2VTSA 3QC9A 4XG2A 4FT9A 4BRXA 4G3FA 2GHMA 3FI4A 4NTSA 1GZKA 3IKAA 4RGJA 3R1SA 3UVQA 3UOLA 4FSYA 3C0GA 2X2MA 4RIXA 3Q9WA 4YJVA 2VAGA 4F9YA 4U45A 2RL5A 5I9VA 4BFMA 1OVEA 2VRXA 4U0IA 4A9SA 3FC2A 1REKA 4XNEA 5K0XA 1IAJA 4XG7A 4FGBA 4BDFA 3D5VA 3RHKA 3F5UA 5AIRA 3KXXA 5IISA 3RALA 4BCGA 2AC5A 3DGKA 1JKLA 3GC8A 1YI3A 4IZ7A 1PXMA 1UNGA 3U9NA 4ZSJA 2XRWA 3II5A 4R3PA 5I9ZA 4NKAA 3LCDA 4Y72A 3QHWA 4Z16A 3COKA 2BDFA 4JRNA 2GSFA 4HCUA 4FKTA 4EBVA 4F9WA 2PE0A 4MWHA 5E92A 3EJ1A 4QQTA 1PYEA 4IC8A 1VYWA 3DTCA 4ERWA 2XUUA 3HV4A 5BVFA 2X6DA 4IADA 4E73A 4YO6A 5C03A 1M2QA 3P5KA 3LXPA 3QKLA 4IAIA 3DOGA 2JLDA 4ZJVA 5IA3A 2C6LA 2BRMA 5BYZA 2ZM4A 1IASA 3VUKA 3UNJA 4C61A 2UUEA 4MWIA 5K0KA 1W98A 4EQUA 5L3AA 2GQRA 3HAMA 3OEZA 1YXSA 2J5EA 2W4JA 3SX9A 2XVDA 4EH4A 4RIYA 4FSQA 4C2VA 4PMPA 3G6GA 4FNWA 4BCOA 1KE8A 4ZSAA 4GL9A 4QO9A 5HTIA 5K4JA 2JITA 3F61A 4JR3A 4ZTLA 3ZZEA 4ASXA 3V5JA 3FBVA 5I3RA 5AP1A 2PUNA 4NWMA 2NPQA 3R8MA 3F5PA 4HYUA 3LLAA 3DA6A 1FQ1B 4FEWA 3EYGA 5J79A 4H3PA 5JN2A 3GI3A 1LEWA 3QTWA 2R3JA 4IWDA 1U59A 2G2FA 4YGAA 5HIBA 3TL8A 4FGRA 4AW5A 1VEBA 2ZV9A 3A4OX 4DINA 3PG3A 4IZYA 5AADA 4LL0A 3C4XA 3I60A 4RC3A 4FT5A 1Q5KA 1GZOA 3RPOA 3ZOSA 3RK7A 3VF9A 1YI4A 2C6TA 5KMJA 3FL4A 4RMZA 1MUOA 5HTCA 5IH6A 1HCKA 4OBPA 4FEUA 3EN5A 5CZIA 3TDVA 1CKIA 2PHKA 3ZCLA 3VBVA 3HP2A 3ZRMA 4KRDA 2F7ZE 3TM0A 3C9WA 1CKJA 1P14A 4YLJA 1YQJA 3A60A 3W2SA 4A9TA 4BY9E 5JH6A 2VWUA 3I1AA 4KIKB 3VQHA 2LGCA 3REPA 4EK5A 3HV3A 4NFNA 4CVAA 2QONA 3WILA 4D1ZA 1UVRA 3KK9A 4AQCA 4QMSA 2I0YA 3LE6A 5ANIA 4R3RA 3QYWA 3FXZA 4F7SA 5M57A 3Q4CA 4Y5HA 1WBVA 2C0TA 4I24A 3FC1X 5H9BA 3MTFA 3DKFA 2PVLA 2A4LA 4MF0A 4NM3A 5IQDA 5L2TA 1R3CA 5LVOA 4AAAA 3U8WA 4XH6A 2JDSA 3K3JA 4GS6A 2CGUA 1ZAOA 4RVMA 4WNOA 4C4JA 4P4CA 3VS2A 1OZ1A 2E2BA 3P86A 3HAVA 5IA4A 4EONA 3AC3A 3ZDIA 3PRIA 4QPSA 4IZ5A 4U40A 4EOSA 3NIEA 2IZUA 3KCKA 2QU6A 2UZBA 1XHAA 3FLNC 2W4OA 2HY81 4O0WA 4RC4A 5KMOA 5M44A 4ID7A 4S30A 2W1EA 4K33A 4FTIA 3FXWA 3KMUA 3LXKA 1F3MC 3R7YA 2O3PA 4CZYB 4GEOA 3UTOA 2RSVA 3ZEPA 2PMIA 3W8QA 3ZDUA 1T46A 4IACA 3H30A 4CNHA 3R8UA 3KVXA 3CKWA 1MQ4A 4LI5A 2IW8A 5I4NA 5M4IA 1UKIA 3MN3A 4S32A 4DEAA 3PLAE 3RAKA 4J95A 3JVRA 2XK6A 3FV8A 2YWPA 5EYKA 1SMHA 2GNFA 3O8TA 1Y6AA 2QHMA 5EYDA 5F1ZA 3LMIA 1GNGA 1Q24A 5KMKA 4YJRA 5AUXA 2UW0A 3QTUA 3SQQA 2YIWA 5DR6A 2I40A 5KBRA 3BHYA 3FLYA 4M84A 3GQIA 5BVWA 5I9YA 5EI2A 5J95A 3TJCA 3GVUA 3I7CA 3ORPA 2J9MA 4RA4A 5CLPA 3RMFA 2DUVA 4E6DA 2VTMA 4EK6A 3KXNA 3TDWA 3CXWA 4RX8A 2ZM3A 1WVXA 4MD9E 3A8XA 2UW8A 1K3AA 3NEWA 3NR9A 4YHJA 5HNIX 1XH5A 1WCCA 2ETKA 4BDJA 1YOMA 4O22A 3D7TB 4J71A 3HRCA 4IZAA 3OP5A 4O0XA 4CXAA 5CEPA 3OBGA 5L4QA 5HIEA 2QVSE 3D83A 1QL6A 3D0EA 3DQXA 4EH7A 5C27A 3FMEA 4WBBB 3UMWA 4HVSA 4AN2A 3GFWA 4I20A 2YIQA 4X3FC 3B2WA 4RFYA 2ZB1A 3UODA 2UZDA 5DR9A 2VTHA 5M56A 4L42A 4PY1A 3S0OA 4BDIA 5DYJA 2WPAA 3FPMA 3O8UA 4BDAA 4C2WA 3JVSA 2CGVA 2FGIA 1H1WA 2J0MB 1L3RE 3BBWA 4XOZA 1WBSA 3KXZA 3T9IA 3C13A 5AJQA 5EW9A 3WBLA 3WI6A 4QP4A 5JQ5A 4R7HA 3E5AA 5H8BA 3B8RA 3VBYA 4EH2A 3N4VA 3TT0A 1E1XA 2VTNA 3BYSA 5CSVA 2CN5A 2YM7A 4E3CA 3EHAA 3PYYA 4XOYA 4JQ8A 3RKBA 3DNDA 4F0GA 2XYUA 3PA5A 4CGAA 3VNTA 3JS2A 3Q6WA 4RLKA 4RZVA 5BMMA 1FBNA 4YJNA 3R01A 4FTCA 2PULA 4OAUC 4C7TA 1OECA 2XJ1A 4PDSA 4MD7E 2BILB 3MYGA 4PRJA 1BLXA 4NCTA 3KRRA 5I0BA 3RM6A 2HZNA 4FIGA 3DK6A 2GFCA 3I0QA 3TNHA 4FOCA 4AW2A 2CMWA 4JAJA 5HCXA 3S4QA 3LM5A 3BYUA 4CFVA 2ZDTA 3G90X 4ZY4A 2QG5A 4GK4A 4U80A 4QMNA 3NUPA 3FJQE 1SZMA 4ASEA 3B2TA 4FSUA 2F4JA 5L6PA 4UMPA 4KS7A 4EOLA 4G31A 4WUNA 3EKKA 3A8WA 4AZEA 4BGQA 2X81A 2BR1A 1Q41A 4G2FA 2XNPA 5AWMA 4PWNA 4OT5A 2YM8A 4R5YA 1UU7A 3HMPA 1XH9A 2IZTA 2PVFA 3MTLA 3QZIA 2XNGA 4RWLA 4BICA 2CNQA 4O81A 5M53A 5ETFA 3VRZA 2VO3A 3PIZA 4FV4A 3V6RA 2VD5A 2VO0A 1Q8UA 2ZVAA 4WD5A 3DS6A 4XMOA 4DBNA 5E1SA 1K9AA 1DI9A 3GQLA 4FUXA 3VF8A 5EDPA 4GKHA 1BYGA 1M7NA 2R3KA 2VX3A 3FZSA 4A7CA 4C36A 4FE2A 2ITWA 1BX6A 4CFUA 3QTSA 3V3VA 5IZFA 4FTNA 3FZRA 4OAVB 2ESMA 4L8MA 2BMCA 4H3QA 3BEAA 2R3NA 4O0TA 4W8EA 2OW3A 2VTRA 5ETIA 1Q8WA 1STCE 3R00A 3DPKA 5BVOA 2KULA 3PPKA 2XMYA 2VTQA 2NRUA 2CPKE 3PLSA 4LOPA 1E9HA 1HOWA 1Q8TA 5J9LA 2PVJA 3FSKA 3FYJX 4ANOA 2ITZA 2B9IA 3NRMA 2VU3A 5CU4A 2WMTA 3D9VA 5A6OA 3G15A 2GS7A 4BTFA 2WOUA 3FQSA 5AM6A 2X2KA 3U4UA 3RWPA 4ZP5A 4WRGA 5AR8A 4F64A 3L9NA 4NW5A 1U5RA 1ZRZA 4BI2A 1JAMA 3E8EA 3DB8A 3DT1A 2WIPA 3I81A 4FV0A 5E8UA 5EDRA 2HENA 5HO8A 4S34A 1NA7A 3E88A 3GXLA 3HRBA 3IGGA 3MH1A 4KIPA 4OTQA 5J9YA 1Q3WA 4NTTA 1ZXEA 3EQCA 3R1NA 1KSWA 4L7FA 1MRYA 4K11A 1Q3DA 5CASA 1K2PA 4C33A 3DKCA 3IPHA 4EJNA 4CYJA 4L44A 4G3EA 1Y57A 2ERKA 3ZUUA 3UVPA 4X6QC 4RWJA 4BDBA 4DTKA 3GCQA 4OR5A 4U5JA 5BUJA 3V01A 4ANLA 5KHWA 5L2WA 1M2PA 3KC3A 4O27B 3T9TA 4JDIA 4DE4A 1KWPA 4I0TA 3PVGA 4NU1A 4DHFA 2XA4A 1DI8A 4NT4A 2VWBA 3SA0A 3DNEA 4EOKA 4A9RA 4AGDA 4F1OA 5C26A 4YTHA 1JKSA 2CLXA 2JAVA 3F5XA 1UU8A 4EYMA 2QLQA 1J3HA 3OUKA 4KBKA 4X7QA 2IO6A 4G9CA 5AV0A 3MIAA 5E8XA 3DXNA 4QTCA 3HRFA 4M3QA 1W82A 2BIKB 4JG6A 2JIUA 2BZKB 3ZXTA 3ZBXA 5B7VA 2CNUA 4L68A 4ANMA 5CANA 3GU8A 4DF3A 1ZOEA 3ORIA 4M8TA 5D7AA 5LMKA 4USDA 5KMLA 3HX4A 5FUTA 3K5UA 2GS6A 4F09A 5AA9A 1FMOE 4QMQA 2C1AA 3LAUA 2QLUA 1VR2A 4G9RA 3FY2A 2HIWA 2EB3A 5CS6A 1EH4A 2UZNA 3LFAA 2YAAA 4EEVA 4PNIA 4F6UA 5M4UA 1BI8A 2UZTA 2UW7A 3EFWA 4NH1A 1GY3A 4FV6A 1LUFA 4QOXA 4XHKB 4YPSA 3N51A 3WZKA 2BHHA 4BVUA 1CSNA 2BFYA 4APCA 3FWQA 1XBCA 4CRLA 5KZIA 4JX7A 3HA6A 2QO7A 3PG1A 4IW0A 5AV2A 5F4NA 3PUPA 3VS1A 5HLPA 4KRCA 3U9CA 3DAJA 3NX8A 4BGGA 2X8EA 3HVCA 3IK3A 3NYOA 4IHPA 4UZDA 5ITAA 5C8NA 2G9XA 3PXFA 5KMNA 3DB6A 4RVKA 4FSMA 5ACBC 4DEGA 4PTGA 3BHVA 1XO2B 1UA2A 5HU3A 3R8VA 3VWAA 2YM5A 1M7QA 3TKIA 2V0DA 3H4JA 3PWDA 4CFWA 3FZTA 2A27A 5KHXA 5AUVA 4H1JA 2IVSA 3ORXA 4DYMA 4EQMA 4DEHA 4PF4A 4X3FB 4DITA 1YDTE 5BVNA 4DA5A 4HOKA 5HIDA 3TI1A 3W16A 3ZM9A 3EN6A 2BHEA 2GHGA 2VGPA 4O7TA 5DPVA 1YOLA 4N57A 2BRGA 3GB2A 4PDYA 2Y8OA 3AT4A 2PMOX 2HY0A 2C6EA 2XKDA 1MRUA 3MY0A 4LGHA 4UZHA 3MY5A 4CLIA 1UNLA 3KMMA 2OZAB 4DG2E 3QD0A 4QQJA 3IS5A 4GYIA 1QMZA 4HPUE 4W9WA 4O7LA 3QD2B 3KFAA 3EFLA 4I6QA 2X9FA 4M13A 2OO8X 3D2IA 2CKQA 4ANBA 2C5XA 2R64A 3EFJA 4FI1A 3ZH8A 5E9EA 3LFSA 4DGLC 4XRLA 2AUHA 2YCFA 1H27A 3NCZA 4TL0A 1GOLA 4QP3A 5EW3A 3ZC6A 4DGGA 4MTAA 5DRDA 4IWQA 4MH7A 4HGLA 3U6HA 4F6WA 3WF9A 4DC2A 4GV1A 1O9UA 4TYIA 1F0QA 5BNJA 4PMMA 5BUIA 3QQUA 2JKQA 3ZS5A 3JPVA 4O83A 2YM3A 5E1EA 2OIBA 3OTVA 4JLCA 3R9DA 3PVWA 3IO7A 4FYNA 4J7BA 1KE9A 5HLNA 4DT9A 3ORNA 3NUSA 1TVOA 5DIAA 4OUCA 3UO4A 3VAPA 2J51A 3G6HA 4QP9A 5AUYA 2OXDA 2FO0A 5JGBA 2V62A 2OICA 2OZOA 4FX3A 4M97A 4WA9A 5KKRC 3LIJA 3NUAA 1Q62A 1FMKA 1JKTA 4Y73A 4AU8A 4FSRA 3SOCA 2O2UA 4BCFA 4IM2A 1UNHA 4AWIA 2RIOA 1NT2A 3KKVA 2X8IA 1KOAA 4G5PA 3MVHA 1XH6A 3PSDA 4BZNA 1JSTA 2Z8CA 4CTCA 1AD5A 2BTRA 2KTYA 2W9FB 2WTIA 2EUFB 5IUIA 4A4OA 5AAFA 3NPCA 1OUKA 4C34A 2HOGA 3BYVA 3D4QA 3EKNA 4D58A 3PE2A 2P0CA 1GIHA 3C4CA 5M07A 2Y7JA 4GMYA 4QP1A 5JEBA 5M4FA 1PY5A 3IW5A 1S9IA 4AXAA 3GC0A 2XBAA 3PXKA 3SXRA 2R3FA 3QCSA 4LYNA 3VW8A 3R1QA 3QRKA 4EK8A 2I1MA 2QO9A 1B39A 4C4GA 5JRQA 2OLCA 4LOOA 4DLJA 2BAQA 3DY7A 4FL1A 4KSQA 4MBIA 5AUWA 1PF8A 5JQ8A 4GKIA 4QMUA 2OF4A 2W05A 2HWOA 3ANQA 5IKWA 2NP8A 4Y8DA 2J4ZA 2O63A 2JBOA 4I4FA 4KIKA 3ZRLA 4KSPA 4BDGA 5IA0A 1GIIA 3F7ZA 3UIUA 3PY0A 4X2KA 4NSTA 3O17A 4N6ZA 1XQZA 1IEPA 3PXZA 3ROYA 4CV9A 3JY9A 2YABA 5HE1A 4ZMEA 4FKIA 4RC2A 5CALA 4XG6A 3FKNA 5CU6A 3ATSA 2VV9A 3ORKA 1P2AA 2B1PA 4NUSA 2PE1A 4QMWA 2EWAA 1YXTA 4IC7A 4HCTA 3KREA 2C5NA 5FXQA 4ACHA 1OKVA 2VNYA 5CAQA 2R7BA 5HBJA 1KOBA 5EOLA 5FXSA 1OL7A 4FYOA 5GZ9A 3RZBA 3WIKA 5M4CA 1H28A 3CY3A 1PMEA 1SYKA 3ITZA 4X2JA 5DNRA 4Y85A 4L43A 3MVJA 1HCLA 3L8XA 2YFXA 5D12A 4ZJIA 3TTIA 4JBOA 2I7QA 4WBOA 2PZYA 4AS0A 2WOTA 3NS9A 5HEZA 4QTDA 3S2PA 3UQGA 3H9FA 3WF6A 3HGKA 1ZY5A 4A07A 3F3WA 2W5BA 2J0JA 5AIKA 1ZOGA 2WQBA 4LL5A 4HYHA 5HVYA 3QZFA 3UO6A 3GCUA 1URCA 2YDKA 2ZJWA 5H3QA 3FMJA 3OZ6A 3Q9XA 3VBXA 2YIRA 4FG7A 3ZONA 4ZTMA 3NMUF 3EL7A 4R5SA 2JEDA 1IA8A 2XIKA 5AR3A 5T68A 2WMRA 4UBAA 3R9HA 5IG1A 4XV3A 4EH5A 4FVRA 2HAKA 4QYHA 4A4LA 4DH5A 4NFMA 5E7RA 3EQRA 3KB7A 5H8GA 3PJ3A 4RZWA 2C3LA 3CQWA 3QKKA 1PXIA 2VTOA 3DFCB 4OTDA 4KUJA 4TXCA 3SGCA 3OWKA 3HP5A 2J0KA 4N70A 4B7TA 2YDIA 3FXXA 2RFNA 3WE8A 4ANSA 3S00A 2IW9A 4I92A 4II5A 5FG8A 5C01A 4O1PA 4FTJA 4E6CA 5CQUA 3CQEA 3DK7A 4QYFA 4IBMA 4IVAA 4OT6A 3D7TA 4I41A 4FIHA 4LGDA 3ZZWA 2PUIA 5ANOA 3ID6C 3DDPA 4XP3A 5CVFA 3CE3A 1UV5A 2C0OA 2PE2A 2YIXA 5M08A 4HGSA 4ITJA 4AA4A 4L9IA 3G9NA 4RQKA 4YMJA 3WE4A 5AV4A 1J7LA 2UV2A 3QX4A 4DEIA 3BV2A 3BKBA 3HUCA 3TUCA 1SVEA 3QX2A 5DN3A 3UOKA 3FLWA 3RHXA 2BZHB 3OXZA 4QYEA 3MFSA 5AR4A 4DFYA 1F5QA 4X3JA 2W1IA 3UG1A 4QTEA 5CT0A 5GZ8A 3DKOA 4AT4A 4DCAA 3KMWA 4J99A 4EH3A 3LQ5A 5HGIA 4AA0A 2WQEA 4WNMA 4E4XA 4YJSA 1YKRA 4C4EA 2P4IA 1B38A 2WEVA 5IA2A 3NNXA 4FT0A 1RE8A 2SRCA 3NGAA 4GRBA 4ITHA 1M17A 3W10A 4WUAA 1ZYCA 3BLHA 3DAKA 3N9XA 3ZRKA 4I1ZA 2C30A 4HPTE 4EORA 5DR2A 4F63A 3ETAA 2J0LA 3RPVA 3TZ7A 3CEKA 2R3LA 1V0PA 4R1VA 2B54A 4UYAA 4F7JA 3FZPA 4IFGA 3TKHA 2P55A 3GC9A 3QRIA 2BRHA 3FLQA 5M51A 3CC6A 4JIAA 3ZSGA 4BBEA 5BX0A 3EQGA 3EQFA 3CIKA 4GT4A 3R8LA 4AGCA 4IAYA 3OHTA 3CPBA 2IZSA 4IVBA 4IWPA 2JFMA 3PZEA 5CSXA 3MH0A 4JI9A 3DXQA 2C3JA 3L8SA 4B8MA 5IDPA 3H10A 4DH8A 3JY0A 1XR1A 4XG3A 2OBJA 1OIRA 3MS9A 3PTGA 4PX6A 4M69B 2WZJA 5DHJA 2A19B 3DBQA 4BBMA 4UY9A 4YTFA 5CU0A 4FZFB 3UZTA 3ZLSA 2R3MA 4ZY5A 2F7EE 4HNIA 2C3IB 3S3IA 2WELA 2XBJA 3UIXA 2F2CB 4Z7GA 3BE9A 3KXGA 4TKSA 2PVKA 2OXYA 4XJ0A 3OC1A 4ALVA 4A9UA 4G34A 2R3QA 1OM1A 2J2IB 3DKGA 3IDCA 4V04A 3EMGA 1OI9A 5JFSA 2V7AA 1AGWA 5IH5A 2VTPA 4DH7A 4U41A 5KKRB 2UVYA 3OXIA 2ONLC 3NAYA 3M11A 4NM7A 4AZFA 4FTRA 5HHWA 3ZEWA 5L6OA 3UMXA 3FEGA 4M15A 3MY1A 2WXVA 4ZTRA 4ZLYA 3KF4A 4GIHA 3UJGA 2OFVA 3KEXA 3SW4A 2W4KA 1JVPP 2UZVA 2YAKA 4F7NA 5IQHA 3CR0A 4KS8A 2IVUA 4RVLA 4R7IA 3C1XA 2RFDA 1YOJA 1QPCA 4RFMA 4UMQA 5KE0A 5GJGA 2HZ0A 3QTZA 4BIEA 4BTKA 1WMKA 3PWYA 3RK5A 5DRBA 5FBNC 4ALWA 1ZOHA 2FSMX 4RT7A 3D94A 3WZDA 4FK3A 2XEYA 3GENA 3ZUTA 3KK8A 4HYIA 3GCPA 2XIXA 3D2KA 4E26A 4ASDA 5HCZA 3OW4A 1CM8A 3UP7A 2H9VA 1ZZ2A 4QPMA 2Q0BA 4NJ3A 2QG7A 3HV6A 4CQGA 5HORA 2OJFE 4JNWA 2VZ6A 2IVVA 3OBJA 5G6VA 2B52A 3EYHA 3HUBA 3IG7A 4PL3A 4D55A 1APME 4V0GB 3SRVA 3WF5A 2OH0E 4KIQA 3HV5A 3DZQA 2C47A 5ICPA 4CZUA 1YWVA 2E9VA 2XM9A 4FR4A 3Q5IA 2XF0A 4CRSA 2P3GX 3I7BA 4BI1A 2QHNA 5GINE 4M0ZA 4IB1A 2ZMCA 4UWCA 3SAYA 4CFNA 5CVGA 2XJ2A 4CMUA 4QNYA 4YJQA 5L2QA 3U6IA 3AD4A 4RPVA 3R22A 4U81A 4AE9A 4CT1A 4J8NA 2ITYA 5I9UA 4UXQA 1RQQA 2UVZA 4G3CA 5FP6A 3VUGA 2EXCX 4R78A 3P23A 1U54B 5EKNA 2PMLX 2ZV8A 4MXOA 1O6YA 3QQGA 4ITIA 1X8BA 3IGOA 3CGFA 4MYGA 2CHLA 5AR5A 3VBWA 5IQBA 2OG8A 3LM0A 3I79A 3PA3A 4J96A 3CBLA 4B99A 4CCUA 3MBLA 3WARA 3LFFA 4DFXE 3EH9A 4D5HA 3UIMA 5DEWA 2IVTA 3E8NA 3Q4UA 2F2UA 5FQDC 4F6SA 2XK8A 1M14A 3GU7A 4CKRA 5HESA 2YZLA 1H0VA 1H1SA 1WBTA 4FV1A 2FH9A 3AG9A 3FHRA 4IX5A 5GHVA 2Z2WA 3SLSA 5ANJA 4IVCA 1RJBA 2VWWA 3LXLA 4N6YA 3ULIA 4WOVA 5TOZA 2H34A 1BMKA 2X7OA 3Q32A 3DBDA 1OPJA 3ERKA 3R6XA 4C35A 1Q61A 2I0VA 4V01A 4ZY6A 3QRJA 4XG8A 4BCMA 3GNIB 1J91A 3EFKA 5ANDA 3PZHA 5G1XA 3S1HA 3BELA 4JIKA 2UW6A 5DVRA 4TWCA 4CG8A 1JQHA 4U6RA 5CNOA 4XUFA 3SD0A 4EZ5A 5ACKA 4ZTNA 3CY2A 4EOMA 2Z7QA 3LFQA 4FIEA 4BWPA 4QMOA 4DTAA 5A4TA 4UN0C 4GK3A 4MF1A 4ACGA 4JS8A 4LMUA 4AACA 4YJUA 2WO6A 2XEZA 4F0IA 3QCQA 4J53A 4RQVA 2W9ZB 4UMTA 5LWMA 4WRSA 1IG1A 3WZJA 3NUYA 4C0TA 4HGTA 4IDTA 3DBCA 3GP0A 2JDRA 2BUJA 3TIZA 3VS6A 3C51A 3Q53A 4L52A 4X3FA 3PJ8A 4I3ZA 5HO6A 3BEGA 3Q52A 2YA9A 3DLZA 4UV0A 2VO6A 1CDKA 1IA9A 1UWJA 1QCFA 4FBXA 3ZTXA 3D14A 3QA0A 4RJ7A 5HOAA 1NVRA 2OZAA 4ZK5A 3O8PA 5AFVA 2P33A 4M7IA 5KCVA 4EHGA 4EQCA 1Y8GA 2NO3A 4QTAA 2DWBA 2VO7A 2HWPA 4E5WA 2YDJA 4W4XA 2FYSA 3O50A 3QFVA 2YWVA 4Q5EA 4FV8A 5EM7A 5FDXA 4JAIA 3OEFX 4NK9A 5FM3A 1ZYDA 1S9JA 3MSSA 4TN6A 3BU3A 5DBXA 4EOOA 5DH3A 4LV8A 4OTHA 3BZ3A 4YUQA 4PUZA 3PA4A 1OPKA 4ONAA 3TV4A 4BBFA 3MI9A 4FKQA 5I5ZA 2OSCA 5A4EA 2RFEA 2W99B 4GJ3A 4OBOA 5EHOA 3VUIA 2ZB0A 4AT5A 4TY1A 4BCJA 3ZM4A 4XP0A 5CEQA 1VJYA 2OH4A 4XX9A 3V51A 2PY3A 2RF9A 4DAWA 3Q3BA 4TYGA 4AFEA 5JZJA 4QTBA 2UZLA 3RTPA 4M67A 5KUPA 2EU9A 4U3ZA 4D2SA 4TNDA 3ZO2A 1P4FA 2W0JA 1W84A 1XH8A 4UXLA 3WIGA 3QXOA 4GUEA 5TT7A 1YXVA 3RJCA 3VS7A 4D4SA 4R1YA 2IPXA 4B4LA 4O6EA 3TCPA 3AGMA 5K9IA 4FOBA 5AV3A 2XB7A 4FA2A 3HMNA 2CN8A 4G3GA 2GNLA 4AN3A 4MXZA 5CF8A 3TUDA 2OFUA 5HD7A 2WIHA 4GFGA 4H58A 3F82A 3W8LA 2YISA 2B9JA 3RP9A 2XM8A 4YNOA 5FWKK 2C1BA 5M55A 3FQHA 1XH7A 4AF3A 2QOBA 4JJRA 2C6DA 5EYMA 4ZAUA 3Q5ZA 5D1JA 5BUEA 4F0FA 5J5TA 3MA6A 5J8IA 1H24A 3P78A 5IPJA 5IUGA 3MH3A 4BF2A 3VC4A 4AG8A 2FA2A 4ZSGA 3FMKA 4U3YA 3HMIA 4FKOA 5CZHA 4AGUA 1A48A 3MESA 1OMWA 3VUMA 4MBJA 5CSPA 4AA5A 4C3PA 4UX9A 5IQAA 4PL4A 1V1KA 2AC3A 4MVFA 3JXWA 3E8DA 4QMTA 5HD4A 4NYEA 3UC3A 4JBQA 2OF2A 4UEUA 3ORMA 4O21A 4FKLA 3P1AA 4S2ZA 5AA8A 4OTRA 4K77A 3EQIA 3CCNA 4ZZNA 3V04A 3AC4A 3ENMA 4LOQA 4LRJA 1DS5A 2XKEA 5E8WA 4ASZA 3PJ1A 2R3GA 1Z57A 1BL6A 4LG4A 1O6LA 5CXZA 3OFMA 4XV2A 5EQPA 3QGWA 2H8HA 1KUTA 1GZ8A 1H01A 3GEQA 3KQ7A 4CG9A 5T6KA 3NIZA 4L3LA 3AD6A 3A7JA 4GVJA 1G5SA 3SRVB 2ETMA 4FZDB 4LUEA 2WFYA 3PXYA 3S95A 4AZWA 3GOPA 4Z3VA 2HK5A 4JT3A 1KV2A 4A4XA 2ZOQA 5DA3A 5JT2A 1NY3A 5A9UA 1UU3A 4Q2AA 2G01A 4W4WA 3LMGA 2PYWA 3OUNB 4TW9A 3QBNA 3VS3A 2WTCA 2RFSA 1OIYA 3EN9A 4BIBA 2BIYA 3W2PA 3W1FA 3I6WA 2IN6A 4UWBA 2O5KA 5EH0A 4YSJA 4FTUA 2XJ0A 4ZTSA 4K0YA 5E8YA 4ZEGA 4HVDA 3PXQA 1CTPE 4OTPA 1WVYA 5AEPA 4RWIA 3IW6A 4AOIA 3QTIA 5J87A 3CTJA 4JBVA 3R7UA 5DI1A 4EJ7A 2O8YA 4DGMA 1IRKA 1H4LA 3R7GA 4FIJA 3V5WA 3PIXA 4D4YA 2R3HA 2FSTX 3HL7A 1I44A 1OKWA 3C50A 3RCDA 4YHFA 3IQ7A 4U8ZA 1OUYA 1J1CA 5CF6A 4EBWA 1G8AA 3KULB 3UP2A 3QLGA 3CLYA 4V05A 3GCVA 2BKZA 2BPMA 2GPHA 2WU6A 3R8PA 2WMBA 5HICA 1YXXA 5HE3A 5BVEA 1REJA 5JZNA 3C5IA 3RINA 5E4HA 5L6WL 3P79A 3IDPA 3BPRA 2Z02A 2EVAA 4DH1A 2RG6A 5ANEA 5CF5A 4O7SA 1NVSA 4IEBA 4L45A 2R5TA 3ELJA 3QXPA 4TPTA 3U55A 4WSYA 4DH3A 4I23A 1SVHA 3UC4A 4EUUA 2YCRA 2QOFA 4RX7A 2R3IA 4LMNA 5JFWA 5HBEA 5F9EA 2HXQA 4GSBA 3BWFA 3R8ZA 4CD0A 1ZMWA 3MPMA 4FKPA 4GU9A 3AQVA 4IMYA 3BCEA 1H25A 4GJ2A 4TWPA 3H0ZA 4YZDA 5EG3A 5FP5A 5KX8A 1PRYA 2IJMA 4RJ8A 4R77A 2WTWA 4AW1A 5IQEA 1XJDA 3A7GA 4ORKA 2NRYA 2X7FA 4DFUA 3A7HA 5BVDA 3G9LX 5A4LA 3T8OA 4MK0A 2Q0NA 2R3PA 1B6CB 2WEIA 3AMAA 1A9UA 2XNOA 4J1RA 5EDQA 4ZLZA 1L8TA 1M2RA 4XP2A 4FKUA 4DEEA 5DOSA 4IB5A 4Z9LA 3V5LA 4EZ7A 3GCSA 3NNUA 3R71A 4O2ZA 3COMA 3TEIA 5TKDA 3HV7A 4BKZA 4CKIA 3O2MA 4WT6A 2WNTA 4PTEA 4FKVA 4O2PA 2A1AB 2WMXA 5JFXA 3M42A 1BL7A 4FKJA 2QNJA 3TNQB 3OWLA 3POOA 5KBQA 4PV0A 3DJ7A 3O23A 3HKOA 3O7LB 2OU7A 4QRCA 3TACA 3QYZA 4DT8A 4WO5A 3RCJA 3C4WA 4JG8A 1ZYLA 2R0UA 4HGEA 4OTGA 5E8VA 4PMTA 3CD8A 3G51A 2WMVA 3UOHA 3LQ8A 2XNBA 2B4SB 3GFEA 4AX8A 2VX0A 1OL5A 1QPDA 4I93A 5BYYA 3FI3A 2ITXA 4M69A 2Z7LA 2QD9A 5DT0A 4EYJA 4C57A 2PPQA 4IVDA 1YW2A 2UW4A 2FUMA 2VNWA 4TTHB 2BZIB 4BC6A 4EKLA 2X4FA 4ZZMA 4JDKA 4ZS4A 4ACMA 4BCQA 3VW6A 2GTNA 5EM8A 4C38A 3DZOA 4EOJA 2B9HA 4TNBA 3NNWA 1QPJA 3QZHA 3SOAA 4FTTA 4EC8A 4JVGA 3QUEA 4FVPA 3KN6A 4KKHA 3RPSA 4NM5A 4QMPA 5IU2A 3DJ6A 4Z7HA 3KRWA 4MQ1A 3FHIA 5J9ZA 3AXWA 3F7WA 3WF8A 2QOOA 3DK3A 2ZMDA 3DDQA 3DU8A 2BDJA 3MW1A 3CTQA 1XH4A 5IQGA 3RAIA 2WQMA 3PP0A 3LJ1A 2QI8A 3IOPA 2BALA 2GFSA 4YBKA 1LEZA 4IB0A 1WVWA 3AMYA 3TN8A 1RW8A 1KE6A 4FT7A 4R6VA 1WBOA 4RIOA 3OVVA 4CZTA 4I5MA 4GG5A 4UMUA 4BIDA 1OGUA 3PJCA 4W8DA 5A14A 2ZYBA 3UOJA 2CJMA 4V0GA 4RJ6A 1WBNA 3R0TA 4PP7A 3UZRA 4YR8A 1CMKE 1PMNA 3SHEA 3R04A 3LFDA 4EOPA 4D0XA 3P7CA 2X2LA 1JSVA 2GNIA 3LCKA 3P4KA 3ZUVA 5K4IA 1VYZA 2PUPA 2VTLA 4MCVA 4CT2A 1Q4LA 4CEGA 2X7GA 5CI6A 2VN9A 4G3DA 2XKFA 3UQFA 2P2HA 5C8KA 1GZNA 2X4ZA 4QP2A 1W0XC 2ITNA 4FTKA 4E4NA 4F1MA 5AAEA 5CAOA 3BBTB 5EI6A 3SVVA 5K5XA 4O0YA 3ZO4A 5B2LA 2W06A 3FI2A 1U54A 4YJPA 2QODA 1R0PA 4YZMA 5AP5A 4F65A 4USFA 3P7AA 3C0HA 5BMSA 3A62A 4LGGA 4EL9A 4EH8A 3ATTA 3A2CA 4H05A 3P0MA 2V22A 4DFLA 1Q8ZA 2E9OA 3NZ0A 3F9NA 3NUXA 5H8EA 5CAUA 5K5NA 3TNIA 4CFXA 4APPA 4OW8A 3G2FA 2PZIA 2ITQA 3QL8A 5CSHA 4IX4A 2GCDA 3E3BX 4FKWA 2QCSA 4K1BA 3V6SA 2F49A 1GIJA 3KA0A 3WOWA 3OW3A 4FTOA 2HW6A 4BZOA 3LFEA 4UALA 3TWJA 4W4VA 3UVRA 2DYLA 5A6NA 2ITPA 2FVDA 4Q5HA 4YBJA 4YSMA 3MB7A 3Q9ZA 4K8AA 3NSZA 5LWNA 2I6LA 3DV3A 2IG7A 5CSWA 3ORZA 1J7UA 2CKOA 3K2LA 4M14A 5CU3A 3MDYA 5K3YA 3H9OA 2YZAA 1OL2A 3CKXA 4HNFA 4YJTA 3ANRA 3R7IA 4EUTA 4KNBA 5EK7A 5L8JA 5L2IA 4RJ5A 3LCSA 3R1YA 4PPBA 4B6LA 4E4MA 1H26A 4RJ4A 4F9CA 5TE0A 1KV1A 5BYLA 2OXXA 3ACJA 5JRSA 5EFQA 2UW5A 4WNKA 5H2UA 5ETAA 5CVHA 3NVMB 3MFUA 3P7BA 3Q2MA 3COHA 3ENHA 3SG9A 3SC1A 3NLBA 1H00A 3C7QA 3FMHA 4FZ6A 1YI6A 3SV0A 4IM0A 3AC8A 3QC4A 4FNYA 4I5HA 4S31A 1DM2A 2W1FA 4W9XA 2C5OA 2WHBA 4BHNA 4ZTHA 4PP9A 1PHKA 3LMHA 3R02A 3G0EA 3JYAA 4DFNA 3TV6A 4E1ZA 4EK4A 4EHVA 2PUUA 1J1BA 2C69A 3TNWA 3A61A 2ITUA 3UG2A 4BZDA 4FG9A 4G1WA 1ZARA 3VN9A 4EWHA 2GNGA 5GIOE 3ZXZA 5HU9A 2IZRA 2YLEA 4I5CA 4I5PA 2QOIA 2YLFA 2C5YA 3LFNA 4QMLA 3ALOA 4FC0A 3ZYAA 3KVWA 3BV3A 3NAXA 3VO3A 2BTSA 4HJOA 4EC9A 3LQ3A 4CSVA 5IQIA 3GU4A 4Y83A 4L53A 5LARA 4BCKA 2YCSA 2UZUE 4JOAA 4OGRA 4QP7A 4ZSLA 1W7HA 1V0BA 4BI0A 3EQPA 3MB6A 4L7SA 2ZM1A 1ZZLA 4EZ3A 3MV5A 5I9XA 3CD3A 2E9NA 1LP4A 2VWXA 4ERKA 1ZLTA 4MKCA 3V8TA 4FODA 4AP7A 2XRUA 2YITA 3VS0A 3A4PA 5CAVA 4FKRA 3AT2A 3LKMA 1Q97A 4FV9A 4O86A 1H1QA 3EZVA 3HDMA 4MQ2A 4YC3A 3B8QA 5HLWA 5DWRA 5GJFA 4FV3A 4UMRA 4BN1A 1TQIA 3FKOA 2VTTA 4YLLA 3BYOA 4F70A 4TYHB 3JUHA 4KA3A 3GBZA 4XV9A 5E8TA 2B7AA 4MXCA 4FSTA 1FVTA 2PK9A 3OCBA 3LJ2A 2CLQA 4MNEB 3AD5A 4U44A 4XLIA 3VBQA 3ZBFA 2UZOA 1MQBA 4FT3A 4AW0A 5HQ0A 4YZNA 2B53A 3Q4ZA 3ZO1A 4FKSA 3QRUA 4FZAB 2FSLX 3MIYA 3UPXA 4C3FA 5JSMA 5C4KA 2QQ7A 2J5FA 5F94A 2G1TA 4A06A 3QAME 3EZRA 5IUHA 2C6IA 1FVVA 3FUPA 3H9RA 3QQHA 1PXKA 4G16A 2PMNX 2PVMA 5EM5A 4E5AX 4J97A 2VWVA 5HG9A 4I0RA 1JKKA 3EN4A 4I6BA 4OLIA 5HCYA 3SDJA 4FTLA 4WG4A 3VHEA 1YDSE 2JIIA 5LVLA 4YZCA 4YO4A 1JOWB 2WQOA 3L8VA 1FPUA 2W1GA 3RM7A 5LVPA 3CJGA 4QP8A 2XK7A 3WYXA 1OL6A 1YHWA 3R7OA 4B0GA 5J1WA 2WTKB 4XBRA 2WTVA 3ZSHA 3F2NA 3R9NA 3T3VA 3TZ8A 2F57A 4O0SA 4TYEA 2JBPA 2ONLA 3NUUA 3AC2A 4FEXA 3QTXA 4NJDA 3R28A 3NVKI 5CU2A 1JBPE 3R73A 4HVIA 3O7LD 2GQSA 3VJOA 3EQHA 4O82A 4C4FA 4FEVA 4I6FA 1U46A 2OJ9A 3FQEA 5AR7A 4FF8A 4MXXA 2JKKA 3IW4A 4O1OA 1J7IA 3QCXA 3E87A 4IIRA 3UNZA 3PSCA 3T3UA 4R3CA 4FV7A 2X6EA 4GK2A 4L3JA 1NW1A 3BHTA 3RNYA 2R3RA 3BI6A 3ULZA 4D4VA 5EYCA 3Q2JA 4NIFB 2Y0AA 4YC6A 5DGZA 5FTGA 3OOMA 1BKXA 4YU2A 2R7IA 1FINA 1U4DA 4UWYA 5E90A 3R63A 2YEXA 4KABA 1H08A 2PVHA 4MXYA 4EK3A 4YZBA 2GU8A 4KIOA 2Y6OA 3OXTA 1OKYA 3LFBA 4XRJA 3FDNA 1R78A 4D28A 3C5UA 4RIWB 4BTMA 4Y46A 5GZAA 3DJ5A 4YTCA 3HDNA 3HNGA 5ANKA 5IF1A 2JD5A 2YACA 4RJ3A 5DT3A 2GHLA 4ZS0A 2JGZA 4D2RA 3QZGA 1PKDA 3BQCA 5B2KA 3RAHA 3DQWA 3R30A 5B2MA 3D7ZA 3AC1A 5LJJA 2UW3A 4K18A 2RGPA 3AMBA 5FLFA 5C1QB 3LOKA 5M09A 2C0IA 3BLQA 4MXAA 4ZIMA 2Z60A 5TO8A 4GT5A 2R4BA 3O0GA 3RPRA 4LRKA 3K3IA 2VWIA 4H39A 5CTPA 5AUTA 3JR1A 2P2IA 4PPAA 3O51A 2ITTA 2OWBA 3VBTA 2C5VA 4LUDA 2W1CA 3L1SA 4X6RA 4ENXA 5JKGA 3ZSIA 2OI4X 2V7OA 4L6QA 4RBLA 2G2HA 2YN8A 4KB8A 2J6MA 5A54A 3UE4A 3ALNA 4QMZA 3F5GA 4GFMA 4XG4A 1FVRA 3R2BA 4JR7A 3U4WA 4DBXA 5C4LA 3BQRA 3MPTA 4I21A 4YZ9A 3WZEA 4O84A 1QPEA 4RA5A 3E62A 3QA8A 4LQMA 1PXOA 2Z7SA 4QQCA 5CT7A 3GUBA 2C6OA 2WQNA 2X8DA 2PWLA 1WFCA 2A0CX 5EHLA 2C6KA 2R3OA 3E3PA 3MGYA 3POZA 3ZFMA 4FVQA 3C4FA 2JKOA 2BRNA 3QD3A 4E7WA 2W7XA 3NW7A 3OOGA 4RX9A 1NVQA 3QTRA 1ATPE 4YC8A 3MFTA 4I94A 3SG8A 2OJIA 4QYYA 4RSSA 3PXRA 1YXUA 3RGFA 3GU6A 3KULA 3TZ9A 1FGKA 3ZO3A 2BCJA 3BWJA 4AFJA 2QOCA 5JMSA 4XBUA 5C9CA 4AZSA 3LFCA 4PPCA 3WF7A 3BX5A 3CGOA 3PY3A 4FICA 4FL2A 3E7OA 1URWA 2ACXA 2UZWE 2OK1A 3R21A 4FG8A 3I6UA 4I22A 3E63A 3PFQA 4TT7A 4UB7A 2QOQA 3NUNA 2CGXA 1Q99A 4C4IA 4AN9A 4WKQA 5FEDA 4I0SA 4QMVA 5CAPA 2PU8A 2XS0A 3KRXA 2RG5A 2V55A 4KBAA 4P90A 3BYMA 4YNEA 3BHHA 4USEA 1OIQA 2YJRA 2YIYA 3KN5A 4ANNA 5A4CA 1DAWA 3ORLA 1YVJA 5HO7A 2PVNA 4MEDA 4BCPA 5LVNA 3EQBA 3R9OA 2GNHA 5CWZA 4ZLOA 2ITOA 3W33A 1H0WA 4J98A 2F7XE 1H07A 1YHVA 3FLSA 4G17A 4QMYA 5FD2A 3RI1A 3QU0A 3PVBA 3IW8A 3AOXA 4NM0A 2WMSA 4QPAA 2HZ4A 2J0IA 2PSQA 4DEDA 5IDNA 4D2VA 3VRYA 2E9UA
chains in the Genus database with same CATH superfamily
3LVPA 3V5QA 1H8FA 3F3UA 3MFRA 4O7NA 2R0IA 4Y5QA 5BVKA 4YTIA 1PKGA 2FB8A 4TZRA 3NCGA 5ETCA 5CENA 3ZHPC 1TKIA 2PZPA 4LRMA 3L9LA 3Q60A 3VUHA 4DGOA 5FBOA 2XNMA 4Z55A 3E92A 3EWHA 3QUPA 2QKRA 4HZSA 4O0VA 3OWPA 2C4GA 3QQJA 4U97A 3BHUA 1L8TA 2ZAZA 3DFAA 3OY1A 4BGHA 3LCTA 3ODZX 3W32A 3ET7A 5HE0A 1ZYJA 5CY3A 2I0HA 4YJOA 2XNNA 4M68A 1MRVA 1OBGA 3A7IA 2QR7A 3PE1A 3PSBA 2ZDUA 3BU5A 3QD4A 3SKCA 4IQ6A 2ITVA 1G8SA 3ZFYA 4GUBA 2WMAA 1LR4A 2ZV2A 4FSNA 5D41A 5DT4A 5C8MA 5T3QA 5GNKA 1O6KA 3QKMA 4C8BA 2GS2A 2WMUA 3LW0A 2OIDA 2W5HA 1A06A 4RLLA 5AP3A 4EHZA 4CKJA 1PXPA 4O7YA 2OJGA 4CYIA 4BDCA 1NXKA 3FMLA 4C58A 5LVMA 4L67A 4CMOA 5DLSA 4FUYA 4D4RA 3QQKA 3ZLXA 3W2RA 3W0QA 1TQPA 3O71A 2WB8A 5D9HA 3COIA 5FGKA 2PZ5A 5GIPE 3TIYA 5KNJA 3FI8A 3CQUA 2J7TA 2X0GA 4ACDA 3DBEA 4D2TA 3W55A 1SNUA 2BZJA 3U54A 1VZOA 4O0UA 5CX9A 4AZVA 3VUDA 5D7VA 3GGFA 2A2AA 1R0EA 3F3TA 4X0MA 1WAKA 1Q8YA 4MAOA 4UYNA 5HVJA 5IMEA 4H3BA 2CCIA 4NZWB 2VX1A 4FIIA 1Y91A 2F9GA 2YM4A 4CQEA 1T45A 4PL5A 4U79A 4AZTA 1G8KA 4E20A 4O7RA 3LPBA 1TQMA 3F3ZA 3G33A 3WZUA 3QWKA 3KL8A 4XEYA 4BDKA 5FXRA 2XZSA 5L8LA 3TYKA 2JC6A 4IJPA 3OT3A 1PMVA 3U6JA 4JMQA 4R7BA 2BKKA 3QRTA 4DHJA 5LOHA 3KF7A 3ORTA 2BVAA 1GJOA 4MD8E 1YWNA 4QT1A 5LXMA 4RIXB 2BFXA 2YM6A 3OT8A 3OY3A 4BTJA 3LZBA 3PPJA 4IXPA 3DAEA 4PQNA 1XBAA 2QKWB 3C4EA 3V8WA 5HX8A 1H1RA 4MUQA 2WTJA 3FLZA 5AUUA 3E64A 4WNPA 4QMXA 4KWPA 3RK9A 3TUBA 3RPYA 3THBA 4F08A 4ZZOA 3KU2A 5AX3A 4AUAA 4AGWA 4WHZA 3OS3A 4D2WA 4NCTC 3FPQA 4C3RA 5A4QA 3QCYA 1PXNA 3RBWA 1YHSA 3OMVA 4XS2A 5LCJA 4OBQA 2W5AA 3ZU7A 3R83A 2X0PA 4H36A 3TJDA 3VULA 3W2OA 3ZFXA 3PP1A 5HG8A 3LJ0A 2XYNA 3K5VA 2CNVA 1XBBA 3OCGA 3FMDA 3ZLWA 2W17A 3HMOA 4IANA 4KD1A 5HI2A 2CKEA 4BCIA 4CMTA 2VTIA 4O6LA 4U42A 3PJ2A 3GOKA 2VTAA 4G6LA 4BDDA 3H0YA 4L01A 3D5UA 2B9FA 3OWJA 4U43A 2EXEA 4F7LA 2V5QA 4FZ7A 4D0WA 4FL3A 3RAWA 3PDTA 2PL0A 3D15A 3EIDA 1YDRE 2O0UA 2EB2A 2W1ZA 2W1DA 3TNPC 4D9UA 4IAZA 5FEQA 3L9MA 1OIUA 4K2RA 3GT8A 4P2KA 3W18A 4RWKA 4RIYB 3UIBA 3PY1A 2GTMA 1UKHA 3V5TA 4BR3A 4BL1A 2J90A 4DFBA 3MJ2A 3P5JC 4FIFA 5AR2A 3UDBA 4EI4A 2XCHA 3IDBA 3PRFA 4P5ZA 2XCKA 4ZJJA 3FMMA 4BWKA 1Z9XA 4O7WA 3LLTA 3UDZA 4HVGA 3AC5A 1WBPA 2CCHA 3AT3A 2VWYA 3DLSA 4BHZA 5CEIA 3UQCA 1Z5MA 1ERKA 2WMWA 3KY2A 4TRLA 4JDHA 4MNFA 4F9AA 3VS4A 4IM3A 2DQ7X 3OG7A 4GH2A 2JDVA 2OKRA 3TTJA 4LM5A 3LHJA 2GNJA 4BKYA 2VGOA 3BLAA 2XK9A 5KO1A 4C4HA 1OKZA 2WMQA 4IAAA 3AGLA 1P4OA 2QOKA 3VHKA 1CKPA 4YURA 2YCQA 4E6QA 2OIQA 3TZMA 3CPCA 4EH6A 3E8CA 3VVHA 3W2QA 3ROCA 4A9YA 4WG3A 3M1SA 4WSQA 4JDJA 5FTQA 5EOBA 3TG1A 4BYJA 4EOIA 5HVKA 1OBDA 3HZTA 4K9YA 5CYIA 3O96A 2ZV7A 5JK3A 2Q83A 4PTCA 4X2GA 4ENYA 2XALA 3TMOA 5AUZA 1R1WA 2H6DA 3KGAA 1OGYA 3KIOC 4JQ7A 3L8PA 5EQYA 5CEKA 4ZMFA 4MX9A 3QHRA 4HYSA 4X21A 3GU5A 2HELA 1H1PA 4FMQA 4O4FA 4E4LA 3DXPA 3R2YA 2IWIA 4QD6A 4BKJA 5FDPA 1XKKA 5DFPA 2HXLA 2Y4IC 3A7FA 1Y6BA 2R2PA 4ZOGA 5E91A 3BGQA 2BAKA 4X2FA 4L00A 5DG5A 5DEYA 4TYHA 1FOTA 3KXHA 5AP6A 3KCFA 5L8KA 2CDZA 4MNEA 3E93A 3MVMA 2YJSA 3QALE 3KRLA 5E8ZA 2X9EA 3HYHA 5EQEA 3QF9A 1AQ1A 1FGIA 5E8SA 5AM7A 3FL5A 5JGDA 3EOCA 2R9SA 2ERZE 3F66A 2JIVA 5TF9A 1W83A 3VONA 4OTWA 2X39A 4AOJA 4WIHA 1SNXA 2YHVA 4O7ZA 2XNEA 4AXCA 3NNVA 4M66A 4GVAA 1PMUA 3NWWA 5HG7A 5HG5A 4XCUA 5I3OA 5IA1A 5LMKC 1R39A 4LV5A 2QU5A 3BLRA 5JFVA 2XK3A 3L9PA 3UYSA 4BYIA 4F4PA 5FTOA 2HZIA 5AP2A 4O96A 5D11A 5A46A 3OCTA 1ZMVA 2G2IA 1P5EA 1MP8A 1XWSA 2B55A 4GFOA 5BPYA 4Y95A 2VUWA 3C0IA 4L3PA 5AAGA 4FNXA 1UU9A 4QMMA 3F2RA 3FZ1A 3M2WA 3EQDA 5A3XA 2Y6MA 4IE9A 4RRVA 3KXMA 3UBDA 2W96B 3UYTA 4FNZA 4D1SA 4C37A 4JL9A 5FM2A 4DFZE 2JFLA 1PXLA 4QYGA 3MWUA 4XV1A 5HE2A 4DCEA 3MVLA 4Q9SA 3MJ1A 3WYYA 4IWOA 1KE5A 5LCKA 5JGAA 5F95A 5CF4A 3SW7A 5CNNA 5IMXA 4HZRA 2A98A 3CTHA 4GU6A 5EHYA 2C68A 3SXFA 3ZC5A 2WTKC 2QOLA 4J8MA 5IEXA 3UO5A 1WZYA 3F6XA 4DGNA 5EKOA 2RKUA 2BRBA 5HNBA 4FV2A 4NIFA 4RX5A 1JSUA 1JLUE 3R7VA 3OD6X 1UWHA 3UPZA 3BL9A 5CEMA 4NL0A 2EXMA 2XP2A 3HA8A 4FSZA 3C4ZA 5M06A 4EOQA 4D9TA 5HTBA 4RIWA 4CLJA 3FYKX 4E93A 4GIIA 4K6ZA 3NYXA 2CGWA 4C59A 4OTIA 2XIYA 5B0XA 3RWQA 3QLFA 4PDPA 2PVYA 4H1MA 4PDOA 3NW6A 5IA5A 4AT3A 2CSNA 3QQLA 2UW9A 1W2CA 2C3KA 3Q6UA 2JKMA 2IW6A 4AOTA 4DLIA 3PPZA 1RDQE 3I4BA 4PNKA 4QNAA 2BAJA 3FAAA 4YHTA 4I6HA 3U51A 3RZFA 4XG9A 4XLVA 2HCKA 5CXHA 5AX9A 1WBWA 3D5XA 2DS1A 4O38A 2G15A 4J52A 3F3VA 3F88A 3HLLA 5F20A 4DG0E 5DE2A 3R9RA 4U7ZA 3I5ZA 3QUDA 4O0RA 5D10A 4E6AA 5L2SA 4O7VA 5BQ0A 1E1VA 3EN7A 5CEOA 3R7EA 4FTAA 1PYXA 3E7VA 4IDVA 1SVGA 4I4EA 3G0FA 4BDHA 4D2PA 1I09A 5IQFA 1GAGA 4CCBA 5FRIA 5AV1A 2OGVA 3GC7A 4RVTA 4HVHA 4B8LA 3BE2A 4BB4A 3DBFA 4RG0A 4WG5A 4CFFA 2H96A 4FV5A 1ND4A 4F99A 3V8SA 3HECA 4JBPA 3ACKA 4EHEA 3KRJA 3Q9YA 1ZWSA 1TFFA 4BDEA 4BCNA 4JG7A 4JQEA 2QR8A 5AP7A 3TXOA 3VIDA 2QURA 1ZMUA 3QGYA 4G5JA 4GCJA 4N4SA 4D1XA 1PXJA 4GW8A 1JNKA 4IAFA 5TR6A 3N4TA 4TWOA 4ZTQA 4ZXTA 3P9JA 5EI8A 1YRPA 2GDOA 2VWZA 4JXFA 2JDOA 4M0YA 2WTDA 3U87A 4ACCA 3IONA 4EKKA 1IAHA 4L46A 3RNIA 5AP0A 3UGCA 3BGZA 3PVUA 4FK6A 4G6OA 4CTBA 3G5DA 1DAYA 3FSFA 3LXNA 4IX6A 5FEEA 4YP8A 4DTBA 4HCVA 5HBHA 3Q4TA 3SXSA 4C62A 4C02A 2XH5A 3MA3A 4KINA 3W2CA 3BIZA 4HW7A 3BGPA 4YPDA 4X2NA 4W4YA 3LCOA 5CI7A 2PZRA 2FSOX 3EB0A 3F69A 2GQGA 3TKUA 4ALUA 5J7BA 3DCVA 5J5SA 3UNKA 5J7HA 4TYJA 2B0QA 3OF0A 4QP6A 1OL1A 3P08A 5KMIA 4IX3A 1V0OA 3I0OA 4BJJB 4ARKA 3CJFA 2NNWB 3Q04A 3VQUA 2JDTA 4FTMA 5HX6A 4AXFA 1ZYSA 3VUTA 3CSVA 3EL8A 4KAOA 3I5NA 3V5PA 2XKCA 1OITA 3QWJA 4FTQA 4LFIA 4EH9A 2ETRA 1VLRA 4GT3A 3ZMMA 4M12A 5J1VA 2HYYA 3CP9A 3IW7A 5HKMA 1BUHA 2XIZA 3FKLA 2W1HA 3HMMA 1M52A 3HEGA 2JAMA 4KKEA 5CQWA 2QC6A 3OTUA 4ANQA 4FEQA 4BWXA 3BU6A 2WKMA 3Q96A 1IR3A 2C6MA 2LAVA 4IB3A 5GJDA 1YWRA 3UZPA 2J50A 3NYNA 4MBLA 4NEUA 3BRBA 2WD1A 2WGJA 1OPLA 4IAKA 3ODYX 4B9DA 2E9PA 3FMNA 3FZOA 1JWHA 3MPAA 4DN5A 2GMXA 4R8QA 5LMAA 4IJ9A 4PMSA 3MH2A 5IEYA 4OTFA 2BDWA 2Y4IB 4NW6A 1Y8YA 2REIA 4YLKA 5EW8A 5IEVA 4MHAA 5KMMA 4P5QA 4AQKA 2BROA 2XK4A 2NYAA 3IOKA 4ZSEA 3NDMA 4FKGA 3K54A 5AP4A 3F2AA 3IECA 3PIYA 1ZY4A 4F9BA 4RFZA 4DG3E 2I0EA 5KZ0A 3OCSA 1JPAA 3NW5A 4G6NA 4P7EA 4AE6A 5ANGA 4I6LA 2PVRA 3D5WA 4D5KA 1LPUA 2HW7A 3DTWA 5HNGA 2CKPA 2UZEA 2X1NA 3NYVA 4DEBA 4KBCA 3H3CA 4IFCA 3VJNA 3QTQA 5DMZA 4FSWA 2WU7A 3VS5A 5IH4A 2AYPA 3RVGA 5LQFA 2VTJA 2QO2A 4GYGA 3A99A 5EM6A 4JRVA 4KKGA 4CV8A 4O91A 4NKSA 2O64A 3FY0A 2OJJA 4GG7A 3TV7A 4TWNA 1PW2A 4F1TA 1U5QA 2QOHA 2Y9QA 3QQFA 2PTKA 4S33A 1G3NA 3CS9A 5AMNA 1OB3A 2UVXA 5HZNA 4IH8A 3ZLYA 4JX3A 1BI7A 4XYFA 4E8AA 5IQCA 2YERA 4QQ5A 2WAJA 3N4UA 2Y4PA 4N0SA 5I9WA 5LMBA 4E5BA 4EWQA 1SM2A 2Z7RA 4BCHA 2O65A 3FE3A 1PJKA 4CFMA 3OROA 4Q9ZA 1KE7A 1W8CA 2XIRA 4U9AA 2VTSA 3QC9A 4XG2A 4FT9A 4BRXA 4G3FA 2GHMA 3FI4A 4NTSA 1GZKA 3IKAA 4RGJA 3R1SA 3UVQA 3UOLA 4FSYA 3C0GA 2X2MA 4RIXA 3Q9WA 4YJVA 2VAGA 4F9YA 4U45A 2RL5A 5I9VA 4BFMA 1OVEA 2VRXA 4U0IA 4A9SA 3FC2A 1REKA 4XNEA 5K0XA 1IAJA 4XG7A 4FGBA 4BDFA 3D5VA 3RHKA 3F5UA 5AIRA 3KXXA 5IISA 3RALA 4BCGA 2AC5A 3DGKA 1JKLA 3GC8A 1YI3A 4IZ7A 1PXMA 1UNGA 3U9NA 4ZSJA 2XRWA 3II5A 4R3PA 5I9ZA 4NKAA 3LCDA 4Y72A 3QHWA 4Z16A 3COKA 2BDFA 4JRNA 2GSFA 4HCUA 4FKTA 4EBVA 4F9WA 2PE0A 4MWHA 5E92A 3EJ1A 4QQTA 1PYEA 4IC8A 1VYWA 3DTCA 4ERWA 2XUUA 3HV4A 5BVFA 2X6DA 4IADA 4E73A 4YO6A 5C03A 1M2QA 3P5KA 3LXPA 3QKLA 4IAIA 3DOGA 2JLDA 4ZJVA 5IA3A 2C6LA 2BRMA 5BYZA 2ZM4A 1IASA 3VUKA 3UNJA 4C61A 2UUEA 4MWIA 5K0KA 1W98A 4EQUA 5L3AA 2GQRA 3HAMA 3OEZA 1YXSA 2J5EA 2W4JA 3SX9A 2XVDA 4EH4A 4RIYA 4FSQA 4C2VA 4PMPA 3G6GA 4FNWA 4BCOA 1KE8A 4ZSAA 4GL9A 4QO9A 5HTIA 5K4JA 2JITA 3F61A 4JR3A 4ZTLA 3ZZEA 4ASXA 3V5JA 3FBVA 5I3RA 5AP1A 2PUNA 4NWMA 2NPQA 3R8MA 3F5PA 4HYUA 3AKKA 3LLAA 3DA6A 1FQ1B 4FEWA 3EYGA 5J79A 4H3PA 5JN2A 3GI3A 1LEWA 3QTWA 2R3JA 4IWDA 1U59A 2G2FA 4YGAA 5HIBA 3TL8A 4FGRA 4AW5A 1VEBA 2ZV9A 3A4OX 4DINA 3PG3A 4IZYA 5AADA 4LL0A 3C4XA 3I60A 4RC3A 4FT5A 1Q5KA 1GZOA 3RPOA 3ZOSA 3RK7A 3VF9A 1YI4A 2C6TA 5KMJA 3FL4A 4RMZA 1MUOA 5HTCA 5IH6A 1HCKA 4OBPA 4FEUA 3EN5A 5CZIA 3TDVA 1CKIA 2PHKA 3ZCLA 3VBVA 3HP2A 3ZRMA 4KRDA 2F7ZE 3TM0A 3C9WA 1CKJA 1P14A 4YLJA 1YQJA 3A60A 3W2SA 4A9TA 4BY9E 5JH6A 2VWUA 3I1AA 4KIKB 3VQHA 4F78A 2LGCA 3REPA 4EK5A 4LDTA 3HV3A 4NFNA 4CVAA 2QONA 3WILA 4D1ZA 1UVRA 4QDVA 3KK9A 4AQCA 4QMSA 2I0YA 3LE6A 5ANIA 4R3RA 3QYWA 3FXZA 4F7SA 5M57A 3Q4CA 4Y5HA 1WBVA 2C0TA 4I24A 3FC1X 5H9BA 3MTFA 3DKFA 2PVLA 2A4LA 4MF0A 4NM3A 5IQDA 5L2TA 1R3CA 5LVOA 4AAAA 3U8WA 4XH6A 2JDSA 3K3JA 4GS6A 2CGUA 1ZAOA 4RVMA 4WNOA 4C4JA 4P4CA 3VS2A 1OZ1A 2E2BA 3P86A 3HAVA 5IA4A 4EONA 3AC3A 3ZDIA 3PRIA 4QPSA 4IZ5A 4U40A 4EOSA 3NIEA 2IZUA 3KCKA 2QU6A 2UZBA 1XHAA 3FLNC 2W4OA 2HY81 4O0WA 4RC4A 5KMOA 5M44A 4ID7A 4S30A 2W1EA 4K33A 4FTIA 3FXWA 3KMUA 3LXKA 1F3MC 3R7YA 2O3PA 4CZYB 4GEOA 3UTOA 2RSVA 3ZEPA 2PMIA 3W8QA 3ZDUA 1T46A 4IACA 3H30A 4CNHA 3R8UA 3KVXA 3CKWA 1MQ4A 4LI5A 2IW8A 5I4NA 5M4IA 1UKIA 3MN3A 4S32A 4DEAA 3PLAE 3RAKA 4J95A 3JVRA 2XK6A 3FV8A 2YWPA 5EYKA 1SMHA 2GNFA 3O8TA 1Y6AA 2QHMA 5EYDA 5F1ZA 3LMIA 1GNGA 1Q24A 5KMKA 4YJRA 5AUXA 2UW0A 3QTUA 3SQQA 2YIWA 5DR6A 2I40A 5BV3A 5KBRA 3BHYA 3FLYA 4M84A 3GQIA 5BVWA 5I9YA 5EI2A 5J95A 3TJCA 3GVUA 3I7CA 3ORPA 2J9MA 4RA4A 5CLPA 3RMFA 2DUVA 4E6DA 2VTMA 4EK6A 3KXNA 3TDWA 3CXWA 4RX8A 2ZM3A 1WVXA 4MD9E 3A8XA 2UW8A 1K3AA 3NEWA 3NR9A 4YHJA 5HNIX 1XH5A 1WCCA 2ETKA 4BDJA 1YOMA 4O22A 3D7TB 4J71A 3HRCA 4IZAA 3OP5A 4O0XA 4CXAA 5CEPA 3OBGA 5L4QA 5HIEA 2QVSE 3D83A 1QL6A 3D0EA 3DQXA 4EH7A 5C27A 3FMEA 4WBBB 3UMWA 4HVSA 4AN2A 3GFWA 4I20A 2YIQA 4X3FC 3B2WA 4RFYA 2ZB1A 3UODA 2UZDA 5DR9A 2VTHA 5M56A 4L42A 4PY1A 3S0OA 4BDIA 5DYJA 2WPAA 3FPMA 3O8UA 4BDAA 4C2WA 3JVSA 2CGVA 2FGIA 1H1WA 2J0MB 1L3RE 3BBWA 4XOZA 1WBSA 3KXZA 3T9IA 3C13A 5AJQA 5EW9A 3WBLA 3WI6A 4QP4A 5JQ5A 4R7HA 3E5AA 5H8BA 3B8RA 3VBYA 4EH2A 3N4VA 3TT0A 1E1XA 2VTNA 3BYSA 5CSVA 2CN5A 2YM7A 4E3CA 3EHAA 3PYYA 4XOYA 4JQ8A 3RKBA 3DNDA 4F0GA 2XYUA 3PA5A 4CGAA 3VNTA 3JS2A 3Q6WA 4RLKA 4RZVA 5BMMA 1FBNA 4YJNA 3R01A 1G8JA 4FTCA 2PULA 4OAUC 4C7TA 1OECA 2XJ1A 4PDSA 4MD7E 2BILB 3PFYA 3MYGA 4PRJA 1BLXA 4NCTA 3KRRA 5I0BA 3RM6A 2HZNA 4FIGA 3DK6A 2GFCA 3I0QA 3TNHA 4FOCA 4AW2A 2CMWA 4JAJA 2AQXA 5HCXA 3S4QA 3LM5A 3BYUA 4CFVA 2ZDTA 3G90X 4ZY4A 2QG5A 4GK4A 4U80A 4QMNA 3NUPA 3FJQE 1SZMA 4ASEA 3B2TA 4FSUA 2F4JA 5L6PA 4UMPA 4KS7A 4EOLA 4G31A 4WUNA 3EKKA 3A8WA 4AZEA 4BGQA 2X81A 2BR1A 1Q41A 4G2FA 2XNPA 5AWMA 4PWNA 4OT5A 2YM8A 4R5YA 1UU7A 3HMPA 1XH9A 2IZTA 2PVFA 2X0OA 3MTLA 2XNGA 3QZIA 4RWLA 4BICA 2CNQA 4O81A 5M53A 5ETFA 3VRZA 2VO3A 3PIZA 4FV4A 3V6RA 2VD5A 2VO0A 1Q8UA 2ZVAA 4WD5A 3DS6A 4XMOA 4DBNA 5E1SA 1K9AA 1DI9A 3GQLA 4FUXA 3VF8A 5EDPA 4GKHA 1BYGA 1M7NA 2R3KA 2VX3A 3FZSA 4A7CA 4C36A 4FE2A 2ITWA 1BX6A 4CFUA 3QTSA 3V3VA 5IZFA 4FTNA 3FZRA 4OAVB 2ESMA 4L8MA 2BMCA 4H3QA 3BEAA 2R3NA 4O0TA 4W8EA 2OW3A 2VTRA 5ETIA 1Q8WA 1STCE 4BJJA 3R00A 3DPKA 5BVOA 2KULA 3PPKA 2XMYA 2VTQA 2NRUA 2CPKE 3PLSA 4LOPA 1E9HA 1HOWA 1Q8TA 5J9LA 2PVJA 3FSKA 3FYJX 4ANOA 2ITZA 2B9IA 3NRMA 2VU3A 5CU4A 2WMTA 3D9VA 5A6OA 3G15A 2GS7A 4BTFA 2WOUA 3FQSA 5AM6A 2X2KA 3U4UA 3RWPA 1W2FA 4WRGA 4ZP5A 5AR8A 4F64A 3L9NA 4NW5A 1U5RA 1ZRZA 4BI2A 1JAMA 3E8EA 3DB8A 3DT1A 2WIPA 3I81A 4FV0A 5E8UA 5EDRA 2HENA 5HO8A 4S34A 1NA7A 3E88A 3GXLA 3HRBA 3IGGA 3MH1A 4KIPA 4OTQA 5J9YA 1Q3WA 4NTTA 1ZXEA 3EQCA 3R1NA 1KSWA 4L7FA 1MRYA 4K11A 1Q3DA 5CASA 1K2PA 4C33A 3DKCA 3IPHA 4EJNA 4CYJA 4L44A 2XAMA 3W0OA 4G3EA 1Y57A 2ERKA 3ZUUA 3UVPA 4X6QC 4RWJA 4BDBA 4DTKA 3GCQA 4OR5A 4U5JA 5BUJA 3V01A 4ANLA 5KHWA 5L2WA 1M2PA 3KC3A 4O27B 3T9TA 4JDIA 4DE4A 1KWPA 4I0TA 3PVGA 4NU1A 4DHFA 2XA4A 1DI8A 4NT4A 2VWBA 3SA0A 3DNEA 4EOKA 4A9RA 4AGDA 4F1OA 5C26A 3BL7A 4YTHA 1JKSA 2CLXA 2JAVA 3F5XA 1UU8A 4EYMA 2QLQA 1J3HA 3OUKA 4KBKA 4X7QA 2IO6A 4G9CA 5AV0A 3MIAA 5E8XA 3DXNA 4QTCA 3HRFA 4M3QA 1W82A 2BIKB 4JG6A 2JIUA 2BZKB 3ZXTA 3ZBXA 5B7VA 2CNUA 4L68A 4ANMA 5CANA 3GU8A 4DF3A 1ZOEA 3ORIA 4M8TA 5D7AA 5LMKA 4USDA 5KMLA 3HX4A 5FUTA 3K5UA 2GS6A 4F09A 5AA9A 1FMOE 4QMQA 2C1AA 3LAUA 2QLUA 1VR2A 4G9RA 3FY2A 2HIWA 2EB3A 5CS6A 1EH4A 2UZNA 3LFAA 2YAAA 4EEVA 4PNIA 4F6UA 5M4UA 1BI8A 2UZTA 2UW7A 3EFWA 4NH1A 1GY3A 4FV6A 1LUFA 4QOXA 4XHKB 4YPSA 3N51A 3WZKA 2BHHA 4BVUA 1CSNA 2BFYA 4APCA 3FWQA 1XBCA 4CRLA 5KZIA 4JX7A 3HA6A 2QO7A 3PG1A 4IW0A 5AV2A 5F4NA 3PUPA 3VS1A 5HLPA 4KRCA 3U9CA 3DAJA 3NX8A 4BGGA 2X8EA 3HVCA 3IK3A 3NYOA 4IHPA 4UZDA 5ITAA 5C8NA 2G9XA 3PXFA 5KMNA 3DB6A 4RVKA 4FSMA 5ACBC 4DEGA 4PTGA 3BHVA 1XO2B 1UA2A 5HU3A 3R8VA 3VWAA 2YM5A 1M7QA 3TKIA 2V0DA 3H4JA 3PWDA 4CFWA 3FZTA 2A27A 5KHXA 5AUVA 4H1JA 2IVSA 3ORXA 4DYMA 4EQMA 4DEHA 4PF4A 4X3FB 4DITA 1YDTE 5BVNA 4DA5A 4HOKA 5HIDA 3TI1A 3W16A 3ZM9A 3EN6A 2BHEA 2GHGA 2VGPA 4O7TA 5DPVA 1YOLA 4N57A 2BRGA 3GB2A 4PDYA 2Y8OA 3AT4A 2PMOX 2HY0A 2C6EA 2XKDA 1MRUA 3MY0A 4LGHA 4UZHA 3MY5A 4CLIA 1UNLA 3KMMA 2OZAB 4DG2E 3QD0A 4QQJA 3IS5A 4GYIA 1QMZA 4HPUE 4W9WA 4O7LA 3QD2B 3KFAA 3EFLA 4I6QA 2X9FA 4M13A 2OO8X 3D2IA 2CKQA 4ANBA 2C5XA 2R64A 3EFJA 4FI1A 3ZH8A 5E9EA 3LFSA 4DGLC 4XRLA 2AUHA 2YCFA 1H27A 3NCZA 4TL0A 1GOLA 4QP3A 5EW3A 3ZC6A 4DGGA 4MTAA 5DRDA 4IWQA 4MH7A 4HGLA 3U6HA 4F6WA 3WF9A 4DC2A 4GV1A 1O9UA 4TYIA 1F0QA 5BNJA 4PMMA 5BUIA 3QQUA 2JKQA 3ZS5A 3JPVA 4O83A 2YM3A 5E1EA 2OIBA 3OTVA 4JLCA 3R9DA 3PVWA 3IO7A 4FYNA 4J7BA 1KE9A 5HLNA 4DT9A 3ORNA 3NUSA 1TVOA 5DIAA 4OUCA 3UO4A 3VAPA 2J51A 3G6HA 4QP9A 5AUYA 2OXDA 4O4EA 2FO0A 5JGBA 2V62A 2OICA 2OZOA 4FX3A 4M97A 4WA9A 5KKRC 3LIJA 3NUAA 1Q62A 1FMKA 1JKTA 4Y73A 4AU8A 4FSRA 3SOCA 2O2UA 4BCFA 2AEGA 4IM2A 1UNHA 4AWIA 2RIOA 1NT2A 1ST4A 3KKVA 2X8IA 1KOAA 4G5PA 3MVHA 1XH6A 3PSDA 4BZNA 1JSTA 2Z8CA 4CTCA 1AD5A 2BTRA 2KTYA 2W9FB 2WTIA 2EUFB 5IUIA 4A4OA 5AAFA 3NPCA 1OUKA 4C34A 2HOGA 3BYVA 3D4QA 3EKNA 4D58A 3PE2A 2P0CA 1GIHA 3C4CA 5M07A 2Y7JA 4GMYA 4QP1A 5JEBA 5M4FA 1PY5A 3IW5A 1S9IA 4AXAA 3GC0A 2XBAA 3PXKA 3SXRA 2R3FA 3QCSA 4LYNA 3VW8A 3R1QA 3QRKA 4EK8A