5BUEA

Erk2 complexed with n-benzylpyridone tetrahydroazaindazole
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
348
structure length
329
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVATRWYRAPEIMLNTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
publication title Ligand efficient tetrahydro-pyrazolopyridines as inhibitors of ERK2 kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 329
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bueA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bueA01
4IE9A 5HU3A 2XNOA 5FEQA 4M67A 3NYXA 4GK4A 2YIXA 4FYNA 3FQEA 4TWNA 5F20A 5KZIA 4DCEA 2JKQA 4CFFA 1PKDA 3LW0A 1W82A 3VHEA 1Q8YA 3IONA 4FT5A 3LFAA 4Q5HA 2HYYA 3LFQA 1TQIA 1XKKA 1YXUA 3PXFA 4YTFA 2BKZA 3ALOA 3DFCB 1OI9A 3D5UA 3WF8A 4BDAA 4F6SA 3G15A 2PE2A 4RIOA 4CTBA 2VNYA 3DK6A 3RNYA 3BIZA 2AYPA 3FYJX 3PE2A 4IJPA 3AC2A 3WZUA 2CLQA 3E63A 3I79A 5IQBA 4XG8A 5CI7A 4FTMA 3QCSA 1H28A 4MBIA 2RSVA 4X2NA 5LXMA 2UZUE 3BHTA 4CVAA 1J7UA 5AM6A 4YJPA 5BPYA 4WO5A 1IRKA 4CQGA 5M07A 3C9WA 4OR5A 3ZU7A 1Q24A 3P7BA 2VX1A 1VR2A 1QPDA 5I9VA 3PVBA 2YIRA 2W1GA 3QLFA 4IX5A 4YTCA 5K0XA 3FBVA 5HLWA 4YBKA 4BI2A 4JXFA 5ITAA 5EQPA 3QCQA 3A62A 3FZSA 4Z55A 5LVLA 1CKIA 5GZ8A 3F69A 3ROCA 5M06A 5JFSA 3RWQA 3R8PA 2PHKA 3CCNA 4F9YA 5CSHA 2P2HA 3TM0A 4BCIA 5CVHA 5IISA 2ZV8A 3EKNA 3RALA 4ANQA 3ZZWA 3OUKA 4LMNA 2W1EA 4GJ2A 4UN0C 4E4XA 5LVPA 3JS2A 4GFOA 4RX8A 2KULA 4U81A 5AV0A 5DWRA 4F7LA 3EN9A 1ZZ2A 4FV7A 2HW6A 4H3BA 4QYEA 4BRXA 3NUSA 4QO9A 3SQQA 3TXOA 4TYJA 3EN6A 3DDQA 2OJGA 4FSWA 3PY0A 4CXAA 5M55A 4YJUA 3I4BA 3MVJA 2EB3A 2YCRA 3VBQA 4QTBA 3G9NA 5IH4A 3UZRA 5FRIA 4H3PA 3VBXA 4IDVA 3DAKA 4FBXA 3WF6A 5EHOA 1XH4A 2XKFA 1OITA 4FZDB 4XLVA 5EW9A 3EN7A 3VUTA 5CF5A 2E9PA 3HVCA 2ETKA 3G2FA 2WQBA 4Q2AA 2QKWB 2V55A 2X7GA 3FMJA 3SLSA 4QNAA 4L00A 3QD0A 2WO6A 2NNWB 3ID6C 3N9XA 2ITQA 5EM5A 2X8EA 2IZTA 5K0KA 3O23A 4ACGA 3E8DA 5CU6A 5C4LA 3ROYA 3AT3A 3C1XA 3ZFXA 3FI3A 3WZJA 2YWPA 4EH3A 3SG8A 4M13A 2ITPA 2Y0AA 2YAKA 5KHXA 3PJCA 3WARA 4TYIA 4E5WA 5AMNA 1LEWA 3MYGA 3QTZA 4G6OA 2JBOA 3WF7A 3VVHA 5KMJA 3D4QA 5EYMA 2Z2WA 3A2CA 4EOKA 3EQGA 3KC3A 5JGBA 4QMVA 3TN8A 3F2NA 4YO6A 2QR7A 4WHZA 4IFGA 4HCVA 5HTCA 2Q0NA 2V5QA 2WTVA 4FV9A 2VWXA 4PF4A 4C57A 3RK9A 4RJ3A 4UMQA 1OKVA 5H3QA 4Z7GA 3CBLA 3GCQA 1ZOHA 2VWWA 2B9FA 2C6KA 2CNQA 1NVQA 2YN8A 3ZYAA 4YZ9A 4BDCA 1PHKA 1W84A 2R3LA 4ZJVA 3OZ6A 4P7EA 5K9IA 3UPZA 4XOZA 4FKJA 4A06A 4O7TA 4U0IA 4BDGA 3COKA 3DZQA 3EOCA 3WYYA 5D11A 4WBBB 3PJ1A 3NAXA 4FSNA 3UO6A 3EL7A 4XCUA 4HOKA 2RGPA 3RAKA 5BYYA 3DPKA 5KNJA 3RCJA 2ZM4A 3KL8A 4XV9A 4R8QA 5AAEA 1NW1A 2RF9A 5TOZA 4MX9A 1XH7A 1OBGA 2VTJA 4O1PA 3PA3A 4BY9E 4K33A 3S00A 4FGBA 2JDVA 2GQRA 3AMBA 1BLXA 4JDKA 4C4EA 1PXLA 4EWHA 3BKBA 4BZDA 5D7AA 5AUTA 2QC6A 3QZGA 3H0ZA 3TKIA 1JAMA 2ITWA 4XH6A 5EYKA 5CAVA 3NIZA 4A9SA 3LCKA 3HA8A 4IB1A 4F7NA 1DI8A 4MAOA 4ZSAA 1PKGA 5TO8A 3KREA 2QOBA 3BE2A 3FLNC 4LV5A 2WMRA 2WQOA 3KXHA 2IZSA 4C3PA 4TY1A 4DT8A 2QOCA 5CU2A 4NFMA 2W1FA 4XJ0A 2XJ1A 1Q5KA 3ZXTA 2FA2A 4JOAA 4RWLA 3RINA 4BBEA 3A7IA 4CFMA 4KBAA 5AR3A 5CSPA 3JVSA 4CQEA 5A46A 4V05A 5FLFA 3B8RA 2QQ7A 1YI6A 3SXRA 4BFMA 4GK2A 4YZBA 4H1MA 1W0XC 3ULIA 5E4HA 5ANEA 5JK3A 3FSKA 4BDIA 4ZS4A 2CCIA 3OF0A 5HLNA 2YITA 3R01A 3W55A 4BTMA 3P5KA 4CSVA 2HXLA 4JT3A 3R2YA 1R39A 2G9XA 4KIKA 4BCMA 3Q53A 1XR1A 5AUZA 1PF8A 2BFXA 4J71A 4KWPA 4BGQA 5DPVA 3Q9ZA 2PE1A 4FKOA 4FYOA 3MJ2A 5LJJA 3QTWA 4D55A 3DLSA 2UZDA 4FSQA 5AP3A 3DAJA 3MVHA 2XNGA 4I4FA 1PMEA 4YZDA 5E7RA 4AGUA 1QPEA 4B4LA 4RQKA 3LFEA 4L46A 3WF9A 2BZHB 3GGFA 2X9FA 4MD8E 3OTVA 3EH9A 5BVEA 4FV8A 4D4YA 4HVDA 3UODA 2BDWA 3ZS5A 1IA8A 3FLQA 2QG7A 2YA9A 4QMLA 3NVKI 4O0SA 3HECA 3DU8A 3DBEA 1K9AA 2IVTA 3QHRA 2W0JA 4MXCA 2C30A 1PYXA 1P14A 4TKSA 3ZC5A 1TKIA 5IA5A 1CM8A 3VN9A 3COHA 4IANA 4QTCA 2YLFA 4OTRA 2CGUA 2OO8X 2ZMCA 5FXQA 3BYVA 2X8IA 1YXTA 4OTHA 1M7NA 3LHJA 3O7LD 3PSBA 2OW3A 4YNEA 5HE2A 3RWPA 3V5JA 4XS2A 3M42A 4U3ZA 4BGGA 5I9YA 4QQJA 1RE8A 1RDQE 1U4DA 2XM9A 4WG3A 3RBWA 3RM7A 2EXEA 2YDKA 2GTMA 4FTIA 3VF8A 5AR4A 4QP1A 3UVQA 1L8TA 3FXXA 4R7HA 3ODZX 3NDMA 5JZNA 2J0LA 4C02A 3W2CA 5JZJA 3Q5IA 4IX4A 1H1SA 4YC6A 3EFKA 2Q83A 4RC2A 3JUHA 2J2IB 5KMMA 5FG8A 3H10A 1H0VA 5EKNA 4IADA 4XG7A 5IQAA 2ZV9A 3GCUA 3MA3A 3QKLA 3U8WA 2BPMA 4ENXA 1Q3WA 2QKRA 4ZTMA 4U45A 3FPQA 3AT4A 4XV2A 3ZRMA 3I7BA 2OJFE 4GMYA 1VZOA 3D83A 2OF2A 5IKWA 4PDPA 3LXPA 4DFNA 2PUIA 3FZPA 4RA5A 2WMWA 4QTAA 5FP5A 3IW4A 4FTRA 2B52A 2R3RA 3UMXA 3UYTA 4C61A 3W16A 4L53A 2CKQA 2ZJWA 4ITIA 1K3AA 3E92A 4WG4A 1NXKA 1H1WA 4WNKA 1ZYSA 2PZ5A 4DEBA 5CF6A 2WHBA 5L3AA 4X6QC 5JRQA 1OL5A 5GIPE 3MV5A 4N6YA 3II5A 2CNUA 2QOQA 3TKUA 1JSUA 2JDTA 3QRIA 4AFEA 3QAME 2XK7A 3E8NA 2R3OA 3C4WA 4IAKA 4C4JA 3TUBA 3TEIA 3QXOA 2BRMA 3OT3A 5KBQA 2W4OA 2PVYA 3VQUA 4NIFA 1YOJA 4CGAA 2C68A 3QCYA 4GVAA 4U3YA 1KE9A 4JR7A 4GG5A 4KNBA 3E8EA 1H1PA 3P9JA 3EHAA 5DIAA 5LWMA 5GZAA 2B9JA 2C5OA 3TUCA 3KK8A 1PXKA 4EI4A 5EDPA 3R9NA 4LGGA 3ANQA 2WTWA 1R3CA 5LVOA 2HWOA 4A9TA 2GCDA 3FYKX 4F9AA 1Q99A 3NUNA 3MESA 4HCUA 3E3PA 3QA0A 3OROA 5BVFA 1BI8A 4V0GB 2ITXA 3AXWA 4RVKA 5BMMA 5AV4A 3RPSA 3HV4A 3CY3A 4KIQA 3HP5A 3F5XA 2XB7A 5J87A 4K8AA 5BX0A 2OIQA 5H8EA 2YM3A 2QO2A 4M12A 4CFVA 4ERWA 3T8OA 3T3UA 3BU3A 4FTLA 4JAIA 5A6NA 4FTQA 1WVXA 2P4IA 3IKAA 4D2VA 3HUBA 3VS3A 2R3GA 4MQ1A 5LQFA 5BMSA 3F6XA 4GRBA 5AUVA 1I09A 3D14A 5E8SA 4NFNA 1V0BA 3Q96A 1P2AA 2VO6A 2CCHA 4RC3A 3EB0A 4WIHA 4DFZE 4PV0A 4FNWA 2PE0A 2XK4A 3D15A 3F2AA 3L8SA 4PMTA 5HVKA 4O0WA 5CEIA 3VHKA 4Z3VA 1Q41A 2VWVA 3UIUA 4I5HA 3PJ8A 4BCPA 5CU0A 4ERKA 1REKA 4EOJA 3EL8A 4NM5A 4NW5A 1CDKA 1UKHA 4JDIA 2UW4A 2J0MB 3DNDA 1O9UA 5A4QA 3FMHA 3PRIA 4G9RA 4J8MA 4G31A 5HIDA 4OTQA 4GKHA 3EFWA 4XUFA 5EI6A 5HZNA 3MY5A 3NNXA 1OIQA 3O17A 4IXPA 4KKEA 4LOQA 4S2ZA 4AT5A 4EOLA 4YUQA 3ZLWA 3DXNA 5DRDA 1STCE 1FGIA 2Z8CA 3OC1A 1P5EA 2UZTA 4YHJA 5DT3A 3D94A 3JVRA 4L9IA 5EW8A 5AX9A 4DF3A 3LJ2A 3I60A 3RGFA 4DGLC 4KINA 2UW0A 4YC3A 3QGWA 4U6RA 3IW5A 2XCKA 4KKHA 4MNFA 2OJJA 4W9WA 1M2QA 2GQSA 1YOMA 1PRYA 5ANOA 3VJNA 3R02A 2WFYA 3VF9A 4C2WA 4FE2A 4FK3A 4DLJA 4CKRA 4GS6A 4AFJA 2YM8A 1WAKA 1VYZA 4FODA 4RJ4A 3BZ3A 1PYEA 4YJQA 3BV3A 5CZIA 2XNPA 3OBGA 4JS8A 2PVNA 3SAYA 4E6CA 1ZLTA 3F3VA 4UEUA 3FZTA 2YCQA 5J1VA 3R0TA 2YAAA 2WIHA 3FXZA 3RAHA 4K1BA 1IG1A 3V8WA 4DG3E 4D2SA 1P4OA 4YJVA 3PXKA 5DR6A 4ANLA 3QQFA 4IB0A 4NTTA 4C35A 2F7EE 3CY2A 3GCVA 4JG6A 4TYEA 5CZHA 4EZ3A 4DA5A 5FTGA 2VO7A 3UP2A 5GHVA 3NAYA 3OD6X 3LXNA 4IHPA 2QONA 1PXNA 1ZMUA 4NYEA 1LP4A 3A7HA 4K0YA 3CS9A 2C47A 2JIUA 1W83A 2O3PA 4DTBA 3MPMA 5EYDA 5CAOA 4MK0A 1XWSA 4JBQA 3W2QA 3KMMA 2WKMA 4LM5A 4UYNA 3PPZA 3BQCA 3BBWA 4QOXA 4QQCA 4C4FA 2XNNA 2OWBA 5IQGA 3PXYA 2W05A 4EH8A 3NVMB 3DNEA 4CLJA 5CANA 1PW2A 4F0FA 5C1QB 3LJ0A 4O84A 2C5NA 2QOOA 3TL8A 3MIAA 5CAPA 2ZM1A 5CASA 1M14A 4P90A 1HCKA 2C5YA 4L6QA 4R7IA 2XEZA 4WUAA 4RVMA 4UWYA 4CV9A 3F2RA 5BYLA 4FIGA 4CFUA 2WMVA 1ZARA 4AE6A 2OZAB 4RA4A 4JQEA 5AAGA 2NRUA 4ANSA 1OM1A 3SW7A 2EB2A 3F3ZA 1R0EA 4IH8A 3F9NA 3RAWA 1PMUA 5F95A 3PUPA 4ASXA 1XH5A 4GIHA 4HYSA 3QD2B 2X1NA 3EN5A 3OS3A 2F7ZE 4BVUA 4O0YA 3NCZA 5HESA 5JSMA 5B0XA 3PVGA 3EJ1A 4HCTA 3CIKA 1OKWA 4KS8A 4GT5A 4Y95A 1YQJA 3OHTA 3LJ1A 4FX3A 3WIGA 2VN9A 5EDRA 3RM6A 4JG7A 3L1SA 5AM7A 3W2OA 4DYMA 3VRZA 4ZLOA 2WEVA 2CSNA 2XIYA 2UW6A 5DT0A 2VU3A 1T45A 4RIXA 2W9ZB 5KMIA 2YWVA 1B38A 2Y6MA 4GIIA 3F3UA 3BEGA 4JDJA 4JIKA 4UZHA 4WUNA 4O7YA 4FTAA 5AUWA 4BR3A 3D7TB 3KEXA 5FDXA 3ZUVA 2P2IA 4LFIA 4GKIA 3WIKA 5CALA 1QCFA 3HA6A 4EH7A 3AGMA 5IA1A 3ZFMA 4BKJA 3QC9A 3EIDA 3SKCA 3LQ8A 2R3JA 1W98A 3SDJA 4AW2A 2GSFA 3DFAA 3RZBA 3QRJA 5LMKC 3MIYA 5HU9A 5AV1A 2YM4A 4O96A 3HDMA 1PMNA 2W96B 4FV2A 3NYVA 3PZHA 5FTQA 4FSUA 2ETRA 2JAVA 3FKOA 3SRVA 4BF2A 2GFSA 5KHWA 2FSLX 4ALUA 1CSNA 3KK9A 4TWCA 4DGMA 3U55A 3DQWA 3OWPA 4U40A 3UIMA 4HJOA 5DEYA 1BL7A 4C2VA 3EFLA 4GU9A 4IM0A 2WMTA 4ZTLA 3JY9A 4TW9A 2RFDA 1SVGA 4FC0A 3OWKA 2O65A 5BUIA 3UNKA 3LLAA 4ZZOA 2UVZA 1QL6A 3MH0A 4Y8DA 4RIYB 4FI1A 3VS5A 1BYGA 3ORPA 4PUZA 3SD0A 4Y85A 1XQZA 5E90A 2WTKB 3AG9A 3LQ5A 5KKRC 4F99A 3GC8A 3QBNA 4I92A 4JBVA 4DCAA 5HOAA 4QYYA 4AZVA 1V0PA 4DHFA 4C37A 5JMSA 5KMKA 3KU2A 3N4TA 5A54A 4GVJA 1H27A 5IH5A 5M56A 3ZDUA 3DB6A 4QD6A 2VWUA 2VTRA 4QP2A 5L6WL 5C8MA 5T6KA 3FZRA 3F82A 2Z7SA 5AEPA 5KO1A 5IMEA 1JNKA 2XH5A 5JH6A 4QP8A 3LOKA 1ND4A 4CKIA 3S1HA 4QMQA 5DE2A 5ANIA 4FEWA 4QQTA 4O6EA 4OTPA 5M57A 3WBLA 1Y6AA 4NM0A 4ASEA 4BDBA 2BALA 3DXQA 4APPA 4I6BA 5BYZA 3AC3A 2OJIA 4TYGA 3R8ZA 4QMYA 3BYMA 3DY7A 1KSWA 1BKXA 1SZMA 3O8TA 5C4KA 2ZOQA 3KY2A 2X6EA 3RZFA 4AZFA 4PMSA 1JVPP 5CY3A 4PPCA 4JR3A 3EQIA 1ZOGA 5JGAA 2OIBA 2BR1A 3OMVA 2V0DA 2XIRA 3ET7A 3NUXA 4IJ9A 3DTWA 3IECA 4JL9A 2OH4A 5EDQA 4M84A 3UG1A 2Z7RA 2PULA 4HVIA 4WRGA 5IUIA 4NTSA 4ZSGA 4AX8A 4E26A 4JQ8A 3VJOA 4ZP5A 5I0BA 5DT4A 3ELJA 3W8QA 4EOIA 4NU1A 5DH3A 5M08A 2BILB 4MXZA 3VUDA 5IQEA 4DC2A 2Z7LA 3IDPA 3RK7A 3Q32A 1G3NA 4IB5A 4MH7A 4EUTA 1NT2A 4BWPA 5BUEA 2RKUA 2J90A 3EQRA 3MH1A 2HZ0A 1OVEA 2X2MA 3MW1A 4IM3A 4NL0A 4D1SA 5CEQA 3LAUA 2BRHA 3K54A 3LM0A 4L68A 3ZSGA 3ZXZA 2VV9A 2RFSA 2WZJA 1U59A 3NNVA 5J95A 4EH4A 2R64A 3BEAA 4PTCA 4FEXA 2DUVA 3A7FA 4HPTE 3Q60A 4AOJA 4FR4A 4LV8A 3Q04A 4LG4A 3PYYA 5E8XA 3HKOA 3BV2A 5KUPA 4XV3A 4PDYA 3ZM4A 3KRLA 2WU6A 1J91A 2XKCA 2W99B 4YBJA 3V51A 1CKJA 3ANRA 2XNMA 3NUYA 5IH6A 4YJTA 1GIIA 3GFEA 3MPAA 4Y83A 5E92A 1AD5A 3HMOA 3UDBA 3LFSA 1SMHA 2Y8OA 2R7BA 1UA2A 5HD7A 3R8VA 3TZ8A 2E2BA 3BELA 3PIZA 1BMKA 1J1CA 3BHUA 3Q4CA 5A3XA 4G3CA 1F0QA 4EYJA 3Q2JA 2X0GA 1WBPA 2YDJA 2WEIA 4I24A 4IX6A 4EL9A 4JG8A 2HZ4A 3GOKA 2OXYA 5ACBC 3WF5A 5A4TA 4RWJA 1H4LA 2SRCA 4OTDA 5HVYA 2G2HA 4QTEA 3ITZA 5DGZA 4RPVA 3TWJA 5CU4A 4DGGA 1FVRA 4CFWA 4XG3A 4X6RA 4AZSA 5HCXA 4F7JA 5IA3A 2RG5A 3ZOSA 5J5TA 4M66A 4IAIA 4BBFA 4TL0A 4M69A 4BDJA 3P86A 1XJDA 4K18A 5TT7A 3OP5A 3TV6A 2J51A 3GP0A 3O8UA 3BYOA 3LCSA 4GT3A 3DKOA 4Q9SA 4WT6A 3UG2A 4NM7A 4PDSA 4WA9A 2REIA 3C13A 2F2CB 2UZLA 3IDBA 2ONLC 4IVDA 2FO0A 2UZNA 3CEKA 3LCOA 1KV1A 4N6ZA 4A4LA 2UUEA 4EORA 2OZOA 4NCTC 4O6LA 5ETCA 1OKYA 4ENYA 1OL7A 3FL4A 4JLCA 1O6YA 3HV3A 2CHLA 3CGOA 3FLWA 3OT8A 4TWOA 4W4XA 4UMRA 2YERA 5FQDC 2OXXA 2PU8A 1GNGA 2HAKA 4YJSA 3R71A 2HW7A 4IZ5A 4RX7A 3UO5A 4E93A 4O38A 5HTIA 1ZY4A 3MPTA 2WTIA 3ETAA 3MBLA 5CSVA 3NEWA 4IWOA 3H9RA 4CMTA 4CG8A 5IUGA 1JKLA 4F6UA 5FUTA 2O5KA 2HY81 2DS1A 2VTTA 2BVAA 3OFMA 2B7AA 4MEDA 4QT1A 3RAIA 2V62A 4FVPA 2X2KA 3KF4A 5EG3A 5HE0A 1S9JA 3PVWA 4IVAA 5T68A 4J53A 3M2WA 4W9XA 3ACJA 1G5SA 3KQ7A 3GU4A 5EHYA 3SC1A 3PWYA 4DH7A 1O6KA 3FXWA 1H1RA 5HX8A 4ZOGA 4ZK5A 5M51A 3R1YA 4FVQA 3S2PA 4F1OA 4ZY5A 3RMFA 4FT9A 4FKLA 3RHKA 4XP0A 4L3JA 1L3RE 4FV5A 4I0SA 4MQ2A 3B2WA 5J7HA 3CR0A 3Q5ZA 2WU7A 3QX4A 2IW9A 2ITNA 2G01A 2BDJA 2C6TA 3GCPA 4D1XA 3C4FA 4E6DA 2PWLA 4BHZA 2I0EA 2V7OA 4GK3A 2PVKA 4YLJA 3QTXA 2PZIA 3KULA 5CX9A 3V5PA 2EU9A 3AGLA 3HV7A 4FMQA 4CNHA 4W4VA 4NWMA 3R1NA 3VS7A 4N70A 4ZXTA 2BHHA 4L8MA 2WOUA 5HCYA 4C62A 3PFQA 5IU2A 3LPBA 1Y8YA 3PSDA 4BCFA 4P5ZA 3A8WA 1PJKA 1H24A 5C8NA 4X3FA 4F65A 3LXLA 3S3IA 3LQ3A 3RVGA 4FTTA 2A19B 3P7AA 1ZAOA 2BIYA 3V8TA 4D4SA 4ASDA 5IQDA 4D9UA 3HMPA 2QHNA 3O51A 3GEQA 4FVRA 4WNOA 4RJ7A 5FD2A 4Z16A 3UTOA 3CD3A 4ALVA 2WQMA 3F5GA 5HBEA 4E6QA 2VTQA 1DAWA 1Q8ZA 1WCCA 5ANKA 1UNLA 3QC4A 4F63A 4Q9ZA 3MFTA 1DAYA 4BBMA 2GNHA 3NWWA 3CKWA 4YJOA 1J7IA 1BL6A 2WQNA 4ZAUA 3PIXA 4WKQA 4CG9A 1KOAA 4EHEA 2X7OA 2I6LA 4IEBA 2QCSA 3ZDIA 5HHWA 1M2PA 4I21A 4YSMA 3K3IA 3VBVA 4ALWA 2ZB0A 4XP3A 3F7ZA 5D7VA 4ZTQA 3UQGA 4NSTA 3L8PA 4A07A 3NW6A 4IM2A 2XRUA 3H0YA 3GU8A 3NIEA 3ENHA 4RJ5A 4XG9A 3UIXA 5FP6A 3LCTA 3FHIA 4BN1A 2PPQA 2G2IA 4G5JA 4BI0A 2UW5A 4DFLA 4RX5A 2VTSA 2VTPA 3KKVA 3P7CA 4AW0A 4E1ZA 2H6DA 4FT7A 4IDTA 4HVSA 4AGCA 3ZH8A 5ETFA 4C38A 2CN5A 3WZDA 5M4IA 4J96A 4DGOA 4Y46A 1GAGA 3BE9A 5C8KA 4HGTA 3LFBA 5HQ0A 4KIKB 2OF4A 3TG1A 5EHLA 1K2PA 1G8AA 2QO7A 2R3KA 4M14A 3NUAA 2EVAA 4G6LA 1PXJA 2R5TA 5BVWA 3FAAA 3QTIA 4EOMA 3NNUA 4HGSA 4I93A 3WE4A 4U8ZA 2ITUA 5K5NA 4EZ5A 4L52A 4YJNA 3ZEPA 4PMMA 5EH0A 2C0TA 4D4VA 3FPMA 2R3IA 4U43A 1KE5A 2X39A 2QOLA 4IMYA 3RNIA 3UVPA 4DITA 4C3FA 4MF1A 5DR2A 3PRFA 4AGWA 3Q3BA 3MY0A 4FTNA 4O0VA 3KRWA 3HAMA 1TVOA 3A60A 2VTHA 5HICA 3UC4A 4HGEA 2ZAZA 3DJ7A 4O7NA 3N51A 4I6HA 2JGZA 3TZ9A 3QZIA 4D2RA 4S32A 4EQMA 5TF9A 4X2GA 3WYXA 2X4FA 4GSBA 4K11A 3IGOA 3HMIA 4QP3A 2C5VA 3I1AA 1UWJA 5I9UA 3PXRA 4Z9LA 4F0IA 3SOAA 3T9IA 2J0IA 1LEZA 5J9ZA 4O0TA 5E9EA 3TNPC 1BUHA 5J1WA 5L2QA 3TIYA 5KCVA 4FL1A 3UOLA 4D5HA 2WD1A 2C6MA 3QTSA 4Q5EA 4XBUA 4XP2A 2OU7A 3TNHA 3PPJA 3K5UA 2VGPA 5HCZA 4KKGA 3GCSA 3HRBA 1KE8A 2GPHA 3KFAA 4JJRA 1PXOA 3KRRA 3DTCA 4FSYA 4OTIA 4QTDA 3E7OA 2FUMA 2NO3A 2UVXA 5JRSA 3AT2A 4RWKA 4DEGA 5HBJA 2BFYA 2I0VA 2XNBA 4USEA 4UX9A 2WIPA 3DV3A 3JYAA 2GDOA 3PIYA 1RW8A 3I81A 4FKPA 2CKPA 3PZEA 3VNTA 3ZC6A 1YXSA 3EFJA 2OKRA 2IW6A 3CQUA 3HEGA 4ZIMA 3R7YA 4IQ6A 4X3JA 2HOGA 3R9DA 4ZTRA 2YEXA 4MXYA 3S95A 2I7QA 5D12A 4ACHA 4YO4A 3IPHA 2PSQA 1KE6A 2IVSA 4YZCA 1OIRA 4X2JA 3MI9A 3HL7A 5F94A 2GFCA 4EH6A 2X8DA 4BCKA 5HNIX 3BI6A 5JKGA 3BLQA 3QU0A 4M0YA 1ZOEA 2OFVA 1GY3A 2BRNA 4D1ZA 4XG2A 4DH3A 4WNPA 4FK6A 4RZVA 4MXXA 4J95A 4F0GA 4RX9A 2IWIA 3DK7A 2BAQA 3MB6A 3RPRA 5CYIA 5KMNA 1ZMVA 1T46A 5CLPA 2X9EA 3EN4A 1YWVA 3CXWA 3U6JA 2OXDA 4I3ZA 3ODYX 1OGUA 3ZEWA 4U97A 4ANOA 3SW4A 5DLSA 5LVMA 4N57A 4O7SA 2C3KA 4DT9A 1F5QA 3KXGA 5CNNA 1UVRA 2XZSA 3FMNA 3G0FA 5FGKA 2JIIA 3BU6A 4IZAA 5CXZA 2V22A 3BCEA 5CQUA 4NIFB 5AP5A 2J5FA 5HIEA 3V5TA 4AP7A 5F9EA 1SVEA 4M68A 4RVLA 4AA5A 4EJ7A 1ZYCA 2C69A 5EM8A 2GS7A 2ZDUA 5C01A 4XOYA 4UMPA 4TYHA 4II5A 3O0GA 5JFWA 5IEVA 4W4WA 5AIKA 3CPBA 1UKIA 4YP8A 4FV6A 3P08A 3DA6A 3EQPA 2BZKB 3L8XA 5A4LA 1V0OA 1RQQA 3Q4UA 3E87A 3BHVA 4JX7A 4FV3A 4M7IA 4JIAA 3VS0A 2WMXA 4FL3A 4NZWB 5CNOA 5H8BA 5AA8A 2B4SB 5FBNC 5L2TA 1ZRZA 4QNYA 3RPVA 3H3CA 2C3LA 2JAMA 2BUJA 2XUUA 3EZVA 2BROA 2H96A 5D41A 2J9MA 4A7CA 1FVVA 1Y57A 3UMWA 1PY5A 2ZB1A 3PPKA 3LMIA 5LCKA 1ZMWA 4BGHA 3ORKA 3T3VA 5IQIA 3FLZA 3BWFA 2A1AB 4I94A 2YCFA 3NR9A 3IS5A 2OG8A 2UW7A 3HDNA 3OW3A 5M09A 3IK3A 5EOBA 5HVJA 5J79A 3MVMA 1YXXA 3V8SA 4UV0A 2CGVA 3H30A 3PLSA 5HI2A 5GJGA 3ZRLA 3ACKA 4EC9A 2RL5A 2OLCA 5FEDA 3ZO4A 3QQJA 4CCBA 4I4EA 4FA2A 5HLPA 5AP1A 3BWJA 3C4XA 2JITA 4RIWA 3G90X 2X81A 5M4CA 3ENMA 2A27A 3M1SA 4FSMA 4BZNA 2EUFB 2QLQA 1HOWA 2CGXA 3ZZEA 3G6GA 1MRVA 2VZ6A 3LFDA 1AQ1A 4ZZMA 3W18A 3PP0A 4BKYA 3BGZA 4FG7A 3AD5A 2JFLA 3ORTA 5GINE 3BHYA 3FLYA 1Q8UA 1W8CA 3EKKA 2R0IA 3GQLA 3BLHA 2PUNA 3L9NA 4R3RA 1OL1A 5I9XA 3DT1A 5EW3A 3QL8A 2PVJA 5AAFA 4YHFA 3BQRA 4L67A 4OBOA 4UYAA 3EQCA 1SNXA 3G0EA 3FMDA 1JLUE 3SV0A 4AS0A 4EKLA 4GEOA 5KE0A 3E88A 3C5IA 4DINA 2BAKA 4AW5A 5CF8A 1WBVA 4AOTA 4O27B 4YR8A 4WD5A 3F61A 2YIWA 1FOTA 2WMAA 3QGYA 3ORNA 4RFZA 4OLIA 2C6OA 4X21A 4BIBA 4D5KA 4EQUA 3GBZA 4HNIA 3M11A 3DAEA 3R21A 3MFSA 3PG3A 2XA4A 4FIJA 4DFYA 3VQHA 3F66A 1YHSA 3SA0A 4DN5A 3REPA 3FL5A 4CMUA 4F4PA 1KOBA 2HELA 3A4PA 3CJGA 3BX5A 5D1JA 4EH9A 1GZKA 2R9SA 4LL0A 3F88A 2ETMA 3QRKA 4BDHA 4CZTA 2ZV7A 4PP9A 4MHAA 5E8TA 4BYJA 2UZVA 4I23A 5HE1A 3F5PA 5IA2A 4CRLA 1U5RA 4FTOA 3U9CA 4XNEA 3L9LA 2XJ2A 3BBTB 3QALE 4LGDA 1OUKA 3CKXA 3OTUA 3VUKA 2VWBA 3R73A 2OSCA 3R22A 4J1RA 4A9RA 4IAYA 4O7ZA 5A4CA 4IFCA 4AAAA 4YSJA 1H0WA 3ORXA 4C7TA 4IVCA 5IA4A 5CU3A 3EZRA 4GH2A 4FTJA 4PRJA 1U46A 5M4FA 2C6LA 4F6WA 2VTMA 3UZPA 3ZRKA 5B2KA 2W17A 2HWPA 1Q3DA 4NM3A 2QOFA 4YZMA 2QOKA 4V01A 4WSYA 5FWKK 2XF0A 3FY0A 3QQKA 3RJCA 4A4XA 2XP2A 2I40A 5LMAA 4KSPA 2J4ZA 2GNLA 5AJQA 3FI8A 3UVRA 4TTHB 3FMLA 4BKZA 2WTDA 4GJ3A 1MQ4A 5EQEA 2VTAA 4F9WA 1YDRE 4H1JA 4KAOA 3FLSA 1ZYJA 4BCJA 3TTJA 3MB7A 4RIXB 4XLIA 4PQNA 3QXPA 4IAFA 4ZMFA 5AV2A 5EM6A 3BYUA 1OPKA 4O22A 4QMWA 3AC4A 3U4UA 4A9YA 2UZWE 2VGOA 2Y6OA 5A9UA 1JKTA 2WNTA 4QYHA 3MS9A 1GIJA 3VULA 5CF4A 2LAVA 2R7IA 2W1CA 1Q4LA 3QQLA 4G5PA 3TACA 3PA5A 3MGYA 4XX9A 1FPUA 2GS2A 5EM7A 3D9VA 4ZEGA 2J50A 3BHHA 4O2PA 2VTLA 1WVYA 3U87A 2XYNA 3DCVA 2AUHA 2X6DA 4FKGA 3KXNA 4W8EA 1UNGA 1URWA 2R2PA 2GMXA 2QHMA 4X0MA 3FMKA 4XEYA 2PVHA 2WAJA 4FKRA 2YM6A 3SRVB 3KXMA 4G3DA 3KRJA 2PMNX 4QYFA 4EBVA 3HRCA 3L9MA 1YWNA 3Q4TA 2Q0BA 5C9CA 4FG9A 5EFQA 4DH8A 3GI3A 3QWJA 5K3YA 4G6NA 4L01A 1CKPA 3HV6A 1OIYA 3MH3A 1JQHA 4ITJA 2B55A 2OJ9A 4C34A 3H9FA 2WELA 4KSQA 4AUAA 3OOGA 5AP7A 5BUJA 4BDDA 4D28A 5HORA 5I4NA 2VAGA 2FGIA 1WMKA 1NY3A 1MQBA 4UWCA 2E9UA 4OBPA 4PL3A 4UXQA 3IG7A 5CVFA 3Q9WA 5FBOA 1JSTA 1YWRA 4FTCA 4FUYA 1IAJA 3DDPA 4USDA 4ZSJA 5C27A 4RG0A 1XH6A 3FI4A 4O7RA 4JX3A 4UALA 4E7WA 4RGJA 2J0JA 3SXFA 3G51A 2C5XA 1LUFA 1MUOA 1M52A 5EQYA 1OPJA 1Z5MA 5GIOE 4R77A 2NRYA 2QODA 4MXAA 2F9GA 3O8PA 3PP1A 4NW6A 4LQMA 3W32A 4MYGA 4CEGA 5J7BA 3OOMA 4R5YA 1WBTA 2ITTA 3TV7A 3OCBA 2HCKA 2BIKB 2WMBA 1FQ1B 2XBJA 4FZ7A 3G5DA 4KA3A 4E4MA 4KD1A 3MY1A 5J9YA 3AQVA 4FZAB 1OBDA 2YIQA 4E5BA 4YC8A 4JAJA 3LMGA 3LE6A 4KRCA 1URCA 2OI4X 4FKIA 1UU8A 2XEYA 4MTAA 4D58A 4KBKA 2C1AA 4ARKA 4EUUA 5AADA 3C50A 3D2IA 5J9LA 1M17A 2HY0A 4P4CA 4GFMA 3GNIB 4PNKA 4QMZA 3WILA 4L43A 5GJFA 3V6RA 3U9NA 1U54A 3CC6A 3I6UA 2O8YA 4QMMA 2BRBA 2GU8A 5G6VA 4U79A 5HIBA 4E5AX 3GFWA 5DYJA 4FEQA 1FGKA 2HIWA 1H08A 5CSXA 2UW8A 5IQCA 4CZUA 4USFA 4C4HA 4H58A 3H4JA 1X8BA 2WMUA 4MNEA 3R2BA 4ONAA 4PPBA 3RTPA 3UP7A 3PDTA 3R1SA 2R3FA 1UV5A 4OGRA 4ZLYA 2C0IA 3KCKA 4NJ3A 5EOLA 2C3IB 4UMUA 1ZWSA 1XBAA 2YFXA 2BCJA 3C5UA 3ORIA 4XHKB 5CI6A 5TKDA 3FEGA 2JD5A 2C6EA 3QTQA 1CTPE 4O82A 4EH5A 3V01A 2E9VA 4HZSA 4I20A 2GNFA 3AD4A 3QQHA 4G9CA 4KIPA 3VW8A 5M53A 4AU8A 3D5WA 2WGJA 2UW3A 4M15A 1F3MC 3PA4A 4C33A 4RJ8A 3PY1A 2CN8A 1UU3A 1RJBA 3H9OA 3R04A 4MD7E 5DRBA 3R83A 4F1TA 5HGIA 2PVRA 2WMSA 4XG6A 4YHTA 3CE3A 4GCJA 4EKKA 3E3BX 4L45A 4KUJA 4JQ7A 3FHRA 5I9ZA 2GNIA 2QR8A 4EJNA 5E1EA 3RK5A 3KXXA 3VS2A 5HG9A 4E4LA 3Q9YA 3SGCA 3D5XA 2JFMA 5CSWA 3W2RA 3GOPA 3PY3A 4FKQA 5AR2A 5DR9A 3OCSA 3UOHA 4FUXA 4FICA 4GFGA 2WB8A 3QUPA 2YJSA 1KE7A 1BI7A 4KBCA 3QYWA 3R30A 3BLRA 1J1BA 2EXCX 4UMTA 3RHXA 5FDPA 4QP9A 3VIDA 1JPAA 3FI2A 5DNRA 4S34A 4NKSA 3UNZA 2C4GA 3QZHA 1B39A 3TT0A 4I22A 4YPSA 3FJQE 1H07A 4LGHA 2GQGA 3AC5A 5IUHA 1OL6A 5HNGA 2B9HA 4D0XA 2W5HA 4FT3A 2Z7QA 4M69B 5CWZA 4ZSEA 2Y9QA 5A6OA 2W1IA 4FSZA 3ZFYA 2O63A 3E62A 4HYUA 4AZTA 2J7TA 3VUIA 2B1PA 4CV8A 2PMLX 3LKMA 4YTIA 4A4OA 4C36A 2VO0A 3UQFA 4GYIA 4ZY4A 4CYIA 2VX3A 4IC7A 4DTKA 5AP6A 3OCTA 2R4BA 2YDIA 1IASA 5E8ZA 5J8IA 4G17A 4YPDA 5IG1A 3OCGA 4QRCA 2CDZA 1MP8A 4B8MA 1M7QA 3IO7A 3PG1A 4MVFA 1J3HA 4WSQA 5DBXA 4CD0A 4O83A 4I6FA 3UE4A 5CAQA 5AFVA 5E8WA 2B53A 4FKSA 2JKMA 2JIVA 4OTWA 3ZBFA 2P33A 2W06A 4TT7A 4RLLA 3R6XA 3DBFA 2R3MA 1FMKA 3QTUA 4I5CA 2B54A 4ANBA 4I1ZA 2VRXA 4C0TA 5IDNA 3QZFA 4MF0A 2X2LA 3ATTA 4I41A 1IAHA 3HZTA 3E5AA 4G3GA 4OAVB 5E1SA 2VD5A 3V3VA 5CAUA 5L8LA 4R1VA 5AUYA 1VYWA 2QVSE 2R3NA 4NEUA 4E3CA 4LOPA 2W5AA 3DS6A 5JQ5A 3KVXA 5IZFA 4EHZA 2XJ0A 3GU7A 2AC3A 2I0HA 4L3LA 3NYNA 3WZEA 4FZFB 3FV8A 3LZBA 4FOCA 1TQMA 4PWNA 3VAPA 3SX9A 3VS1A 3AD6A 4R7BA 3ZTXA 5GZ9A 2KTYA 3F7WA 3ZLSA 4ACMA 3ZO2A 3MSSA 2IPXA 3IW6A 4IB3A 5E8YA 4PDOA 4YLLA 4ACDA 2BKKA 2PVFA 3QCXA 4EC8A 1KV2A 4QPAA 4BIEA 4D2PA 3BGPA 3IOKA 4FOBA 1WVWA 4S31A 3LFCA 4J98A 3TDWA 4DBXA 4FEVA 4NH1A 3V04A 2G1TA 5IQFA 3KULB 4BHNA 5LOHA 5EI8A 1YRPA 3OXZA 3NCGA 5HO7A 3FY2A 2UZOA 2YIYA 5DEWA 2VWZA 2DQ7X 4BYIA 3GVUA 3UOKA 4AOIA 1UU7A 2XMYA 4IZYA 5DOSA 3LFFA 4IWQA 4B7TA 4RFMA 4IVBA 3EQBA 2WOTA 4NK9A 4JBOA 1XO2B 4X3FB 3O71A 2IZRA 3Q4ZA 3RPOA 1G8SA 5HO6A 5BVOA 5CS6A 5CVGA 5H9BA 2DWBA 3PTGA 2BTRA 2QOHA 4LUEA 4OW8A 3HMMA 5E8VA 3R7OA 2R0UA 4M97A 3BGQA 3QD3A 4DGNA 4S30A 2PZYA 2UVYA 3S0OA 4LOOA 4XRJA 3GC9A 4CT2A 3B2TA 4DEEA 4I0RA 1PXIA 4FZ6A 3ZSIA 4F9BA 2NPQA 3E93A 3P0MA 3CD8A 4MBJA 4DBNA 3DGKA 1A48A 4NT4A 3FE3A 3QUDA 3K2LA 3TNQB 3VC4A 3B8QA 3KN6A 3OBJA 4YJRA 3WZKA 4PP7A 4OTFA 4WBOA 2FH9A 4YURA 5T3QA 4EOSA 4MXOA 4ORKA 4BICA 2P55A 4C4GA 5L2IA 2BZJA 4K6ZA 4EK5A 4X7QA 3UQCA 3BPRA 2HXQA 3IW7A 4LYNA 2OH0E 1H25A 4FIEA 1GOLA 3W1FA 2BZIB 2EWAA 3KRXA 3VBTA 4HYIA 3I5ZA 3ZHPC 2H8HA 4Z7HA 5HTBA 4QMXA 3LIJA 2CGWA 3CPCA 4YNOA 3KMUA 4DFBA 5JQ8A 3LLTA 4QMPA 4ASZA 2YZAA 1BX6A 3NGAA 3UJGA 5AR5A 3ORLA 2XKEA 4V04A 4AN2A 2CNVA 1UNHA 1QPJA 3HV5A 2XIZA 3VO3A 3I0OA 2WXVA 2DYLA 3OXTA 1ZYLA 4J7BA 2XBAA 2QI8A 4J8NA 4F64A 4IWDA 3PJ2A 1KUTA 4RQVA 3PSCA 3HYHA 4C58A 3THBA 4E8AA 3PWDA 4P5QA 4EYMA 5AWMA 3CTHA 1V1KA 4E4NA 3AMAA 3R7VA 1YDSE 4U9AA 2YHVA 4FKWA 4BWKA 2XK6A 3QLGA 3GENA 3V6SA 2I1MA 4G34A 4O91A 3CTQA 4I6QA 5CEMA 2YM7A 3FQHA 4M3QA 3NRMA 5ICPA 3FC1X 3U54A 4DEHA 1WBSA 4ANNA 4ZZNA 2VX0A 3NMUF 5LMKA 5IDPA 4BWXA 4YZNA 5LVNA 3QQUA 4WRSA 3CSVA 1A9UA 3ZCLA 3KMWA 5AX3A 4DH5A 3QYZA 3TZMA 3VWAA 4H3QA 3MH2A 3L9PA 4MWHA 1UU9A 5C03A 3O2MA 3UO4A 3N4VA 2ERZE 2FB8A 4FV0A 5KKRB 2H34A 2B9IA 2PL0A 2UZEA 2QO9A 3EYHA 5EI2A 5ACKA 2HK5A 3HGKA 5D10A 1UWHA 4ZSLA 2F4JA 3WE8A 3GC7A 4AZWA 4LRMA 4PNIA 3OEZA 4R1YA 3TTIA 3DXPA 1YVJA 4S33A 4BDFA 3G33A 3FMMA 3L8VA 1JOWB 4RJ6A 5F4NA 5CEKA 3COIA 1SM2A 2C1BA 4KRDA 5H8GA 3U4WA 1OMWA 3SOCA 2UW9A 3CQWA 2XKDA 2YISA 4AGDA 3O96A 1Y8GA 3TCPA 4RT7A 5HNBA 2QD9A 4EONA 4MWIA 3DJ5A 4GU6A 3TJDA 1YI3A 4QPMA 4HYHA 2BDFA 2IN6A 2RFNA 2UZBA 3G6HA 4M8TA 4B0GA 3RKBA 5L6PA 3I6WA 3A7JA 4MKCA 2ZV2A 4O2ZA 4I0TA 4BI1A 4DTAA 2IW8A 3LMHA 3NX8A 3OWJA 3QD4A 2PVMA 1M2RA 3G9LX 3TDVA 2GTNA 3LVPA 3FWQA 4D0WA 3D2KA 2JC6A 2X7FA 3NNWA 5EYCA 1EH4A 2QG5A 4Y73A 3VW6A 2ZM3A 4G1WA 3ORZA 3QQGA 5JN2A 4O0UA 3POZA 4L7FA 4BTJA 2JDRA 1OB3A 3EQDA 1ATPE 5KMLA 1IEPA 2VTOA 3D7ZA 1OL2A 2QURA 4J52A 4H05A 4AF3A 1PXPA 4MCVA 3DB8A 4JVGA 3FUPA 4BIDA 4Y5HA 5LWNA 3IW8A 5IF1A 3UBDA 4ZS0A 4O1OA 1OUYA 4DEDA 1YHVA 1OECA 2IVVA 1DS5A 2Y4IB 2O0UA 4RRVA 3VS6A 4X2FA 3UZTA 4AN3A 5CT0A 5KMOA 2ACXA 1Y6BA 2Z02A 2PZRA 4BCQA 3GC0A 3QTRA 4U44A 4G3FA 3V5LA 4XRLA 2W1DA 3Q2MA 3K3JA 3ZO1A 3GU6A 4GV1A 4C4IA 3GB2A 2I0YA 4XG4A 3S4QA 1E9HA 4L42A 3R9HA 4PPAA 4K2RA 2XNEA 4BL1A 2OFUA 5F1ZA 2X4ZA 1NVSA 3KB7A 3MDYA 4J99A 4PL4A 4BC6A 4HGLA 5A4EA 4HVGA 1AGWA 3I7CA 5CXHA 1ERKA 1VJYA 4TYHB 4ACCA 4AA4A 4BTKA 5B2MA 3TUDA 4MD9E 1LPUA 3NZ0A 4EQCA 3IQ7A 1OIUA 4LMUA 1OKZA 2GHMA 2WTKC 3E8CA 4FNZA 2XK8A 4BZOA 2XCHA 4GG7A 2XVDA 3LCDA 1JSVA 4NUSA 3BRBA 3UOJA 1H1QA 4G16A 3QHWA 4I5PA 1Q8WA 3TV4A 1HCLA 3AOXA 4TRLA 2HZNA 4ZTHA 3IOPA 3NW7A 4CLIA 2FSOX 4L3PA 2ITVA 5HG8A 2GNJA 2JDOA 4AT3A 1YOLA 2W5BA 4DFXE 2W1HA 4EK4A 4DEIA 2R3PA 4CT1A 2WMQA 4HPUE 4IW0A 4LL5A 4U41A 5CT7A 1GZ8A 3CLYA 5AP0A 3R8MA 5TE0A 3DLZA 3R7IA 5LARA 2CPKE 1Q62A 3HX4A 4EHVA 3WOWA 3HNGA 5BVKA 2IVUA 3ZUUA 4QMUA 4YU2A 3OG7A 3JY0A 3ZLXA 2HZIA 5AUXA 2VUWA 2QU6A 4GT4A 3C4EA 3DJ6A 4B8LA 3SXSA 5AUUA 5CEPA 5JEBA 4E73A 5AP2A 3D0EA 4RIWB 3QUEA 3TKHA 2RIOA 4CFXA 5IMXA 1WBWA 3W2PA 2FYSA 2PYWA 4IAAA 5ETAA 4DE4A 4EOOA 2LGCA 4HW7A 2WTCA 3GXLA 5I5ZA 3OY1A 4QMOA 2VWYA 4QMSA 2A2AA 3ZO3A 3BU5A 4DLIA 3HP2A 3R28A 3TNIA 5BNJA 2VNWA 4EK6A 2BAJA 1SYKA 4GUBA 4ZJJA 2F57A 3VS4A 1R0PA 1R78A 2ONLA 2ZMDA 2YACA 1XBBA 3NSZA 4FKUA 4FV4A 5IQHA 4UBAA 4AA0A 1VEBA 3AC1A 4NCTA 3JXWA 4FSTA 4FIIA 1YXVA 3PXZA 1NVRA 2EXMA 4YGAA 5D9HA 5HG5A 5E8UA 4NKAA 3TIZA 4N0SA 4U7ZA 5FTOA 4RMZA 4O21A 4CRSA 5JFXA 1GJOA 5TR6A 4O0XA 2VTNA 3C51A 4FNXA 5GJDA 4AW1A 4QP6A 5EK7A 5I3OA 3OEFX 3EQFA 1R1WA 2G15A 1J7LA 1CMKE 1ZZLA 2BTSA 3Q6UA 3ALNA 3FDNA 4TPTA 3MTLA 3U6HA 4AE9A 4O7VA 5K4IA 2GNGA 3HMNA 3R7EA 4BTFA 1YW2A 1H26A 1APME 2H9VA 4CZYB 3FZ1A 2CJMA 3PXQA 4FKTA 2Y7JA 3AMYA 3JPVA 3W2SA 3F3TA 1Z57A 3UGCA 5C26A 3ATSA 3E64A 4FT0A 1P4FA 3DKGA 3U51A 1SVHA 4V0GA 4RLKA 4UWBA 1NA7A 5ETIA 4AT4A 5EKOA 3I5NA 3Q9XA 4FL2A 4L44A 5DA3A 4DEAA 5M44A 4ZTNA 3POOA 2W4JA 2E9NA 4IC8A 2YCSA 5HE3A 5I9WA 1YDTE 2C0OA 3FSFA 3A8XA 2C6IA 4TN6A 4CFNA 5KX8A 1ZY5A 3QA8A 4WG5A 3COMA 4P2KA 5CEOA 4DH1A 3RP9A 4FV1A 3W8LA 2GHGA 4TNDA 4B6LA 3UYSA 4TWPA 5LMBA 3R8UA 4C59A 3DZOA 3C7QA 4R78A 3EMGA 1PMVA 5IEXA 4AWIA 3CGFA 3SHEA 1E1XA 1ZYDA 4OT6A 4ID7A 4QP4A 5JFVA 4D4RA 5HEZA 4KB8A 5AP4A 2PUPA 4X2KA 2JKKA 3EWHA 5ANJA 3VUMA 2FVDA 4GW8A 1A06A 3E7VA 3ZBXA 4O86A 4DFUA 3NW5A 3KVWA 5B2LA 3Q52A 2UV2A 4ZLZA 3QFVA 3P78A 3RI1A 4DAWA 4QMNA 3IDCA 4R3CA 2C6DA 2CLXA 2OGVA 3KF7A 5L6OA 4CYJA 4EZ7A 2ITYA 2E9OA 5JT2A 3PE1A 4ZY6A 2JEDA 2P3GX 3OY3A 3P4KA 5DN3A 3UC3A 3V5QA 2OK1A 3NUPA 4FIHA 5CQWA 4FGRA 2GS6A 2YJRA 2F49A 4XBRA 1FVTA 5HX6A 2F7XE 4L7SA 4PY1A 3UNJA 4UY9A 2FSTX 4JI9A 4EOQA 4IIRA 2ITOA 3F3WA 2VWIA 4BCHA 3FKNA 1ZXEA 2HENA 2PTKA 4WOVA 4Y5QA 2PMIA 3RPYA 2OBJA 4TNBA 1Q61A 4G2FA 2XRWA 2JBPA 4KABA 4PMPA 5ANDA 3LM5A 1I44A 4JDHA 4FIFA 3FKLA 4C3RA 2J0KA 4DG0E 4AG8A 4EH2A 4FTUA 2QU5A 1MRUA 4IWPA 4YLKA 3C0IA 3DBDA 3ZONA 5FM2A 3O50A 2J6MA 2WTJA 4EK8A 2ITZA 4HZRA 4KIOA 5FXRA 2JKOA 4AXAA 3ERKA 1Q8TA 2C3JA 3MWUA 2YLEA 3LFNA 4I5MA 5I3RA 3ULZA 3V5WA 1S9IA 3DBQA 4U42A 5HG7A 3KXZA 3Q6WA 4UZDA 1E1VA 2OICA 3R8LA 4GL9A 5L8KA 3MFRA 3R63A 4X3FC 4CTCA 4U80A 4ZMEA 2A0CX 4RVTA 3ZM9A 3CTJA 2CKEA 2Y4PA 1REJA 4ZTSA 3SG9A 4FF8A 2OIDA 3W10A 2ERKA 4UB7A 5DG5A 4LRKA 4JRVA 1QMZA 2RFEA 3MFUA 3QKKA 4OT5A 5DHJA 1FINA 1JBPE 4GYGA 2YM5A 2V7AA 2W1ZA 3C4ZA 5FEEA 4PTEA 4RBLA 5L4QA 5KZ0A 2WPAA 2PMOX 4FNYA 1YKRA 4AN9A 4BCOA 4O0RA 2FSMX 1OZ1A 2JLDA 3QKMA 4G3EA 3A7GA 2XIKA 3R00A 1JWHA 3K5VA 4APCA 3EYGA 3PJ3A 4FSRA 5GNKA 5CENA 3MVLA 4AACA 1GIHA 5DI1A 3OWLA 3MTFA 5LCJA 3HRFA 4F9CA 4BCNA 1MRYA 1WFCA 4JBPA 4RFYA 4PTGA 3IGGA 5E91A 5AV3A 3I0QA 3UIBA 5HD4A 1FMOE 1YI4A 5HBHA 4H39A 2R3QA 4NJDA 5J5SA 2OZAA 1GZOA 3W33A 4O81A 3TNWA 3ZMMA 5BQ0A 4FG8A 3QF9A 5HO8A 3VBYA 5DMZA 1TQPA 4PX6A 3NPCA 3GQIA 5JGDA 3VRYA 4TXCA 3F5UA 3ORMA 4U5JA 4QYGA 4EBWA 3OXIA 4MBLA 4D2WA 3P23A 2CMWA 5FM3A 1IR3A 4Y72A 4D2TA 2BRGA 4XYFA 4OUCA 1H01A 4IZ7A 3R1QA 3T9TA 4LUDA 4IAZA 4M0ZA 4A9UA 1Z9XA 2O64A 4RWIA 3KA0A 2A4LA 4F7SA 4O7WA 1U54B 2IZUA 3C0HA 4W4YA 4RSSA 5DVRA 3R9OA 4OBQA 3OUNB 4B99A 3MN3A 4F08A 3D7TA 3PLAE 4ANMA 3KCFA 1H8FA 4EOPA 3AC8A 4OTGA 4BCGA 1XBCA 2GHLA 4YMJA 1DM2A 4MNEB 1QPCA 1JKKA 1Y91A 3C0GA 2PVLA 4ITHA 2BMCA 3CJFA 5IEYA 5AR7A 3RCDA 4CCUA 3A61A 4EEVA 3TI1A 5M4UA 3QX2A 4O7LA 5AR8A 4EK3A 2XM8A 3GUBA 1KWPA 4LRJA 3SVVA 2W4KA 1H00A 1XH9A 2RG6A 2XYUA 2XIXA 4IBMA 2NP8A 3QRTA 4QQ5A 2ZVAA 3BYSA 4F1MA 5IA0A 3TJCA 1FBNA 3GU5A 4CMOA 3HUCA 5BVNA 2YZLA 4XMOA 3WI6A 4FEUA 3EQHA 3NLBA 3QRUA 4DG2E 3FZOA 5H2UA 2QOIA 2W7XA 3A4OX 3P79A 3PVUA 5BVDA 1DI9A 2ESMA 5CTPA 4EWQA 2ZDTA 4JNWA 3DQXA 4QPSA 5ANGA 4AZEA 5K5XA 2R3HA 2IO6A 2W9FB 3DKCA 4RIYA 4BDKA 2G2FA 5HKMA 3VUGA 2IJMA 4FKVA 4AQCA 4ZJIA 3MJ1A 4R6VA 2Z60A 3ZLYA 2P0CA 5AIRA 3DOGA 1IA9A 3CP9A 3OW4A 2B0QA 1OPLA 4QMTA 5A14A 2PY3A 2VTIA 3CQEA 3P1AA 2IG7A 1U5QA 2VO3A 3ZSHA 4F09A 3DK3A 4XV1A 3ZUTA 4KS7A 5IPJA 1XH8A 5DFPA 4YTHA 3DBCA 3HAVA 5L2WA 3DKFA 2WQEA 3VBWA 4R3PA 1GZNA 4HVHA 4IACA 2ZYBA 3TZ7A 2BHEA 3NS9A 3R7GA 2XK9A 4IX3A 3C4CA 1Q97A 3FMEA 3KN5A 3NUUA 4PL5A 4R5SA 2YABA 4RZWA 4WNMA 3JR1A 3N4UA 4CKJA 1WBOA 5B7VA 2J5EA 2PZPA 2XK3A 3QWKA 4J97A 2O2UA 2QNJA 4EHGA 4BB4A 3U6IA 5KBRA 1B6CB 1WBNA 3VUHA 2JDSA 2AC5A 4RC4A 3MA6A 4HNFA 5AA9A 4JRNA 3NYOA 3OVVA 4FTKA 3UPXA 1LR4A 4LI5A 4D9TA 4K9YA 2F2UA 2PUUA 4UXLA 1JKSA 3FQSA 1YHWA 5G1XA 2XS0A 3R7UA 4F70A 3HLLA 3R9RA 1PXMA 2QLUA 4QP7A 5FXSA 4E20A 4TZRA 4GUEA 2Y4IC 3FC2A 4N4SA 1XHAA 5L2SA 1O6LA 3LXKA 1W7HA 4K77A 5K4JA 3KGAA 4W8DA 2CKOA 3O7LB 5L8JA 4H36A 2PK9A 4OAUC 4B9DA 4E6AA 3A99A 3D5VA 4C8BA 1WZYA 3GT8A 4BDEA 1SNUA
chains in the Genus database with same CATH superfamily
4IE9A 4O4CA 2XNOA 5FEQA 4M67A 5HU3A 3NYXA 4GK4A 2YIXA 4FYNA 3FQEA 4TWNA 5F20A 5KZIA 4DCEA 2JKQA 4CFFA 1PKDA 3LW0A 1W82A 3VHEA 1Q8YA 3IONA 4FT5A 3LFAA 4Q5HA 2HYYA 3LFQA 3PUFC 1TQIA 1XKKA 1YXUA 3PXFA 4YTFA 2BKZA 3ALOA 3DFCB 1OI9A 3D5UA 3WF8A 4BDAA 4F6SA 1VLRA 3G15A 2PE2A 4RIOA 4CTBA 2VNYA 3DK6A 3RNYA 3BIZA 2AYPA 3FYJX 3PE2A 4IJPA 3AC2A 3WZUA 2CLQA 3E63A 3I79A 5IQBA 4XG8A 5CI7A 4FTMA 3QCSA 1H28A 3W0MA 4MBIA 2RSVA 4X2NA 5LXMA 2UZUE 3BHTA 4CVAA 1J7UA 5AM6A 4YJPA 5BPYA 4WO5A 1IRKA 4CQGA 5M07A 3C9WA 4OR5A 3ZU7A 1Q24A 3P7BA 2VX1A 1VR2A 1QPDA 5I9VA 3PVBA 2YIRA 2W1GA 3QLFA 4IX5A 4YTCA 5K0XA 3FBVA 5HLWA 4YBKA 4BI2A 4JXFA 5ITAA 5EQPA 3QCQA 3A62A 3FZSA 4Z55A 5LVLA 1CKIA 5GZ8A 3F69A 3ROCA 5M06A 5JFSA 3RWQA 3R8PA 2PHKA 3CCNA 4F9YA 5CSHA 2P2HA 3TM0A 4BCIA 5CVHA 5IISA 2NYAA 2ZV8A 3EKNA 3RALA 4ANQA 3ZZWA 3OUKA 4LMNA 2W1EA 4GJ2A 4UN0C 4E4XA 5LVPA 3JS2A 4GFOA 4RX8A 2KULA 4U81A 5AV0A 5DWRA 4F7LA 3EN9A 1ZZ2A 4FV7A 2HW6A 4H3BA 4QYEA 4BRXA 3NUSA 4QO9A 3SQQA 3TXOA 4TYJA 3EN6A 3DDQA 2OJGA 4FSWA 3PY0A 4CXAA 5M55A 4YJUA 3I4BA 3MVJA 2EB3A 2YCRA 3VBQA 4QTBA 3G9NA 5IH4A 3UZRA 5FRIA 4H3PA 3VBXA 4IDVA 3DAKA 4FBXA 3WF6A 5EHOA 1XH4A 2XKFA 1OITA 4FZDB 4XLVA 5EW9A 3EN7A 3VUTA 5CF5A 2E9PA 3HVCA 2ETKA 3G2FA 2WQBA 4Q2AA 2QKWB 2V55A 2X7GA 3FMJA 3SLSA 4QNAA 4L00A 3QD0A 2WO6A 2NNWB 3ID6C 3N9XA 2ITQA 5EM5A 2X8EA 2IZTA 5K0KA 3O23A 4ACGA 4AXDA 3E8DA 5CU6A 5C4LA 3ROYA 3AT3A 3C1XA 3ZFXA 3FI3A 3WZJA 2YWPA 4EH3A 3SG8A 4M13A 2ITPA 2Y0AA 2YAKA 5KHXA 3PJCA 3WARA 4TYIA 4E5WA 5AMNA 1LEWA 3MYGA 3QTZA 4G6OA 2JBOA 3WF7A 3VVHA 5KMJA 3D4QA 5EYMA 2Z2WA 3A2CA 4EOKA 3EQGA 3KC3A 5JGBA 4QMVA 3TN8A 3F2NA 4YO6A 2QR7A 4WHZA 4IFGA 4HCVA 5HTCA 2Q0NA 2V5QA 2WTVA 4FV9A 2VWXA 4PF4A 4C57A 3RK9A 4RJ3A 4UMQA 1OKVA 5H3QA 4Z7GA 3CBLA 1XMMA 3GCQA 1ZOHA 2VWWA 2B9FA 2C6KA 2CNQA 1NVQA 2YN8A 3ZYAA 4YZ9A 4BDCA 1PHKA 1W84A 2R3LA 4ZJVA 3OZ6A 4P7EA 5K9IA 3UPZA 4XOZA 4FKJA 4A06A 4O7TA 4U0IA 4BDGA 3COKA 3DZQA 3EOCA 3WYYA 5D11A 4WBBB 3PJ1A 3NAXA 4FSNA 3UO6A 3ML1A 3EL7A 4XCUA 4HOKA 2RGPA 3RAKA 5BYYA 3DPKA 5KNJA 3RCJA 2ZM4A 3KL8A 4XV9A 4R8QA 5AAEA 1NW1A 2RF9A 5TOZA 4MX9A 1XH7A 1OBGA 2VTJA 4O1PA 3PA3A 4BY9E 4K33A 3S00A 4FGBA 2JDVA 2GQRA 3W0PA 3AMBA 1BLXA 4JDKA 4C4EA 1PXLA 4EWHA 3BKBA 4BZDA 5D7AA 5AUTA 2QC6A 3QZGA 3H0ZA 3TKIA 1JAMA 2ITWA 4XH6A 5EYKA 5CAVA 3NIZA 4A9SA 3LCKA 3HA8A 4IB1A 4F7NA 1DI8A 4MAOA 4ZSAA 1PKGA 5TO8A 3KREA 2QOBA 3BE2A 3FLNC 4LV5A 2WMRA 2WQOA 3KXHA 2IZSA 4C3PA 4TY1A 1W2CA 2QOCA 5CU2A 4DT8A 4NFMA 2W1FA 4XJ0A 2XJ1A 1Q5KA 3ZXTA 2FA2A 4JOAA 4RWLA 3RINA 4BBEA 3A7IA 4CFMA 4KBAA 5AR3A 5CSPA 3JVSA 4CQEA 5A46A 4V05A 5FLFA 3B8RA 2QQ7A 1YI6A 3SXRA 4BFMA 4GK2A 4YZBA 4H1MA 1W0XC 3ULIA 5E4HA 5ANEA 5JK3A 3FSKA 4BDIA 4ZS4A 2CCIA 3OF0A 5HLNA 2YITA 3R01A 3W55A 4BTMA 3P5KA 4CSVA 2HXLA 4DDGA 4JT3A 3R2YA 1R39A 2G9XA 4KIKA 4BCMA 3Q53A 1XR1A 5AUZA 1PF8A 2BFXA 4J71A 4KWPA 4BGQA 5DPVA 3Q9ZA 2PE1A 4FKOA 4FYOA 3MJ2A 5LJJA 3QTWA 4D55A 3DLSA 2UZDA 4FSQA 5AP3A 3DAJA 3MVHA 2XNGA 4I4FA 1PMEA 4YZDA 5E7RA 4AGUA 1QPEA 4B4LA 4RQKA 3LFEA 4L46A 3WF9A 2BZHB 3GGFA 2X9FA 4MD8E 3OTVA 3EH9A 5BVEA 4FV8A 4D4YA 4HVDA 3UODA 2BDWA 3ZS5A 1IA8A 3FLQA 2QG7A 2YA9A 4QMLA 3NVKI 4O0SA 3HECA 3DU8A 3DBEA 1K9AA 2IVTA 3QHRA 2W0JA 4MXCA 2C30A 1PYXA 1P14A 4TKSA 3ZC5A 1TKIA 5IA5A 1CM8A 3VN9A 3COHA 4IANA 4QTCA 2YLFA 4OTRA 2CGUA 2OO8X 2ZMCA 5FXQA 3BYVA 2X8IA 1YXTA 4OTHA 1M7NA 3LHJA 3O7LD 3PSBA 2OW3A 4YNEA 5HE2A 3RWPA 3V5JA 4XS2A 3M42A 4U3ZA 4BGGA 5I9YA 4QQJA 1RE8A 1RDQE 1U4DA 2XM9A 4WG3A 3RBWA 3RM7A 2EXEA 2YDKA 2GTMA 4FTIA 3VF8A 5AR4A 4QP1A 3UVQA 1L8TA 3FXXA 4R7HA 3ODZX 3NDMA 5JZNA 2J0LA 4C02A 3W2CA 5JZJA 3Q5IA 4IX4A 1H1SA 4YC6A 3EFKA 2Q83A 4RC2A 3JUHA 2J2IB 5KMMA 5FG8A 1W2DA 3H10A 1H0VA 5EKNA 4IADA 4XG7A 5IQAA 2ZV9A 3GCUA 3MA3A 3QKLA 3U8WA 2BPMA 4ENXA 1Q3WA 2QKRA 4ZTMA 4U45A 3FPQA 3AT4A 4XV2A 3ZRMA 3I7BA 2OJFE 4GMYA 1VZOA 3D83A 2OF2A 5IKWA 4PDPA 3LXPA 4DFNA 2PUIA 3FZPA 4RA5A 2WMWA 4QTAA 5FP5A 3IW4A 4FTRA 2B52A 2R3RA 3UMXA 3UYTA 4C61A 3W16A 4L53A 2CKQA 2ZJWA 4ITIA 1K3AA 3E92A 4WG4A 1NXKA 1H1WA 4WNKA 1ZYSA 2PZ5A 4DEBA 5CF6A 2WHBA 5L3AA 4X6QC 5JRQA 1OL5A 5GIPE 3MV5A 4N6YA 3II5A 2CNUA 2QOQA 3TKUA 1JSUA 2JDTA 3QRIA 4AFEA 3QAME 2XK7A 3E8NA 2R3OA 3C4WA 4IAKA 4C4JA 3TUBA 3TEIA 3QXOA 2BRMA 3OT3A 5KBQA 2W4OA 2PVYA 3VQUA 4NIFA 1YOJA 4CGAA 2C68A 3QCYA 4GVAA 4U3YA 1KE9A 4JR7A 4GG5A 4KNBA 3E8EA 1H1PA 3P9JA 3EHAA 5DIAA 5LWMA 5GZAA 2B9JA 3W0RA 2C5OA 3TUCA 3KK8A 1PXKA 4EI4A 5EDPA 3R9NA 4LGGA 3ANQA 2WTWA 1R3CA 5LVOA 2HWOA 4A9TA 2GCDA 3FYKX 4F9AA 1Q99A 3NUNA 3MESA 4HCUA 3E3PA 3QA0A 3OROA 5BVFA 1BI8A 4V0GB 2ITXA 3AXWA 4RVKA 5BMMA 5AV4A 2ZFYA 3RPSA 3HV4A 3CY3A 4KIQA 3HP5A 3F5XA 2XB7A 5J87A 4K8AA 5BX0A 2OIQA 5H8EA 2YM3A 2QO2A 4M12A 4CFVA 4ERWA 4FJVA 3T8OA 3T3UA 3BU3A 4FTLA 4JAIA 5A6NA 4FTQA 4DHZA 1WVXA 2P4IA 3IKAA 4D2VA 3HUBA 3VS3A 2R3GA 4MQ1A 5LQFA 5BMSA 3F6XA 4GRBA 5AUVA 1I09A 3D14A 5E8SA 4NFNA 1V0BA 3Q96A 1P2AA 2VO6A 2CCHA 4RC3A 3EB0A 4WIHA 4DFZE 4PV0A 4FNWA 2PE0A 2XK4A 3D15A 3F2AA 3L8SA 4PMTA 5HVKA 4O0WA 5CEIA 3VHKA 4Z3VA 1Q41A 2VWVA 3UIUA 4I5HA 3PJ8A 4BCPA 5CU0A 4ERKA 1REKA 4EOJA 5BV3A 3EL8A 4NM5A 4NW5A 1CDKA 1UKHA 4JDIA 2UW4A 2J0MB 3DNDA 1O9UA 5A4QA 3FMHA 3PRIA 4G9RA 4J8MA 4G31A 5HIDA 4OTQA 4GKHA 3EFWA 4XUFA 5EI6A 5HZNA 3MY5A 3NNXA 1OIQA 3O17A 4IXPA 4KKEA 4LOQA 4S2ZA 4AT5A 1TZDA 4EOLA 4YUQA 3ZLWA 3DXNA 5DRDA 1STCE 1FGIA 2Z8CA 3OC1A 1P5EA 2UZTA 4YHJA 5DT3A 3D94A 3JVRA 4L9IA 5EW8A 5AX9A 4DF3A 3LJ2A 3I60A 3RGFA 4AQKA 4DGLC 4KINA 2UW0A 4YC3A 3QGWA 4U6RA 3IW5A 2XCKA 4KKHA 4MNFA 2OJJA 4W9WA 1M2QA 2GQSA 1YOMA 1PRYA 5ANOA 3VJNA 3R02A 2WFYA 3VF9A 4C2WA 4FE2A 4FK3A 4DLJA 4CKRA 4GS6A 4AFJA 2YM8A 1WAKA 1VYZA 4FODA 4RJ4A 3BZ3A 1PYEA 4YJQA 3BV3A 5CZIA 2XNPA 3OBGA 4JS8A 2A98A 2PVNA 3SAYA 4E6CA 1ZLTA 3F3VA 4UEUA 3FZTA 2YCQA 5J1VA 3R0TA 2YAAA 2WIHA 3FXZA 3RAHA 4K1BA 1IG1A 3V8WA 4DG3E 4D2SA 1P4OA 4YJVA 3PXKA 5DR6A 4ANLA 3QQFA 4IB0A 4NTTA 4C35A 2F7EE 3CY2A 3GCVA 4JG6A 4TYEA 5CZHA 4EZ3A 4DA5A 5FTGA 2VO7A 3UP2A 5GHVA 3NAYA 3OD6X 3LXNA 4IHPA 2QONA 1PXNA 1ZMUA 4NYEA 1LP4A 3A7HA 4K0YA 3CS9A 2C47A 2JIUA 1W83A 2O3PA 4DTBA 3MPMA 5EYDA 5CAOA 4MK0A 1XWSA 4JBQA 3W2QA 3KMMA 2WKMA 4LM5A 4UYNA 3PPZA 3BQCA 3BBWA 4QOXA 4QQCA 4C4FA 2XNNA 2OWBA 5IQGA 3PXYA 2W05A 4EH8A 3NVMB 3DNEA 4CLJA 5CANA 1PW2A 4F0FA 5C1QB 3LJ0A 4O84A 2C5NA 2QOOA 3TL8A 3MIAA 5CAPA 2ZM1A 5CASA 1M14A 4P90A 1HCKA 2C5YA 4L6QA 4R7IA 2XEZA 4WUAA 4RVMA 4UWYA 4CV9A 3F2RA 5BYLA 4FIGA 4CFUA 2WMVA 1ZARA 4AE6A 2OZAB 4RA4A 4JQEA 5AAGA 2NRUA 4ANSA 1OM1A 3SW7A 2EB2A 3F3ZA 1R0EA 4IH8A 3F9NA 3RAWA 1PMUA 5F95A 3PUPA 4ASXA 1XH5A 4GIHA 4HYSA 3QD2B 2X1NA 3EN5A 3OS3A 2F7ZE 4BVUA 4O0YA 3NCZA 5HESA 5JSMA 5B0XA 3PVGA 3EJ1A 4HCTA 3CIKA 1OKWA 4KS8A 2AEGA 4GT5A 4Y95A 1YQJA 3OHTA 3LJ1A 4FX3A 3WIGA 2VN9A 1G8JA 5EDRA 3RM6A 4JG7A 3L1SA 5AM7A 3W2OA 4DYMA 3VRZA 4ZLOA 2WEVA 2CSNA 2XIYA 2UW6A 5DT0A 2VU3A 1T45A 4RIXA 2W9ZB 5KMIA 2YWVA 1B38A 2Y6MA 4GIIA 3F3UA 3BEGA 4JDJA 4JIKA 4UZHA 4WUNA 4O7YA 4FTAA 5AUWA 4BR3A 3D7TB 4AXCA 3KEXA 5FDXA 3ZUVA 3W0QA 2P2IA 4LFIA 4GKIA 3WIKA 5CALA 1QCFA 3HA6A 4EH7A 3AGMA 5IA1A 3ZFMA 4BKJA 3QC9A 3EIDA 3SKCA 3LQ8A 2R3JA 1W98A 3SDJA 4AW2A 2GSFA 3DFAA 3RZBA 3QRJA 5LMKC 3MIYA 5HU9A 5AV1A 2YM4A 4O96A 3HDMA 1PMNA 2W96B 4FV2A 3NYVA 3PZHA 5FTQA 4FSUA 2ETRA 2JAVA 3FKOA 3SRVA 4BF2A 2GFSA 5KHWA 2FSLX 4ALUA 1CSNA 3KK9A 4TWCA 4DGMA 3U55A 3DQWA 3OWPA 4U40A 3UIMA 4HJOA 5DEYA 1BL7A 4C2VA 3EFLA 4GU9A 4IM0A 2WMTA 4ZTLA 3JY9A 4TW9A 2RFDA 1SVGA 4FC0A 3OWKA 2O65A 5BUIA 3UNKA 3LLAA 4ZZOA 2UVZA 1QL6A 3MH0A 4Y8DA 4RIYB 4FI1A 3VS5A 1BYGA 3ORPA 4PUZA 3SD0A 4Y85A 1XQZA 5E90A 2WTKB 3AG9A 3LQ5A 5KKRC 4F99A 3GC8A 3QBNA 4I92A 4JBVA 4DCAA 5HOAA 4QYYA 4AZVA 1V0PA 4DHFA 4C37A 5JMSA 5KMKA 3KU2A 3N4TA 5A54A 4GVJA 1H27A 5IH5A 5M56A 3ZDUA 3DB6A 4QD6A 2VWUA 2VTRA 4QP2A 5L6WL 5C8MA 5T6KA 3FZRA 3F82A 2Z7SA 5AEPA 5KO1A 5IMEA 1JNKA 2XH5A 5JH6A 4QP8A 3LOKA 1ND4A 4CKIA 3S1HA 4QMQA 5DE2A 5ANIA 4FEWA 4QQTA 4O6EA 4OTPA 5M57A 3WBLA 1Y6AA 4NM0A 4ASEA 4BDBA 4QDEA 2BALA 3DXQA 4APPA 4I6BA 5BYZA 3AC3A 2OJIA 4TYGA 4LV7A 3R8ZA 4QMYA 3BYMA 3DY7A 1KSWA 1BKXA 1SZMA 3O8TA 5C4KA 2ZOQA 3KY2A 2X6EA 3RZFA 4AZFA 4PMSA 1JVPP 5CY3A 4PPCA 4JR3A 3EQIA 1ZOGA 5JGAA 2OIBA 3TYKA 2BR1A 3OMVA 2V0DA 2XIRA 3ET7A 3NUXA 4IJ9A 3DTWA 3IECA 4JL9A 2OH4A 5EDQA 4M84A 3UG1A 2Z7RA 2PULA 4HVIA 4WRGA 5IUIA 4NTSA 4ZSGA 4AX8A 4E26A 4JQ8A 3VJOA 4ZP5A 5I0BA 3AKJA 5DT4A 3ELJA 3W8QA 4EOIA 4NU1A 5DH3A 5M08A 2BILB 4MXZA 3VUDA 5IQEA 4DC2A 2Z7LA 3IDPA 3RK7A 3Q32A 1G3NA 4IB5A 4MH7A 4EUTA 1NT2A 4BWPA 5BUEA 2RKUA 2J90A 3EQRA 3MH1A 2HZ0A 1OVEA 2X2MA 3MW1A 4IM3A 4NL0A 4D1SA 5CEQA 3LAUA 2BRHA 3K54A 3LM0A 4L68A 3ZSGA 3ZXZA 2VV9A 2RFSA 2WZJA 1U59A 3NNVA 5J95A 4EH4A 2R64A 2IEWA 3BEAA 4PTCA 4FEXA 2DUVA 3A7FA 4HPTE 3Q60A 4AOJA 3AKKA 4FR4A 4LV8A 3Q04A 4LG4A 3PYYA 5E8XA 3HKOA 3BV2A 5KUPA 4XV3A 4PDYA 3ZM4A 3W0SA 3KRLA 2WU6A 1J91A 2XKCA 2W99B 4YBJA 3V51A 1CKJA 3ANRA 2XNMA 3NUYA 5IH6A 4YJTA 1GIIA 3GFEA 3MPAA 4Y83A 5E92A 1AD5A 3HMOA 3UDBA 3LFSA 1SMHA 2Y8OA 2R7BA 1UA2A 5HD7A 3R8VA 3TZ8A 2E2BA 3BELA 3PIZA 1BMKA 1J1CA 3BHUA 3Q4CA 5A3XA 4G3CA 1F0QA 4EYJA 3Q2JA 2X0GA 1WBPA 2YDJA 2WEIA 4I24A 4IX6A 4EL9A 4JG8A 2HZ4A 3GOKA 2OXYA 5ACBC 3WF5A 5A4TA 4RWJA 1H4LA 2SRCA 4OTDA 5HVYA 2G2HA 4QTEA 3ITZA 5DGZA 4RPVA 3TWJA 5CU4A 4DGGA 1FVRA 4CFWA 4XG3A 4X6RA 4AZSA 5HCXA 4F7JA 5IA3A 2RG5A 3ZOSA 5J5TA 4M66A 4IAIA 4BBFA 4TL0A 4M69A 4BDJA 3P86A 1XJDA 4K18A 5TT7A 3OP5A 3TV6A 2J51A 3GP0A 3O8UA 3BYOA 3LCSA 4GT3A 3DKOA 4Q9SA 4WT6A 3UG2A 4NM7A 4PDSA 4WA9A 2REIA 3C13A 2F2CB 2UZLA 3IDBA 2ONLC 4IVDA 2FO0A 2UZNA 3CEKA 3LCOA 1KV1A 4N6ZA 4A4LA 3BL7A 2UUEA 4EORA 2OZOA 4NCTC 4O6LA 5ETCA 1OKYA 4ENYA 1OL7A 3FL4A 4JLCA 1O6YA 3HV3A 2CHLA 3CGOA 3FLWA 3OT8A 4TWOA 4W4XA 4UMRA 2YERA 5FQDC 2OXXA 2PU8A 3AKLA 1GNGA 2HAKA 4YJSA 3R71A 2HW7A 4IZ5A 4RX7A 3UO5A 4E93A 4O38A 5HTIA 1ZY4A 3MPTA 2WTIA 3ETAA 3MBLA 5CSVA 3NEWA 4IWOA 3H9RA 4CMTA 4CG8A 5IUGA 1JKLA 4F6UA 5FUTA 2O5KA 2HY81 2DS1A 2VTTA 2BVAA 3OFMA 2B7AA 4MEDA 4QT1A 3RAIA 2V62A 4FVPA 2X2KA 3KF4A 5EG3A 5HE0A 1S9JA 3PVWA 4IVAA 5T68A 2AQXA 4J53A 3M2WA 4W9XA 3ACJA 1G5SA 3KQ7A 3GU4A 5EHYA 3SC1A 3PWYA 4DH7A 1O6KA 3FXWA 1H1RA 5HX8A 4ZOGA 4ZK5A 5M51A 4FRFA 3R1YA 4FVQA 3S2PA 4F1OA 4ZY5A 3RMFA 4FT9A 4FKLA 3RHKA 4XP0A 4L3JA 1L3RE 4FV5A 4I0SA 1G8KA 4MQ2A 3B2WA 5J7HA 3CR0A 3Q5ZA 2WU7A 3QX4A 2IW9A 2ITNA 2G01A 2BDJA 2C6TA 3GCPA 4D1XA 3C4FA 4E6DA 2PWLA 4BHZA 2I0EA 2V7OA 4GK3A 2PVKA 4YLJA 3QTXA 2PZIA 3KULA 5CX9A 3V5PA 2EU9A 3AGLA 3HV7A 4FMQA 4CNHA 4W4VA 4NWMA 3R1NA 3VS7A 4N70A 4ZXTA 2BHHA 4L8MA 2WOUA 5HCYA 4C62A 3PFQA 5IU2A 3LPBA 1Y8YA 3PSDA 4BCFA 4P5ZA 3A8WA 1PJKA 1H24A 5C8NA 4X3FA 4F65A 3LXLA 3S3IA 3LQ3A 3RVGA 4FTTA 2A19B 3P7AA 1ZAOA 2BIYA 3V8TA 4D4SA 4ASDA 5IQDA 4D9UA 3HMPA 2QHNA 3O51A 3GEQA 4FVRA 4WNOA 4RJ7A 5FD2A 4Z16A 1OGYA 3UTOA 3CD3A 1ST4A 4ALVA 2WQMA 3F5GA 5HBEA 4E6QA 2VTQA 1DAWA 1Q8ZA 1WCCA 5ANKA 1UNLA 3QC4A 4F63A 4Q9ZA 3MFTA 1DAYA 4BBMA 3UDTA 2GNHA 3NWWA 3CKWA 4YJOA 1J7IA 1BL6A 2WQNA 4ZAUA 3PIXA 4WKQA 4CG9A 1KOAA 4EHEA 2X7OA 2I6LA 4IEBA 2QCSA 3ZDIA 5HHWA 1M2PA 4I21A 4YSMA 3K3IA 3VBVA 4ALWA 2ZB0A 4XP3A 3F7ZA 5D7VA 4ZTQA 3UQGA 4NSTA 3L8PA 4A07A 3NW6A 4IM2A 2XRUA 3H0YA 3GU8A 3NIEA 3ENHA 4RJ5A 4XG9A 3UIXA 5FP6A 3LCTA 3FHIA 4BN1A 2PPQA 2G2IA 4G5JA 4BI0A 2UW5A 4DFLA 4RX5A 2VTSA 2VTPA 3KKVA 3P7CA 4AW0A 4E1ZA 2H6DA 4FT7A 4IDTA 4HVSA 4AGCA 3ZH8A 5ETFA 4C38A 2CN5A 3WZDA 5M4IA 4J96A 4DGOA 4Y46A 1GAGA 3BE9A 5C8KA 4HGTA 3LFBA 5HQ0A 4KIKB 2OF4A 3TG1A 5EHLA 1K2PA 1G8AA 2QO7A 2R3KA 4M14A 3NUAA 2EVAA 4G6LA 1PXJA 2R5TA 5BVWA 2XAOA 3FAAA 3QTIA 4EOMA 3NNUA 4HGSA 4I93A 3WE4A 4U8ZA 2ITUA 5K5NA 4EZ5A 4L52A 4YJNA 3ZEPA 4PMMA 5EH0A 2C0TA 4D4VA 3FPMA 2R3IA 4U43A 1KE5A 2X39A 2QOLA 4IMYA 3RNIA 3UVPA 4DITA 4C3FA 4MF1A 5DR2A 3PRFA 4AGWA 3Q3BA 3MY0A 4FTNA 4O0VA 3KRWA 3HAMA 1TVOA 3A60A 2VTHA 5HICA 3UC4A 4MUQA 4HGEA 2ZAZA 3DJ7A 4O7NA 3N51A 4I6HA 2JGZA 3TZ9A 3QZIA 4D2RA 4S32A 4EQMA 5TF9A 4X2GA 3WYXA 2X4FA 4GSBA 4K11A 3IGOA 3HMIA 4QP3A 2C5VA 3I1AA 1UWJA 5I9UA 3PXRA 4Z9LA 4F0IA 3SOAA 3T9IA 2J0IA 1LEZA 5J9ZA 4O0TA 5E9EA 3TNPC 1BUHA 5J1WA 5L2QA 3TIYA 5KCVA 4FL1A 3UOLA 4D5HA 2WD1A 2C6MA 3QTSA 4Q5EA 4XBUA 4XP2A 2OU7A 3TNHA 3PPJA 3K5UA 2VGPA 5HCZA 4KKGA 3GCSA 3HRBA 1KE8A 2GPHA 3KFAA 4JJRA 1PXOA 3KRRA 3DTCA 4FSYA 4OTIA 4QTDA 3E7OA 2FUMA 2NO3A 2UVXA 5JRSA 3AT2A 4RWKA 4DEGA 5HBJA 2BFYA 2I0VA 2XNBA 4USEA 4UX9A 2WIPA 3DV3A 3JYAA 2GDOA 3PIYA 1RW8A 3I81A 4FKPA 2CKPA 3PZEA 3VNTA 3ZC6A 1YXSA 3EFJA 2OKRA 2IW6A 3CQUA 3HEGA 4ZIMA 3R7YA 4IQ6A 4X3JA 2HOGA 3R9DA 4ZTRA 2YEXA 4MXYA 3S95A 2I7QA 5D12A 4ACHA 4YO4A 3IPHA 2PSQA 1KE6A 2IVSA 4YZCA 1OIRA 4X2JA 3MI9A 3HL7A 5F94A 2GFCA 4EH6A 2X8DA 4BCKA 5HNIX 3BI6A 5JKGA 3BLQA 3QU0A 4M0YA 1ZOEA 2OFVA 1GY3A 2BRNA 4D1ZA 4XG2A 4DH3A 4WNPA 4FK6A 4RZVA 4MXXA 4J95A 4F0GA 4RX9A 2IWIA 3DK7A 2BAQA 3MB6A 3RPRA 5CYIA 5KMNA 1ZMVA 1T46A 5CLPA 2X9EA 3EN4A 1YWVA 3CXWA 3U6JA 2OXDA 4I3ZA 3ODYX 1OGUA 3ZEWA 4U97A 4ANOA 3SW4A 5DLSA 5LVMA 4N57A 4O7SA 2C3KA 4DT9A 1F5QA 3KXGA 5CNNA 1UVRA 2XZSA 3FMNA 3G0FA 5FGKA 2JIIA 3BU6A 4IZAA 5CXZA 2V22A 3BCEA 5CQUA 4NIFB 5AP5A 2J5FA 5HIEA 3V5TA 4AP7A 5F9EA 1SVEA 4M68A 4RVLA 4AA5A 4EJ7A 1ZYCA 2C69A 5EM8A 2GS7A 2ZDUA 5C01A 4XOYA 4UMPA 4TYHA 4II5A 3O0GA 5JFWA 5IEVA 3UDSA 4W4WA 5AIKA 3CPBA 1UKIA 4YP8A 4FV6A 3P08A 3DA6A 3EQPA 2BZKB 3L8XA 5A4LA 1V0OA 1RQQA 3Q4UA 3E87A 3BHVA 4JX7A 4FV3A 4M7IA 4JIAA 3VS0A 2WMXA 4FL3A 4NZWB 5CNOA 5H8BA 5AA8A 2B4SB 5FBNC 5L2TA 1ZRZA 4QNYA 3RPVA 3H3CA 2C3LA 2JAMA 2BUJA 2XUUA 3EZVA 2BROA 2H96A 5D41A 2J9MA 4A7CA 1FVVA 1Y57A 3UMWA 1PY5A 2ZB1A 3PPKA 3LMIA 5LCKA 1ZMWA 4BGHA 3ORKA 3T3VA 5IQIA 3FLZA 3BWFA 2A1AB 4I94A 2YCFA 3NR9A 3IS5A 2OG8A 2UW7A 3HDNA 3OW3A 5M09A 3IK3A 5EOBA 5HVJA 5J79A 3MVMA 1YXXA 3V8SA 4UV0A 2CGVA 3H30A 3PLSA 5HI2A