5BUEA

Erk2 complexed with n-benzylpyridone tetrahydroazaindazole
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
348
structure length
329
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVATRWYRAPEIMLNTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Ligand efficient tetrahydro-pyrazolopyridines as inhibitors of ERK2 kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 109
structure length 329
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bueA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bueA01
2YCQA 2GS6A 3Q52A 4MK0A 2ERZE 5FGKA 3V04A 2WTWA 2BR1A 3B8RA 4BDCA 4Z55A 2QO9A 3SG9A 1JQHA 4AXAA 4RSSA 2ITTA 3UOJA 4IVDA 2G2IA 1KSWA 2FO0A 4D5KA 4U0IA 5DEWA 2R3NA 2HELA 1Z5MA 2B52A 4I0TA 4MXAA 3FLSA 5CF5A 4C35A 4L7SA 3AT3A 4NKAA 3F82A 2B1PA 3ZYAA 5EQEA 1KUTA 4RFMA 4G17A 4OT5A 4ZTQA 5BYZA 4P2KA 2HY81 4DGOA 2HZ0A 5KMMA 5A4EA 4ACGA 2VTTA 4ZTMA 3OWLA 5AR3A 3ULZA 2QO2A 3FMNA 4PRJA 2C3IB 5DRDA 3DK3A 5B7VA 1NXKA 3IECA 5IUIA 4IWOA 4IC8A 4AZWA 3CXWA 4FV0A 3D0EA 4PPAA 4ACHA 1URWA 4Q9SA 1U54B 3BE2A 3DKCA 3W2RA 2X7FA 3Q9YA 3BI6A 1XO2B 1KE8A 3PJ2A 4Y5HA 3R7YA 5FD2A 5HBJA 5JFXA 4DH3A 4A9RA 5JK3A 1WBSA 4HZRA 2ZDTA 3W2CA 1YOMA 1GZ8A 2YWPA 4KIOA 3P4KA 4RGJA 1JSUA 3RK5A 4FNZA 4W4YA 5F95A 1BYGA 3P23A 5HVJA 4MH7A 1VYZA 3B2WA 3GCPA 3NYNA 5ACKA 4U43A 3VRYA 2DS1A 5HIDA 3TV6A 4F08A 1OKVA 2ITUA 4AF3A 1YI3A 4EOPA 5ANKA 2J5EA 3D2KA 5ANDA 2X2LA 3UO5A 4GFGA 5HU9A 3QA8A 2WOTA 3P7BA 4QMYA 5J9ZA 3R9RA 3DKOA 3PIZA 2W1CA 3NUAA 4M84A 2HCKA 4D2WA 3LKMA 1IA8A 4QP8A 4YZCA 3SV0A 5ANIA 4KBCA 5T3QA 3ZDUA 4AE6A 2CJMA 3G5DA 2GTMA 3NDMA 3M11A 3E3BX 2Q83A 4V0GA 4UMQA 4BBMA 4AP7A 2R4BA 3NYVA 2QHMA 4H3PA 1KOBA 4G34A 1MRUA 2HWOA 4L3LA 3KCKA 4C59A 3CE3A 2W17A 3CY3A 5E8SA 2UVXA 3QBNA 3I60A 2W0JA 4PL4A 2R3MA 4I3ZA 3MH3A 2BRNA 3ZOSA 4E20A 2QLUA 4E93A 4NH1A 4RX7A 4RVLA 1CSNA 1WVXA 4FG7A 4F9YA 3BBTB 3VW6A 1Q3DA 3K54A 5ICPA 3Q04A 2GNLA 2JLDA 5FBNC 3CSVA 5IPJA 3TZMA 4KD1A 4K18A 1M2QA 4CMOA 4K9YA 3F61A 3TNQB 4DG3E 3TIZA 2PY3A 1FMOE 4FKLA 4L52A 4CD0A 2G01A 3ROCA 4IHPA 3ZM9A 3Q2JA 3G6GA 3P1AA 3VS2A 1BX6A 2YN8A 5HZNA 5L3AA 4BTMA 2FGIA 3D7TA 3QQGA 3O7LB 5JGAA 3UQCA 1HCLA 4PDSA 3PPZA 4KINA 3ZTXA 4LMUA 4FK6A 2XIKA 2FA2A 2IZTA 2BZIB 4D55A 2WIPA 4Y5QA 3ORKA 1DM2A 1YOLA 5HE2A 5IA0A 3HX4A 3PVUA 4ZY5A 2QNJA 4AGUA 1T46A 5K0KA 3VHEA 5M51A 1IR3A 3F3ZA 3GOPA 5CT0A 5C1QB 5B2MA 3W2QA 4H39A 2R3FA 4E4MA 5HQ0A 4R3RA 4AU8A 3UP2A 5I3OA 4DTBA 2VU3A 3AD6A 1H1PA 3EQDA 3OG7A 5HNBA 5FTGA 3ORLA 4AOJA 4X2KA 3OS3A 4D58A 3QTUA 3TDVA 4PPBA 4DBXA 4E26A 4QYGA 2FSOX 3PA4A 4EQMA 4QQ5A 4O7LA 4MBJA 1QMZA 5CENA 2C69A 3GU5A 4USDA 4EOIA 4I24A 4JAJA 4XV9A 3NYXA 4EYJA 2PYWA 3WZEA 4ANQA 3FV8A 2R2PA 1CM8A 3QYZA 3V8TA 1NW1A 4I5MA 2F2UA 4AG8A 3RP9A 3WBLA 4EUUA 3AMBA 3VQHA 4FMQA 3T9TA 3NS9A 2FVDA 4QTAA 4L3JA 2DQ7X 4DG2E 1M2RA 3FYKX 5JRSA 3EQIA 3AMYA 3AMAA 2YZAA 3PRFA 2PMNX 2VN9A 2YIYA 3LJ2A 4OTQA 2JKMA 2O2UA 4BGGA 1XHAA 3R83A 4D1XA 5LMKC 3BRBA 2BAJA 3LXKA 3ZRKA 4FEUA 2XH5A 3LFFA 5KMLA 3KEXA 3EZVA 5EM7A 4GL9A 4D9UA 3LMGA 4YHJA 4YO6A 1YDSE 5CEPA 3FY2A 5M4FA 4ASDA 4JIKA 4U8ZA 2P55A 5LVLA 4NUSA 2YM8A 3D83A 4BTJA 2PVFA 1BL6A 4NTSA 4C0TA 4CEGA 4DLJA 5HTCA 2XBJA 4G5PA 1EH4A 4BGQA 2BFYA 5J95A 3MPAA 5FWKK 5AUXA 3TIYA 4TWCA 3MJ1A 3UPXA 1HOWA 5IEYA 3S4QA 4K8AA 3AC2A 2UW0A 4QMZA 3VNTA 4M69A 5AV3A 2AC3A 3KMUA 1OI9A 5IISA 5A4TA 3TI1A 3RJCA 3ET7A 5LMAA 3IW8A 4RJ3A 4XNEA 1E1VA 4FZ7A 5HBHA 3WF6A 4E1ZA 2ETMA 4EWHA 5E8VA 3NX8A 2CGUA 5CVFA 5JN2A 5H8BA 4XG2A 3SW4A 4C38A 4DH1A 2JDOA 3AC4A 3FWQA 2CCHA 3ORNA 4O0VA 4MAOA 2W96B 3QCSA 4FEWA 3G6HA 4XLVA 5E8YA 4ZAUA 4RLKA 5HOAA 4YR8A 4DINA 3ORMA 5DBXA 3TT0A 3U51A 1YHSA 2OZOA 4L3PA 5AP1A 5EYMA 4W8DA 2J0LA 2OH0E 3A60A 4C3RA 1GZKA 2PMLX 1B6CB 3DY7A 3F88A 4OLIA 4XYFA 2IVTA 3QALE 4AW0A 5EQYA 2UZTA 3R7VA 4TYGA 2OO8X 1WBOA 3DAEA 4BY9E 4YC6A 2EXMA 4Y95A 2B7AA 4O7ZA 4FT3A 3TEIA 3SKCA 1JNKA 2FUMA 3F6XA 2OJJA 3DT1A 3GI3A 3IONA 1FPUA 2WU7A 3LCDA 1OIRA 3OCSA 3NGAA 1OITA 5IH5A 3S1HA 2XKEA 4DFZE 2Z7RA 2C0IA 2QI8A 3F3WA 4RQKA 4NM3A 1WMKA 4YZ9A 4BDGA 5D11A 5AP3A 1H4LA 4DEAA 3HMPA 1R0EA 3GCUA 1OMWA 3HP2A 3LCSA 4KB8A 4JBPA 4UY9A 4L01A 5JZNA 2A0CX 3UVPA 1FVTA 1REJA 2F7XE 2RSVA 4AWIA 4U45A 4TYEA 4EH3A 3ID6C 2EWAA 4BKJA 1YRPA 3MVHA 5EK7A 3CTQA 1DI8A 3RNIA 1UVRA 3U54A 1R39A 5FXSA 3O71A 4GK4A 3TZ8A 5C4LA 1JKLA 1H27A 5D1JA 5HD4A 3CPCA 3MY1A 4UEUA 3ORIA 2A4LA 4P90A 5D7VA 3TN8A 4TL0A 3G15A 2VO0A 2QOCA 4Q9ZA 4G6LA 2JITA 4DF3A 3I6WA 3W8LA 2UZDA 4C61A 2VV9A 2XM8A 3UOLA 4ANMA 5CXHA 2X8IA 3LFAA 4BIEA 3G0FA 3PRIA 5BUIA 4BCJA 2XYUA 3DTCA 3F5UA 3KY2A 5CYIA 4UWCA 4FV3A 2C6LA 4MEDA 3BU5A 2XVDA 4E5AX 1J7UA 4GG5A 4HYIA 4HPTE 4F99A 5JEBA 3L8XA 4ZSGA 4YBJA 1R1WA 3RHKA 2PU8A 4RZWA 4D2RA 5EW8A 4CZUA 4PTGA 4UBAA 5L2TA 3QLFA 2OICA 2CKOA 1Q24A 4NIFA 1BI7A 3OBJA 4BCKA 2JKKA 1YXXA 4BDHA 4DGGA 3ULIA 3VF8A 5BUEA 2CLQA 5AP0A 3GCSA 3K5VA 4FK3A 2P4IA 1YDTE 3QXPA 3LFQA 5C27A 3QUEA 1WVYA 3DLZA 2C6KA 3L1SA 3OCTA 4ANBA 5KKRC 3Q9XA 3LZBA 3DJ6A 2C5XA 3QCXA 4J96A 2RG5A 3B8QA 5I9VA 1M52A 2UW4A 1F0QA 4Z16A 4FV5A 3MFRA 4YTIA 4ZY4A 5IA5A 4ITHA 4O0RA 2X2KA 4CCUA 4EZ3A 3IO7A 3AC1A 1MP8A 3TZ7A 2PWLA 2GNFA 5LMKA 2HZNA 3N4TA 3D4QA 4EC9A 4KNBA 4LGHA 3F66A 4WUNA 5EFQA 2OLCA 3CPBA 1NVSA 1WBTA 4NKSA 3PG3A 3TL8A 5AA9A 2XYNA 4GSBA 5LOHA 2CN8A 2YABA 2VO6A 5KHWA 3RPSA 5KMKA 2ETRA 2Z02A 2UW6A 2ZJWA 2UZUE 4AA0A 2R3PA 3O23A 3GBZA 4KSPA 4LGDA 4FYOA 4EK4A 4RWLA 2WQNA 3FLQA 4QMOA 2OSCA 2YWVA 5CU0A 2V7OA 4TWPA 5AV2A 5FQDC 5EDQA 4FVPA 4NCTC 2WELA 5H8EA 3FEGA 4AW2A 5IF1A 2I6LA 2P2IA 5FDPA 2IG7A 1P2AA 3BPRA 2ESMA 3F5PA 2JD5A 4FG9A 4GK3A 3MWUA 1Q4LA 4S30A 5DI1A 4OR5A 3DKGA 4IDTA 3RCJA 2C3JA 2FSLX 3ZO4A 2XIYA 4IADA 1STCE 3NNWA 4FEQA 1B38A 2J6MA 2UZLA 1U4DA 4XX9A 5DE2A 3QD3A 3ATSA 4CG8A 5FLFA 5CI7A 4CG9A 5J1VA 4DG0E 2A19B 2YJSA 4FSYA 2OBJA 2BROA 5IDPA 3MPMA 4M13A 1M7QA 2ITYA 2QU5A 4DEHA 3OXIA 2R3IA 4FSZA 3S0OA 1NY3A 4U6RA 2XIZA 4UV0A 2XF0A 2GQSA 4UMUA 3S00A 4XP2A 2OF4A 5DGZA 4FIEA 5JFWA 3WZUA 2QOFA 2IW8A 3QQHA 4KABA 4EH9A 4UX9A 4II5A 3PLAE 2BMCA 3CKWA 5AX9A 5HLPA 3UC3A 3ENHA 4ENYA 3AT2A 3WILA 4ZIMA 2VWUA 2X7OA 3LJ0A 3LM0A 3HV5A 5CX9A 3PVGA 1OL1A 4F09A 4I94A 2YERA 4N70A 1H08A 5FM3A 4BCGA 4F9WA 3MN3A 3WYYA 3KA0A 4I6BA 4UZDA 4M68A 5IQFA 1UNGA 3O8TA 2VWWA 2YIQA 4CQGA 5HG9A 1WBWA 4O81A 2O65A 4YC3A 2E2BA 3AC5A 5CNOA 5C8MA 3EFKA 4QTEA 5DR2A 1ZRZA 3NUNA 2KULA 4JX7A 2GSFA 1P4OA 2X9EA 3VBXA 3BYVA 2YDKA 5F1ZA 4FL2A 3ZM4A 1OBGA 2ZV7A 3DBFA 4AZTA 5CQUA 2WFYA 3VF9A 2EB3A 3PJ1A 4F70A 4I6HA 1FOTA 3POOA 1URCA 3DB6A 3SXSA 1PYXA 5JQ8A 1ZXEA 3OUKA 3KXXA 4N57A 2YCSA 4G3GA 2A27A 1ZMUA 4FT7A 3VBTA 3TKUA 3MB6A 1FVVA 1PXKA 3ROYA 4A4LA 1YOJA 2OKRA 2YJRA 4O7YA 3F5GA 4QMNA 4CFFA 2J9MA 4FKPA 3W16A 4RX9A 4AACA 1UA2A 3EQRA 4JQ8A 4AE9A 4BYIA 5BVEA 4KSQA 5IG1A 3EQCA 2X39A 2IN6A 1GOLA 3UZRA 3HVCA 3SXRA 5CSPA 1YXUA 2WIHA 3K5UA 4FSUA 1Q8TA 3FPMA 3MYGA 4E4NA 5HLWA 2CNUA 3FAAA 5DOSA 1UKHA 4L6QA 5JQ5A 4FF8A 2F7ZE 4FX3A 4BB4A 2I40A 4DAWA 5HG5A 3LLTA 2BRGA 1WBPA 2WQEA 4RA5A 3HA8A 4FSWA 4AX8A 1U5RA 1H24A 3C0IA 2WMVA 3KXGA 4IB1A 3KK9A 2IPXA 2V7AA 3DFCB 3R04A 1VEBA 4YZMA 5HI2A 3C4WA 3E7OA 3MFTA 2IWIA 4D4SA 5D12A 3TM0A 2NRYA 5HCYA 4UN0C 4F1MA 3HAVA 4CRSA 2DUVA 5J79A 4XRJA 5IU2A 3HYHA 5E8WA 5ETCA 2UW7A 3A2CA 4EL9A 4RJ4A 1P14A 3ERKA 3N4UA 3OOGA 3BLRA 5AWMA 5M07A 5HE0A 2Y8OA 1ZAOA 4HZSA 4ID7A 4XV3A 4KIPA 4RIWB 3U8WA 3SLSA 3PP0A 3W18A 5C03A 3UBDA 3PLSA 1CDKA 2PUIA 3H3CA 5EHLA 4GT3A 4I41A 4Z3VA 3OUNB 3GGFA 4GFOA 4UMTA 5CVGA 5L2SA 1K9AA 1AGWA 4DTAA 2R3GA 4IZAA 3UVRA 5CI6A 3I5ZA 1H1QA 4KKHA 5BVKA 4TTHB 1Q41A 1O6KA 2EB2A 3SRVA 3IW4A 4DFYA 1FMKA 4FV2A 4OBOA 5EYCA 1WCCA 4QYHA 1U5QA 4OUCA 3DZQA 3SOCA 2C3LA 1J7IA 5AFVA 4PP9A 4F0GA 2BRMA 3R9NA 3I7CA 3P7CA 4D2PA 3PA5A 5JFVA 1H8FA 2PVKA 4R7HA 3FL5A 5AUZA 4AOTA 4LRJA 4IX4A 3KC3A 4YMJA 5A4CA 5M08A 4U44A 1RE8A 1GAGA 3R00A 5AUTA 5IEXA 5HTBA 1PKGA 2BHEA 5CAPA 3EN4A 3EOCA 4YNEA 1ZYCA 2GFCA 2UW8A 2WEIA 3R21A 3TTJA 1JKKA 1MQ4A 4HGSA 4UZHA 5DH3A 4UMPA 2GU8A 3IW5A 4PL3A 5CF8A 4QYFA 4X2FA 4LUDA 4RWIA 4P4CA 1YI4A 2HXQA 3SQQA 3VUMA 5CT7A 5AUUA 4XRLA 2VRXA 4O21A 1JSTA 2HZIA 2Z60A 3FKNA 4GFMA 3EN9A 3QRTA 4MWIA 4OTWA 4F1TA 4HVHA 4JVGA 3HV3A 4I92A 4X21A 3QTQA 4O84A 4QYYA 5CXZA 2RGPA 1E9HA 3PY0A 1W7HA 3NNXA 4HCVA 4FODA 3U9CA 3W8QA 3OT8A 3FI2A 2GDOA 3UGCA 4ZTLA 4PMTA 4XH6A 1OIUA 5A4QA 4G16A 4RWKA 1PW2A 2VO3A 1PKDA 3R1QA 4BCPA 3E3PA 4M15A 2JIIA 5AM7A 2B9HA 3OTUA 4JRVA 4IAAA 3ZFYA 3DBEA 4WRSA 3PXKA 2LAVA 1OZ1A 2XK3A 2VX1A 3CIKA 2XIRA 4MD7E 4OTPA 1KE5A 3FI3A 4RWJA 5DT0A 4IX6A 5AP4A 5HBEA 4ACDA 4QTCA 2UZOA 3TUCA 2WKMA 4FNYA 3VUGA 1GZNA 1X8BA 2AUHA 4KA3A 1Q8UA 4ACCA 4C4HA 2W1FA 4CT2A 3BU3A 3COIA 2RF9A 1H1WA 4K2RA 2OIQA 1NVQA 4EBVA 4ZY6A 2GCDA 1LUFA 2GNIA 5BUJA 3FL4A 4TN6A 2H8HA 3C4ZA 2YA9A 3OWPA 4HCUA 5L6WL 2HWPA 4O86A 3S2PA 3ALNA 2P3GX 3F9NA 2JBOA 3BE9A 1W84A 3VUIA 2W9ZB 1O6LA 4IVCA 3UE4A 1DAWA 3O96A 2JC6A 5AUWA 5HVYA 4BHNA 1WBNA 2GNGA 2J4ZA 3FJQE 3LOKA 4I5PA 4W4VA 3DA6A 5K5NA 3U6IA 3DJ5A 3P5KA 3I79A 4JLCA 4KIKB 4DEGA 3V5QA 2VX0A 4Z9LA 5CZIA 5IQEA 3JS2A 5AV1A 3OW3A 5FUTA 1UU7A 4E5WA 4AQCA 1BI8A 2PZ5A 4BCFA 3QTXA 2I0HA 4W4XA 2XNPA 2PSQA 1PF8A 3FZOA 3WE4A 1H28A 4LI5A 5CTPA 2C3KA 2WMUA 4RIXB 2R7BA 1W83A 3E88A 4DFLA 4YURA 1SVEA 1LR4A 5HIBA 3C0GA 2YM6A 3QQFA 4ITJA 2X8EA 4CFXA 4MHAA 5DWRA 4EKKA 5HVKA 4JOAA 1ZY5A 3QZGA 2BDWA 2Q0NA 5FDXA 4QTBA 4G6NA 4MD8E 2NRUA 4YJPA 3BYSA 4RFZA 4AN9A 3L9LA 2WMWA 4MYGA 5CNNA 4AZEA 3CEKA 2YIWA 4BCIA 4F6WA 3KGAA 3E64A 4PF4A 1GY3A 1OGUA 3AXWA 5CU4A 1SMHA 4TRLA 5CS6A 2NO3A 5A3XA 5L8LA 3MESA 5EG3A 3FMJA 4IXPA 4IIRA 5EYKA 5A4LA 5EKOA 1ZYSA 2C5NA 2WEVA 1Y8YA 4IFCA 4O0SA 2ZAZA 2OIBA 4OTGA 2PHKA 3EWHA 4U3YA 3G33A 3ORZA 4WD5A 4IB5A 5KZIA 1PXIA 3PZEA 4MF0A 4X3FB 4XV1A 3TV4A 3MS9A 2ZDUA 1XBAA 5K4IA 1KE6A 2R3KA 3QTWA 4BDEA 4FTCA 3ZS5A 3DOGA 2OG8A 1F3MC 4WNPA 5GZ8A 1Q8YA 5E7RA 2ZYBA 5HHWA 4A06A 4BDAA 3LCKA 4EBWA 1FGKA 4RPVA 5CEOA 4L9IA 2ZB1A 5FM2A 4FC0A 2YM7A 3KU2A 3V5PA 2ZOQA 2V22A 2PZIA 3EQFA 1MRVA 3BELA 4UWBA 1LP4A 2X1NA 4XG9A 4Y85A 2W1DA 2PUPA 4WG4A 1FQ1B 2HAKA 4M97A 4U5JA 4J8NA 3ANRA 4YTHA 4ZTNA 3ALOA 3DKFA 4GIIA 5DR9A 1H0VA 2OFVA 4YJNA 2B9IA 4U79A 4PY1A 3R8VA 4AZSA 4DEEA 5ETIA 2YAKA 3F7ZA 5DFPA 1MRYA 5BYLA 2Y4IB 4MXZA 3SDJA 3RBWA 3RZFA 4O7RA 4ZZNA 3M42A 3QLGA 3QC4A 3EN5A 4L42A 4PV0A 5K9IA 4RA4A 2PVHA 1GIJA 2YITA 2C47A 2QONA 4I5HA 3ZBFA 4BWKA 3VUHA 4F7NA 4D2TA 5IQDA 4B8LA 3RNYA 4MTAA 5DEYA 3QYWA 4EK8A 3ZZEA 4V04A 5BQ0A 1WAKA 1GIIA 3SG8A 2ONLC 1JLUE 3QC9A 2GMXA 4XG4A 3LMIA 4FTAA 2XKDA 3EN7A 4JRNA 4U42A 3UMXA 3ZUUA 4QP9A 5ACBC 3D5UA 5KUPA 2R0UA 3BZ3A 3JYAA 3G2FA 4I6FA 2XJ0A 4YJRA 4GKIA 2EUFB 3KULA 2VWZA 4ASXA 3PZHA 4X2NA 3L8SA 4PP7A 1TQPA 5AAEA 5LCJA 4JBVA 1PMNA 4M14A 2RIOA 2WGJA 3WE8A 4D9TA 3TUBA 2EVAA 1XH6A 3PY1A 4XG6A 1CMKE 4FT5A 4XP0A 4YLJA 2PVLA 2I7QA 1JWHA 4FNXA 4HPUE 3ZSIA 5DA3A 2OXDA 4M0YA 5EHYA 5M53A 3FKOA 4IJ9A 4I21A 2YCRA 4EI4A 4FKUA 1OL5A 3ELJA 3TACA 4K0YA 4DBNA 2XKFA 5KMOA 2IVVA 4QTDA 3OT3A 3HKOA 4R1YA 3KREA 2I0EA 3FBVA 2XJ1A 1F5QA 4ZMFA 2YIRA 3FLZA 4TKSA 3I6UA 3NUXA 3BWFA 3R7IA 3VBYA 2H6DA 1OL2A 4FSRA 4AS0A 3V8SA 2A2AA 3DGKA 3R1SA 3ZSGA 4BCQA 4BDKA 4ZJVA 3FMHA 2VTSA 4EYMA 3C5IA 3EJ1A 4H1JA 1RW8A 3R02A 3FC1X 5AR4A 3EYHA 4CYIA 1ATPE 3PXQA 1OBDA 2E9PA 4H05A 3AGMA 3JUHA 3FSFA 3ZC6A 4BIDA 3OW4A 4LQMA 4GYGA 3HV7A 3U87A 3KRRA 2XNOA 5LVMA 3OVVA 4FKJA 4FZ6A 5HO7A 4Z7HA 5GINE 4BKYA 4C4EA 2QOQA 2YIXA 2ZM1A 3PXFA 3D7ZA 2RL5A 2R3RA 4F1OA 2W1IA 3C4XA 1JPAA 5AIRA 2IVSA 4LV5A 4RRVA 4IX5A 2R5TA 2OZAA 2WMXA 2WTKB 3MY5A 4NM5A 4Y72A 4EWQA 5IA1A 4DFXE 5IUHA 5J7BA 3H9OA 1G8AA 3F2RA 3MV5A 4V0GB 4B0GA 3FQEA 1QCFA 4TYIA 3BWJA 3PWDA 3QKKA 1ZWSA 5ANJA 3I81A 4DGLC 1H1SA 1ZYJA 3COKA 3SXFA 2QKWB 2E9OA 3E8DA 5CSVA 4HW7A 2ITOA 4FV9A 4WA9A 3EQHA 4FL1A 3HA6A 4FOCA 5CY3A 1SM2A 4QMQA 2YHVA 5KMIA 4Y83A 4TW9A 2WTIA 1KE9A 2P2HA 2JAMA 3KF7A 4GVJA 3ZLWA 1ZZLA 4R78A 4R3PA 2EU9A 2R3QA 2VZ6A 1R3CA 2PVRA 5I9WA 2YLEA 3HV4A 4ZLZA 5CAQA 3DXPA 4P5QA 4QMUA 5HG8A 4O7NA 3LMHA 3U4WA 1OKZA 1M2PA 4GIHA 4MXXA 2GTNA 2RFDA 3WYXA 4BRXA 4K6ZA 5LVNA 3HDMA 3Q2MA 4GT4A 4O91A 2ITWA 4LOOA 4D2SA 3F2AA 2PUNA 4NFNA 2CMWA 5FP6A 4PL5A 5GZAA 2BTSA 4IC7A 2VX3A 1R0PA 3D7TB 3TUDA 4KRDA 4FL3A 2C6DA 4G6OA 2Y6MA 3O8UA 4N6ZA 3EL7A 2I0YA 3QFVA 2VTNA 3D9VA 5FP5A 2OIDA 3B2TA 4TZRA 2HXLA 4FVRA 2GNJA 4FKWA 4ONAA 5HEZA 2R0IA 3LW0A 4HOKA 4CFNA 5HU3A 3O17A 4DHFA 2C1BA 3A7FA 4NW5A 2BHHA 2J0JA 4LOQA 3F7WA 3LFEA 1YWNA 3BIZA 4V01A 3RK9A 2CKQA 3VQUA 3R63A 4IZ5A 3FLYA 3A99A 4BF2A 4CSVA 2QKRA 4CZYB 2VTRA 4YJOA 4C02A 4D1SA 2BKKA 3BYUA 4W9WA 5GNKA 3TKIA 4QPSA 5AP7A 4EOQA 3CD8A 3RCDA 1R78A 5IKWA 4FSNA 4F9AA 5CANA 3C9WA 2E9NA 5L2QA 5KZ0A 3ZRLA 3ATTA 4R1VA 4FV8A 4TXCA 2UVZA 5CVHA 4NU1A 3HMOA 2XK6A 2ONLA 3VS7A 3LAUA 4FGBA 3WARA 2YM4A 1KV2A 1GJOA 2YEXA 5LCKA 3RALA 4QP3A 2BPMA 3TJCA 3WZJA 4ZP5A 5D41A 4AW5A 2C5YA 4GJ3A 3V5WA 3W55A 4QQTA 5EI2A 4R5SA 4QP1A 4EZ5A 4FTNA 5AR5A 3U6JA 1GZOA 2JBPA 2QR8A 4OTRA 2B0QA 1ZMVA 2P33A 4FIIA 2Y0AA 4GMYA 4XG3A 3L9MA 5HO6A 3WF5A 2C6IA 5TT7A 5DT4A 4KKEA 4LV8A 3UNZA 1XQZA 2OU7A 3Q96A 3ZO3A 4USFA 4F6UA 4PX6A 4H36A 4E4LA 3EL8A 3OD6X 5IUGA 4FIFA 4OAVB 4NK9A 4DN5A 3BX5A 3KQ7A 4E7WA 3FXWA 3GC7A 5DIAA 4ZZMA 3DFAA 4CLIA 5L2WA 3C4FA 4ZLYA 4IVBA 5HNGA 1J1BA 3D5VA 2CGWA 4WHZA 3BYMA 3GQIA 3ODZX 2VWXA 2C6TA 2UZEA 3GC8A 4GRBA 2PVMA 4C34A 4CCBA 5K5XA 2VWYA 2YCFA 2VNWA 3CP9A 3T9IA 3FLNC 3ZUTA 4RX8A 3ZXZA 2O64A 5K3YA 4G9RA 3RTPA 4IJPA 2KTYA 3A4PA 2IZUA 4I0RA 1ZARA 5D10A 5FRIA 2XK8A 3BQRA 3I0QA 3Q3BA 4IE9A 5AP2A 3UZPA 5GIOE 3QXOA 4EOKA 4B7TA 3QGYA 3BCEA 3RKBA 4MXYA 5ETAA 4QT1A 2YACA 2ERKA 4OBQA 3NZ0A 4AGWA 4ARKA 3R8UA 4DYMA 3ITZA 3KVXA 4FSTA 4PMSA 3RI1A 4B6LA 3NAYA 2O63A 4YZDA 3ZC5A 4CTCA 5HX6A 4EONA 2WOUA 1G5SA 1NT2A 3GENA 3VHKA 4ALUA 4CVAA 1P5EA 4IZ7A 4O7TA 2VTOA 4OTDA 4RVKA 4NWMA 3MA3A 3NUPA 5EOLA 1ZOHA 2P0CA 3DB8A 4LL0A 4FEXA 4NZWB 4EH5A 2QURA 3OFMA 3PSCA 2WMQA 3Q9WA 3NW7A 3QCQA 3R8LA 3CKXA 2CDZA 3F5XA 3LE6A 5E91A 4XCUA 1ZLTA 5I5ZA 2CKPA 2C6OA 4HCTA 4TY1A 5BX0A 4DITA 5DRBA 3MDYA 2W7XA 4QPMA 1IAJA 3UIUA 3PXYA 4W8EA 4BCNA 3WIKA 2V5QA 5FTQA 4JIAA 2ITQA 5CEQA 2QO7A 4DEIA 3FZPA 3R6XA 4ANNA 5ITAA 2DYLA 3A62A 4TYHB 1XH7A 1UU8A 3IQ7A 2BDFA 3NYOA 4XOZA 3R0TA 3OP5A 3EKNA 1JKTA 2UUEA 2ETKA 3FMLA 4UALA 3LLAA 4ALWA 4WO5A 3QD2B 2R64A 3KN5A 3UMWA 5CF6A 2YFXA 4IANA 4J71A 4F9CA 5KCVA 4TWOA 3PVWA 2YISA 3LFDA 1PYEA 2X4FA 4O7VA 2HW7A 2XK9A 4EH6A 5EI8A 3KRXA 3EKKA 2QHNA 3FMEA 2JFLA 1SVHA 3DDPA 3LQ8A 3O50A 4JT3A 4FKIA 3LXLA 5F94A 1WBVA 3DXQA 3L9NA 4AA4A 4YJTA 4QMXA 2YM3A 4FTLA 5BPYA 5H9BA 2WQBA 2HIWA 5KX8A 2OK1A 1SYKA 3FLWA 3GC0A 5LWNA 3D2IA 2PVYA 2IJMA 3DAJA 5E1EA 4A9TA 4KUJA 4JDKA 4KWPA 4I22A 5CALA 4YJSA 5H8GA 1PXPA 2UW3A 4X2JA 3W32A 4O1OA 2HYYA 5EH0A 2WAJA 3BV2A 3UYTA 4YNOA 5J5TA 4O82A 3RAIA 3QHWA 5EQPA 4L43A 1T45A 2FH9A 5AAGA 3MH2A 5CWZA 4N6YA 2Y7JA 4O0TA 3K2LA 3N9XA 4JL9A 4RVTA 1S9JA 2XCHA 4Q2AA 4EKLA 4NIFB 2W99B 3Q9ZA 3DXNA 3QRIA 4GK2A 3AGLA 4BFMA 4ITIA 5M56A 4QP6A 3N51A 4XMOA 4WIHA 5EDRA 3ZUVA 4MD9E 2B53A 2UW5A 1PRYA 4C4IA 4K33A 3UQFA 3EB0A 4GW8A 4EOJA 5GZ9A 4LUEA 3UG2A 3H0YA 4FKGA 3ENMA 4CZTA 3MJ2A 1DI9A 4BCOA 3JVRA 4BZOA 1IRKA 3CS9A 3QQJA 5L2IA 4FTUA 3HNGA 4FKOA 4BHZA 1ZY4A 1OPLA 5CAOA 4DT8A 5FXRA 5JRQA 3SAYA 5HE3A 2R3OA 3V6SA 2WMBA 3BGPA 3R9OA 4QP4A 1WZYA 2QQ7A 4IMYA 4L45A 4NYEA 3TJDA 3MTLA 3RWPA 1H1RA 1XH5A 3D5WA 4KRCA 1Z9XA 3P78A 3EQBA 4M8TA 3UOKA 4JG6A 3RGFA 2ITVA 2JDSA 2JIUA 5IH6A 2IZRA 4C2WA 4LMNA 4WBOA 5ANGA 3QWJA 2WQOA 3KMWA 3DDQA 3FY0A 2XIXA 4JI9A 4TPTA 5BVWA 2GQGA 4R5YA 3DQWA 2JAVA 3FXXA 3KRJA 2UZNA 3CGOA 4CQEA 2OJIA 3KRWA 4E3CA 2XNGA 5EI6A 3R7EA 4JG7A 3UVQA 3CJFA 3VJOA 2O0UA 2W1EA 5H3QA 3RPYA 2X6DA 4UMRA 3OEZA 4FKVA 4O2ZA 2XUUA 4EZ7A 1FVRA 4HNFA 3V01A 5BMMA 5KO1A 1IG1A 3PJ8A 4EHEA 4HVIA 5DN3A 5A9UA 3KB7A 3QCYA 2VO7A 2DWBA 3GC9A 4OBPA 3CCNA 3LJ1A 4L67A 3OBGA 5ANOA 3W2OA 3HL7A 4IQ6A 4NSTA 4FV6A 4X3FC 2VWBA 3ZMMA 4KAOA 3HMMA 3QD4A 4KS8A 3F2NA 4AAAA 3H9RA 4U97A 3FI8A 5IQCA 4FIHA 3ORTA 3QZIA 5IZFA 1SZMA 1YWRA 2WTCA 3H9FA 3V5LA 3VS6A 4A9YA 3AC8A 4BDBA 4DGMA 5LVPA 3GP0A 1W82A 4XLIA 3IDBA 4IAIA 3RVGA 4C7TA 5A6OA 3DU8A 1PXNA 3DNEA 4B99A 4KS7A 3WI6A 2I0VA 4A7CA 2VD5A 3D14A 3C7QA 4PDOA 3PUPA 1OL7A 2FSTX 2B54A 3HMNA 4IX3A 3MFUA 4A4XA 3MBLA 2W4KA 4F7SA 4J52A 3VVHA 1XH8A 3A7GA 4DC2A 1AQ1A 4M67A 2QOIA 4C58A 3E5AA 4EUTA 2JKOA 4D1ZA 2Y4IC 4AT5A 4R3CA 4FTKA 4UXLA 5DLSA 5C8NA 3E87A 4BC6A 2C6MA 3U6HA 2REIA 4ANOA 4IM3A 4IAZA 3FPQA 4ZSAA 1Q3WA 4OGRA 3QTIA 4YPSA 3IW7A 4MQ2A 4LRMA 5HNIX 1QPCA 4PQNA 4WRGA 2UZVA 5K0XA 2B4SB 1NA7A 1MQBA 3WF8A 4F0IA 4O0XA 1PMEA 2PE1A 4DTKA 3DCVA 3GU4A 4EOLA 3ANQA 3QU0A 5L8JA 3DBCA 5M44A 2PVNA 3GVUA 3THBA 3BEAA 3COMA 2W4JA 3OROA 5JGDA 2VTIA 4RQVA 2G9XA 5KBQA 4BZDA 4BL1A 4NCTA 5DVRA 3V5JA 2LGCA 4OT6A 3NW5A 3G0EA 4O0UA 4W9XA 4WG3A 3F3VA 4QMMA 4D5HA 1B39A 1O9UA 3GXLA 3NUSA 4RIYA 1Q61A 4FGRA 5GJDA 3MY0A 3UZTA 1IAHA 5IQBA 4MWHA 2XM9A 3RHXA 4NM7A 1UNLA 3IDCA 5HESA 4BBEA 4XP3A 3O51A 1IEPA 5ANEA 3W2PA 1JOWB 3MVLA 3KKVA 4BYJA 2RFEA 3KFAA 3VS3A 5AUVA 2QOOA 3CLYA 4RC4A 3DLSA 4G3CA 5F20A 5KBRA 4A9UA 5BNJA 2V62A 2JDVA 3CGFA 4BCMA 4C37A 4EEVA 5EKNA 4MNEA 4FR4A 3T3VA 1V0OA 3ZXTA 3EHAA 3LHJA 4PDPA 4EHZA 4QMWA 4U7ZA 2BALA 5A46A 2F49A 2VTQA 4WNMA 2IW6A 3Q32A 2XRWA 1CKJA 3AD4A 1V1KA 3HDNA 1J3HA 3U9NA 2CKEA 4AZFA 2W05A 4BWPA 3JY9A 3GNIB 5F4NA 3SC1A 3UC4A 2RFNA 1H00A 5CAVA 4EK6A 5G1XA 3EIDA 5E90A 3MSSA 3BBWA 5T6KA 3VAPA 4P7EA 3V8WA 4AN2A 3DJ7A 4DA5A 5HICA 3VUKA 3QTRA 3JXWA 5EYDA 2JIVA 1H0WA 2W5HA 4UB7A 2HW6A 4WG5A 3UDBA 5AA8A 5HTIA 1YXVA 4LL5A 2BDJA 4RIOA 4J8MA 3MI9A 4PPCA 3DK7A 3A7JA 5D7AA 3T3UA 4ANLA 2XB7A 3Q6WA 1J91A 4PMPA 2WTKC 2HZ4A 2XZSA 5JGBA 2PE0A 3KRLA 4G3FA 3UYSA 1Y8GA 3LVPA 3ACJA 4LYNA 1PJKA 3C0HA 4N4SA 3LFNA 4YUQA 4HVDA 1QPJA 2ITZA 3Q4TA 2WPAA 2JFMA 4C4JA 2F4JA 3ZSHA 3SRVB 1JAMA 2QD9A 2QG7A 3EMGA 1Q99A 4H58A 3SW7A 3HUBA 2PULA 1OECA 4DH8A 1ZOGA 1Y57A 4QMSA 4TNBA 1DAYA 5DHJA 3ZCLA 2XEYA 3NUUA 3OOMA 1WFCA 5DYJA 4YBKA 3WZDA 4JG8A 3NW6A 4PNKA 3KXZA 3V3VA 4R8QA 1YI6A 3DNDA 3VBWA 3RK7A 1SNXA 5C4KA 3IG7A 4ZJJA 4PDYA 3QX2A 4J95A 2WNTA 3HEGA 3NVKI 4G5JA 4I23A 2JEDA 3UPZA 3ZLYA 1O6YA 4WUAA 4EH2A 4X6QC 4EH7A 1U54A 3IGOA 2W06A 4ZK5A 3BHTA 5H2UA 3VULA 5L8KA 5EM5A 3PIXA 2PZPA 4K11A 4QNYA 3BLQA 5BVFA 4NJ3A 4WBBB 2W5AA 5LJJA 3AT4A 2GPHA 4X7QA 5HGIA 3U55A 5EHOA 3LIJA 2W1GA 4JBOA 4UYNA 5AIKA 4GG7A 5AADA 4YZBA 4CNHA 4IAYA 5M4UA 4JBQA 3HMIA 1RQQA 3KXMA 4OTHA 5DNRA 1FGIA 5E92A 5IA4A 4IZYA 4JXFA 1UU3A 4YLKA 2VGPA 4MXCA 4O7WA 2YZLA 2BAKA 4FA2A 2IZSA 4GU6A 4AOIA 3SHEA 3WOWA 3I5NA 3NPCA 4C36A 2QOHA 3LQ5A 4O96A 5IQAA 1XR1A 5AR2A 3E8NA 4RG0A 1PXJA 3R30A 2B9JA 3IOKA 3Q4ZA 4FIJA 4USEA 1YDRE 4X2GA 4NW6A 3EFJA 4CKJA 2G2HA 2QCSA 4IDVA 4CFWA 4G2FA 1TKIA 2ZV8A 2CNQA 4FEVA 2PL0A 1ZYLA 5FTOA 3BYOA 4EOOA 4RJ6A 5CAUA 4S2ZA 3OWJA 4YP8A 4CFMA 3O7LD 4JNWA 5I9XA 3P9JA 3R8ZA 2R3HA 4KBAA 4Z7GA 1JKSA 3UO4A 3GB2A 4BTFA 5CEKA 3D15A 2GQRA 1Q8WA 5AEPA 5AAFA 1L8TA 5M09A 3TWJA 3TV7A 4AFEA 4PNIA 3MFSA 2CNVA 4IAFA 2GFSA 3A7HA 4M0ZA 1PXLA 4CGAA 2C0OA 3IKAA 3M2WA 4RJ8A 2F57A 4EJ7A 4MQ1A 4OTFA 5CLPA 4FBXA 3QF9A 4MCVA 3TG1A 2WO6A 3OEFX 2X0GA 4DFUA 4KKGA 4HGLA 3KVWA 4CXAA 4IWPA 3R8PA 3QZFA 3U4UA 3RINA 3BQCA 1PMUA 1QPDA 5EM6A 4CYJA 4EHVA 5K4JA 5IA3A 2WXVA 1UV5A 4FUYA 4XS2A 4FTJA 3IS5A 3BHVA 5TKDA 4A4OA 5EM8A 4NTTA 2C68A 3KXNA 3PVBA 4QQCA 5C01A 3RAHA 3V5TA 4L46A 3WF7A 4E6QA 4R77A 2QLQA 4X3JA 4L8MA 1LPUA 5AP6A 3KMMA 4W4WA 2Y6OA 3NWWA 2C6EA 2BRBA 4PTEA 4CFUA 1SVGA 3NCZA 3OMVA 4MF1A 3R8MA 3LCOA 4JR3A 4FTRA 2OXYA 1A06A 1MUOA 1UWJA 4IFGA 1LEWA 2PMOX 3OXTA 3RWQA 2R3LA 3CJGA 4DCAA 4HVSA 1Y91A 3UTOA 4HGEA 4QMLA 2J0IA 2PTKA 2FYSA 3PFQA 2VTAA 3QD0A 3QHRA 3ORXA 4P5ZA 3L9PA 3DAKA 4ALVA 2XNEA 5B0XA 4PWNA 2WHBA 4DCEA 3CR0A 2QOKA 4YSJA 5FEEA 4IM2A 4JQ7A 2BVAA 2G2FA 4FKTA 4JDHA 4U40A 5HCZA 3RPOA 3UOHA 2HY0A 4EOSA 1CKPA 3L8VA 3R01A 3ZDIA 3ZRMA 4ACMA 4E6DA 2XS0A 5TOZA 2Z7LA 4IACA 3ZFMA 1P4FA 3DTWA 3N4VA 3QRKA 1BKXA 2PUUA 3HP5A 3ZBXA 1XBCA 2XK7A 4RMZA 5CSWA 4E6AA 5ETFA 5IMEA 3NR9A 2HENA 3BU6A 3FZTA 4UYAA 1U46A 3GU8A 2W9FB 2XP2A 3PWYA 5AP5A 4MNFA 4BBFA 4D4VA 2E9UA 2PE2A 2BZJA 4BN1A 3E8CA 4FSQA 4KBKA 3BHHA 3OZ6A 4GVAA 5HKMA 3VS1A 3NUYA 3KK8A 4O6EA 4TYJA 2OGVA 5AUYA 3TXOA 4I93A 2C0TA 2ZV9A 4K77A 2R9SA 4YU2A 3CQWA 4Y46A 1OKWA 3MVJA 3NIZA 5TF9A 1YVJA 3FMKA 2J50A 2JGZA 3P7AA 4MKCA 4APPA 4U9AA 4DEDA 3LXNA 5D9HA 1RDQE 1H26A 1Z57A 3R9HA 4OAUC 5LQFA 3L8PA 4TWNA 3QKLA 3SVVA 3TKHA 4XOYA 3KULB 3EQGA 1KV1A 4QNAA 3QL8A 1YQJA 4PMMA 3OF0A 4A07A 3ZEPA 3VN9A 4C62A 5F9EA 4JS8A 4S33A 4F9BA 4JDIA 4JJRA 5I9UA 4ZLOA 3VRZA 4D2VA 3BKBA 2UZWE 5HIEA 3AQVA 3G9NA 3O2MA 5DR6A 4X0MA 4YTFA 3QX4A 5IA2A 4FVQA 4CFVA 4BGHA 2OXXA 3MIAA 5J9YA 4O27B 2BZHB 5KE0A 4IW0A 3WIGA 1SNUA 1YHWA 3PXRA 3LFSA 4U3ZA 3RM6A 4YTCA 3VJNA 1W8CA 3A8XA 1ND4A 3ZLXA 5E4HA 4XEYA 4FV4A 5E8ZA 2VNYA 3OXZA 5EOBA 1Q8ZA 4HNIA 4YLLA 4ASEA 2WTDA 4DFBA 2UV2A 4QYEA 4CT1A 2WZJA 4XBUA 4S31A 3EN6A 4E6CA 3TZ9A 4IH8A 2Y9QA 4FT9A 2NP8A 2BILB 3QA0A 5B2KA 4YHTA 3TNPC 4E5BA 4FTQA 3DBDA 5FG8A 1XBBA 2O8YA 3ZFXA 5AR7A 3CQUA 3TCPA 4ZS4A 4ZSLA 3E93A 3MTFA 4H1MA 2Q0BA 4M66A 4WSYA 2VTPA 2CCIA 4B4LA 4IAKA 4F65A 3BHUA 2Z7SA 2RG6A 4UXQA 1Q62A 1XH9A 4G1WA 4HJOA 2O5KA 4FIGA 2OJFE 4LG4A 2BIKB 2UW9A 1A9UA 4FNWA 5FEDA 5L6OA 4FKRA 2YM5A 2OZAB 1KE7A 3R73A 4E4XA 2ITNA 4NL0A 3VC4A 4NEUA 3G9LX 5FBOA 3PPJA 5FXQA 1H01A 4OW8A 4C57A 4RVMA 4JX3A 1ERKA 4U81A 2PK9A 4HYSA 3UP7A 4FT0A 1M14A 4QP2A 3ZO1A 2X81A 3PJ3A 3TTIA 3I1AA 4YO4A 4U80A 3OCGA 5BYYA 4FG8A 1H07A 3RAWA 1XH4A 4DE4A 2VTMA 5IH4A 3EZRA 3A61A 1BL7A 4F63A 1XJDA 4Y73A 5HLNA 1A48A 4CKIA 4ZXTA 4L00A 3A4OX 3GFWA 3GCQA 4IB0A 4EH4A 3SX9A 3SA0A 5LWMA 2O3PA 3QTZA 4ZSJA 1QPEA 4C8BA 5L6PA 5KMNA 4G3EA 2G15A 4FKQA 2WTVA 4RZVA 5IDNA 4ZTRA 4EQUA 1H25A 3GCVA 3IGGA 3QQLA 4B9DA 3MH0A 4O83A 4F4PA 5GJFA 4ERKA 4TT7A 3W1FA 2BKZA 4BTKA 4L7FA 2QR7A 4BDFA 3VUDA 4F7LA 3FZ1A 4BWXA 1YXSA 4JQEA 3R2YA 4N0SA 2SRCA 4I4FA 3C4CA 3LCTA 4TYHA 3Q6UA 4UWYA 5LARA 2J0KA 4RT7A 4XG7A 1PY5A 1OUKA 3AG9A 3NNUA 3I7BA 3UIBA 2ZMCA 5CSXA 3NNVA 3V51A 3P86A 4M69B 4TNDA 2G1TA 3UIXA 4K1BA 5TO8A 2OJGA 3RMFA 3QGWA 2XNMA 1NVRA 2OJ9A 4AN3A 4BI2A 3ETAA 1CKIA 4GH2A 2VWVA 2AC5A 3PP1A 4ZZOA 4G9CA 3VW8A 3C5UA 2HK5A 2V0DA 4CMTA 2J90A 1V0BA 1RJBA 4FTMA 3C1XA 3POZA 3Q5ZA 4RJ5A 3H10A 3PE2A 5IMXA 1PXOA 4G31A 2J0MB 3VS4A 5CQWA 3NCGA 3KCFA 4GCJA 2I1MA 4XV2A 4M7IA 4DEBA 4FSMA 2JDRA 4KIQA 4QQJA 4ANSA 5J87A 4FV7A 4O0YA 4QMPA 3FZRA 2C5OA 2F7EE 4IBMA 4YZNA 3ZZWA 2HOGA 3BEGA 3H0ZA 3AD5A 4GV1A 4O38A 4V05A 4O7SA 4XHKB 2XK4A 5E9EA 5CU2A 3FE3A 4BKZA 2UVYA 3F69A 3CQEA 5IQIA 4NFMA 3Q4UA 1QL6A 2BFXA 1UU9A 4RJ7A 2XMYA 2C5VA 4DGNA 3QQKA 4BDDA 3R28A 4CRLA 3OCBA 4AFJA 5JT2A 4ZSEA 5HE1A 1OL6A 4R7IA 4ASZA 3GOKA 2JKQA 3NRMA 2XCKA 4ZEGA 1VR2A 1YKRA 2F9GA 3KXHA 4XJ0A 3NIEA 2XBAA 3DZOA 2C4GA 3LFCA 2QODA 3MA6A 3QKMA 4IVAA 4BZNA 3G51A 4D0WA 5HCXA 4RC2A 3PTGA 4RC3A 3HRCA 5AJQA 3FQHA 3RPRA 1JVPP 3W10A 3F3UA 2WMRA 5CEMA 3MH1A 2ITPA 5CEIA 2QVSE 3TNHA 3DBQA 3CTHA 4QD6A 3TDWA 3E63A 5HX8A 1UWHA 1Y6AA 2BCJA 4GUBA 2WQMA 3GT8A 4NM0A 3BGZA 3PSBA 3OWKA 3PXZA 3S95A 4AT4A 4XG8A 5EDPA 2VTHA 3ZH8A 4AA5A 2YDJA 2W1ZA 3RZBA 5CF4A 2CGVA 1GNGA 3IW6A 2PZYA 4F6SA 3A8WA 3QRUA 4M12A 1PXMA 3VO3A 5I4NA 4WNOA 5HD7A 2NNWB 4QO9A 4FTOA 3CD3A 2QG5A 5JFSA 3VIDA 3DPKA 4O1PA 4J7BA 4A9SA 3QZHA 4YHFA 4AZVA 4APCA 2PZRA 5IEVA 4ZS0A 2B9FA 4EH8A 3SOAA 4ORKA 3MW1A 4EHGA 2ZB0A 3UNJA 5J5SA 4C2VA 1YXTA 2QU6A 2WTJA 3NVMB 2A1AB 4I0SA 4M3QA 1APME 3GQLA 3JPVA 3JVSA 4BI0A 4FTTA 3Q60A 5BMSA 5KMJA 1OIYA 4RFYA 3HV6A 5LXMA 5E8UA 1OM1A 4HYUA 4R7BA 1Q5KA 2CLXA 3DV3A 1LEZA 1BUHA 3GUBA 2UZBA 4WOVA 3FMDA 4ENXA 5A54A 1J7LA 2C1AA 1XWSA 2XA4A 3ODYX 4I4EA 5DMZA 2GS7A 4QRCA 3EFLA 3MPTA 3R71A 4PTCA 4C33A 4LGGA 4FI1A 4Q5EA 1TQIA 5L4QA 1OIQA 4FZFB 5A14A 1ZMWA 1G8SA 5CU6A 3WZKA 3IDPA 3T8OA 4WSQA 4IM0A 4JR7A 4YJQA 3WF9A 4R6VA 4D0XA 5LVOA 4BR3A 3EYGA 3F3TA 2QC6A 3SD0A 5AV4A 5I9ZA 3ZU7A 5E1SA 2XNNA 2YDIA 3PYYA 5M4CA 3FDNA 4OTIA 4QOXA 5G6VA 4BDJA 4C3PA 3C4EA 5JZJA 5FEQA 3MVMA 2ZMDA 3G90X 3PPKA 4YGAA 3R7GA 4U41A 4DH7A 2ZM3A 3PG1A 5T68A 2QOLA 4L44A 3OTVA 2GNHA 2W5BA 3NMUF 4YC8A 1DS5A 2YLFA 2WMAA 2ZM4A 4GJ2A 4DT9A 3FKLA 1M7NA 3RAKA 5DPVA 3UNKA 3QWKA 2Z7QA 4IWQA 5JMSA 3KF4A 5M4IA 4YSMA 3RPVA 2Y4PA 3PDTA 3QAME 1IASA 2PVJA 4YPDA 3D5XA 3VBVA 2RKUA 3LFBA 4J1RA 4QMTA 2WMSA 3IPHA 2QOBA 5E8XA 4C4GA 5KNJA 2OF2A 5CSHA 2VTLA 3DK6A 4RIWA 4X6RA 2OWBA 2OFUA 4ZTSA 4J97A 3MIYA 4L53A 4EC8A 4DH5A 1W98A 2ZV2A 3HAMA 2J5FA 2VTJA 4S34A 3FI4A 3P08A 2EXEA 3K3IA 3ZONA 3TNWA 3NEWA 2X7GA 2X4ZA 1Y6BA 3BLHA 4ZTHA 4CV9A 4NJDA 5I0BA 3EQPA 4O22A 5TE0A 1W0XC 3PSDA 1ZZ2A 3HRBA 2BRHA 5J1WA 3P79A 3C50A 3V6RA 4EK5A 2VAGA 5IQHA 4FE2A 1WVWA 4E8AA 4MBLA 4B8MA 5CASA 3R2BA 4S32A 2IO6A 2Z2WA 4FV1A 2F2CB 3CTJA 2VUWA 4ERWA 2ACXA 5CZHA 4GKHA 4GU9A 2X9FA 2X2MA 4Y8DA 3UO6A 3CBLA 3HECA 4LM5A 3ACKA 1M17A 5HORA 4J53A 4IB3A 2RFSA 3NAXA 3M1SA 3UQGA 2WD1A 3QUPA 3FUPA 3A7IA 5AV0A 1YW2A 4IEBA 1XKKA 4LRKA 1U59A 3ZO2A 1PHKA 2JDTA 3QUDA 4O6LA 2BIYA 5C8KA 2BAQA 4QP7A 3H4JA 1K3AA 5LMBA 3E8EA 3FC2A 3P0MA 3Q53A 1UKIA 3GU6A 3LPBA 4RBLA 2BZKB 3UIMA 1OPJA 2IW9A 4FUXA 4MX9A 3NLBA 4LFIA 4D4RA 1Q97A 2WB8A 2FB8A 4D4YA 2ITXA 1YHVA 5C9CA 5I9YA 1VZOA 3HZTA 4I20A 2GHMA 1REKA 1OB3A 4QPAA 5BVNA 1IA9A 4FYNA 3HUCA 4C4FA 1YWVA 5AMNA 5I3RA 1UNHA 2OW3A 5M55A 5DT3A 4CLJA 2H9VA 4J98A 4D28A 4I5CA 2IVUA 2XEZA 3FMMA 3GEQA 5EW9A 2XJ2A 3E62A 2OI4X 3EFWA 5HO8A 3AC3A 3BGQA 3PIYA 3ORPA 5A6NA 5GIPE 4AGDA 2WU6A 3GFEA 3ZHPC 2J51A 4MXOA 3DQXA 2W1HA 5E8TA 3HRFA 5EW3A 1KOAA 3C13A 3D94A 5JSMA 5DG5A 2PMIA 5M57A 3LQ3A 3UODA 3ZLSA 4ZMEA 3LXPA 4BDIA 4O0WA 3OY1A 1V0PA 2BTRA 3QQUA 1TVOA 4HGTA 2X8DA 5HG7A 3ZEWA 5KHXA 2C30A 4BVUA 4J99A 3S3IA 5C26A 1E1XA 4GEOA 2AYPA 5BVOA 3DS6A 5AM6A 3KN6A 1G3NA 4DFNA 4XUFA 3Q4CA 4EJNA 5KKRB 3FHRA 5CU3A 4GYIA 3FZSA 2XKCA 4EQCA 3TNIA 3AOXA 2V55A 4I6QA 3K3JA 2GHGA 2NPQA 4AUAA 1PMVA 2CPKE 4XBRA 1J1CA 3UJGA 4E73A 3CY2A 5J8IA 4RX5A 5JH6A 2H96A 2BUJA 2PPQA 4KIKA 3UG1A 4YJVA 3VBQA 3R22A 4NT4A 4PUZA 2X6EA 3Q5IA 1BMKA 4HVGA 3OY3A 4FOBA 5BVDA 4C3FA 3JY0A 1ZOEA 4MVFA 4CMUA 4EK3A 3HGKA 2GHLA 1OUYA 2WMTA 3MB7A 2VWIA 3RM7A 1BLXA 4RIXA 3SGCA 5M06A 1VYWA 3I4BA 4QMVA 2J7TA 5B2LA 2H34A 1CTPE 3R1YA 3FHIA 4GUEA 4JAIA 4AT3A 1JSVA 3FYJX 3O8PA 5TR6A 3R7UA 4FKSA 3FSKA 5J7HA 1ZYDA 4F64A 4H3BA 2Z8CA 1HCKA 2CSNA 2FSMX 3H30A 3R9DA 2R7IA 3E7VA 4FZDB 4FICA 4F0FA 4G3DA 3COHA 4L68A 3VUTA 3QTSA 4AW1A 1OKYA 3FQSA 4ZJIA 4GS6A 1I09A 5AX3A 4WT6A 1I44A 4RIYB 2CN5A 1FBNA 4WNKA 2E9VA 3OC1A 4MBIA 1GIHA 2B55A 3VWAA 5GJGA 2R3JA 3GU7A 4HYHA 4CTBA 4JDJA 3I0OA 3O0GA 2VGOA 3KL8A 3PJCA 4X3FA 1OVEA 4BICA 4IWDA 4I1ZA 1K2PA 3E92A 4RLLA 1JBPE 4CV8A 3NSZA 5J9LA 3OHTA 1OPKA 3EH9A 3II5A 1KWPA 3FXZA 4BCHA 3R7OA 4FZAB 3VS5A 4DLIA 5AR8A 4MNEB 4AGCA 4EORA 3HLLA 4BI1A 3REPA 3W2SA 4H3QA 2W4OA 2YAAA 3VS0A 1S9IA 3W33A 3R1NA 2GS2A 1TQMA 1AD5A 3PY3A 4YJUA 2J2IB 2OH4A 2CGXA 3IOPA 4ZOGA 3PA3A 4EOMA 1FINA 3CC6A 2EXCX 3BHYA 3JR1A 3IK3A 3BV3A 2ZVAA 5JKGA 3LM5A 4LOPA 2CHLA 3MGYA 4F7JA 5GHVA 3PE1A 1L3RE 4WKQA 4Q5HA 1VJYA 4BIBA 2XNBA 4O2PA 5IQGA 4FTIA 4GT5A 3QRJA 4CKRA 2XRUA 3C51A
chains in the Genus database with same CATH superfamily
2YCQA 2GS6A 3Q52A 4MK0A 2ERZE 5FGKA 3V04A 2WTWA 2BR1A 3B8RA 4BDCA 4Z55A 2QO9A 3SG9A 1JQHA 4AXAA 4RSSA 2ITTA 4LDTA 2X0PA 3UOJA 4IVDA 2G2IA 1KSWA 2FO0A 4D5KA 4U0IA 5DEWA 2R3NA 2HELA 4QDEA 1Z5MA 2B52A 4I0TA 4MXAA 3FLSA 5CF5A 4C35A 4L7SA 3AT3A 4NKAA 3F82A 2B1PA 3ZYAA 5EQEA 1KUTA 4RFMA 4G17A 4OT5A 4ZTQA 5BYZA 4P2KA 2HY81 4DGOA 2HZ0A 5KMMA 5A4EA 4ACGA 2VTTA 4ZTMA 3OWLA 5AR3A 3ULZA 2QO2A 3FMNA 4PRJA 2C3IB 5DRDA 3DK3A 5B7VA 1NXKA 3IECA 5IUIA 4IWOA 4IC8A 4AZWA 3CXWA 4FV0A 3D0EA 4PPAA 4ACHA 3W0MA 1URWA 4Q9SA 1U54B 3BE2A 3DKCA 3W2RA 2X7FA 3Q9YA 3BI6A 1XO2B 1KE8A 3PJ2A 4Y5HA 3R7YA 5FD2A 5HBJA 5JFXA 4DH3A 4A9RA 5JK3A 1WBSA 4HZRA 2ZDTA 3W2CA 1YOMA 1GZ8A 2YWPA 4KIOA 3P4KA 4RGJA 1JSUA 3RK5A 4FNZA 4W4YA 5F95A 1BYGA 3P23A 5HVJA 4MH7A 1VYZA 3B2WA 3GCPA 3NYNA 5ACKA 4U43A 3VRYA 2DS1A 5HIDA 3TV6A 4F08A 1OKVA 2ITUA 4AF3A 1YI3A 4EOPA 5ANKA 2J5EA 3D2KA 5ANDA 2X2LA 3UO5A 4GFGA 5HU9A 3QA8A 2WOTA 3P7BA 4QMYA 5J9ZA 3R9RA 3DKOA 3PIZA 2W1CA 3NUAA 4M84A 2HCKA 4D2WA 3LKMA 1IA8A 4QP8A 4YZCA 3SV0A 5ANIA 4KBCA 5T3QA 3ZDUA 4AE6A 2CJMA 3G5DA 2GTMA 3NDMA 3M11A 3E3BX 2Q83A 4V0GA 4UMQA 4BBMA 4AP7A 2R4BA 3NYVA 2QHMA 4H3PA 1KOBA 4G34A 1MRUA 2HWOA 4L3LA 3KCKA 4C59A 3CE3A 3PFYA 2W17A 3CY3A 5E8SA 2UVXA 3QBNA 3I60A 2W0JA 4PL4A 2R3MA 4I3ZA 3MH3A 2BRNA 3ZOSA 4E20A 2QLUA 4E93A 4NH1A 4RX7A 4RVLA 1CSNA 1WVXA 4FG7A 4F9YA 3BBTB 3VW6A 1Q3DA 3K54A 5ICPA 3Q04A 2GNLA 2JLDA 5FBNC 3CSVA 5IPJA 3TZMA 4KD1A 4K18A 1M2QA 4CMOA 4K9YA 3F61A 3TNQB 4DG3E 3TIZA 2PY3A 1FMOE 4FKLA 4L52A 4CD0A 2G01A 3ROCA 4IHPA 3ZM9A 3Q2JA 3G6GA 3P1AA 3VS2A 1BX6A 2YN8A 5HZNA 5L3AA 4BTMA 2FGIA 3D7TA 3QQGA 3O7LB 5JGAA 3UQCA 1HCLA 4PDSA 3PPZA 4KINA 3ZTXA 4LMUA 4FK6A 2XIKA 2FA2A 2IZTA 2BZIB 4D55A 2WIPA 4Y5QA 3ORKA 1DM2A 1YOLA 5HE2A 5IA0A 3HX4A 3PVUA 4ZY5A 2QNJA 4AGUA 1T46A 5K0KA 3VHEA 5M51A 1IR3A 3F3ZA 3GOPA 5CT0A 5C1QB 5B2MA 3W2QA 4H39A 2R3FA 4E4MA 5HQ0A 4R3RA 4AU8A 3UP2A 5I3OA 4DTBA 2VU3A 3AD6A 1H1PA 3EQDA 3OG7A 5HNBA 5FTGA 3ORLA 4AOJA 4X2KA 3OS3A 4D58A 4DDIA 3QTUA 3TDVA 4PPBA 4DBXA 4E26A 4QYGA 2FSOX 3PA4A 4EQMA 4QQ5A 4O7LA 4MBJA 4F78A 1QMZA 5CENA 2C69A 3GU5A 4USDA 4EOIA 4I24A 4JAJA 4XV9A 3NYXA 4EYJA 2PYWA 3WZEA 4ANQA 3FV8A 2R2PA 1CM8A 3QYZA 3V8TA 1NW1A 4I5MA 2F2UA 4AG8A 3RP9A 3WBLA 4EUUA 3AMBA 3VQHA 4FMQA 3T9TA 3NS9A 2FVDA 4QTAA 4L3JA 2DQ7X 4DG2E 1M2RA 3FYKX 5JRSA 3EQIA 3AMYA 3AMAA 2YZAA 3PRFA 2PMNX 2VN9A 2YIYA 3LJ2A 4OTQA 2JKMA 2O2UA 4BGGA 1XHAA 3R83A 4D1XA 5LMKC 4AAYA 3BRBA 2BAJA 3LXKA 3ZRKA 4FEUA 2XH5A 3LFFA 5KMLA 3KEXA 3EZVA 5EM7A 4GL9A 4D9UA 3LMGA 4YHJA 4YO6A 1YDSE 5CEPA 3FY2A 5M4FA 4ASDA 4JIKA 4U8ZA 2P55A 5LVLA 4NUSA 2YM8A 3D83A 4BTJA 2PVFA 1BL6A 4NTSA 4C0TA 4CEGA 4DLJA 5HTCA 2XBJA 4G5PA 1EH4A 4BGQA 2BFYA 5J95A 3MPAA 5FWKK 5AUXA 3TIYA 4TWCA 3MJ1A 3UPXA 1HOWA 5IEYA 3S4QA 4K8AA 3AC2A 2UW0A 4QMZA 3VNTA 4M69A 5AV3A 2AC3A 3KMUA 1OI9A 5IISA 5A4TA 3TI1A 3RJCA 3ET7A 5LMAA 4O4DA 1W2DA 3IW8A 4RJ3A 4XNEA 1E1VA 4FZ7A 5HBHA 3WF6A 4E1ZA 2ETMA 4EWHA 5E8VA 3NX8A 2CGUA 5CVFA 5JN2A 5H8BA 4XG2A 3SW4A 4C38A 4DH1A 2JDOA 3AC4A 3FWQA 2CCHA 3ORNA 4O0VA 4MAOA 2W96B 3QCSA 4FEWA 3G6HA 4XLVA 5E8YA 4O4CA 4ZAUA 4RLKA 5HOAA 4YR8A 4DINA 3ORMA 5DBXA 3TT0A 3U51A 1YHSA 2OZOA 4L3PA 5AP1A 5EYMA 4W8DA 2J0LA 2OH0E 3A60A 4C3RA 1GZKA 2PMLX 1B6CB 3DY7A 3F88A 4OLIA 4XYFA 2IVTA 3QALE 4AW0A 5EQYA 2UZTA 3R7VA 4TYGA 2OO8X 1WBOA 3DAEA 4BY9E 4YC6A 2EXMA 4Y95A 2B7AA 4O7ZA 4FT3A 3TEIA 3SKCA 1JNKA 2FUMA 3F6XA 2OJJA 3DT1A 3GI3A 1XMLA 3IONA 1FPUA 2WU7A 3LCDA 1OIRA 3OCSA 3NGAA 1OITA 5IH5A 3S1HA 2XKEA 4DFZE 2Z7RA 2C0IA 2QI8A 3F3WA 4RQKA 4NM3A 1WMKA 4YZ9A 4BDGA 5D11A 5AP3A 1H4LA 4DEAA 3HMPA 1R0EA 3GCUA 1OMWA 3HP2A 3LCSA 4KB8A 4JBPA 4UY9A 4L01A 5JZNA 2A0CX 3UVPA 1FVTA 1REJA 2F7XE 2RSVA 4AWIA 4U45A 4TYEA 4EH3A 3ID6C 2EWAA 4BKJA 1YRPA 3MVHA 5EK7A 3CTQA 1DI8A 3RNIA 1UVRA 3U54A 1R39A 5FXSA 3O71A 4GK4A 3TZ8A 5C4LA 1JKLA 1H27A 5D1JA 5HD4A 3CPCA 3MY1A 4UEUA 3ORIA 2A4LA 4P90A 5D7VA 3TN8A 4TL0A 3G15A 2VO0A 2QOCA 4Q9ZA 4G6LA 2JITA 4DF3A 3I6WA 3W8LA 2UZDA 4C61A 2VV9A 2XM8A 3UOLA 4ANMA 5CXHA 2X8IA 3LFAA 4BIEA 3G0FA 3PRIA 5BUIA 4BCJA 2XYUA 3DTCA 3F5UA 3KY2A 5CYIA 4UWCA 4FV3A 2C6LA 4MEDA 3BU5A 2XVDA 4E5AX 1J7UA 4GG5A 4HYIA 4HPTE 4F99A 5JEBA 3L8XA 4ZSGA 4YBJA 1R1WA 3RHKA 2PU8A 4RZWA 4D2RA 5EW8A 4CZUA 4PTGA 4UBAA 5L2TA 3QLFA 2OICA 2CKOA 1Q24A 4NIFA 1BI7A 3OBJA 4BCKA 2JKKA 1YXXA 4BDHA 4DGGA 3ULIA 3VF8A 5BUEA 2CLQA 5AP0A 3GCSA 3K5VA 4FK3A 2P4IA 1YDTE 3QXPA 3LFQA 5C27A 3QUEA 1WVYA 3DLZA 2C6KA 3L1SA 3OCTA 4ANBA 5KKRC 3Q9XA 3LZBA 3DJ6A 2C5XA 3QCXA 4J96A 2RG5A 3B8QA 5I9VA 1M52A 2UW4A 1F0QA 4Z16A 4FV5A 3MFRA 4YTIA 4ZY4A 5IA5A 4ITHA 4O0RA 2X2KA 4CCUA 4EZ3A 3IO7A 3AC1A 1MP8A 3TZ7A 2PWLA 2GNFA 5LMKA 2HZNA 3N4TA 3D4QA 4EC9A 4KNBA 4LGHA 3F66A 4WUNA 5EFQA 2OLCA 3CPBA 1NVSA 1WBTA 4NKSA 3PG3A 3TL8A 5AA9A 2XYNA 4GSBA 5LOHA 2CN8A 2YABA 2VO6A 5KHWA 3RPSA 5KMKA 2ETRA 2Z02A 2UW6A 2ZJWA 2UZUE 4AA0A 2R3PA 3O23A 3GBZA 4KSPA 4LGDA 4FYOA 4EK4A 3BL9A 3BLAA 4RWLA 2WQNA 2A98A 3FLQA 2OSCA 4QMOA 2YWVA 5CU0A 2V7OA 4TWPA 5AV2A 5FQDC 5EDQA 4FVPA 4NCTC 2WELA 5H8EA 3FEGA 4AW2A 5IF1A 2I6LA 2P2IA 5FDPA 2IG7A 1P2AA 3BPRA 2ESMA 3F5PA 2JD5A 4FG9A 4GK3A 3MWUA 1Q4LA 4S30A 5DI1A 3BL7A 4OR5A 3DKGA 4IDTA 3RCJA 2C3JA 2FSLX 3ZO4A 2XIYA 4IADA 1STCE 3NNWA 4FEQA 3W0OA 1B38A 2J6MA 2UZLA 1U4DA 4XX9A 5DE2A 3QD3A 3ATSA 4CG8A 5FLFA 5CI7A 4CG9A 5J1VA 4DG0E 2A19B 2YJSA 4FSYA 2OBJA 2BROA 5IDPA 3MPMA 4M13A 1M7QA 2ITYA 2QU5A 4DEHA 3OXIA 2R3IA 4FSZA 3S0OA 1NY3A 4U6RA 2XIZA 4UV0A 2XF0A 2GQSA 3O5AA 4UMUA 3S00A 4XP2A 2OF4A 5DGZA 4FIEA 5JFWA 3WZUA 2QOFA 2IW8A 3QQHA 4KABA 4EH9A 4UX9A 4II5A 3PLAE 2BMCA 1OGYA 3CKWA 5AX9A 5HLPA 3UC3A 3ENHA 4ENYA 3AT2A 3WILA 4ZIMA 2VWUA 2X7OA 3LJ0A 3LM0A 3HV5A 5CX9A 3PVGA 1OL1A 4F09A 4I94A 2YERA 4N70A 1H08A 5FM3A 4BCGA 4F9WA 3MN3A 3WYYA 3KA0A 4I6BA 4UZDA 4M68A 5IQFA 1UNGA 3O8TA 2VWWA 2YIQA 4CQGA 5HG9A 1WBWA 4DHJA 4O81A 2O65A 4YC3A 2E2BA 3AC5A 5CNOA 5C8MA 3EFKA 4QTEA 5DR2A 1ZRZA 3NUNA 2KULA 4JX7A 2GSFA 1P4OA 2X9EA 3VBXA 3BYVA 2YDKA 5F1ZA 4FL2A 3ZM4A 1OBGA 2ZV7A 3DBFA 4AZTA 5CQUA 2WFYA 3VF9A 2EB3A 3PJ1A 4F70A 4I6HA 1FOTA 3POOA 1URCA 3DB6A 3SXSA 1PYXA 5JQ8A 1ZXEA 3OUKA 3KXXA 4N57A 2YCSA 4G3GA 2A27A 1ZMUA 4FT7A 3VBTA 3TKUA 3MB6A 1FVVA 1PXKA 3ROYA 4A4LA 1YOJA 2OKRA 2YJRA 4O7YA 3F5GA 4QMNA 4CFFA 2J9MA 4FKPA 3W16A 4RX9A 4AACA 1UA2A 3EQRA 4JQ8A 4AE9A 4BYIA 5BVEA 4KSQA 5IG1A 3EQCA 2X39A 2IN6A 1GOLA 3UZRA 3HVCA 3SXRA 5CSPA 1YXUA 2WIHA 3K5UA 4FSUA 1Q8TA 3FPMA 3MYGA 4E4NA 5HLWA 2CNUA 3FAAA 5DOSA 1UKHA 4L6QA 5JQ5A 4FF8A 2F7ZE 4FX3A 4BB4A 2I40A 4DAWA 5HG5A 3LLTA 2BRGA 1WBPA 2WQEA 4RA5A 3HA8A 4FSWA 4AX8A 1U5RA 1H24A 3C0IA 2WMVA 3KXGA 4IB1A 3KK9A 2IPXA 2V7AA 3DFCB 3R04A 1VEBA 4YZMA 5HI2A 3C4WA 3E7OA 3MFTA 2IWIA 4D4SA 5D12A 1ST0A 3TM0A 2NRYA 5HCYA 4UN0C 4F1MA 3HAVA 4CRSA 2DUVA 5J79A 4XRJA 5IU2A 3HYHA 5E8WA 5ETCA 2UW7A 3A2CA 4EL9A 4RJ4A 1P14A 3ERKA 3N4UA 3OOGA 3BLRA 5AWMA 5M07A 5HE0A 2Y8OA 1ZAOA 4HZSA 4ID7A 4XV3A 4KIPA 4RIWB 3U8WA 3SLSA 3PP0A 3W18A 5C03A 3UBDA 3PLSA 1CDKA 2PUIA 3H3CA 5EHLA 4GT3A 4I41A 4Z3VA 3OUNB 3GGFA 4GFOA 4UMTA 5CVGA 5L2SA 1K9AA 1AGWA 4DTAA 2R3GA 4IZAA 3UVRA 5CI6A 3I5ZA 1H1QA 4KKHA 5BVKA 4TTHB 1Q41A 1O6KA 2EB2A 3SRVA 3IW4A 4DFYA 1FMKA 4FV2A 4OBOA 5EYCA 1WCCA 4QYHA 1U5QA 4OUCA 3DZQA 3SOCA 2C3LA 1J7IA 5AFVA 4PP9A 4F0GA 2BRMA 3R9NA 3I7CA 3P7CA 4D2PA 3PA5A 5JFVA 1H8FA 2PVKA 4R7HA 3FL5A 5AUZA 4AOTA 4LRJA 4IX4A 3KC3A 4YMJA 5A4CA 5M08A 4U44A 1RE8A 1GAGA 3R00A 5AUTA 5IEXA 5HTBA 1PKGA 2BHEA 5CAPA 3EN4A 3EOCA 4YNEA 1ZYCA 2GFCA 2UW8A 2WEIA 3R21A 3TTJA 1JKKA 1MQ4A 4HGSA 4UZHA 5DH3A 4UMPA 2GU8A 3IW5A 4PL3A 4JMQA 5CF8A 4QYFA 4X2FA 4LUDA 4RWIA 4P4CA 1YI4A 2HXQA 4QDVA 3SQQA 3VUMA 5CT7A 5AUUA 4XRLA 2VRXA 4O21A 1JSTA 2HZIA 2Z60A 3FKNA 4GFMA 3EN9A 3QRTA 4MWIA 4OTWA 4F1TA 4HVHA 4JVGA 3HV3A 4I92A 4X21A 3QTQA 4O84A 4QYYA 5CXZA 2RGPA 1E9HA 3PY0A 1W7HA 3NNXA 4HCVA 4FODA 3U9CA 3W8QA 3OT8A 3FI2A 2GDOA 3UGCA 4ZTLA 4PMTA 4XH6A 1OIUA 5A4QA 4G16A 4RWKA 1PW2A 2VO3A 1PKDA 3R1QA 4BCPA 3E3PA 4M15A 2JIIA 5AM7A 2B9HA 3OTUA 4JRVA 4IAAA 3ZFYA 3DBEA 4WRSA 3PXKA 2LAVA 1OZ1A 2XK3A 2VX1A 3CIKA 2XIRA 4MD7E 4OTPA 1KE5A 3FI3A 4RWJA 5DT0A 4IX6A 5AP4A 5HBEA 4ACDA 4AXDA 4QTCA 2UZOA 3TUCA 2WKMA 4FNYA 3VUGA 1GZNA 1X8BA 2AUHA 4KA3A 1Q8UA 4ACCA 4C4HA 2W1FA 4CT2A 3BU3A 3COIA 2RF9A 1H1WA 4K2RA 2OIQA 1NVQA 4EBVA 4ZY6A 2GCDA 1LUFA 2GNIA 5BUJA 3FL4A 4TN6A 2H8HA 3C4ZA 2YA9A 3OWPA 4HCUA 5L6WL 2HWPA 4O86A 3S2PA 3ALNA 2P3GX 3F9NA 2JBOA 3BE9A 1W84A 3VUIA 4DDGA 2W9ZB 1O6LA 4IVCA 3UE4A 1DAWA 3O96A 2JC6A 5AUWA 5HVYA 4BHNA 1WBNA 2GNGA 2J4ZA 3FJQE 3LOKA 4I5PA 4W4VA 3DA6A 5K5NA 3U6IA 3DJ5A 3P5KA 3I79A 4JLCA 4KIKB 4DEGA 3V5QA 2VX0A 4Z9LA 5CZIA 5IQEA 3JS2A 5AV1A 3OW3A 5FUTA 1UU7A 4E5WA 4AQCA 1BI8A 2PZ5A 4BCFA 3QTXA 2I0HA 4W4XA 4BJJB 2XNPA 2PSQA 1PF8A 3FZOA 3WE4A 2XAOA 1H28A 4LI5A 5CTPA 2C3KA 2WMUA 4RIXB 2R7BA 1W83A 3E88A 4DFLA 4YURA 1SVEA 1LR4A 5HIBA 3C0GA 2YM6A 3QQFA 4ITJA 2ZFYA 2X8EA 4CFXA 4MHAA 5DWRA 4EKKA 5HVKA 4JOAA 1ZY5A 3QZGA 2BDWA 2Q0NA 5FDXA 4QTBA 4G6NA 4MD8E 2NRUA 4YJPA 3BYSA 4RFZA 4AN9A 3L9LA 2WMWA 4MYGA 5CNNA 4AZEA 3CEKA 2YIWA 4BCIA 4F6WA 3KGAA 3E64A 4PF4A 1GY3A 1OGUA 3AXWA 5CU4A 1SMHA 4TRLA 5CS6A 2NO3A 5A3XA 5L8LA 3MESA 5EG3A 3FMJA 4IXPA 4IIRA 5EYKA 5A4LA 5EKOA 1ZYSA 2C5NA 2WEVA 1Y8YA 4IFCA 4O0SA 2ZAZA 2OIBA 4OTGA 2PHKA 3EWHA 4U3YA 3G33A 3ORZA 4WD5A 4IB5A 5KZIA 1PXIA 3PZEA 4MF0A 4X3FB 4XV1A 3TV4A 3MS9A 2ZDUA 1XBAA 5K4IA 1KE6A 2R3KA 3QTWA 4BDEA 4FTCA 3ZS5A 3DOGA 2OG8A 1F3MC 4WNPA 5GZ8A 1Q8YA 5E7RA 2ZYBA 5HHWA 4A06A 4BDAA 3LCKA 4EBWA 4FJVA 1FGKA 4RPVA 5CEOA 4L9IA 2ZB1A 5FM2A 4FC0A 2YM7A 3KU2A 3V5PA 2ZOQA 2V22A 2PZIA 3EQFA 1MRVA 3BELA 4UWBA 1LP4A 2X1NA 4XG9A 4Y85A 2W1DA 2PUPA 4WG4A 1FQ1B 2HAKA 4M97A 4U5JA 4J8NA 3ANRA 4YTHA 4ZTNA 3ALOA 3DKFA 4GIIA 5DR9A 1H0VA 2OFVA 4YJNA 2B9IA 4U79A 4PY1A 3R8VA 4AZSA 4DEEA 5ETIA 2YAKA 3F7ZA 2AEGA 5DFPA 1MRYA 5BYLA 2Y4IB 4MXZA 3SDJA 3RBWA 3RZFA 4O7RA 4ZZNA 3M42A 3QLGA 3QC4A 3EN5A 4L42A 4PV0A 5K9IA 1VLRA 4RA4A 2PVHA 1GIJA 2YITA 2C47A 2QONA 2IF8A 4I5HA 3ZBFA 3VUHA 4BWKA 4D2TA 4F7NA 5IQDA 4B8LA 3RNYA 4MTAA 5DEYA 3QYWA 4EK8A 3ZZEA 4V04A 5BQ0A 1WAKA 1GIIA 3SG8A 4DHIB 2ONLC 1JLUE 3QC9A 2GMXA 4XG4A 3LMIA 4FTAA 2XKDA 3EN7A 4JRNA 4U42A 3UMXA 3ZUUA 4QP9A 5ACBC 3D5UA 5KUPA 2R0UA 3BZ3A 3JYAA 3G2FA 4I6FA 2XJ0A 4YJRA 4GKIA 2EUFB 3KULA 2VWZA 4ASXA 3PZHA 4X2NA 3L8SA 4PP7A 1TQPA 5AAEA 5LCJA 4JBVA 1PMNA 4M14A 2RIOA 2WGJA 3WE8A 4D9TA 3TUBA 2EVAA 1XH6A 3PY1A 4XG6A 1CMKE 4FT5A 4XP0A 4YLJA 2PVLA 2I7QA 1JWHA 4FNXA 4HPUE 3ZSIA 5DA3A 2OXDA 4M0YA 5EHYA 5M53A 3FKOA 4IJ9A 4I21A 2YCRA 4EI4A 4FKUA 1OL5A 3ELJA 3TACA 4K0YA 4DBNA 2XKFA 5KMOA 2IVVA 4QTDA 3OT3A 3HKOA 4R1YA 3KREA 2I0EA 3FBVA 2XJ1A 1F5QA 4ZMFA 2YIRA 3FLZA 4TKSA 3I6UA 3NUXA 3BWFA 3R7IA 3VBYA 2H6DA 1OL2A 4FSRA 4AS0A 3V8SA 2A2AA 3DGKA 3R1SA 3ZSGA 4BCQA 4BDKA 4ZJVA 3FMHA 2VTSA 4EYMA 3C5IA 3EJ1A 4H1JA 1RW8A 3R02A 3FC1X 5AR4A 3EYHA 4CYIA 1ATPE 3PXQA 1OBDA 2E9PA 4H05A 3AGMA 3JUHA 3FSFA 3ZC6A 4BIDA 3OW4A 4LQMA 4GYGA 3HV7A 3U87A 3KRRA 2XNOA 5LVMA 3OVVA 4FKJA 4FZ6A 5HO7A 4Z7HA 5GINE 4BKYA 4C4EA 2QOQA 2YIXA 2ZM1A 3PXFA 3D7ZA 2RL5A 3W0PA 2R3RA 4F1OA 2W1IA 3C4XA 1JPAA 5AIRA 2IVSA 4LV5A 4RRVA 4IX5A 2R5TA 2OZAA 2WMXA 2WTKB 3MY5A 4NM5A 4Y72A 4EWQA 5IA1A 4DFXE 5IUHA 3W0NA 5J7BA 3H9OA 1G8AA 3F2RA 4AQKA 3MV5A 4V0GB 4B0GA 3FQEA 1QCFA 4TYIA 3BWJA 3PWDA 3QKKA 1ZWSA 5ANJA 3I81A 4DGLC 1H1SA 1ZYJA 3COKA 3SXFA 2QKWB 2E9OA 3E8DA 5CSVA 4HW7A 2ITOA 4FV9A 4WA9A 3EQHA 4FL1A 3HA6A 4FOCA 5CY3A 1SM2A 4QMQA 2YHVA 5KMIA 4Y83A 4TW9A 1XMMA 2WTIA 1KE9A 2P2HA 2JAMA 3KF7A 4GVJA 3ZLWA 1ZZLA 4R78A 4R3PA 2EU9A 2R3QA 2VZ6A 1R3CA 2PVRA 5I9WA 2YLEA 3W0RA 3HV4A 4ZLZA 5CAQA 3DXPA 4P5QA 4QMUA 5HG8A 4O7NA 3LMHA 3U4WA 1OKZA 1M2PA 4O4BB 4GIHA 4MXXA 2GTNA 2RFDA 3WYXA 4BRXA 4K6ZA 5LVNA 3HDMA 3AKJA 3Q2MA 4GT4A 4O91A 2ITWA 4LOOA 4FRFA 4D2SA 3F2AA 2PUNA 4NFNA 2CMWA 5FP6A 4PL5A 5GZAA 2BTSA 4IC7A 2XANA 2VX3A 1R0PA 3D7TB 3TUDA 4KRDA 4FL3A 2C6DA 4G6OA 2Y6MA 3O8UA 4N6ZA 3EL7A 2I0YA 3QFVA 2VTNA 3D9VA 5FP5A 4AXEA 2OIDA 3B2TA 4TZRA 2HXLA 4FVRA 2GNJA 4FKWA 4ONAA 5HEZA 2R0IA 3LW0A 4HOKA 4CFNA 5HU3A 3O17A 4DHFA 2C1BA 3A7FA 4NW5A 2BHHA 2J0JA 4LOQA 2X0OA 3F7WA 3LFEA 1YWNA 3BIZA 4V01A 3RK9A 2CKQA 3VQUA 3R63A 4IZ5A 3FLYA 3A99A 4BF2A 4CSVA 2QKRA 1W2FA 4CZYB 2VTRA 4YJOA 4C02A 4D1SA 2BKKA 3BYUA 4W9WA 5GNKA 3TKIA 4QPSA 5AP7A 4EOQA 3CD8A 3RCDA 1R78A 5IKWA 4FSNA 4F9AA 5CANA 3C9WA 2E9NA 5L2QA 5KZ0A 3ZRLA 3ATTA 4R1VA 4FV8A 4TXCA 2UVZA 5CVHA 4NU1A 3HMOA 2XK6A 2ONLA 3VS7A 4DHZA 3LAUA 4FGBA 3WARA 2YM4A 1KV2A 1GJOA 2YEXA 5LCKA 3RALA 4QP3A 2BPMA 3TJCA 3WZJA 4ZP5A 5D41A 4AW5A 2C5YA 4GJ3A 3V5WA 3W55A 4QQTA 5EI2A 4R5SA 4QP1A 4EZ5A 4FTNA 5AR5A 3U6JA 1GZOA 2JBPA 2QR8A 4OTRA 2B0QA 1ZMVA 2P33A 4FIIA 2Y0AA 4GMYA 4XG3A 3L9MA 5HO6A 3WF5A 2C6IA 5TT7A 5DT4A 4KKEA 4LV8A 3UNZA 1XQZA 2OU7A 3Q96A 3ZO3A 4USFA 4F6UA 4PX6A 4H36A 4E4LA 3EL8A 3OD6X 5IUGA 4FIFA 4OAVB 4NK9A 4DN5A 3BX5A 3KQ7A 4E7WA 3FXWA 3GC7A 5DIAA 4ZZMA 3DFAA 4CLIA 5L2WA 3C4FA 4ZLYA 4IVBA 5HNGA 1J1BA 3D5VA 2CGWA 4WHZA 3BYMA 3GQIA 3ODZX 2VWXA 2C6TA 2UZEA 3GC8A 4GRBA 2PVMA 4C34A 4CCBA 5K5XA 2VWYA 1W2CA 2VNWA 2YCFA 3CP9A 3T9IA 3FLNC 3ZUTA 4RX8A 3ZXZA 2O64A 5K3YA 4G9RA 3RTPA 4IJPA 2KTYA 3A4PA 3UDTA 2IZUA 4I0RA 1ZARA 5D10A 5FRIA 2XK8A 3BQRA 3I0QA 3Q3BA 4IE9A 5AP2A 3UZPA 5GIOE 3QXOA 4EOKA 4B7TA 3QGYA 3BCEA 3RKBA 4MXYA 5ETAA 4QT1A 2YACA 2ERKA 4OBQA 3NZ0A 4AGWA 4ARKA 3R8UA 4DYMA 3ITZA 3KVXA 4FSTA 4PMSA 3RI1A 4B6LA 3NAYA 2O63A 4YZDA 3ZC5A 4CTCA 5HX6A 4EONA 2WOUA 1G5SA 1NT2A 3GENA 3VHKA 4ALUA 4CVAA 1P5EA 4IZ7A 4O7TA 2VTOA 4OTDA 4RVKA 4NWMA 3MA3A 3NUPA 5EOLA 1ZOHA 2P0CA 3DB8A 4LL0A 4FEXA 4NZWB 4EH5A 2QURA 3OFMA 3PSCA 2WMQA 3Q9WA 3NW7A 3QCQA 3R8LA 3CKXA 2CDZA 3F5XA 3LE6A 5E91A 4XCUA 1ZLTA 5I5ZA 2CKPA 2C6OA 4HCTA 4TY1A 5BX0A 4DITA 5DRBA 3MDYA