5BUEA

Erk2 complexed with n-benzylpyridone tetrahydroazaindazole
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
348
structure length
329
Chain Sequence
b'PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVATRWYRAPEIMLNTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Ligand efficient tetrahydro-pyrazolopyridines as inhibitors of ERK2 kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 109
structure length 329
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bueA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bueA01
3AD6A 4CG8A 3DBEA 3AC3A 3ORMA 2V55A 2OIQA 4LOPA 4M0ZA 3I7CA 4FNZA 4USEA 3OCTA 2FYSA 2X7FA 3POZA 5J95A 3RKBA 3U8WA 3OUKA 3LLAA 3DKGA 4BDEA 4KKEA 3D15A 4CZUA 3QA0A 1Q97A 3RZBA 3D2KA 1UNGA 1OIRA 2Z7QA 4Y5HA 2ZV9A 2EUFB 4FZFB 4AFJA 1YXSA 3CKWA 4Y8DA 3UO6A 4C34A 4ZEGA 1S9IA 3RBWA 5HTBA 4JVGA 1SYKA 4J99A 3R9DA 3WIKA 1YDTE 3A7FA 1GIJA 3GUBA 3R9RA 5H8GA 4XMOA 2ITUA 3WF6A 2F2UA 3O51A 2ITNA 4WUAA 4F9YA 1PMUA 2ETMA 2QOOA 2QODA 3R2YA 3CTQA 3TNIA 4X3FA 4XS2A 5CEIA 4LQMA 3UYSA 4AZFA 4K8AA 1E9HA 1PW2A 3BGZA 4PP9A 3HRCA 3UOLA 5CANA 2VTMA 3F2RA 3EHAA 2OIDA 3Q52A 2R3PA 4IH8A 3OUNB 1XKKA 3COMA 1OB3A 3ZUVA 2JKQA 2YM6A 3KVWA 4DH7A 2P3GX 2XRWA 4QMXA 5KHXA 4FT7A 2W5AA 4DYMA 4EBVA 4YBKA 4AN3A 4FZ6A 4HVIA 4W8EA 3MESA 1XH7A 3PA3A 4BHNA 2C0TA 2GS7A 4FG9A 3CEKA 3RGFA 3TACA 3FZRA 4FV3A 4WG3A 2HAKA 5CXHA 2IVTA 4JOAA 2R3QA 3I7BA 4RVLA 3JY0A 3ZHPC 1IEPA 4PF4A 4BDBA 1PXKA 4DEGA 1CSNA 4QTEA 2WO6A 4FTOA 3ZZWA 4BCFA 4MVFA 3LCOA 4RFMA 3VUGA 4FIEA 3DPKA 2JFMA 3DGKA 2WMUA 4ANNA 2BMCA 3QTZA 1IG1A 5AUVA 1VEBA 2PL0A 3HV7A 2IW9A 3ZXZA 3TKUA 3WE4A 1BL6A 2PK9A 3Q9WA 1YXVA 3GOKA 3DZQA 4UMQA 4F99A 3REPA 3QC4A 2V22A 1PXIA 4XYFA 1W98A 5L8JA 2Y4PA 3NUUA 4BWXA 3ALOA 1Z9XA 1H00A 3AD5A 3HMOA 3IONA 4JRVA 3BGPA 5BYLA 3MJ2A 2IZSA 3GI3A 4CQEA 2WMTA 4XP0A 3O71A 4FOBA 4MNFA 1ZYJA 2QC6A 4BIEA 2JDSA 2R3RA 4AT5A 2R0IA 4L52A 4AG8A 4CFWA 3FMEA 3IDBA 4MBJA 3UVRA 5IEXA 4XNEA 3CY3A 4LMUA 4YHJA 5LWMA 5ETIA 2PVFA 1VZOA 2WTIA 4MF0A 4QP6A 2Z02A 4WRSA 2A27A 2E9OA 2XRUA 4B8LA 3BWJA 3DFCB 3W2SA 4PMTA 4PX6A 5DLSA 4B4LA 4L45A 4C3PA 4L7SA 3KU2A 1YQJA 4G6NA 5CSVA 4B8MA 2WMBA 5I4NA 5FTQA 3TL8A 3GXLA 3HV4A 4BDAA 1P4FA 2RL5A 3PPZA 5ANEA 4E93A 4ALWA 4KUJA 5AAFA 2Y6MA 1HOWA 4IX3A 3S3IA 5AP7A 5EM5A 4S34A 3DK3A 3RPYA 1P2AA 3K5UA 5CVHA 2GTMA 4YGAA 1JKLA 1WFCA 4GT3A 4IJPA 4D4VA 4EHGA 1OITA 2UW6A 3GCUA 4QYYA 4M68A 2R3FA 3RPSA 3ZS5A 4ANLA 4NTSA 3PDTA 4WOVA 4FV1A 2OU7A 3P86A 2C6OA 5I9ZA 5EYDA 4FOCA 3DAEA 1UV5A 5IPJA 3V04A 4E73A 2ZB1A 3KQ7A 4ZY5A 1GNGA 5BVOA 4OGRA 2OZAA 2UW4A 2C6DA 2AC5A 3H9OA 4RFYA 3H30A 4APCA 3ZRKA 2R64A 4A4LA 3GCVA 2W1IA 5HORA 2WHBA 3LVPA 4E7WA 4GKHA 1YW2A 3R1QA 2JGZA 3QYWA 5IQDA 5BPYA 3RM7A 3NZ0A 2I7QA 2GNGA 4MAOA 5J7BA 4QP1A 3OFMA 1MQBA 3LXKA 5HLNA 4HGEA 4EUTA 2XIYA 3MTFA 4QP2A 5DYJA 4A9RA 3QTWA 4ZJVA 4YZBA 1MRYA 4M14A 2WU6A 3CQWA 2XMYA 4CLIA 4F6UA 3PA5A 4FSNA 2HZ0A 3G0EA 3QGWA 1Q4LA 3ET7A 4NWMA 1Z5MA 3TNWA 4FBXA 4TWPA 4OR5A 4EORA 4MD9E 5DE2A 4LRJA 2VO3A 4PDSA 2BDJA 5IQIA 3QGYA 4QMNA 1WBNA 4IFGA 4KS8A 4TYJA 5HICA 4EQCA 2RFEA 5HLWA 3F88A 3DXNA 3PYYA 5HTIA 1KE9A 4ITIA 4IAKA 5CU2A 3VUTA 4WNOA 1BMKA 2R3HA 2R3KA 3R8ZA 5A6NA 2B1PA 4HJOA 5I9VA 1H27A 5K4JA 5FEEA 5HZNA 2G15A 3RALA 3N4TA 3DFAA 4LG4A 1XQZA 3ZM4A 2WIHA 5GIOE 5CZHA 4J8MA 5EH0A 3FQEA 4QMLA 5H2UA 5HG8A 2I1MA 2IVSA 1W83A 2QR8A 2CNVA 3KC3A 1OUKA 2IW6A 4FYNA 3VQHA 4C02A 4EOJA 2IN6A 3BCEA 4I4EA 1FMKA 3BRBA 4FKPA 4UWBA 4QQJA 4TN6A 3QD3A 3LIJA 3EFLA 5DR9A 5GNKA 3EB0A 3V01A 2C5XA 3S95A 3G0FA 4XG4A 3TUDA 3D2IA 1CDKA 3OW4A 1WBTA 2UZNA 4ZSEA 4XG8A 1ATPE 1ZOHA 2O5KA 4DH1A 5BMSA 4P5ZA 3QQJA 4M69A 3DS6A 2O64A 3NW5A 3UOHA 4O0XA 3KGAA 3UPXA 4GU9A 3WF5A 5H9BA 3P5KA 1JPAA 4K2RA 3DLSA 3EQHA 2VTJA 3LJ2A 3PJ3A 5M51A 2VO6A 3F3UA 3PP1A 4L6QA 3HYHA 2W1ZA 1M7QA 4IM3A 5HI2A 1OL2A 4X3FC 2WNTA 3NRMA 4LL5A 4JR7A 2W9ZB 5CS6A 5HE2A 3I1AA 3WARA 5CF6A 5IQHA 4DT9A 2R9SA 4QMSA 2BDFA 2W1HA 3LCTA 4D2PA 3LMHA 4Y73A 5AR2A 1XBCA 4BFMA 4CT2A 5DR2A 3ULZA 4ZOGA 3QU0A 2WMQA 3IW5A 4J1RA 5AX9A 2WTWA 4FG7A 4FX3A 4FSUA 4OBPA 1OECA 2W05A 1REKA 1LEZA 4E8AA 2GMXA 4BIDA 4XCUA 1CKIA 3TIYA 4J7BA 2ITXA 4P2KA 5HNGA 3U9NA 3POOA 3ORLA 4ZMEA 3TJCA 4WIHA 2YM3A 2YM4A 4AT3A 4EOMA 1GAGA 4WT6A 4UMUA 3RNYA 3DJ7A 4AACA 2V62A 2XBJA 3W1FA 3D5VA 2UZTA 4HYIA 3LFFA 4WKQA 2J0IA 3QCXA 4IZ5A 4PNKA 4FIGA 2WQMA 5KMOA 4L7FA 2WMVA 4OAUC 4JG8A 2PVYA 4FIIA 3VHEA 3ZH8A 3SHEA 4DEAA 4E4MA 2R5TA 3NAYA 4CMTA 4D5HA 4FTKA 4F1MA 2YLEA 1STCE 1R39A 5BMMA 3TNQB 3BYVA 3Q3BA 4FKSA 4ZTQA 2WIPA 2OLCA 5IA5A 2W06A 4ZLYA 3H3CA 5BYZA 2QOHA 3QCYA 3ULIA 4YUQA 4RA5A 4L53A 2X0GA 1PXJA 2HZIA 3R7IA 3VBWA 4ALVA 3CSVA 4IDTA 5AUZA 2J0LA 5M06A 5L2WA 4O7WA 4EC8A 4U43A 3L8XA 3Q4TA 5DR6A 5BUEA 5AADA 3ZBFA 2GPHA 1WMKA 4NEUA 3DZOA 3HV6A 2JKMA 1OKWA 3V8TA 3ZLYA 1YHWA 4U42A 3TDVA 4DG2E 3R6XA 5CSPA 4K1BA 3FBVA 1FMOE 4IQ6A 2XYUA 3N51A 5D10A 5IMXA 3LM0A 3EMGA 4IAFA 3TT0A 2BILB 4FSYA 2XA4A 2RG5A 2ZJWA 3SKCA 5EI6A 3FDNA 1W0XC 2ITQA 4O2ZA 4NCTA 1WCCA 5M53A 1LEWA 4JXFA 2GU8A 4U5JA 3QQLA 3K54A 3NUYA 3UZTA 3BI6A 3LFSA 5HG7A 2XCKA 1OL7A 3PXKA 4BI1A 5AM6A 2I0HA 2F2CB 5F9EA 2CNUA 4PDYA 3PSCA 4TTHB 4L43A 3GBZA 1HCLA 5CU4A 3UODA 5M4IA 3OC1A 4YC3A 2PZRA 1NVRA 3O17A 3KULB 2WMXA 4KKHA 4EOLA 5FD2A 3ROCA 3C4XA 4MF1A 4MD7E 4F9AA 1PXPA 3E8DA 2IVVA 4AW5A 3TV4A 3QKKA 4JNWA 3GB2A 3P1AA 4FSRA 3PG1A 2QOIA 2OSCA 3B8QA 3KFAA 2A4LA 4FKWA 3AMBA 4UZHA 5HBJA 4ZSLA 4GT5A 4GG5A 3VQUA 3HV5A 3BV2A 5IH4A 1PJKA 4MNEB 1H08A 3CTHA 3VJNA 2G9XA 3R30A 5TOZA 3R9HA 3K2LA 2WQOA 4EK8A 4FNXA 4D9UA 2CSNA 4U97A 3UIXA 2C3KA 4G3GA 5F20A 2OO8X 1WBPA 1WAKA 2YLFA 5EOBA 5IF1A 3O8UA 4G3EA 4G9RA 4FV5A 4YJTA 2JLDA 1Q62A 4FTUA 1SVHA 4BIBA 1XH5A 3VBXA 4F64A 1FGIA 3U6JA 1WBSA 3BLQA 4O7VA 4K6ZA 5BUJA 3NW7A 5EG3A 3CY2A 4H1MA 4N70A 5F95A 3OWLA 5C8MA 3MJ1A 4Y83A 4A7CA 4DEBA 3UNKA 2CMWA 3P7BA 5F1ZA 2X39A 1IAJA 2W5HA 4EWQA 4ZTMA 3PJ2A 3JYAA 4R77A 2XK4A 4RJ6A 4BGGA 3PRIA 4V01A 5B2KA 3I81A 4B0GA 2F7ZE 4H39A 3RZFA 2WPAA 4U45A 2CGWA 3QTQA 5M57A 3ZUUA 2NO3A 4IWOA 5F4NA 1QPDA 5CSXA 1YI4A 3NDMA 4UZDA 4DFYA 5HIBA 4KIKB 5HVKA 4AU8A 3RAWA 5IISA 4XJ0A 5FDXA 2PVMA 4BKZA 3BV3A 2UW5A 3FKOA 4IIRA 4E4LA 5LVOA 1NT2A 2PTKA 3L8VA 5CLPA 2XK3A 2C6IA 1FGKA 2Q0NA 4BYJA 2UZWE 2ZDTA 3E7OA 3RVGA 4R5YA 3TEIA 5J5TA 2AYPA 3H10A 3KA0A 4BI2A 5EHYA 2OJGA 4GMYA 3FWQA 4FSZA 3LHJA 4NSTA 3ELJA 1OIQA 1XHAA 2B52A 2YDIA 3KRWA 3D0EA 5M44A 2NNWB 1H1QA 4L01A 4ZJIA 1M2QA 4BDKA 5FUTA 2BCJA 3L9LA 5AUWA 3FY0A 1ZZ2A 4TKSA 4GK3A 5JN2A 2CKPA 3QYZA 4RC3A 4AN9A 1OKZA 4F9CA 5FLFA 3THBA 4DTBA 2FSMX 5K9IA 4O7TA 4WD5A 2BFXA 4C7TA 2J6MA 1R3CA 4WRGA 4AGWA 1UWHA 5CNNA 2WFYA 3BEAA 4FL2A 4XOYA 3N4VA 3DY7A 5KMMA 4GK2A 2BROA 3QD4A 3RP9A 3ACJA 4EQUA 4JDHA 4RIXB 2LAVA 3WILA 1OVEA 4TNBA 5J1VA 2YITA 4PL3A 3FZOA 2Z2WA 4B99A 3C4ZA 1PMVA 3GC7A 3NGAA 2FUMA 4B6LA 2V0DA 3EFWA 1KSWA 4DF3A 3QCSA 5HGIA 3LQ3A 4H05A 4C3RA 3UYTA 2NRYA 4MWIA 4J96A 3V5JA 4XHKB 3G6HA 3O8PA 5DMZA 3DNDA 4FZ7A 3KK8A 4TZRA 3SV0A 3DDPA 5CALA 5LOHA 5AP5A 3RHKA 1ZARA 4O1OA 5HIEA 5AR7A 1M2PA 2XM9A 5G1XA 1M17A 4AOJA 2VTQA 3BEGA 1Q41A 1Q8WA 1XBAA 2JIIA 4PPCA 4YJVA 5T3QA 3QXPA 4F1OA 3M2WA 1RE8A 4FEQA 2DYLA 4R1VA 4ZXTA 3CXWA 2XK9A 5FBOA 1Q5KA 2VO0A 4XRJA 2W96B 3W2RA 4GW8A 3QZGA 4YJNA 5IUIA 4LL0A 1PKGA 2W1CA 2PSQA 2FSLX 3HA6A 5HKMA 1HCKA 4DGMA 5L4QA 2OXDA 2YM8A 3RCDA 3FKLA 3UOKA 4ENYA 1H1SA 5C8KA 4N4SA 1P4OA 2R7BA 2CKEA 3EWHA 4M8TA 5E8SA 5E8WA 3SC1A 1LPUA 3P79A 3NWWA 4NM7A 3UP7A 4RX8A 4ZAUA 5AEPA 3LFBA 2RFDA 2YCQA 4A4OA 1KV1A 4MX9A 2HCKA 3C1XA 3E87A 1QPCA 4KIQA 4CCBA 3AC5A 4AXAA 2W1EA 3G15A 3BQRA 4H1JA 4C4IA 3RTPA 4GYGA 2BRNA 2WOTA 3CD8A 4X21A 3RAIA 3MVMA 4MNEA 2WTJA 1FOTA 1FVVA 2XBAA 3FLZA 5DG5A 4I6QA 4G3FA 5EDPA 4BYIA 4EUUA 5DPVA 2YCFA 4OT6A 4M66A 2W1FA 4G9CA 3ITZA 5AIKA 2H8HA 2R0UA 4RLKA 4AGDA 2BTSA 3A7IA 5E8XA 2AC3A 2YFXA 3H0YA 3SQQA 4X7QA 4BWKA 2WEVA 3WZDA 3FZ1A 3PVWA 4W4YA 2J5FA 2J9MA 3FC1X 4PDPA 1SM2A 3C4EA 4OUCA 5HE3A 2X8DA 4NM3A 2ZM1A 4JBPA 2ZB0A 3C13A 4G3CA 4Y46A 3DBCA 3FMKA 3HMMA 4MK0A 2WZJA 3B2TA 2RIOA 4QP3A 5KZIA 4FSQA 3ZO4A 5CVFA 4N57A 4A9YA 4IX5A 2J0MB 4BKJA 5ETFA 3RNIA 1Y6AA 2BTRA 4TYHA 5M55A 4FC0A 4DG0E 2HELA 4G17A 4TPTA 3QWJA 3GU7A 4YO6A 3D4QA 2VWBA 3UGCA 3ZO3A 3PZEA 5M09A 5IH6A 3UBDA 3SG8A 1H1RA 3OROA 2O63A 4KIKA 5HVYA 3FXWA 4QOXA 2GHLA 3HLLA 5CT0A 3C4WA 4BVUA 5KBRA 3E3PA 4ZJJA 3UTOA 4BHZA 4O27B 3BGQA 3FLYA 5E1EA 4XH6A 4EL9A 4HNFA 1Z57A 4I23A 2XKDA 3A7GA 3G51A 4MXXA 4QMZA 5HBEA 5TE0A 4D1XA 5KUPA 1H26A 2W1GA 4UXQA 4F7LA 1Y8GA 4PMSA 4IVCA 4PL5A 3COHA 2VGOA 2A0CX 4HCTA 4RC4A 3ZBXA 4FT0A 4IB0A 3UMXA 3ORKA 2KULA 2PVJA 4BTMA 2YAKA 3CBLA 1U54A 4YSJA 3ZC6A 2C3LA 3Q6WA 3ORPA 3S0OA 3ZO1A 5EHLA 4BF2A 4DEHA 2QG7A 2H34A 4D2SA 4P4CA 3OBGA 3CGFA 5FXRA 2CLQA 2WU7A 4JAIA 2X1NA 3COKA 3D5UA 2XH5A 2QD9A 5FGKA 3QHWA 4AZTA 3R02A 3MH3A 4MXCA 3QLFA 1M2RA 4W9WA 3MSSA 4BBFA 3R9NA 5I0BA 2C69A 3LCDA 1O6KA 1RJBA 4IB1A 3EOCA 3EQPA 4BGQA 3F3VA 4O7ZA 3IW7A 4IBMA 4QMTA 4RIXA 1BUHA 3AGLA 2UUEA 5EI2A 3DOGA 3I60A 1FPUA 1VYWA 5EYCA 2R7IA 5AWMA 4L44A 3TV6A 5C01A 3ZSHA 3SG9A 3DBDA 5E8TA 2W99B 4AE6A 4PPAA 3DAJA 2ITWA 3PLSA 5AV0A 1KV2A 3ZOSA 3VF9A 4GS6A 4U81A 2W4JA 3QRUA 2C6MA 1U46A 1KE8A 4KKGA 1GOLA 4O0VA 3TKHA 1JQHA 4W4XA 4O91A 4XLIA 3KB7A 3E64A 2QLUA 4ZP5A 3RK7A 5LXMA 2BZKB 4IW0A 2WQEA 1YI6A 5JGBA 4G5PA 3FEGA 3OHTA 1OL5A 4U3YA 2X7GA 5D41A 4EK3A 1KWPA 2OH0E 3EIDA 3FUPA 4I0TA 3MVHA 4CD0A 4FSWA 3UC3A 5DFPA 3A7HA 3V5LA 5E1SA 4C59A 3ATTA 5JFXA 3DCVA 3EQDA 2CLXA 1XH9A 3BBWA 3VUDA 4CZTA 4GCJA 2PZPA 1MP8A 2OH4A 2C6EA 2C4GA 3PVBA 2OFUA 4GYIA 5K5NA 3AXWA 3VO3A 4QNYA 3RINA 4U6RA 4MXOA 5AUYA 4DC2A 3BYUA 3ETAA 2PE0A 3U4WA 3Q9ZA 4QMQA 2HK5A 4BCNA 5EQEA 2ONLC 4TWOA 2QURA 2XIZA 4YZMA 2PMIA 3NIZA 4JQEA 5CAPA 2PE1A 3CJGA 3KN6A 4FZAB 3D83A 5IH5A 4R5SA 1LR4A 1A9UA 2F57A 3L9MA 4YU2A 5AAGA 3MPAA 3WF7A 3DTWA 1J7IA 1Q24A 4U79A 5CF4A 3PVUA 2WTKB 3LW0A 3V5PA 2ZM3A 4O81A 3E63A 4IXPA 5GHVA 1KOBA 2I40A 4YJSA 5IDNA 3FLWA 5L8LA 4LFIA 3GCQA 3K3JA 4D58A 5EKNA 5HX8A 4I94A 3MFUA 2GTNA 4OTGA 4RQVA 5J9YA 4GVJA 2QOFA 1W8CA 4G5JA 3CD3A 3WBLA 4DGNA 4JQ8A 4ORKA 3P4KA 2O2UA 2Z60A 4QMYA 5HHWA 2YWVA 4EH7A 4FT9A 1ZYCA 3Q60A 3P0MA 5CF8A 2J7TA 2XNEA 3HA8A 3DNEA 2F7XE 2VWYA 3IK3A 4K9YA 5FP5A 4Z3VA 3HRFA 3T3UA 1U5QA 4D5KA 4WNPA 4GEOA 4XRLA 3V5QA 3GCSA 3I0OA 3P7CA 4NW5A 2WQBA 4CRSA 4YMJA 3GFWA 3FMNA 4NH1A 1NVSA 5EW8A 4D28A 4YJPA 4FKGA 4DEDA 4K33A 5CYIA 5L3AA 3OZ6A 4QYFA 2VWWA 3OD6X 5IQCA 4FMQA 3KXZA 3LFDA 3DXPA 2I6LA 1XR1A 2XKCA 4DAWA 3R9OA 2BZIB 3TNHA 4BCQA 4PNIA 2VAGA 2OWBA 2BRGA 3A61A 3E8NA 4J71A 4RIYB 5DEYA 3VW8A 3ZRLA 2JKKA 5J7HA 5JRQA 5L6PA 3PXQA 2ZMDA 3WIGA 1J7LA 5KMIA 5BVDA 4DBNA 2C3IB 5L6OA 3VS4A 3VNTA 3A2CA 4XLVA 4EHVA 4KB8A 2ITOA 1A06A 4D55A 2Y7JA 4FEUA 3GC8A 3LMGA 3BX5A 3CP9A 5DEWA 2R3MA 3FLNC 4CFFA 2GNIA 5HQ0A 5AA8A 2C6TA 2WAJA 4FKIA 4F7NA 4EQMA 1ZAOA 4YR8A 2UW9A 4QTDA 1FVTA 2I0VA 2GS2A 3QUEA 4G3DA 2HY81 3FLQA 3R28A 3AGMA 4KSQA 1YOLA 4DLIA 3E93A 1J1CA 4D9TA 4DT8A 5IEVA 3EZVA 4MWHA 3Q2MA 4XP3A 5HU9A 4BDFA 1P5EA 3OY3A 5EDRA 3T8OA 2BIYA 2WMWA 4YZNA 4NM0A 3WZKA 2IG7A 3MBLA 4AUAA 4USDA 2CCHA 4NKAA 4L3PA 3R8MA 3RAHA 4G6LA 1XH4A 4LUEA 5CAVA 4FKUA 4EYJA 4HCVA 4D0WA 4RIWA 3F3TA 5HO8A 4I5MA 5CAQA 2GNJA 2BVAA 3OBJA 2ETKA 4I22A 4OT5A 4RBLA 5JMSA 5M4FA 4UYAA 3IDPA 3KXMA 4OTFA 1PXOA 3DKFA 5FM2A 4ACMA 4HPTE 4CQGA 2BRHA 3CR0A 4FGBA 2PUPA 3OOMA 4E5WA 4YTFA 4QYGA 2QLQA 4GT4A 3R8UA 5A4LA 3C9WA 4V04A 2HZ4A 4NT4A 4L68A 5CXZA 2B54A 3GT8A 3MA3A 3ZLWA 2YHVA 4BBMA 2W4OA 2BHHA 3CLYA 3PRFA 1ZMUA 2Z7SA 3LPBA 4LUDA 4XEYA 4WSYA 4PDOA 2X9FA 2EXMA 2GSFA 1TQIA 2VWIA 2PMOX 4ACCA 1FINA 3V5WA 4DFUA 2P0CA 1H01A 4RG0A 4HVDA 2FA2A 4UBAA 4L42A 3KRJA 2XNNA 3FL5A 5AAEA 4ANOA 4F63A 2B9FA 4U0IA 4YNOA 3TZ9A 3ZRMA 3NUSA 1QMZA 3BU3A 4LOQA 4EH4A 4U7ZA 3D7ZA 3LQ8A 2QO9A 3BYSA 5CENA 4DINA 4HYUA 3RK9A 4BDIA 3GOPA 2W1DA 4CV9A 3S00A 2PPQA 4F1TA 3FSKA 3QALE 2I0EA 4BICA 4CYJA 4DA5A 4IADA 4HPUE 1JBPE 3U6HA 2OG8A 5HVJA 3ROYA 4UMRA 2B0QA 3MVJA 1U59A 3QWKA 4I6FA 3KF4A 2A2AA 3FI8A 1JWHA 3HKOA 5DRBA 3U87A 3UVPA 1RDQE 5CTPA 1H0VA 3GC9A 2A1AB 1OI9A 5FEDA 3UG1A 4DH3A 3T3VA 2HW7A 2Y9QA 4UMPA 2XB7A 1CTPE 3ACKA 4PPBA 3IECA 1YRPA 4MH7A 4ASZA 3BE9A 3DKOA 2VX1A 2ZDUA 2HENA 3C0HA 4CEGA 4O0YA 4OBOA 4CSVA 4BGHA 5KMNA 3TIZA 3HAVA 3R1YA 4KWPA 2XKFA 4BR3A 5A4CA 4M12A 1XH6A 2XK7A 4FKOA 2IPXA 2XNPA 3NCZA 3HV3A 3OXIA 4U3ZA 2IZRA 3VUIA 4YLJA 4D4RA 2QCSA 3JPVA 4U41A 4E5AX 5ICPA 3UOJA 5GZ8A 2Y0AA 2KTYA 3EKKA 4PRJA 5ITAA 1UU9A 2YM5A 4ACHA 3PUPA 4E5BA 5HLPA 1J7UA 4XV1A 4IZYA 3EQIA 3W8QA 4EHZA 1PMNA 2VNWA 3DJ5A 2Y6OA 5L8KA 2YA9A 1BKXA 2JIUA 1G8AA 3QAME 3LMIA 2XEZA 1CM8A 2YCSA 3NVKI 1JOWB 1ZYSA 2UZBA 4I0SA 3DDQA 4QTAA 3V3VA 4DGLC 3UO4A 1Y91A 4I5CA 4AAAA 4F08A 3MB7A 2Z7LA 4DFZE 3FPMA 1SMHA 3HMNA 4APPA 4NKSA 3KXXA 3KREA 4R7BA 3R73A 1I09A 2OBJA 3FE3A 3OF0A 1E1XA 4HCUA 4ZZNA 3KY2A 3E7VA 4OTIA 4EH3A 3SOAA 2CN5A 4JIAA 3PFQA 1PXNA 4FL3A 3PJ1A 3NNUA 4IC8A 2WKMA 4FYOA 2DS1A 4MXYA 2HXLA 2W7XA 4V0GB 4KIOA 4YZCA 3EJ1A 4FT3A 5AUXA 4M0YA 5HOAA 3CPBA 3P78A 3TN8A 3OOGA 2XS0A 3EL7A 5EFQA 2PZ5A 1PKDA 3BZ3A 3II5A 3TWJA 4E1ZA 3KKVA 2X81A 4NK9A 3TJDA 1OL6A 3PA4A 1K3AA 2B53A 2BRMA 5CSHA 4WG5A 4CFNA 4ZTRA 5FXQA 5LMBA 3FJQE 5IU2A 1VYZA 4TW9A 4BCOA 4BTFA 4C4JA 5AUTA 2ACXA 4DCEA 2QO7A 4FTJA 2C5VA 2BZJA 4WUNA 2FH9A 4FTCA 3KXNA 4RWLA 3BELA 3ODYX 5IA0A 4QTBA 4C4FA 5A54A 2PZIA 2WMRA 1IR3A 4I3ZA 3UJGA 2UW0A 2JKOA 1ZY4A 2YIYA 3HUBA 3RJCA 4BZOA 1EH4A 2XK8A 4F4PA 4R3RA 3IOPA 5E8YA 3LFAA 5AP0A 3W2QA 4KSPA 3PP0A 1H28A 3RWPA 4IANA 3AQVA 2ZVAA 5ANDA 2GHMA 5CY3A 5DHJA 5EOLA 4F9WA 3HNGA 4TRLA 3V51A 3LXLA 4CKIA 4IVAA 5CEMA 4PUZA 4HVSA 2G1TA 4HW7A 3HGKA 3QZFA 4KNBA 1B6CB 2BALA 2XNGA 2ZAZA 4XG7A 3C4FA 2R4BA 2PUUA 4AZWA 3VUMA 3PXZA 5AP2A 4MHAA 4X3JA 3CQUA 3EYGA 4AA4A 1UWJA 2UVYA 3AD4A 1JVPP 3UZPA 4ANBA 4O7LA 3MY5A 4BY9E 4MEDA 3C5IA 4Q5HA 2X8IA 3QUPA 4CVAA 2FSTX 4IB5A 3OEZA 4H3PA 3AC2A 3AT2A 4LV5A 3TKIA 3QC9A 4DHFA 4FVRA 4FF8A 2A19B 2VNYA 3PWDA 3R63A 4BWPA 5C4LA 3KCKA 3PXFA 3OG7A 2OJIA 4GG7A 2ITPA 2OIBA 2YWPA 2X8EA 3A4OX 3CIKA 3IKAA 3C7QA 5I5ZA 4C61A 4F0GA 4IVDA 3TI1A 3PE2A 4C62A 5IDPA 3W10A 2C5NA 3DXQA 1YDRE 2R3NA 3PJCA 5AX3A 5J9ZA 2B9JA 3PXYA 4CTCA 3LFEA 5GJFA 3R8PA 1OIUA 1Q8UA 3DQWA 3LJ1A 4ZK5A 4DTKA 4NIFB 2GS6A 5E92A 2VWXA 5AV3A 4BI0A 5ANIA 5IQAA 1LP4A 2XIXA 4DN5A 1JSTA 2BAQA 2H96A 5M08A 1URWA 3KVXA 3NUXA 5DGZA 2XF0A 3N4UA 3PY3A 1GIIA 4TNDA 5C4KA 4XP2A 5J5SA 3SX9A 4FTLA 5HD4A 1OGUA 2OJFE 4YTHA 1BI8A 3MPTA 5A3XA 4E4XA 1JLUE 4FTMA 3QQFA 5AR3A 1H07A 4L46A 5E90A 2YZLA 5E4HA 3R7YA 3FMLA 4X2KA 3BE2A 4CFUA 4FV7A 1YXXA 4G31A 4HZRA 3W33A 5KBQA 4QRCA 3LCKA 4RX7A 3VBTA 2GFCA 1LUFA 2IZUA 5JT2A 5JK3A 3OWKA 4S30A 2Z8CA 1OUYA 4QP4A 4MCVA 4GU6A 4XX9A 5TF9A 3VHKA 3CPCA 2PMNX 3Q5IA 2UVXA 1H25A 4W9XA 4YJOA 4MBIA 2VTOA 4D0XA 3BQCA 3ZU7A 2RG6A 2UVZA 4MTAA 4BDDA 2VTSA 4F65A 4LMNA 2XP2A 4M97A 1APME 3O96A 4TT7A 3R71A 5AR5A 2OF2A 3FHRA 1IRKA 2PVRA 3IO7A 4KBKA 4CXAA 3IGGA 2YJSA 4A4XA 4D2TA 3MY0A 5CZIA 5JFVA 2ITZA 5A14A 1Y57A 1ZZLA 2CGUA 2ESMA 2HW6A 3NYXA 4ENXA 4DE4A 2GNFA 4QMWA 4W4VA 1G5SA 3F61A 5IA2A 1QL6A 3QL8A 3CJFA 3A8XA 3GNIB 3ZUTA 5C03A 3L8PA 2WTKC 3EFJA 4PL4A 3UP2A 4BDHA 5JH6A 1IASA 2JDVA 1UU3A 4FV6A 2Y8OA 4V05A 3FMDA 1W84A 4F9BA 3SXRA 3NCGA 2WMAA 1ZOGA 4ZTNA 3BU6A 4C4GA 4EOKA 2EXCX 4PV0A 4ID7A 1SNUA 3KL8A 2CCIA 3UQGA 5A4EA 4HGTA 3MFSA 2F49A 2DWBA 3DAKA 1Y6BA 4DFBA 4D2RA 3IPHA 1A48A 4D2VA 4GUEA 4V0GA 3ANQA 1B39A 5H3QA 4NUSA 5HG5A 4YLLA 3BBTB 2XM8A 4GIIA 4EZ5A 3VC4A 4RJ3A 3R2BA 4A9SA 3DTCA 5B2LA 3AC1A 3S4QA 4FODA 4GRBA 2VTTA 4IWPA 4UV0A 1W7HA 4UB7A 4O83A 3DK6A 4PY1A 3A99A 4C58A 5TT7A 2VX3A 4O0SA 4U44A 4FI1A 4NW6A 1YOMA 3GU4A 4RSSA 3I4BA 4E6QA 3W2OA 4PP7A 3EN7A 4ZMFA 2ZMCA 3PTGA 4QMMA 4XG6A 4EOOA 2RKUA 1MQ4A 5LMAA 1Q8TA 2QO2A 2REIA 3C5UA 1YI3A 3VS5A 3LFCA 3N9XA 5LWNA 4C3FA 3M42A 2GNLA 2ONLA 4H58A 4KABA 2VN9A 1NY3A 4EJ7A 5M4UA 4GFOA 5GZAA 3HVCA 1IAHA 2JDOA 2C68A 4FTRA 4G2FA 2PU8A 3NMUF 3MDYA 1J91A 3VS3A 3T9IA 2VD5A 4ZY6A 3R01A 4J98A 4ALUA 5I3RA 2Q0BA 4OLIA 5ETCA 5BYYA 4Y5QA 3D14A 2EB2A 4I24A 1Q99A 4AA0A 4RFZA 5KMLA 2UW7A 1YKRA 2P2IA 3O2MA 4FV2A 4F7SA 3L9NA 1Q61A 3M11A 4YC8A 5HIDA 4GIHA 3CQEA 2V7AA 2NRUA 4TXCA 4C2VA 4LYNA 3H0ZA 3ZFYA 5IEYA 4FV9A 2RGPA 1F0QA 3OWPA 4ZLOA 2WB8A 3R7EA 2WMSA 2VTPA 4RA4A 1URCA 4XV9A 5GJDA 4NJDA 4AZVA 4IDVA 2IW8A 3BPRA 3F9NA 3KULA 4QD6A 1H1PA 3W2PA 3NVMB 2O0UA 1WVXA 1R78A 4S31A 4DGGA 3PE1A 4MXAA 2J90A 1WVWA 4EKKA 4O7NA 3NR9A 1V0BA 4DEEA 1U5RA 3QRIA 2V7OA 5FRIA 3ZCLA 3HX4A 4K0YA 4DG3E 4Y72A 4EHEA 4EKLA 4X2GA 1ZMVA 3F3WA 5I9WA 5K5XA 2ERKA 4EK5A 4NFMA 5F94A 3FC2A 5D12A 2ERZE 4FT5A 3UVQA 2XZSA 1QPJA 1UKIA 2B7AA 2C30A 2H9VA 3RWQA 1IA8A 4WHZA 5C8NA 3U4UA 2VZ6A 4WO5A 4AOTA 4I92A 4PWNA 1GY3A 2Y4IB 4I1ZA 4RVMA 3UIUA 3V5TA 5KMJA 4OTPA 3QRKA 4JR3A 4KBAA 4OTRA 5TR6A 4EH8A 4LV8A 2W4KA 5AM7A 5HE1A 4RC2A 1XJDA 2Q83A 3ZDIA 1GZNA 3UQCA 3TUCA 4KRDA 1DAYA 4BZDA 3S1HA 1H0WA 2BHEA 3LQ5A 3VS6A 2XYNA 5JZJA 3C0IA 3AT4A 5M56A 2E9PA 3VS7A 2QONA 3EFKA 4H3QA 3LE6A 4AGUA 5CNOA 2VTHA 4IEBA 4RWIA 2X7OA 4QMOA 4RJ8A 2GQRA 3Q9YA 3CGOA 4L00A 2SRCA 3V8WA 5IQEA 3KEXA 3QD0A 5D11A 3BHVA 3RM6A 2ZOQA 4IC7A 4DH8A 3KXHA 3LFQA 2JDRA 3G9NA 3NYVA 5CWZA 3PVGA 4XV2A 2XJ2A 4FUXA 3RMFA 5B2MA 4QMVA 4AT4A 3NIEA 1PRYA 4M3QA 4PTEA 1T45A 3ZFMA 4OAVB 4D4SA 4QTCA 1NXKA 2J51A 3O50A 4F6SA 4NL0A 4TL0A 3QRJA 5HCXA 3ZDUA 4I4FA 4I93A 3FMHA 3R0TA 3UNZA 3VN9A 3D7TB 1Q3WA 4LOOA 2CNQA 3FQHA 3K3IA 3QQGA 4NZWB 2NP8A 3GEQA 2BAJA 4LGDA 3ORNA 5L2TA 1JKKA 5FEQA 3VAPA 4O7SA 2BZHB 4MYGA 2BUJA 3F66A 3PY1A 4BCIA 3G6GA 1Q3DA 3GP0A 4Y85A 4ZSJA 4FL1A 5LVLA 3VWAA 1RQQA 2VTLA 3D9VA 4FICA 5CU6A 3ZZEA 2QNJA 1SNXA 2X2MA 3F5UA 1YXUA 4LI5A 4UXLA 5DT4A 4EH5A 5KKRB 3D5WA 2P33A 4MQ1A 4LGHA 4QPAA 3FZSA 4X2FA 3M1SA 1YVJA 3KRRA 4IAIA 5ANJA 5BQ0A 4Z55A 3JVSA 3GCPA 1L3RE 4JLCA 4JIKA 3ZYAA 1M7NA 1BI7A 2PVKA 4BDGA 3TZMA 2JDTA 4IJ9A 3QLGA 4BZNA 4FEVA 1CMKE 3MB6A 3ENHA 1WBOA 1M14A 2CKQA 3V6SA 2G01A 4DLJA 5CEPA 1BL7A 4U9AA 4S33A 5EM6A 5FG8A 2E9UA 5HCZA 1XWSA 1VR2A 2R3JA 5AA9A 3HP2A 3HDMA 2J2IB 4CMOA 3MFRA 5KCVA 4RVTA 3E8EA 3MTLA 2BIKB 1OBDA 5L2IA 4O6EA 2ZM4A 5CI7A 1GIHA 1P14A 3GU6A 3AMYA 3UIMA 4Q9ZA 2PVHA 2B55A 1Q8YA 1SZMA 3EN9A 3MA6A 3L1SA 3FMMA 4ANSA 4Z7GA 3UC4A 3NUNA 5CI6A 2PVNA 2X6DA 4GL9A 2OZOA 5CVGA 3ORIA 3HECA 3NX8A 4BCPA 4NFNA 5EQYA 1YWVA 2C1BA 4MBLA 4WG4A 3IGOA 3FI4A 4AZSA 2W5BA 4IX6A 2OXYA 3VS2A 1S9JA 3EQRA 3WYYA 2E9NA 1PY5A 3QTRA 5HEZA 2YDJA 3TCPA 3WZUA 4HVGA 5HCYA 3FPQA 3FKNA 2QVSE 4JJRA 1G3NA 5HU3A 4XG3A 4YHFA 1E1VA 3LOKA 4AE9A 2ZV2A 5DWRA 5GJGA 2V5QA 4DEIA 1PXLA 2ZYBA 5HNBA 2EXEA 4QMUA 3KRLA 3SW7A 5L2SA 2X2LA 4KD1A 4E20A 3OEFX 4YSMA 1ND4A 3HRBA 4OTQA 1JNKA 5AV1A 4EI4A 2PMLX 4ERKA 4AA5A 4O82A 4ZIMA 4O2PA 3R7OA 2OGVA 3TXOA 5EHOA 4CKJA 4L3LA 4PMPA 2VTIA 4ANQA 4FK3A 3PWYA 4RWKA 3QTSA 5EKOA 3QQUA 4BCJA 4RJ4A 5HESA 4B9DA 4DFNA 3FI3A 2X4FA 1AQ1A 3BHUA 3O7LD 3FY2A 3FHIA 4NTTA 4BBEA 4O6LA 3SDJA 4EOIA 5EQPA 1ZXEA 2XJ0A 2RFNA 3OT3A 4JBOA 3MH1A 4F0IA 5TKDA 3EQFA 3NLBA 3MY1A 4BB4A 5EYKA 3DA6A 5LJJA 5AJQA 4IAZA 4A06A 3G33A 2CGVA 3TZ8A 4AN2A 5CT7A 5JGAA 5K0XA 3A60A 5LCKA 4HZSA 4L8MA 4M69B 3BHYA 2QHNA 3P7AA 3CS9A 3NW6A 5E8UA 3ZSGA 3IDCA 2WGJA 3RI1A 3A8WA 4R3PA 5C26A 3FQSA 3KN5A 4O21A 5GIPE 3R21A 4FSMA 2YCRA 3NYNA 3Q4ZA 2YEXA 3QTXA 2GQSA 2JITA 4F0FA 4U40A 3PIZA 4GFGA 2PULA 2JBPA 4EBWA 4YJUA 1J3HA 5GZ9A 5HG9A 4CKRA 3LKMA 4QYEA 4EH6A 4O0TA 5LVPA 1ZMWA 5DBXA 3IS5A 2IWIA 3O0GA 2XEYA 3ENMA 4BCHA 3ZO2A 2ZV7A 4FSTA 3ZSIA 2E2BA 4J95A 4FKTA 1O9UA 5JKGA 3BU5A 4GJ2A 3E92A 2PWLA 3D5XA 4IZ7A 4UWCA 4C37A 4L3JA 1JAMA 2VTAA 3UZRA 3FZPA 5DI1A 3CKXA 2UZDA 1TQPA 4C8BA 2RF9A 4II5A 5DRDA 2YJRA 4Q5EA 4FEXA 2IO6A 3ZFXA 2OJ9A 1SVEA 3OCGA 3D7TA 4M67A 4Z9LA 5AUUA 4H36A 4GFMA 4MKCA 5FDPA 2XNBA 4HOKA 3HAMA 5B0XA 2EVAA 3EKNA 2EB3A 3VUHA 4G6OA 4C4HA 4RX5A 5LMKC 5FTOA 4FTQA 5FXSA 5G6VA 5LVNA 2QOLA 2O65A 2VUWA 3NPCA 2BDWA 4FGRA 4BC6A 3FL4A 4O7YA 1G8SA 2J4ZA 2ITYA 3JVRA 5AP3A 1X8BA 1V0PA 4AP7A 3MW1A 4I20A 5B7VA 2P2HA 3GC0A 2C0IA 5M07A 4D1SA 2C5OA 5BX0A 3SA0A 4FIFA 3OMVA 4FTNA 4YZDA 2I0YA 5EI8A 1CKPA 4ZS4A 4L9IA 3VS0A 4N6YA 3LFNA 3MPMA 4WBBB 3P08A 3GQLA 3OCSA 4XV3A 2VRXA 5EW3A 3RAKA 3VIDA 3UG2A 3VS1A 5HO7A 1W82A 4ONAA 3HDNA 4J8NA 3OTVA 3MVLA 2PYWA 2HYYA 4H3BA 3VF8A 3HL7A 3S2PA 2YIRA 3Q6UA 1K9AA 2OFVA 3MYGA 3Q96A 4RPVA 4DH5A 3OXZA 1Y8YA 3CC6A 5CX9A 2YERA 3BHHA 5EYMA 4D4YA 5HO6A 4DITA 5D7AA 4CCUA 4C0TA 1TKIA 3NNXA 3PPJA 3AT3A 2CHLA 3ZXTA 3OT8A 3LAUA 3NAXA 2JC6A 4UY9A 4XUFA 3DT1A 1UNLA 1NW1A 4CRLA 1JSVA 3KMWA 1BLXA 3UMWA 3QZIA 1FQ1B 4WSQA 4ARKA 3GVUA 5HBHA 4BN1A 4W8DA 3R1SA 3DV3A 2HOGA 5CEKA 3FXZA 4EOQA 2WOUA 1UNHA 2QU5A 2QKRA 4JS8A 3A62A 3QRTA 5I9YA 5TO8A 3R7UA 3TDWA 2VTRA 4UYNA 3BWFA 5CASA 1PHKA 4CNHA 5ANKA 1OKVA 1AD5A 4QQTA 2JD5A 3E88A 1PMEA 3IW4A 3AC4A 3R7GA 4ITHA 4RGJA 3TNPC 4O1PA 1QPEA 4BTJA 3W32A 3EN6A 3UIBA 3DK7A 5AFVA 4UEUA 4JG6A 2W9FB 5DA3A 4AW0A 4ZLZA 2BKZA 5AV2A 3PSBA 3OWJA 5J87A 4XBUA 4I6BA 3DQXA 1GZKA 4CTBA 4F6WA 4AX8A 5T6KA 2J5EA 4CT1A 4P7EA 2BFYA 3U6IA 1MUOA 4C38A 4J52A 3W55A 3WYXA 4EZ7A 4AGCA 4M7IA 3HMPA 1DI9A 3JXWA 5FWKK 3W8LA 2G2IA 5CU3A 4EEVA 4GSBA 1JKTA 4FG8A 5I9UA 5CU0A 2WEIA 5JFWA 1DAWA 3E3BX 4ACDA 4ZTLA 5FTGA 3UPZA 3QX2A 3SGCA 1YXTA 2BR1A 2YISA 5DNRA 2CPKE 5CEQA 1O6YA 2FVDA 3I5ZA 3P9JA 3FYKX 4OTWA 1OZ1A 3I5NA 3JY9A 4FE2A 4P90A 3BLHA 2YM7A 5AP4A 4RRVA 3FLSA 5DT0A 4C36A 4D2WA 2C6KA 3PLAE 2YIWA 1MRVA 5H8BA 2YN8A 3FYJX 3Q4CA 3WF9A 2QQ7A 1YOJA 3F69A 4JL9A 4O0RA 4R7IA 3RCJA 3W16A 4ASXA 3EQBA 4R6VA 4UN0C 3MFTA 4O84A 3NS9A 4E6DA 5J1WA 2WQNA 4JBQA 5CQWA 3KMUA 4YC6A 1FBNA 4BL1A 2GCDA 5KHWA 3QTUA 4JDIA 2P4IA 1F3MC 3O8TA 3VW6A 5IUHA 2O8YA 4R7HA 2ITTA 4JBVA 1XH8A 3PXRA 3SXSA 4RJ7A 4FV8A 4AF3A 4I21A 4PMMA 5C9CA 5BUIA 5K4IA 3NNWA 3ALNA 3A7JA 4XG2A 5I9XA 5BVNA 3ZM9A 3ORZA 4IAYA 5ETAA 2W17A 4IWQA 4YHTA 5C27A 4RIYA 2B9IA 3T9TA 2OF4A 4CMUA 3TTJA 2YDKA 2Y4IC 4FTIA 3E8CA 2J0KA 5IG1A 2WTCA 3VBQA 4ANMA 3G2FA 3G5DA 2F7EE 3L8SA 3DU8A 2VU3A 2AUHA 4FKRA 4FTTA 2R3IA 1DS5A 3I0QA 4CLJA 2YACA 1ZLTA 5KZ0A 3COIA 2XK6A 4QYHA 3TM0A 4OW8A 1OBGA 3F6XA 3MI9A 3PJ8A 4LRKA 4O0UA 4NU1A 3GENA 3LLTA 3DBQA 3EQCA 4IZAA 4AOIA 3NUAA 4I5PA 1PYXA 1R1WA 4MXZA 2H6DA 4O96A 4QP9A 4R3CA 4FV0A 2JAVA 2F4JA 3GU8A 3W2CA 3WE8A 1UU8A 4FNWA 3OS3A 3SLSA 4CYIA 3R8LA 5CAOA 2QR7A 3KCFA 4GJ3A 2YZAA 3F5XA 2RSVA 4IX4A 1PXMA 5IA1A 4EOPA 3HUCA 2WELA 1L8TA 2GDOA 4YBJA 5JZNA 4PQNA 3R22A 3PIXA 4LGGA 3SRVB 3OVVA 5HD7A 2XIRA 3WF8A 3MIAA 4RLLA 2YIQA 2XKEA 5LVMA 3O7LB 3EZRA 2WXVA 3CCNA 4RIOA 1Q8ZA 4EWHA 4LRMA 4BDCA 4M84A 3L9PA 1XO2B 5K3YA 5JEBA 2XIKA 2HY0A 3Q04A 4O38A 1ZWSA 2QOBA 5BVEA 1VJYA 3OP5A 1AGWA 1ZRZA 4CFMA 4F7JA 2OW3A 3ANRA 3P23A 3ZLXA 1TQMA 2VO7A 3AG9A 4IB3A 1R0PA 5FP6A 3QHRA 4AQCA 3EQGA 3DBFA 1M52A 3FZTA 4I41A 4EH2A 3EYHA 3MGYA 4FVPA 5A6OA 4EK6A 4Z16A 4JDJA 5HTCA 1H4LA 2DUVA 3WI6A 3DLZA 4A9UA 5KKRC 4E26A 5AR4A 2FSOX 3Q4UA 1PYEA 4CFVA 5CQUA 2QOQA 4IMYA 5J8IA 5BVWA 3IOKA 1GZ8A 3NEWA 3QQKA 4ZTHA 2OI4X 4XG9A 3GFEA 3Q5ZA 3QUDA 3CTJA 4QP8A 4A07A 2GQGA 4TYGA 4RZWA 2XNOA 4U8ZA 5E8ZA 3ATSA 3U55A 4WA9A 4OTDA 2JBOA 5IMEA 4I5HA 1GJOA 4DFXE 3R1NA 1IA9A 4KINA 4QQ5A 3LJ0A 3ID6C 3ZLSA 4FNYA 4ZSGA 3TUBA 3OCBA 3WZEA 2VWUA 1KE6A 2VWVA 2Z7RA 3VULA 3TTIA 4BKYA 2PVLA 2VGPA 1TVOA 2OK1A 2GFSA 3D94A 4JX3A 3VUKA 3UO5A 1RW8A 3DB8A 5J79A 1UKHA 5KMKA 3SXFA 2QHMA 3MH2A 5KX8A 4C57A 3PZHA 4GK4A 4DFLA 4KBCA 3E5AA 2PHKA 3V8SA 5KE0A 5A4QA 3C51A 3QCQA 2UW3A 5EK7A 3VBYA 5D7VA 1V1KA 3BYOA 4FA2A 5IQBA 4E4NA 3B2WA 3OTUA 2FGIA 4RJ5A 4UWYA 4X0MA 3H4JA 2B9HA 5C1QB 4TWNA 4IE9A 4ERWA 4O86A 5AMNA 4R8QA 2EU9A 5L2QA 2UZLA 4QPMA 1O6LA 1OKYA 3GGFA 1CKJA 4QO9A 2G2FA 4RMZA 5AP1A 4R78A 1ZYDA 4FKQA 2WTDA 2HZNA 4YO4A 2BKKA 4CGAA 3QA8A 4HYHA 4ZTSA 4O7RA 5EDQA 5AV4A 3F2AA 2VX0A 4TYHB 4IWDA 3F5PA 3UNJA 5BVFA 2XNMA 2QG5A 3HP5A 3DJ6A 4YTCA 3OXTA 3GQIA 2PZYA 2ETRA 1J1BA 4HGLA 4FKVA 1V0OA 4O22A 2BRBA 3VRZA 4IM0A 4RVKA 3ZMMA 5LARA 5D1JA 4KRCA 4B7TA 1H8FA 1K2PA 2WTVA 4OTHA 1ERKA 4QP7A 3RPOA 3TG1A 4ZZMA 5E8VA 4RZVA 4Z7HA 4YJRA 4IACA 4PTCA 4AFEA 3QXOA 4X6RA 4C33A 1SVGA 1T46A 3FMJA 4EYMA 3HMIA 3NSZA 2VTNA 4OBQA 2C6LA 3A4PA 5AR8A 4G1WA 3SW4A 3ZEWA 3UQFA 2XVDA 3UDBA 1NVQA 3EL8A 3PIYA 3U9CA 5DVRA 1U54B 2OJJA 4K11A 4TYIA 1OPKA 5JQ8A 3RHXA 3IW8A 5E7RA 1FVRA 3SOCA 5A46A 2XJ1A 3HZTA 3QF9A 2QOCA 4BDJA 4FTAA 3E62A 4J53A 5DH3A 5DOSA 3VJOA 4BCGA 1KOAA 4BCKA 2UW8A 2UZOA 2O3PA 3LXNA 4EOSA 5JGDA 3ERKA 3IQ7A 2CDZA 2YAAA 1PF8A 1UA2A 2F9GA 3EN5A 3LCSA 3NUPA 2CGXA 3ORXA 2JEDA 3PY0A 4Q9SA 4YNEA 3RK5A 1QCFA 3PG3A 4U80A 3C0GA 2QKWB 2HIWA 3F2NA 4E6AA 2QI8A 4FIJA 4FUYA 2X6EA 5DN3A 4A9TA 4ASEA 3LZBA 4WNMA 3SRVA 4EK4A 1MRUA 3MN3A 4FK6A 3IW6A 2XUUA 3G9LX 4AW2A 1WBWA 2HXQA 4AZEA 5FBNC 4S2ZA 2OICA 3FSFA 4MD8E 3VBVA 3R04A 2R3LA 5HX6A 3BYMA 4P5QA 1WZYA 5IA3A 2JAMA 5L6WL 4F70A 5IQFA 4JDKA 2CJMA 4QQCA 2E9VA 3H9FA 1OL1A 2PE2A 4ACGA 4JT3A 5LCJA 2X2KA 5D9HA 3QQHA 4DBXA 2GNHA 2YIXA 1KUTA 3F7WA 2C1AA 3GU5A 4C35A 5FQDC 5JFSA 5IKWA 1YHVA 3F5GA 4HNIA 4IHPA 4AW1A 4CFXA 5DIAA 1ZY5A 3KMMA 2B4SB 3QX4A 4Q2AA 5T68A 5ACKA 4F09A 4JG7A 4EJNA 3O23A 3FI2A 4GUBA 4YURA 2UZVA 4G34A 1OPJA 3HEGA 3F7ZA 4JAJA 4NYEA 1UU7A 1WVYA 1U4DA 2IJMA 2R3OA 4C4EA 2X4ZA 2LGCA 4IVBA 1YWRA 2J0JA 4N6ZA 3FXXA 3UE4A 3QZHA 1OPLA 2GHGA 4FIHA 4YPDA 2HWOA 2WD1A 2UZUE 4X3FB 5EM8A 3SD0A 3I6UA 5AIRA 2IVUA 5IZFA 2RFSA 2R3GA 3JR1A 5M4CA 2J50A 4NIFA 3MIYA 1REJA 5GINE 3W18A 4WNKA 5EW9A 4ZSAA 2VV9A 3CE3A 3MWUA 2R2PA 3DB6A 3G90X 4MQ2A 4R1YA 4EONA 5CAUA 3KK9A 1DM2A 4CZYB 4NCTC 4PTGA 5IA4A 3PPKA 4W4WA 3DKCA 4DGOA 2EWAA 4XBRA 3NNVA 3R8VA 2C5YA 2CN8A 4E3CA 5CF5A 1WBVA 4FKLA 4YTIA 5JSMA 4FR4A 3LXPA 4X2JA 3FAAA 4X2NA 4AS0A 3QKMA 4C2WA 4I0RA 4FV4A 4RT7A 2ITVA 4GVAA 4XOZA 2VWZA 5A4TA 5CEOA 4TY1A 4D1ZA 4YZ9A 4FEWA 5LMKA 1DI8A 4IAAA 3QTIA 4JI9A 4M13A 1KE5A 4UALA 1YHSA 5LQFA 3BHTA 5I3OA 2PUIA 5HE0A 1H24A 4K18A 1XBBA 4ZZOA 3OY1A 4FKJA 3I6WA 4QPSA 3MV5A 5E91A 4J97A 4NJ3A 3I79A 2IZTA 5E9EA 4UX9A 4I6HA 4RQKA 3F82A 3ORTA 3C50A 5CSWA 1JKSA 2UV2A 4DTAA 1YWNA 3AMAA 4IM2A 4YLKA 2P55A 4FVQA 3BIZA 4AWIA 4YP8A 3AC8A 1KE7A 3F3ZA 4HYSA 5JQ5A 1OIYA 4ZS0A 4RWJA 2QU6A 4HVHA 3SVVA 3TZ7A 4O0WA 3H9RA 3TV7A 3R83A 2JIVA 4HGSA 5ANGA 2W0JA 3BKBA 4YPSA 3EH9A 1ZYLA 1GZOA 4KS7A 1BYGA 3KRXA 2FB8A 4QT1A 4Y95A 5ANOA 2JFLA 5AP6A 3VRYA 4K77A 3ZC5A 4ZY4A 3Q9XA 4KAOA 4CG9A 5KNJA 3OW3A 3U54A 5BNJA 3KXGA 4LM5A 4TYEA 4IFCA 5ACBC 3BLRA 2BAKA 3RPVA 3LM5A 2G2HA 5FM3A 3PSDA 3ZTXA 4JX7A 4NM5A 4FZDB 3U51A 3AOXA 3JUHA 2C3JA 1UVRA 2X9EA 5A9UA 4GKIA 3K5VA 3QKLA 3R00A 4G16A 4GV1A 3RPRA 5KO1A 3VVHA 4EH9A 2C0OA 1JSUA 2QOKA 3IG7A 4EC9A 3Q32A 4QNAA 5EM7A 4RX9A 3ODZX 1OM1A 3ZONA 5H8EA 1B38A 2CKOA 3ZEPA 4DCAA 4JRNA 4YJQA 4BRXA 3Q2JA 2OKRA 3B8RA 3QBNA 5IQGA 4ASDA 3NYOA 5DT3A 4N0SA 4RIWB 3QD2B 1I44A 4USFA 1OMWA 1F5QA 2YABA 4WBOA 2OZAB 2PY3A 4UMTA 2C47A 2NPQA 3JS2A 3R7VA 4EZ3A 2ZV8A 5JRSA 4KIPA 2PUNA 4TWCA 3WZJA 1BX6A 2OXXA 3KF7A 4JQ7A 3WOWA 3Q53A 4M15A 4E6CA 4L67A 4GH2A 1ZOEA 2FO0A 5IUGA 4QMPA 2UZEA 4X6QC 3QFVA 1H1WA 5J9LA 4BCMA 4BTKA 5HNIX 5BVKA 2BPMA 2HWPA 4KA3A 3V6RA 3MH0A 3MS9A 3C4CA 3SAYA 4S32A 5K0KA 4CV8A 4ITJA 1YDSE 2DQ7X 1R0EA 1NA7A 3EN4A 3FV8A 2XCHA
chains in the Genus database with same CATH superfamily
3AD6A 4CG8A 3DBEA 3AC3A 3ORMA 2V55A 2OIQA 4LOPA 4M0ZA 3TMOA 3I7CA 4FNZA 4USEA 3OCTA 2FYSA 2X7FA 3POZA 5J95A 3RKBA 3U8WA 3OUKA 3LLAA 3DKGA 4BDEA 4KKEA 3D15A 4CZUA 3QA0A 1Q97A 3RZBA 3D2KA 1UNGA 1OIRA 2Z7QA 4Y5HA 4FRFA 2ZV9A 2EUFB 4FZFB 4AFJA 1YXSA 1ST0A 3CKWA 4Y8DA 3P5JC 3UO6A 4C34A 4ZEGA 1S9IA 3RBWA 5HTBA 4JVGA 1SYKA 4J99A 3R9DA 3WIKA 1YDTE 3A7FA 4AXDA 1GIJA 3GUBA 3R9RA 5H8GA 4XMOA 2ITUA 3WF6A 2F2UA 3O51A 2ITNA 4WUAA 4F9YA 1PMUA 2ETMA 2QOOA 2QODA 3R2YA 3CTQA 3TNIA 4X3FA 4XS2A 5CEIA 4LQMA 3UYSA 4AZFA 4K8AA 1E9HA 1PW2A 3BGZA 4PP9A 3HRCA 3UOLA 5CANA 2VTMA 2X0QA 3F2RA 3EHAA 2OIDA 3Q52A 2R3PA 4IH8A 3OUNB 1XKKA 3COMA 1OB3A 3ZUVA 2JKQA 2YM6A 1W2DA 3KVWA 2P3GX 2XRWA 4QMXA 4DH7A 5KHXA 4FT7A 2W5AA 4DYMA 4EBVA 4YBKA 4AN3A 4FZ6A 4HVIA 4W8EA 3MESA 1XH7A 3PA3A 4BHNA 2C0TA 3W0MA 2GS7A 4FG9A 3CEKA 3RGFA 3TACA 4DHJA 3FZRA 4FV3A 4WG3A 2HAKA 5CXHA 2IVTA 4JOAA 2R3QA 3I7BA 4RVLA 3JY0A 3ZHPC 1IEPA 4PF4A 4BDBA 1PXKA 4DEGA 1CSNA 4QTEA 2WO6A 4FTOA 3ZZWA 4BCFA 4MVFA 3LCOA 4RFMA 3VUGA 4FIEA 3DPKA 2JFMA 3DGKA 2WMUA 4ANNA 2BMCA 3QTZA 1IG1A 5AUVA 1VEBA 2PL0A 3HV7A 2IW9A 3ZXZA 3TKUA 3WE4A 1BL6A 2PK9A 3Q9WA 1YXVA 3GOKA 3DZQA 4UMQA 4F99A 3REPA 3QC4A 2V22A 1PXIA 4XYFA 1W98A 5L8JA 2Y4PA 3NUUA 4BWXA 3ALOA 1Z9XA 1H00A 3AD5A 3HMOA 3IONA 4JRVA 3BGPA 5BYLA 3MJ2A 2IZSA 3GI3A 4CQEA 2WMTA 4XP0A 3O71A 4FOBA 4MNFA 1ZYJA 2QC6A 2X0PA 4BIEA 2JDSA 2R3RA 4AT5A 2R0IA 4L52A 4AG8A 4CFWA 3FMEA 3IDBA 4MBJA 3UVRA 5IEXA 4XNEA 3CY3A 4LMUA 4YHJA 5LWMA 5ETIA 2PVFA 1VZOA 2WTIA 4MF0A 4QP6A 2Z02A 4WRSA 2A27A 2E9OA 2XRUA 4B8LA 3BWJA 3DFCB 3W2SA 4PMTA 4PX6A 5DLSA 4B4LA 4L45A 4C3PA 4L7SA 3KU2A 1YQJA 4G6NA 5CSVA 4B8MA 2WMBA 5I4NA 5FTQA 3TL8A 3GXLA 3HV4A 4BDAA 1P4FA 2RL5A 3PPZA 5ANEA 4E93A 4ALWA 4KUJA 5AAFA 2Y6MA 1HOWA 4IX3A 3S3IA 5AP7A 5EM5A 4S34A 3DK3A 3RPYA 1P2AA 3K5UA 5CVHA 2GTMA 4YGAA 1JKLA 1WFCA 4GT3A 4IJPA 4D4VA 4EHGA 1OITA 2UW6A 3GCUA 4QYYA 4M68A 2R3FA 3RPSA 3ZS5A 4ANLA 4NTSA 3PDTA 4WOVA 4FV1A 2OU7A 3P86A 2C6OA 5I9ZA 5EYDA 4FOCA 3DAEA 1UV5A 5IPJA 3V04A 4E73A 2ZB1A 3KQ7A 4ZY5A 1GNGA 5BVOA 4OGRA 2OZAA 2UW4A 2C6DA 2AC5A 3H9OA 4RFYA 3H30A 4APCA 3ZRKA 2R64A 4A4LA 3GCVA 2W1IA 5HORA 2WHBA 3LVPA 4E7WA 4GKHA 1YW2A 3R1QA 2JGZA 3QYWA 5IQDA 5BPYA 3RM7A 3NZ0A 2I7QA 2GNGA 4MAOA 5J7BA 4QP1A 3OFMA 1MQBA 3LXKA 5HLNA 4HGEA 4EUTA 2XIYA 3MTFA 4QP2A 3UDZA 5DYJA 4A9RA 3QTWA 4ZJVA 4YZBA 1MRYA 4M14A 2WU6A 3CQWA 2XMYA 4CLIA 4F6UA 3PA5A 4FSNA 2HZ0A 3G0EA 3QGWA 1Q4LA 3ET7A 4NWMA 1Z5MA 3TNWA 4FBXA 4TWPA 4OR5A 4EORA 4MD9E 5DE2A 4LRJA 2VO3A 4PDSA 2BDJA 5IQIA 3QGYA 2IEWA 4QMNA 1WBNA 4IFGA 4KS8A 4TYJA 5HICA 4EQCA 2RFEA 5HLWA 3F88A 3DXNA 3PYYA 5HTIA 1KE9A 4ITIA 4IAKA 3W0SA 5CU2A 3VUTA 4WNOA 1BMKA 2R3HA 2R3KA 3R8ZA 5A6NA 2B1PA 4HJOA 5I9VA 1H27A 5K4JA 5FEEA 5HZNA 2G15A 3RALA 3N4TA 3DFAA 4LG4A 1XQZA 3ZM4A 2WIHA 3W0RA 5CZHA 4J8MA 5EH0A 3FQEA 4QMLA 5H2UA 5HG8A 2I1MA 2IVSA 1W83A 2QR8A 2CNVA 3KC3A 1OUKA 2IW6A 4FYNA 3VQHA 4C02A 4EOJA 2IN6A 3NFFB 3BCEA 4I4EA 1FMKA 3BRBA 4FKPA 4UWBA 4QQJA 2XALA 4TN6A 3QD3A 3LIJA 3EFLA 5DR9A 5GNKA 3EB0A 3V01A 2C5XA 3S95A 3G0FA 4XG4A 3TUDA 3D2IA 1CDKA 3OW4A 1WBTA 2UZNA 4ZSEA 4XG8A 1ATPE 1ZOHA 2O5KA 4DH1A 5BMSA 4P5ZA 3QQJA 4M69A 3DS6A 2O64A 3NW5A 3UOHA 4O0XA 3KGAA 3UPXA 4GU9A 3WF5A 5H9BA 3P5KA 1JPAA 4K2RA 3DLSA 3EQHA 2VTJA 3LJ2A 3PJ3A 5M51A 2VO6A 3F3UA 3PP1A 4L6QA 3HYHA 2W1ZA 1M7QA 4IM3A 5HI2A 1OL2A 4X3FC 2WNTA 3NRMA 4LL5A 4JR7A 2W9ZB 5CS6A 5HE2A 3I1AA 3WARA 5CF6A 5IQHA 4DT9A 2R9SA 4QMSA 2BDFA 2W1HA 3LCTA 4D2PA 3LMHA 4Y73A 5AR2A 1XBCA 4BFMA 4CT2A 5DR2A 3ULZA 4ZOGA 3QU0A 2WMQA 3IW5A 4J1RA 5AX9A 2WTWA 4FG7A 4FX3A 4FSUA 4OBPA 1OECA 2W05A 1REKA 1LEZA 4E8AA 2GMXA 4BIDA 4XCUA 1CKIA 3TIYA 4J7BA 2ITXA 4P2KA 5HNGA 3U9NA 3POOA 3ORLA 4ZMEA 3TJCA 4WIHA 2YM3A 2YM4A 4AT3A 4EOMA 1GAGA 4WT6A 4UMUA 3RNYA 3DJ7A 4AACA 2V62A 2XBJA 3W1FA 3D5VA 2UZTA 4HYIA 3LFFA 4WKQA 2J0IA 3QCXA 4IZ5A 4PNKA 4FIGA 2WQMA 5KMOA 4L7FA 2WMVA 4OAUC 4JG8A 2PVYA 4FIIA 3VHEA 3ZH8A 3SHEA 4DEAA 4E4MA 2R5TA 3NAYA 4CMTA 4D5HA 4FTKA 4F1MA 2YLEA 1STCE 1R39A 5BMMA 3TNQB 3BYVA 3Q3BA 4FKSA 4ZTQA 2WIPA 2OLCA 5IA5A 2W06A 4O4EA 3H3CA 5BYZA 4ZLYA 2QOHA 3QCYA 3ULIA 4YUQA 4RA5A 4L53A 2X0GA 1PXJA 2HZIA 3R7IA 3VBWA 4ALVA 3CSVA 4IDTA 5AUZA 2J0LA 5M06A 5L2WA 4O7WA 4EC8A 4U43A 3L8XA 3Q4TA 5DR6A 5BUEA 5AADA 3ZBFA 2GPHA 1WMKA 4NEUA 3DZOA 3HV6A 2JKMA 1OKWA 3V8TA 3ZLYA 1YHWA 4U42A 3TDVA 4DG2E 3R6XA 5CSPA 4K1BA 3FBVA 1FMOE 4IQ6A 2XYUA 3N51A 5D10A 5IMXA 3LM0A 3EMGA 4IAFA 3TT0A 2BILB 4FSYA 2XA4A 2RG5A 2ZJWA 3SKCA 5EI6A 3FDNA 1W0XC 2ITQA 4O2ZA 4NCTA 1WCCA 5M53A 1LEWA 4JXFA 2GU8A 4U5JA 3QQLA 3K54A 3NUYA 3UZTA 3BI6A 3LFSA 5HG7A 2XCKA 1OL7A 3PXKA 4BI1A 5AM6A 2I0HA 2F2CB 5F9EA 2CNUA 4PDYA 3PSCA 4TTHB 4L43A 3GBZA 1HCLA 5CU4A 3UODA 5M4IA 3OC1A 4YC3A 2PZRA 1NVRA 3O17A 3KULB 2WMXA 4KKHA 4EOLA 5FD2A 3ROCA 3C4XA 4MF1A 4MD7E 4F9AA 1PXPA 3E8DA 2IVVA 4AW5A 3TV4A 3QKKA 4JNWA 3GB2A 3P1AA 4FSRA 3PG1A 2QOIA 2OSCA 3B8QA 3KFAA 2A4LA 4FKWA 3AMBA 4UZHA 5HBJA 4ZSLA 4GT5A 4GG5A 3VQUA 3HV5A 3BV2A 5IH4A 1PJKA 4MNEB 1H08A 3CTHA 3VJNA 2G9XA 3R30A 5TOZA 3R9HA 3K2LA 2WQOA 4EK8A 4FNXA 4D9UA 2CSNA 4U97A 3UIXA 2C3KA 4G3GA 5F20A 2OO8X 1WBPA 1WAKA 2YLFA 5EOBA 5IF1A 3O8UA 4G3EA 4G9RA 4FV5A 4YJTA 2JLDA 1Q62A 4FTUA 1SVHA 4BIBA 1XH5A 3VBXA 4F64A 1FGIA 3U6JA 1WBSA 3BLQA 4O7VA 4K6ZA 5BUJA 3NW7A 5EG3A 5GIOE 3CY2A 4H1MA 4N70A 5F95A 3OWLA 5C8MA 3MJ1A 4Y83A 4A7CA 4DEBA 3UNKA 2CMWA 3P7BA 5F1ZA 2X39A 1IAJA 2W5HA 4EWQA 4ZTMA 3PJ2A 3JYAA 4R77A 2XK4A 4RJ6A 4BGGA 3PRIA 4V01A 5B2KA 3I81A 4B0GA 2F7ZE 4H39A 3RZFA 2WPAA 4U45A 2CGWA 3QTQA 5M57A 3ZUUA 2NO3A 4IWOA 5F4NA 1QPDA 5CSXA 1YI4A 3NDMA 4UZDA 4DFYA 5HIBA 4KIKB 5HVKA 4AU8A 3RAWA 5IISA 4XJ0A 5FDXA 2PVMA 4BKZA 3BV3A 2UW5A 3FKOA 4IIRA 4E4LA 5LVOA 1NT2A 2PTKA 3L8VA 5CLPA 2XK3A 2C6IA 1FGKA 2Q0NA 4BYJA 2UZWE 2ZDTA 3E7OA 3RVGA 4R5YA 3TEIA 5J5TA 2AYPA 3H10A 3KA0A 4BI2A 5EHYA 2OJGA 4GMYA 3FWQA 4FSZA 3LHJA 2AEGA 4NSTA 3ELJA 1OIQA 1XHAA 2B52A 2YDIA 3KRWA 3D0EA 5M44A 2NNWB 1H1QA 4L01A 4ZJIA 1M2QA 4BDKA 5FUTA 2BCJA 3L9LA 5AUWA 3FY0A 1ZZ2A 4TKSA 4GK3A 5JN2A 2CKPA 3QYZA 4RC3A 4AN9A 1OKZA 4F9CA 5FLFA 3THBA 4DTBA 2FSMX 5K9IA 4O7TA 4WD5A 2BFXA 4C7TA 2J6MA 1R3CA 4WRGA 4AGWA 1UWHA 5CNNA 2WFYA 3BEAA 2IF8A 4FL2A 4XOYA 3N4VA 3DY7A 5KMMA 4GK2A 2BROA 3QD4A 3RP9A 3ACJA 4EQUA 4JDHA 4RIXB 2LAVA 3WILA 1OVEA 4TNBA 5J1VA 2YITA 4PL3A 3FZOA 2Z2WA 4B99A 3C4ZA 1PMVA 3GC7A 3NGAA 2FUMA 4B6LA 2V0DA 3EFWA 1KSWA 4DF3A 3QCSA 5HGIA 3LQ3A 4H05A 4C3RA 3UYTA 2NRYA 4MWIA 4J96A 3V5JA 4XHKB 3G6HA 3O8PA 5DMZA 3DNDA 4FZ7A 3KK8A 4TZRA 3SV0A 3DDPA 5CALA 5LOHA 5AP5A 3RHKA 1ZARA 4O1OA 5HIEA 5AR7A 1M2PA 2XM9A 5G1XA 1M17A 4AOJA 2VTQA 3BEGA 1Q41A 1Q8WA 1XBAA 2JIIA 4PPCA 4YJVA 5T3QA 3QXPA 4F1OA 3M2WA 1RE8A 4FEQA 2DYLA 4R1VA 4ZXTA 3CXWA 2XK9A 5FBOA 1Q5KA 2VO0A 4XRJA 1VLRA 2W96B 3W2RA 4GW8A 3QZGA 4YJNA 5IUIA 4LL0A 1PKGA 2W1CA 2PSQA 4O4FA 2FSLX 3HA6A 5HKMA 1HCKA 4DGMA 5L4QA 2OXDA 2YM8A 3RCDA 3FKLA 3UOKA 4ENYA 1H1SA 5C8KA 4N4SA 1XMLA 1P4OA 2A98A 2R7BA 2CKEA 3EWHA 4M8TA 5E8SA 5E8WA 3SC1A 1LPUA 3P79A 3NWWA 4NM7A 3UP7A 4RX8A 4ZAUA 5AEPA 3LFBA 2RFDA 2YCQA 4A4OA 1KV1A 4MX9A 2HCKA 3C1XA 3E87A 1QPCA 4KIQA 4CCBA 3AC5A 4AXAA 2W1EA 3G15A 3BQRA 4H1JA 4C4IA 3RTPA 4GYGA 2BRNA 2WOTA 3CD8A 4X21A 3RAIA 3MVMA 4MNEA 2WTJA 1FOTA 1FVVA 2XBAA 3FLZA 5DG5A 4I6QA 4G3FA 5EDPA 4BYIA 4EUUA 5DPVA 2YCFA 4OT6A 4M66A 2W1FA 4G9CA 3ITZA 5AIKA 2H8HA 2R0UA 4RLKA 4AGDA 2BTSA 3A7IA 5E8XA 2AC3A 2YFXA 3H0YA 3SQQA 4X7QA 4BWKA 1ST4A 2WEVA 3WZDA 3FZ1A 3PVWA 4W4YA 2J5FA 2J9MA 3FC1X 4PDPA 1SM2A 3C4EA 4OUCA 5HE3A 2X8DA 4NM3A 2ZM1A 4JBPA 2ZB0A 3C13A 4G3CA 4Y46A 3DBCA 3FMKA 3HMMA 4MK0A 2WZJA 3B2TA 2RIOA 4QP3A 5KZIA 4FSQA 3ZO4A 5CVFA 4O4BB 4N57A 4A9YA 4IX5A 2J0MB 4BKJA 5ETFA 3RNIA 1Y6AA 2BTRA 4TYHA 5M55A 4FC0A 4DG0E 2HELA 4G17A 4TPTA 3QWJA 3GU7A 4YO6A 3D4QA 2VWBA 3UGCA 3ZO3A 3PZEA 5M09A 5IH6A 3UBDA 3SG8A 1H1RA 3OROA 2O63A 4KIKA 5HVYA 3FXWA 4QOXA 2GHLA 3HLLA 5CT0A 3C4WA 4BVUA 5KBRA 3E3PA 4ZJJA 3UTOA 4BHZA 4O27B 3BGQA 3FLYA 5E1EA 4XH6A 4EL9A 4HNFA 1Z57A 4I23A 2XKDA 3A7GA 3G51A 4MXXA 4QMZA 5HBEA 5TE0A 4D1XA 5KUPA 1H26A 2W1GA 4UXQA 4F7LA 1Y8GA 4PMSA 4IVCA 4PL5A 3COHA 2VGOA 2A0CX 4HCTA 4RC4A 3ZBXA 4FT0A 4IB0A 3UMXA 3ORKA 2KULA 2PVJA 4BTMA 2YAKA 3CBLA 1U54A 4YSJA 3ZC6A 2C3LA 3Q6WA 3ORPA 3S0OA 3ZO1A 5EHLA 4BF2A 4DEHA 2QG7A 2H34A 4D2SA 4P4CA 3OBGA 3CGFA 5FXRA 2CLQA 2WU7A 4JAIA 2X1NA 3COKA 3D5UA 2XH5A 2QD9A 5FGKA 3QHWA 4AZTA 3R02A 3MH3A 4MXCA 3QLFA 1M2RA 4W9WA 3MSSA 4BBFA 3R9NA 5I0BA 2C69A 3LCDA 1O6KA 1RJBA 4IB1A 3EOCA 3EQPA 4BGQA 3F3VA 4O7ZA 3IW7A 4IBMA 4QMTA 4RIXA 1BUHA 4DDGA 3AGLA 2UUEA 5EI2A 3DOGA 3I60A 1FPUA 1VYWA 5EYCA 2R7IA 5AWMA 4L44A 3TV6A 5C01A 3ZSHA 3SG9A 3DBDA 5E8TA 2W99B 4AE6A 4PPAA 3DAJA 2ITWA 3PLSA 5AV0A 1KV2A 3ZOSA 3VF9A 4GS6A 4U81A 2W4JA 3QRUA 2C6MA 1U46A 1KE8A 4KKGA 1GOLA 4O0VA 3TKHA 1JQHA 4W4XA 4O91A 4XLIA 3KB7A 3E64A 2QLUA 4ZP5A 3RK7A 5LXMA 2BZKB 4IW0A 2WQEA 1YI6A 5JGBA 4G5PA 3FEGA 3OHTA 1OL5A 4U3YA 2X7GA 5D41A 4EK3A 1KWPA 2OH0E 3EIDA 3FUPA 4I0TA 3MVHA 4CD0A 4FSWA 3UC3A 5DFPA 3A7HA 3V5LA 5E1SA 4C59A 3ATTA 5JFXA 3DCVA 3EQDA 2CLXA 1XH9A 3BBWA 3VUDA 4CZTA 4GCJA 2PZPA 1MP8A 2OH4A 2C6EA 2C4GA 3PVBA 2OFUA 4GYIA 5K5NA 3AXWA 3VO3A 4QNYA 3RINA 4U6RA 4MXOA 5AUYA 4AXCA 4DC2A 3BYUA 3ETAA 2PE0A 3U4WA 3Q9ZA 4QMQA 2HK5A 4BCNA 5EQEA 2ONLC 4TWOA 2QURA 2XIZA 4YZMA 2PMIA 3NIZA 4JQEA 5CAPA 2PE1A 3CJGA 3KN6A 4FZAB 3D83A 5IH5A 4R5SA 1LR4A 1A9UA 2F57A 3L9MA 4YU2A 5AAGA 3MPAA 3WF7A 3DTWA 1J7IA 1Q24A 4U79A 5CF4A 3PVUA 2WTKB 3LW0A 3V5PA 2ZM3A 4O81A 3E63A 4IXPA 5GHVA 1KOBA 2I40A 4YJSA 5IDNA 3FLWA 5L8LA 4LFIA 3GCQA 3K3JA 4D58A 5EKNA 5HX8A 4I94A 3MFUA 2GTNA 3PFYA 4OTGA 4RQVA 5J9YA 4GVJA 2QOFA 1W8CA 4G5JA 3CD3A 3WBLA 4DGNA 4JQ8A 4ORKA 3P4KA 2O2UA 2Z60A 4QMYA 5HHWA 2YWVA 4EH7A 4FT9A 1ZYCA 3Q60A 3P0MA 2XAMA 5CF8A 2J7TA 2XNEA 3HA8A 3DNEA 2F7XE 2VWYA 3IK3A 4K9YA 5FP5A 4Z3VA 3HRFA 3T3UA 1U5QA 4D5KA 4WNPA 4GEOA 4XRLA 3V5QA 3GCSA 3I0OA 3P7CA 4NW5A 2WQBA 4CRSA 4YMJA 3GFWA 3FMNA 4NH1A 1NVSA 5EW8A 4D28A 4YJPA 4FKGA 4DEDA 3KIOC 4K33A 5CYIA 5L3AA 3OZ6A 4QYFA 2VWWA 3OD6X 5IQCA 4FMQA 3KXZA 3LFDA 3DXPA 2I6LA 1XR1A 2XKCA 4DAWA 3R9OA 2BZIB 3TNHA 4BCQA 4PNIA 2VAGA 2OWBA 2BRGA 3A61A 3E8NA 4J71A 4RIYB 5DEYA 3VW8A 3ZRLA 2JKKA 5J7HA 5JRQA 5L6PA 3PXQA 2ZMDA 3WIGA 1J7LA 5KMIA 5BVDA 4DBNA 2C3IB 5L6OA 3VS4A 3VNTA 3A2CA 4XLVA 4EHVA 4KB8A 2ITOA 1A06A 4D55A 2Y7JA 4FEUA 3GC8A 3LMGA 3BX5A 3CP9A 5DEWA 2R3MA 3FLNC 4CFFA 2GNIA 5HQ0A 5AA8A 2C6TA 2WAJA 4FKIA 4F7NA 4EQMA 1ZAOA 4YR8A 2UW9A 4QTDA 1FVTA 2I0VA 2GS2A 3QUEA 4G3DA 2HY81 3FLQA 3R28A 3AGMA 4KSQA 1YOLA 4DLIA 3E93A 1J1CA 4D9TA 4DT8A 5IEVA 3EZVA 4MWHA 3Q2MA 4XP3A 5HU9A 4BDFA 1P5EA 3OY3A 5EDRA 3T8OA 2BIYA 2WMWA 4YZNA 4NM0A 3WZKA 2IG7A 3MBLA 4AUAA 4USDA 2CCHA 4NKAA 4L3PA 3R8MA 3RAHA 4G6LA 1XH4A 4LUEA 5CAVA 4FKUA 4EYJA 4HCVA 4D0WA 4RIWA 3F3TA 5HO8A 4I5MA 5CAQA 2GNJA 2BVAA 3OBJA 2ETKA 4I22A 4OT5A 4RBLA 5JMSA 5M4FA 4UYAA 3IDPA 3KXMA 4OTFA 1PXOA 3DKFA 5FM2A 4ACMA 4HPTE 4CQGA 2BRHA 3CR0A 4FGBA 2PUPA 3OOMA 4E5WA 4YTFA 4QYGA 2QLQA 4GT4A 3R8UA 5A4LA 3C9WA 4V04A 2HZ4A 4NT4A 4L68A 5CXZA 2B54A 3GT8A 3MA3A 3ZLWA 2YHVA 4BBMA 2W4OA 2BHHA 3CLYA 3PRFA 1ZMUA 2Z7SA 3LPBA 4LUDA 4XEYA 4WSYA 4PDOA 2X9FA 2EXMA 2GSFA 1TQIA 2VWIA 2PMOX 4ACCA 1FINA 3V5WA 4DFUA 2P0CA 1H01A 4RG0A 4HVDA 2FA2A 4UBAA 4L42A 3KRJA 2XNNA 3FL5A 5AAEA 4ANOA 4F63A 2B9FA 4U0IA 4YNOA 3TZ9A 3ZRMA 3NUSA 1QMZA 3BU3A 4LOQA 4EH4A 4U7ZA 3D7ZA 3LQ8A 2QO9A 3BYSA 5CENA 4DINA 4HYUA 3RK9A 4BDIA 3GOPA 2W1DA 4CV9A 3S00A 2PPQA 4F1TA 3FSKA 3QALE 2I0EA 4BICA 4CYJA 4DA5A 4IADA 4HPUE 1JBPE 3U6HA 2OG8A 5HVJA 3ROYA 4UMRA 2B0QA 3MVJA 1U59A 3QWKA 4I6FA 3KF4A 2A2AA 3FI8A 1JWHA 3HKOA 5DRBA 3U87A 3UVPA 1RDQE 5CTPA 1H0VA 3GC9A 2A1AB 1OI9A 5FEDA 3UG1A 4DH3A 3T3VA 2HW7A 2Y9QA 4UMPA 2XB7A 1CTPE 3ACKA 4PPBA 3IECA 1YRPA 4MH7A 4ASZA 3W0OA 3BE9A 3DKOA 4BJJB 2VX1A 2ZDUA 2HENA 3C0HA 4CEGA 4O0YA 4OBOA 4CSVA 4BGHA 5KMNA 3TIZA 3HAVA 3R1YA 4KWPA 2XKFA 4BR3A 5A4CA 4M12A 1XH6A 2XK7A 4FKOA 4BJJA 2IPXA 2XNPA 3NCZA 3HV3A 3OXIA 4U3ZA 2IZRA 3VUIA 4YLJA 4D4RA 2QCSA 3JPVA 4U41A 4E5AX 5ICPA 3UOJA 5GZ8A 2Y0AA 2KTYA 3EKKA 4PRJA 5ITAA 1UU9A 2YM5A 4ACHA 3PUPA 4E5BA 5HLPA 1J7UA 4XV1A 4IZYA 3EQIA 3W8QA 4EHZA 1PMNA 2VNWA 3DJ5A 2Y6OA 5L8KA 2YA9A 1BKXA 2JIUA 1G8AA 3QAME 3LMIA 2XEZA 1CM8A 2YCSA 3NVKI 1JOWB 1ZYSA 2UZBA 4I0SA 3DDQA 4QTAA 3V3VA 4DGLC 3UO4A 1Y91A 4I5CA 4AAAA 4F08A 3MB7A 2Z7LA 4DFZE 3FPMA 1SMHA 3HMNA 4APPA 4NKSA 3KXXA 3KREA 4R7BA 3R73A 1I09A 2OBJA 3FE3A 3OF0A 1E1XA 4HCUA 4ZZNA 3KY2A 3E7VA 4OTIA 4EH3A 3SOAA 2CN5A 4JIAA 3PFQA 1PXNA 4FL3A 3PJ1A 3NNUA 4IC8A 2WKMA 4FYOA 2DS1A 4MXYA 2HXLA 2W7XA 4V0GB 4KIOA 4YZCA 3EJ1A 4FT3A 5AUXA 4M0YA 5HOAA 3CPBA 3P78A 3TN8A 3OOGA 2XS0A 3EL7A 5EFQA 2PZ5A 1PKDA 3BZ3A 3II5A 3TWJA 4E1ZA 3KKVA 2X81A 2XARA 4NK9A 3TJDA 1OL6A 3PA4A 1K3AA 2B53A 2BRMA 5CSHA 4WG5A 4CFNA 4ZTRA 5FXQA 5LMBA 3FJQE 5IU2A 1VYZA 4TW9A 4BCOA 4BTFA 4C4JA 5AUTA 2ACXA 4DCEA 3VONA 2QO7A 4FTJA 2C5VA 2BZJA 4WUNA 5BV3A 2FH9A 4FTCA 3KXNA 4RWLA 3BELA 3ODYX 5IA0A 4QTBA 4C4FA 5A54A 2PZIA 2WMRA 1IR3A 4I3ZA 3UJGA 2UW0A 1G8KA 2JKOA 1ZY4A 2YIYA 3HUBA 3RJCA 3TYKA 4BZOA 1EH4A 2XK8A 4F4PA 4R3RA 3IOPA 5E8YA 3LFAA 5AP0A 3W2QA 4KSPA 3PP0A 1H28A 3RWPA 4IANA 3AQVA 2ZVAA 5ANDA 2GHMA 5CY3A 5DHJA 5EOLA 4F9WA 3HNGA 4TRLA 3V51A 3LXLA 4CKIA 4IVAA 5CEMA 4PUZA 4HVSA 2G1TA 4HW7A 3HGKA 3QZFA 4KNBA 1B6CB 2BALA 2XNGA 2ZAZA 4XG7A 3UDTA 3C4FA 2R4BA 2PUUA 4AZWA 3VUMA 3PXZA 5AP2A 4MHAA 4X3JA 3CQUA 3EYGA 4AA4A 1UWJA 2UVYA 3AD4A 1JVPP 3UZPA 4ANBA 4O7LA 3MY5A 4BY9E 4MEDA 3C5IA 4Q5HA 2X8IA 3QUPA 4CVAA 2FSTX 4IB5A 3OEZA 4H3PA 3AC2A 3AT2A 4LV5A 3TKIA 3QC9A 4DHFA 4FVRA 4FF8A 2A19B 2VNYA 3PWDA 3R63A 4BWPA 5C4LA 3KCKA 3PXFA 3OG7A 2OJIA 4GG7A 2ITPA 2OIBA 2YWPA 2X8EA 1G8JA 3A4OX 3CIKA 3IKAA 3C7QA 5I5ZA 4C61A 4F0GA