5BUEA

Erk2 complexed with n-benzylpyridone tetrahydroazaindazole
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
348
structure length
329
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVATRWYRAPEIMLNTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand efficient tetrahydro-pyrazolopyridines as inhibitors of ERK2 kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
total genus 109
structure length 329
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bueA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bueA01
2BFXA 2HXQA 3F7ZA 4JDHA 4O0SA 2B53A 3PA5A 3ZYAA 4BBMA 3Q9XA 4ACMA 3PWYA 3I81A 5BUJA 3U54A 3GU6A 2HWPA 4YTIA 2WMSA 4CD0A 4YP8A 4PP9A 5HG8A 3I1AA 1J3HA 1J1CA 1NVSA 2BAQA 4AZVA 1MQBA 4L44A 1DM2A 3SG9A 4KD1A 3TIYA 2E9NA 2CGUA 4O6LA 3ZS5A 4E5AX 4FK6A 4JQ7A 3HLLA 4X21A 5DH3A 3ZU7A 3U55A 3UZTA 2C6OA 4X0MA 3BHUA 4RWLA 2R4BA 1YKRA 4YZCA 3TWJA 4DLJA 4QMTA 1J7UA 3HV7A 5JH6A 2YWPA 5AEPA 3WZDA 4M69A 3GI3A 5J7BA 5A6NA 3ZO4A 2R3RA 3FMHA 1FVRA 1H1QA 2VTLA 4RFZA 1SVHA 3BBWA 2QOOA 3DBEA 4RX8A 2VU3A 5J7HA 4I6BA 4BDKA 3UNZA 4C0TA 3I0OA 4FTQA 5A54A 2YZLA 2C5OA 3FKOA 3UGCA 5BQ0A 1YI6A 4FBXA 4WOVA 5AUYA 2QHMA 4XG6A 3WF8A 3NUPA 4J1RA 4TKSA 2IZSA 3D2IA 5AJQA 4NSTA 3NUXA 2Z7LA 1UU7A 4OTIA 5BMSA 4P7EA 3HEGA 4CFMA 2J0JA 2X8DA 5TKDA 3G9NA 4PTCA 2QC6A 3R1QA 3KXNA 4GH2A 3DJ6A 5M4FA 4BYIA 4G6LA 3Q4UA 5BVNA 2BTSA 3F2NA 3VUIA 4BVUA 1SVEA 1FOTA 1UKHA 4ID7A 5DVRA 4BI2A 4DT8A 2Y0AA 5DYJA 1F0QA 5IUIA 3TZMA 3PXQA 3EYHA 2VTPA 3GU7A 2C0TA 5CU3A 4BI1A 4R1YA 3GCUA 4L6QA 4RQKA 3LIJA 5HEZA 4GYGA 3RAHA 4X3FA 4AOIA 3DY7A 4FG7A 4EH5A 4EEVA 4C38A 3RK7A 4XG2A 1BUHA 2OO8X 1W84A 5HX6A 5BVDA 5KMJA 1Q62A 4YZMA 4FTCA 2PPQA 3FDNA 3O7LD 3PSDA 4UMQA 1LR4A 4Y73A 2BPMA 1OL5A 2ZM1A 3PY0A 3FV8A 5C1QB 3QZIA 4D2TA 4MD9E 1YXUA 4IAZA 1XHAA 4J97A 5T6KA 4UB7A 1M14A 4BKJA 4DG3E 3KGAA 4CSVA 4N4SA 4RIWA 4C7TA 3M2WA 4DG0E 2WMXA 2G2IA 2ZV9A 3QAME 4JDIA 3CD8A 5HI2A 4DFLA 3MVLA 2BHHA 2PMNX 4KBAA 1PMUA 3EN7A 4LG4A 2W5AA 1RE8A 2Y4IB 4O1OA 2VX0A 2PE2A 2VD5A 3KMWA 3KQ7A 4FSZA 4QP9A 3QWKA 5CEPA 5FD2A 4EHEA 2XVDA 3DJ7A 3LXKA 5L2QA 4O7NA 1YW2A 3SVVA 2AUHA 3G33A 5DIAA 3LQ3A 4FV7A 5EI8A 3KMMA 1G8SA 3O0GA 3PVUA 3NAYA 4UYNA 3VF8A 4C02A 3CGFA 4DC2A 1PYEA 2QHNA 3VS5A 3MB7A 3A8WA 4O96A 4FG8A 4NFMA 3Q96A 1BX6A 2PVHA 3AQVA 5I5ZA 4PDYA 5CZHA 2IO6A 4X3FB 4FEXA 4IVCA 4I93A 5DEYA 1YI4A 2YIRA 1H08A 5CALA 2PMIA 1IEPA 3G0EA 3QX4A 2HZ4A 2GNGA 3QA8A 2YLEA 4GU9A 4J99A 3B2WA 2WQBA 3R63A 3ZZEA 3AC3A 2PK9A 2NRUA 3SRVB 3KK8A 4YC8A 3HRBA 5CI6A 2WMTA 3U9NA 3WYXA 2PZRA 2BZIB 3WARA 3G9LX 4LRMA 2UZLA 3FWQA 3QRTA 4RIXA 3ZZWA 4JRNA 4EHVA 4EK5A 5AR3A 3FLQA 3COKA 3E7VA 4AFJA 4BBEA 2VO3A 4G3FA 4FT9A 4AW2A 4ALUA 4KWPA 3ZLSA 3FY0A 5J1WA 4EOKA 3T8OA 3O51A 2I0VA 4YZ9A 4CLIA 3IPHA 1UNGA 4M69B 4CTCA 1B38A 4X6RA 3HUCA 2QLQA 2WU6A 4QRCA 3TEIA 5AP7A 4BDFA 4Z16A 2RF9A 4LUEA 3AC5A 3VS3A 2IN6A 4ZTMA 1MQ4A 4D4VA 5ICPA 5LQFA 3ZXZA 3O23A 3QBNA 5BPYA 5KMKA 5HVJA 4G6OA 3UO6A 4RJ7A 3FMMA 2CGXA 4BCNA 3UYSA 1STCE 4TXCA 4J8NA 2W1HA 3H9FA 3LW0A 5A4CA 3HMNA 3HP2A 2DWBA 4DH5A 4U80A 1U59A 1VZOA 5D7AA 2XM8A 3W8LA 2E2BA 4CMUA 2XK8A 4NM0A 4FT3A 3GC9A 4L7SA 4O0XA 2OWBA 4WSQA 1P2AA 3F2AA 4G3GA 4MWHA 4F1TA 4X2KA 4Q9ZA 4AUAA 3KRXA 4R6VA 2YDJA 3AD4A 5DRBA 3TCPA 4YJRA 4D4RA 4R3RA 3QZHA 3ZEWA 1O9UA 3ORKA 3KXHA 4E4NA 2X7OA 4AT5A 4IM3A 5IQBA 2UZTA 2E9PA 3UO5A 1Z9XA 3A8XA 3QALE 1K3AA 3CCNA 4RMZA 5IH6A 4CRLA 4AZFA 3WE4A 2XS0A 4UX9A 4WG3A 3VQHA 2UZUE 4ZZOA 2BMCA 4S2ZA 3CS9A 3V5WA 4HPTE 1YOMA 3RI1A 3LHJA 5GZAA 5L8KA 4DBNA 3SW7A 4AZWA 2YFXA 2W1GA 1AQ1A 4KKGA 3HKOA 4DEAA 4J7BA 4LGGA 4IB1A 3RPYA 4MNEB 5DR6A 2B9HA 3BLHA 1TQIA 3EQBA 2GNFA 2C6MA 1YI3A 3I5ZA 2WZJA 4JOAA 3EN6A 3RKBA 3F66A 3A4OX 4FIGA 3FPQA 3NYXA 1CSNA 3O96A 3DZQA 5L4QA 4MQ2A 4ZSLA 3FHIA 3TN8A 5BUIA 2PMOX 3FXZA 4QTAA 3S00A 3T9IA 4C4HA 4FSNA 3UE4A 2VO6A 3OEZA 1XBBA 3CIKA 1OKYA 3LFSA 3ZDIA 3GOKA 3VN9A 3OCSA 4EH7A 5AUUA 3R9RA 2Z7SA 4O91A 3PLAE 3FAAA 4DGNA 1G8AA 3FUPA 3W2CA 4HVGA 2F2CB 4BDIA 4UWYA 3OHTA 5CU0A 2H96A 4A9YA 4E8AA 2PVRA 3UYTA 5LOHA 1Y8YA 2FGIA 2C5VA 5CT0A 3W55A 1H8FA 3OT3A 3DAJA 4F7NA 4DFXE 4HCUA 2P2HA 5IQHA 3FI3A 4U43A 2KTYA 4IVAA 3KXGA 4WIHA 4DYMA 5IMEA 4ZTQA 3HYHA 4MWIA 3O17A 3IGGA 4QT1A 3MFSA 2R3PA 5AP0A 5HKMA 3KF7A 3GC7A 4EBVA 1OI9A 2JGZA 1JVPP 3FMDA 1YDRE 1CKPA 3PJCA 4RJ6A 2WTVA 1JAMA 5EH0A 4YUQA 5I9XA 3DT1A 3WBLA 3P78A 4GJ3A 5KO1A 4EH4A 4ANLA 3EKNA 3FXXA 3ANRA 5CU2A 3RNYA 4D9UA 5CAVA 1XH7A 3R9DA 5GZ9A 4HYIA 3TXOA 3DCVA 2X1NA 1PMNA 4FKTA 2CCIA 4MTAA 4ZY4A 3LPBA 4E5WA 1FINA 4USDA 3VW8A 4A9SA 4AGCA 4F99A 4FEWA 3QQHA 5J79A 5HO8A 3P5KA 4FIEA 3EN5A 4ZTNA 2RSVA 3RVGA 3FSFA 4OTGA 4KB8A 3TNIA 4F7SA 3EN4A 4FSWA 5CEIA 1Q8ZA 3MTLA 5I4NA 4RIXB 4BC6A 2B9IA 3B8QA 3DQWA 3OWKA 4USFA 4ACDA 3QQLA 4KBCA 3WZEA 3A99A 4DGGA 3PA4A 3BQCA 3BGQA 3DK3A 4GVAA 1PYXA 1J7LA 2R3NA 4FV0A 5JGDA 2ACXA 4IWQA 3HA6A 2BUJA 5IKWA 4O7WA 5EI2A 1ZY5A 5H9BA 3PDTA 2PVKA 3Q5ZA 5DA3A 3EH9A 4FTLA 4QYEA 4XV1A 4OAUC 4FEVA 4JG6A 5ANDA 4GIHA 2J51A 2R7IA 2ITTA 4XMOA 5DBXA 2PVLA 5ANGA 3A7GA 3E93A 3MVHA 3UC4A 1LPUA 4Y5QA 3ULIA 3ZONA 4D4SA 3QKLA 4OT5A 4DFZE 3ZRLA 3ORPA 3OVVA 4IFGA 2CN8A 2B9JA 4RVMA 5FQDC 5TF9A 1YWVA 3LCKA 4EQUA 2EWAA 3D5WA 3AC2A 3G51A 1EH4A 4XRLA 3P08A 4EK3A 2WEVA 4L3JA 5L3AA 3ATTA 4YNOA 4WNKA 4ACGA 2QLUA 3QF9A 4K18A 4AN3A 1CKJA 5CF6A 5C27A 5FTOA 4WNOA 3F3WA 4AN9A 4CG8A 4F7JA 2VWZA 4O1PA 4KUJA 3ZLYA 3NWWA 4EUTA 4IXPA 3TKHA 4FKPA 2VTTA 4JRVA 2C0IA 1JKSA 3FZSA 5JFXA 5M55A 2G01A 5L6PA 1BL6A 2VRXA 3P0MA 4ENYA 3MPMA 2R3MA 3MJ1A 4RWKA 3BLQA 4FIHA 4KIPA 4MXCA 3R7EA 4RIWB 4YLLA 1P5EA 3IG7A 3S4QA 3QD4A 4CLJA 4QPMA 4FGBA 5E91A 1UWHA 3ZO2A 3AD5A 3R21A 4CCBA 1H25A 3D5XA 4MQ1A 4RX5A 3ZBFA 3ID6C 1LP4A 1ATPE 5GJDA 3BWFA 4PP7A 4H3BA 4D2SA 5KMMA 4IVBA 5GZ8A 4IAAA 3HZTA 4D5KA 5D10A 5IEXA 3R6XA 2BDFA 5K0XA 5JFWA 4P90A 2OLCA 1IR3A 2Y9QA 2BKZA 4CXAA 3QQKA 2BFYA 4JBOA 2EVAA 4FIIA 3KREA 4IB0A 5DGZA 4EOPA 2FUMA 2R3KA 4QNAA 5AM7A 4D1ZA 5HORA 3WF7A 3FL5A 2GCDA 3QTWA 3QQGA 3MH2A 4A4XA 4B7TA 2OK1A 3PIXA 3E7OA 3NIZA 3MH0A 2XCHA 3V5LA 3OG7A 1SNUA 2Z7RA 2XYNA 4CT2A 4YZDA 4MF1A 3DKOA 3PXZA 4DAWA 2QR7A 3A2CA 3VUDA 5ITAA 3Q04A 1WBTA 3BHYA 3NDMA 4G9RA 3QGYA 3S0OA 3ODZX 2R3QA 4TNDA 3MY0A 2YAAA 2ZDUA 3DB6A 4XCUA 4XV3A 1QPEA 4W4XA 3COHA 1FMKA 5HNBA 4BYJA 1H01A 2DYLA 2VTRA 2BDJA 3WOWA 4O84A 3FLYA 2YA9A 3KB7A 4H39A 4DLIA 2PU8A 3NS9A 3P79A 2Q0BA 2XA4A 4FICA 4C34A 4RJ5A 3IW4A 4MXXA 5F9EA 4LRKA 4ZMFA 3ZRKA 3DBCA 2WTKB 4RJ3A 4UMPA 4PDOA 1ERKA 3BU5A 3H9OA 3HDNA 4F64A 5CI7A 4Z7HA 3QTRA 5L8LA 3VVHA 3EQHA 3LLTA 2HCKA 4KINA 2VTIA 1RJBA 3HMMA 3MY1A 5TOZA 4NW5A 3V5TA 2YIYA 3QTSA 3BEGA 2ITZA 1U5RA 4J71A 3VHKA 4IZ5A 3JXWA 4AP7A 4EOMA 4YTCA 2R5TA 5IU2A 3PPKA 2PVJA 4FKJA 3VC4A 2YWVA 3K5UA 4BTKA 2G2HA 1WVWA 4TYGA 4JR3A 5M07A 2WFYA 3LM5A 4BKYA 2XEYA 3S2PA 4BICA 1Y6AA 5KKRC 1CM8A 3QUDA 4NEUA 2CKPA 4AW0A 3F69A 4L45A 4U5JA 4W8DA 2OH0E 1YHWA 3C5IA 2XNMA 1H4LA 1XKKA 4FIJA 4WNPA 5EDRA 3N4VA 1LEWA 1T46A 3ROCA 4GUEA 5HE0A 3E8DA 4IWDA 4OTWA 4V0GA 5EOBA 5H8GA 4F63A 1Y57A 2Y6MA 5HOAA 3B8RA 1U54B 3BRBA 4V0GB 3HL7A 3O7LB 3QCQA 5FM3A 5L8JA 1Q61A 1YVJA 4RA5A 3VHEA 2IW8A 4FTIA 2O2UA 3OMVA 4JBPA 1M52A 3PSBA 5JFSA 1BKXA 5KBRA 2GNIA 3DKGA 3D83A 4YBKA 4ANOA 4N6ZA 1I09A 2PZ5A 4PTEA 4YC6A 4E93A 5GINE 2WTIA 3RALA 1IASA 3G6HA 4QYFA 3EHAA 4FV5A 5IA5A 4WUNA 4IMYA 4AF3A 2PZPA 3PIZA 5A4TA 4FGRA 3MFUA 3R7GA 4RSSA 4YZNA 4QMSA 5J9LA 3ATSA 5ETIA 3VBYA 3D15A 4U6RA 1GAGA 3FI4A 3MS9A 2GU8A 3BU6A 3LXNA 3R73A 3O8PA 3H3CA 3MH3A 5JRQA 5A3XA 5J95A 3GQLA 4U44A 3V8SA 3EQGA 3AD6A 3KRJA 2C0OA 3O8UA 3HDMA 3F5GA 2X9FA 4ITHA 4O7SA 2UW9A 1PXMA 4DITA 3MPTA 4O38A 4GEOA 3E8NA 2OU7A 3WILA 4BL1A 4MVFA 3W8QA 1Z5MA 1OIUA 3FZPA 3ODYX 4N0SA 1L8TA 3QHWA 4KIKB 4HVSA 4KRDA 4L46A 4EZ7A 4L43A 2YN8A 3MWUA 4GG5A 3AC4A 4C35A 3BIZA 5AV1A 4LV8A 3R02A 5AR7A 3VIDA 3ZSIA 3FMKA 2XBJA 1OPJA 3IK3A 4IC8A 4Y85A 4YJQA 1YHSA 3CJFA 3A62A 3SD0A 2EUFB 5FBNC 4HNFA 4C4FA 3TUBA 4EOJA 3KC3A 4FTKA 5HD4A 4NCTA 5AA8A 2HZIA 4WKQA 1FMOE 4BB4A 2IW9A 1JPAA 3SRVA 3EQDA 3NNXA 1R3CA 2J0IA 3NW6A 4TYEA 1XH8A 3PG1A 4TWPA 3NX8A 4E6QA 2O5KA 3R01A 4MH7A 3RPSA 2V7OA 5DOSA 5DN3A 3CKWA 2WMQA 4FTTA 1Q41A 3PWDA 5IQCA 3R1YA 3DXPA 4M66A 2W0JA 5IZFA 2FSTX 4O81A 2YM5A 1E1VA 4PDSA 4BCGA 4C3PA 1G3NA 3D7TB 1Y6BA 2QOKA 5LJJA 4S30A 3OWJA 4KABA 1FGKA 5CZIA 4XBUA 3EL8A 4C61A 4DG2E 4FNYA 2C47A 4FNZA 4ZIMA 3E5AA 3GP0A 3QRJA 4NCTC 4F9WA 2XK7A 5A4LA 2FB8A 3RGFA 3W2RA 1VYWA 2HXLA 1OUKA 2C3LA 5L2IA 3QQFA 4RRVA 3EB0A 1ZLTA 2JKQA 3KA0A 4FVPA 4HCTA 4N70A 1OUYA 3BELA 5DMZA 3UNKA 4R78A 3CPBA 5IQAA 1A48A 4ZOGA 3QUPA 3HMPA 2R3IA 3DAEA 4TNBA 3UZRA 4PMMA 1YDSE 3IW6A 4JDJA 5FG8A 2PSQA 5IG1A 1UU8A 2VNWA 3EFLA 2YM7A 3FPMA 2WMWA 3R7UA 1BI7A 4XG4A 2H6DA 4QQJA 4AZTA 3D9VA 2XP2A 4DCEA 3WIGA 5HICA 5D1JA 5DT4A 4ZJIA 2R3HA 5IQEA 1Y8GA 2QOFA 2QKRA 2R7BA 4H05A 2XNEA 3LCTA 2C6EA 2G2FA 3OP5A 3EWHA 4KKEA 4U41A 4F08A 3AGMA 5HGIA 4EH6A 2A2AA 3R1SA 4I6FA 5CY3A 3MVJA 4EHZA 4I6QA 3R0TA 4G6NA 5ANKA 4EYMA 5HTBA 2W5HA 2W06A 2Z60A 3G2FA 3QRIA 5CYIA 2IG7A 1I44A 3LXPA 2BTRA 4JX7A 4KS7A 4AT4A 4EOOA 2CHLA 5CSWA 2PZYA 3UQFA 3IW8A 4AN2A 2HELA 4AE9A 2BAKA 1OL7A 3HVCA 4PY1A 4CG9A 3PXRA 4YMJA 4L3PA 5IQGA 3E88A 4XH6A 4CV8A 4HVDA 2XK4A 3JR1A 3C13A 5IQFA 4QYHA 4UXQA 5CXHA 4ZJJA 1OPLA 3CPCA 3OUKA 4HVIA 3SA0A 5BYLA 3FMNA 3KRWA 4JBVA 3W10A 4DH8A 4D5HA 4I0TA 3Q9ZA 2YDIA 2XK9A 3L9NA 5EHYA 4JIKA 4AU8A 4C2VA 2NP8A 5AFVA 3EYGA 2UZVA 4MBJA 2GNHA 3KRLA 4FV1A 3VBWA 2HW6A 4P5ZA 5AV3A 2JFMA 1CMKE 3LFDA 3LQ8A 1TQMA 3NUUA 3Q4CA 3TNWA 4D0XA 2QONA 4YSJA 2GQSA 5C4KA 1OL2A 4RC2A 3M42A 1H1RA 5J5TA 5C9CA 1QPCA 3MDYA 5K3YA 4L67A 3R7IA 2ITWA 4FT0A 4QP2A 4G9CA 3I0QA 3PE2A 3W16A 4Y83A 4EI4A 5HO7A 3NZ0A 3QZFA 2JBPA 2PUPA 4IFCA 5BVFA 4Y72A 3QC4A 2F57A 4LL5A 4O2ZA 4ZK5A 2WOUA 4DGLC 4A4OA 3OF0A 4D2VA 1WBNA 2F9GA 5I9ZA 5E8UA 5H3QA 5HE1A 5AV4A 4JNWA 4C4JA 4N57A 1Q99A 1XH6A 3BKBA 3AXWA 4PNIA 4TWCA 5BVKA 3RMFA 3TNQB 4D1XA 4R77A 4H1MA 2YITA 2X7GA 1ZYDA 3DTCA 3C1XA 3N51A 3U51A 3LZBA 3UVQA 3SXFA 4BCFA 5GIPE 5JGAA 1OECA 4I4FA 3R8MA 4DEGA 4KBKA 5AX9A 1WBVA 3FXWA 3R8VA 4X3JA 1PXNA 2HY81 2WQMA 2XKEA 5CSHA 3UC3A 4CMOA 5JQ5A 3LMIA 3A7FA 1R0EA 3SAYA 2ITXA 4L52A 2HIWA 5HNGA 2XIYA 4C37A 3ALOA 3V5QA 3JUHA 2G1TA 2ITOA 3DBQA 2UZOA 4AWIA 4ZAUA 1H1PA 3GXLA 3H0ZA 3QLGA 1WZYA 4E6AA 5A46A 4QQ5A 1ZYJA 3PUPA 1V0PA 3LLAA 5CSPA 2J6MA 3OCGA 3QKMA 3EQIA 5HCXA 2PL0A 3PXFA 5ETFA 5BYZA 2J0LA 1GOLA 1H1SA 3V04A 1ZOHA 2BAJA 3L1SA 4C4GA 3CXWA 2FSLX 4E3CA 1YWNA 5K0KA 1JQHA 4YTHA 5D11A 4U45A 4NTTA 3CQWA 4HVHA 4JIAA 4G34A 4XG8A 3LFNA 3D5VA 5TT7A 3Q2MA 3LCOA 4XJ0A 4R8QA 4FZ7A 5FWKK 5AP4A 5J9ZA 3NAXA 3DBDA 5CANA 1YQJA 3E64A 3IECA 4KKHA 1U46A 2BRHA 3UQGA 3WF6A 3O50A 4ZJVA 4M14A 4FKIA 1E9HA 3NNVA 4IX3A 5HCYA 4AW1A 4J96A 4AT3A 4JXFA 3FL4A 2H9VA 4JBQA 4R7HA 4B0GA 5T68A 4FT7A 4GFMA 2A4LA 2OI4X 3W2OA 1WVXA 4IIRA 4K11A 4PRJA 3PG3A 4LL0A 1OGUA 1B6CB 4MEDA 3DV3A 5FTGA 5E8ZA 3PE1A 4I5HA 4APCA 4F1OA 5DHJA 5IH5A 1OBGA 2JBOA 4K77A 4LM5A 4U40A 2QO2A 3PY1A 3GU4A 4BHNA 3AOXA 3KN5A 4OTPA 4U0IA 4CYJA 3ELJA 4OAVB 2B7AA 4GU6A 4I94A 3C4EA 5LVOA 2J5FA 1BLXA 3GB2A 3CKXA 3IDPA 4NKAA 5EKOA 4UMUA 4CGAA 2P3GX 4FKVA 2W1ZA 3NNUA 1SYKA 4GT4A 3S1HA 2BKKA 1WBOA 4NKSA 3QTXA 2RG5A 3FQSA 4F9YA 2C30A 3PPZA 4AG8A 3L9PA 3QQUA 4NM7A 5CVGA 1OIQA 4YHTA 1ZAOA 4Z7GA 3TDVA 2QOHA 4BFMA 5CASA 1OIRA 4DFUA 4UZDA 3JVRA 2VTJA 2JDRA 3MB6A 5BVOA 4I24A 3QC9A 3QA0A 2WELA 5JFVA 1Q3DA 1ZZLA 5DNRA 4QPAA 2UZDA 3RHKA 3TKIA 4D55A 2C5XA 4QTBA 3KK9A 3H0YA 3MIAA 4EZ3A 4MXAA 4HZSA 5BYYA 3KULA 4DFNA 3RNIA 4EH9A 4FKOA 5IA3A 4EOSA 2HW7A 5CSXA 4DEHA 5AR8A 5CX9A 2W7XA 2HENA 4FF8A 2I7QA 3C50A 2WTDA 2OZAA 3R30A 4R5SA 4JJRA 3RWPA 5KBQA 4IH8A 2WQNA 5HLWA 2VWBA 2WMRA 4MXOA 2RFNA 2VZ6A 4BDEA 3ENMA 4EONA 1KV2A 3CQUA 3CTQA 2JDVA 1XJDA 1R1WA 1URCA 3BYMA 4IEBA 3DZOA 3C0IA 2XUUA 1R0PA 3SDJA 4GKIA 5CQUA 4K8AA 1H0WA 2Y4PA 4D0WA 5CWZA 1RQQA 5FXQA 5E1SA 1AGWA 4RIOA 4FVRA 3U6HA 2BRMA 2Z8CA 2GFCA 3V3VA 1ZWSA 2O8YA 2OJJA 1MP8A 5I0BA 4GK3A 2W4KA 4DH3A 4U3ZA 3R8UA 3RCDA 2GS2A 1M2QA 3OXTA 2ITNA 3RWQA 2YABA 2XKDA 4O7LA 3KU2A 2BRNA 3IDCA 4RZVA 1JOWB 2VN9A 3EOCA 1W98A 3ZO3A 3DFCB 4IDTA 4JLCA 5DWRA 2FVDA 4CV9A 2J4ZA 3LFBA 4HPUE 3F82A 1UV5A 4D2PA 4XNEA 2HYYA 5IUHA 4ZMEA 5HHWA 1CKIA 3D7ZA 3MA6A 3HUBA 4GCJA 3QTIA 5KZIA 1W8CA 2WMUA 3HV4A 3FEGA 1PXJA 1PF8A 4EYJA 1U4DA 4HZRA 4NM3A 3DNEA 3ALNA 4FV8A 1VYZA 4FTOA 5KMNA 3W1FA 3Q53A 1H27A 4MHAA 5IEYA 1OIYA 5F94A 5H8EA 5EQEA 5G6VA 3NYVA 3U4UA 3WIKA 5A9UA 5KZ0A 2HWOA 2X7FA 2Q0NA 3NVMB 3VBQA 4P4CA 2WAJA 3L9MA 2BROA 2JD5A 4TW9A 3DAKA 5HU9A 4FKGA 4ASEA 4QMLA 3CTJA 3QD3A 4P2KA 4WA9A 5AR2A 2CSNA 3FE3A 4YO4A 5EDPA 2LAVA 1S9IA 3IGOA 4EK4A 4XV9A 4OT6A 2OFVA 3W18A 5TE0A 3VS7A 4U8ZA 4QD6A 1X8BA 5EM8A 4CMTA 3LAUA 3QRUA 5C8NA 4NJDA 1V1KA 3OY3A 3I6UA 3KEXA 3M11A 3PJ3A 3FI8A 1HCKA 1ZYLA 4HJOA 5L2TA 4XP2A 3AC8A 3FC2A 4EH2A 4BWXA 2ETRA 5LMKA 5LCKA 3EQFA 3HNGA 3UODA 1PW2A 3KVWA 5JT2A 2ZV8A 1KSWA 2VWUA 3R2YA 5C03A 3LE6A 4L42A 4QP1A 2H8HA 2V62A 2YCRA 5JRSA 5EI6A 1QPDA 4ANQA 5IDNA 4ZXTA 4UWBA 4OBPA 2IVTA 3CR0A 3ZSGA 2QO7A 4IVDA 4O27B 3UPXA 3UZPA 4YC3A 4UEUA 3O2MA 4CFNA 2O63A 5CEQA 4FR4A 5DG5A 4G2FA 4O0RA 3KKVA 3UDBA 2F7XE 2QNJA 5HVYA 3T3UA 3SXRA 3C4XA 4APPA 4JG8A 3UBDA 2DQ7X 3NIEA 4KIKA 3TUDA 3FZRA 2VO0A 5B2MA 1YWRA 4G3CA 2XJ0A 2YLFA 2OH4A 2A27A 2YHVA 2R64A 4WNMA 5AP6A 2XMYA 4DINA 5KNJA 2ONLC 4M84A 2Z7QA 2WGJA 5JEBA 3S3IA 5BX0A 3UTOA 3KFAA 1QMZA 3TZ7A 2AC5A 2XCKA 3DLZA 4L7FA 2F2UA 5FP6A 2UW4A 2W4OA 1XBCA 1H28A 4CQEA 1PKDA 4YURA 3R9OA 2R3JA 4ITIA 3ORTA 4WD5A 5EM5A 5IMXA 5I9UA 2QU5A 3PLSA 4UWCA 3F5PA 4XX9A 3SC1A 5CAPA 4O7YA 2GNLA 4GG7A 4JX3A 2GPHA 1Q8WA 1ZZ2A 3A61A 3HMOA 3ZFXA 2FSMX 3KCFA 5K4IA 4CFXA 3DPKA 3PIYA 4Z55A 2JLDA 4ACHA 2RFSA 5IA4A 2VV9A 3HECA 3OTVA 3ETAA 5GNKA 4X2NA 4RVKA 3OT8A 4FKLA 2HAKA 1Q5KA 2XNNA 4GK4A 4A9TA 2XIKA 3Q6UA 4KIQA 4L01A 4B99A 2W17A 3ZOSA 2BVAA 1V0BA 3G0FA 3VS1A 3OW4A 3P7BA 5H2UA 3F3UA 4FNXA 1DI9A 5LXMA 4FTJA 2W99B 4PL5A 4RWIA 3ROYA 3O8TA 2VTMA 1H26A 3F5XA 4Z9LA 3POZA 4G17A 3UIUA 3IO7A 1PRYA 3FHRA 4N6YA 3OCTA 4F4PA 5BMMA 3DNDA 3PTGA 3BHTA 2QVSE 2XF0A 4XG9A 3R7YA 4EC8A 4TPTA 2C6IA 5C01A 3RINA 5EFQA 4C4IA 4ANMA 4I4EA 5ANIA 4TN6A 3ULZA 4DEBA 5A4QA 1ZYCA 4WG5A 4BHZA 3GOPA 3HV5A 4YNEA 5M4CA 3D0EA 2OG8A 3CY2A 2RFDA 4D4YA 2CLQA 2V7AA 5AX3A 2XRWA 3EFWA 2VGPA 2PY3A 1GIIA 3BEAA 4BCPA 3F88A 4PF4A 2C5NA 4IX4A 3EQRA 4ZTRA 5E9EA 1O6YA 4S32A 3TZ9A 4AX8A 2WXVA 1WBWA 3AMAA 4BGQA 3DKFA 4F6UA 3L8XA 5E8WA 2WTJA 1ZOEA 2ITYA 4I6HA 4EL9A 4JG7A 2LGCA 3PZHA 4IB5A 4DF3A 4LOPA 5LVLA 5KKRB 2XNOA 4BR3A 4WBOA 2P55A 1PXOA 2BRBA 1FGIA 3DDPA 5EHLA 5HE3A 4E4LA 2VNYA 3QU0A 2PYWA 2HZ0A 3KRRA 4RJ8A 3D4QA 4D9TA 1NA7A 5DPVA 3BZ3A 3RPOA 1GIHA 4AQCA 2G15A 1KV1A 3GVUA 4CNHA 4BGGA 4IDVA 3VBXA 2V22A 4YJOA 3R7VA 4YBJA 2PUUA 5D41A 3RAIA 4E4MA 3BU3A 4II5A 2PHKA 3PVGA 2Z2WA 1FBNA 2PE0A 4MNFA 4CFUA 4IJ9A 4O0UA 3UNJA 4WG4A 2UW3A 2WTKC 3OTUA 4JAIA 3UOKA 3ZLWA 3BGZA 4C58A 1Q8TA 4UXLA 5AA9A 1IAJA 4QMOA 1JBPE 1JWHA 5FGKA 4EZ5A 3SQQA 4F9CA 3COIA 4FE2A 2BR1A 4XG3A 4PL3A 3C0HA 3BE9A 4YGAA 3VJNA 3ORXA 4BDGA 5CEKA 4K0YA 3KY2A 3VBVA 5E90A 3PYYA 3FLWA 3FLZA 4GT5A 3U4WA 3BV2A 2JC6A 3QFVA 3QYZA 5AAFA 5KHXA 3MA3A 3QD0A 1KE6A 4E6CA 4GSBA 4CQGA 5HBHA 2P0CA 4F0FA 3MPAA 1M7QA 3I79A 5JZJA 1DAWA 1JNKA 5IA1A 4NUSA 2QURA 1XH4A 3D14A 1NXKA 1FVTA 2YAKA 3LOKA 2J50A 2KULA 4NTSA 2GDOA 3RBWA 3DK6A 3GU5A 2CN5A 4BKZA 4G1WA 2QQ7A 3KXMA 2WO6A 4IX6A 4YPDA 5L2WA 3VJOA 2IW6A 5C8MA 3TV7A 3HGKA 5D12A 5EM7A 1H00A 3VWAA 3QXOA 2RIOA 1AD5A 1XH5A 3UQCA 4GIIA 5LWNA 4NH1A 4BCIA 3NSZA 4O7ZA 4TYHB 3QL8A 2J0MB 5ANOA 3OOMA 3P4KA 5DR9A 2CKOA 4OR5A 4IX5A 4FC0A 4IB3A 2PVFA 1ZXEA 3SOCA 5HNIX 5EQPA 2VWIA 3KXZA 3V6SA 4BWKA 1QCFA 2ITPA 3CP9A 3ZLXA 4GFOA 2EU9A 1IG1A 4R3PA 3BX5A 4QNYA 2VGOA 4ITJA 4DTBA 5E8TA 4AA5A 5CNNA 5HO6A 1A9UA 2X2KA 2XNPA 5J87A 2QU6A 3NYOA 4FYNA 2CCHA 3NNWA 1ZMVA 3MJ2A 1H0VA 4FEUA 5FEDA 2OXYA 4FZFB 5FXRA 2UVYA 1OL6A 3LXLA 3R8LA 4CZTA 3FBVA 5FP5A 4AE6A 2WIHA 4HGLA 1WAKA 2WU7A 4L68A 4IW0A 3NYNA 5E4HA 2OGVA 1Q8YA 3BGPA 4V05A 3R8ZA 3G15A 4NYEA 2YDKA 3E8EA 4BIDA 2BRGA 3EN9A 4BTMA 2P4IA 5LVNA 4CT1A 2X81A 4BZNA 3FY2A 4RQVA 3NCGA 5HLPA 1W7HA 4X6QC 4NFNA 3DK7A 4EH8A 5A4EA 5FM2A 4XYFA 3THBA 4LQMA 2XNBA 5AV2A 4TYJA 4I23A 2OZAB 5IA2A 2FSOX 3R1NA 4IZAA 2WMBA 3NCZA 2I1MA 2Q83A 4AW5A 3QCSA 3EKKA 4TY1A 3P23A 5CT7A 4TTHB 3OUNB 5GJFA 3MI9A 5ANEA 2YZAA 4M67A 1PMEA 3AG9A 3E87A 3RK5A 5I9VA 5KUPA 4JL9A 3TTIA 3PJ1A 5HZNA 2XNGA 3IS5A 3ANQA 4O7RA 4ASDA 4BTFA 3E3PA 5F1ZA 3OW3A 2WD1A 2OICA 4C3FA 1REKA 4FKWA 2ITUA 2JAMA 4RFYA 2ERKA 4F9AA 3R71A 3UP7A 4PMTA 4QQTA 2PVMA 2XB7A 2C6DA 2YJRA 1OBDA 1NY3A 2JITA 4JS8A 5DRDA 5JN2A 3LJ1A 4ERKA 3JYAA 5EYCA 4R7BA 4PV0A 2R0IA 3GT8A 4HW7A 3SLSA 3O71A 3QGWA 3FYKX 5E8SA 4RGJA 4FT5A 3QQJA 2YJSA 4LGDA 1GZOA 4F7LA 2B0QA 4YJTA 2X6EA 2OXDA 4O0VA 4I20A 2FO0A 1DAYA 3TJDA 1U54A 4JR7A 3NPCA 4G31A 2R0UA 4ALWA 4IAYA 3NRMA 3AT3A 2W9ZB 3FQHA 2JFLA 3C4FA 3S95A 4H1JA 2QODA 4AACA 3N4TA 2PVNA 3CTHA 3C9WA 3DJ5A 3WZJA 1K2PA 3HV6A 3DXQA 4Y8DA 5DT3A 2XK6A 4M12A 3KL8A 3Q9YA 1U5QA 2I0YA 2V55A 3I7BA 3C4WA 3DBFA 1UNLA 3VO3A 4O82A 4L9IA 4BDCA 4FNWA 5EDQA 4ZSEA 2CLXA 5IQIA 5HE2A 4PPCA 3KVXA 3EFJA 2WTWA 4PUZA 4YO6A 3QCYA 5E8XA 2ZJWA 4FSUA 5E8YA 1OKVA 3TACA 3A7HA 4MBIA 4C36A 5K5NA 4X7QA 3C4ZA 4ZZNA 2VWXA 2GFSA 4E1ZA 4QYGA 2JEDA 3RK9A 4RLLA 2J9MA 3ZO1A 4G5JA 4O86A 4RIYB 2XKFA 2E9OA 3ACKA 4B8MA 4C8BA 3F6XA 2GMXA 3T9TA 2W05A 1BYGA 3R83A 4NZWB 2W1IA 2W1CA 3EL7A 1CTPE 3G5DA 3QCXA 4AGUA 4DTAA 3ZFMA 2FH9A 5M53A 3AMBA 3MSSA 3ZDUA 3CEKA 3BYVA 3QUEA 3UOLA 5DR2A 2Z02A 3F9NA 1SM2A 3NR9A 3AGLA 4TWNA 4MCVA 5I3RA 4ZTLA 3GCSA 2A19B 4LRJA 2B52A 2BZHB 3OCBA 3PZEA 1MRUA 3LMGA 4YSMA 3GU8A 5M51A 3Q52A 3CLYA 3HRCA 1YXTA 4FKRA 3ACJA 3LVPA 1P4FA 4EKLA 3V5PA 5CS6A 2QG7A 4XUFA 5KCVA 4GUBA 5AUXA 4C57A 3DXNA 4DCAA 1O6LA 2XK3A 3I5NA 3HX4A 4OTQA 3POOA 4GYIA 4QMZA 2F4JA 1WFCA 3P7CA 3EQPA 2IVSA 1GZ8A 2QO9A 3E3BX 1JSUA 5KE0A 1R78A 3BYOA 4ANNA 2J90A 3JS2A 2WHBA 2W4JA 5M44A 4FV6A 4A07A 2VTQA 4HNIA 3SKCA 4CVAA 3R7OA 2XM9A 4MKCA 1PHKA 2XIRA 3F3VA 5LVPA 2C1AA 2ITVA 2O65A 3H10A 3FJQE 4OTRA 4DFYA 3TT0A 2VO7A 3VQUA 5AUZA 2C4GA 4CZUA 4EJ7A 2HOGA 4U81A 3B2TA 2BZJA 4K2RA 4FV3A 4I41A 4H58A 4RWJA 4FTUA 4Y46A 2W96B 5BNJA 5C26A 5CAOA 1ZYSA 5DFPA 3SHEA 3VUGA 5LWMA 3HAMA 3PXKA 3LM0A 5FBOA 2ZV7A 3SGCA 3GNIB 4IWPA 5EHOA 3A4PA 3MV5A 4O22A 5C4LA 4I0RA 3MN3A 3TDWA 3E62A 4IAFA 1ZMWA 3LQ5A 2QOBA 5HCZA 4RA4A 5FTQA 3TNHA 4CCUA 1ZARA 4RJ4A 3UP2A 1ND4A 2VTNA 3F5UA 4BCKA 2YM8A 4XBRA 3G6GA 4FZ6A 2W1EA 2V5QA 4KNBA 3V6RA 3VNTA 2JAVA 4ANSA 2GQGA 3DQXA 4A7CA 3OXIA 3MFRA 4OTHA 2BCJA 3D2KA 5HG5A 4ZY6A 1WMKA 1YXXA 5B7VA 4LUDA 3RHXA 5EYDA 1URWA 1GY3A 1JSVA 2GTNA 3U9CA 5EG3A 3FKNA 4FOCA 1MUOA 2BZKB 5EW3A 2YCSA 3OXZA 4FI1A 4TT7A 5HTIA 3R8PA 3RAWA 3V51A 3ENHA 5B0XA 3HRFA 4MK0A 5IF1A 4OW8A 4C4EA 4AOTA 1H07A 4EBWA 2X6DA 2PVYA 5ETAA 4YLKA 1XQZA 5AAGA 2RGPA 2GHLA 5CU4A 5HG9A 4RT7A 3RPVA 4E6DA 4EK8A 1O6KA 5DE2A 5LMBA 4AFEA 3CBLA 4YJNA 2XIZA 5CVFA 1GNGA 4UALA 4KS8A 2VTSA 3AT4A 3TV6A 4OTDA 1OKWA 3OBJA 3VS4A 4QMMA 3ZBXA 2J2IB 3PVBA 2XIXA 3VS2A 3SOAA 4HYSA 3ZM9A 4RLKA 4GVJA 4O0WA 1SZMA 4IM2A 3IDBA 2C6KA 3Q6WA 4O0YA 2IVVA 1XH9A 4FTNA 4HYHA 4NK9A 4AS0A 2BDWA 3UPZA 1OVEA 4RC4A 2ZVAA 5HU3A 1ZY4A 1G5SA 4IAKA 3LFFA 1H24A 4FV9A 3AMYA 3OBGA 4FTAA 5F20A 3QLFA 4XG7A 4CFFA 2IJMA 4IZYA 4S31A 2ZV2A 3QZGA 2X9EA 4CZYB 1Q24A 2CNVA 1OM1A 3BI6A 4ORKA 5LVMA 4F6WA 4F65A 1Z57A 3GCVA 1TVOA 1XR1A 1IAHA 1PXLA 4E5BA 5EW8A 1UWJA 3ZH8A 3SW4A 3CD3A 3BYUA 4EJNA 3BHHA 5AV0A 4LOOA 4PPBA 3W2PA 1IRKA 2YCFA 3EZRA 5LARA 3R04A 2PZIA 2B1PA 4GMYA 4DBXA 2OJFE 2OSCA 2XZSA 3IQ7A 5AUVA 2JIVA 4RX9A 5EM6A 3V8WA 2XEZA 4BDDA 4FOBA 3D94A 2QKWB 2GNJA 2RL5A 3R22A 5TO8A 4EHGA 2IWIA 3JY0A 4ERWA 1V0OA 4CKIA 3QKKA 2JIIA 2WMVA 3QTUA 4U3YA 4DH1A 5LMKC 4EOQA 4BIEA 3WZKA 3L9LA 3LFCA 4X2FA 3K54A 4BWPA 1E1XA 1K9AA 3Q5IA 2JDOA 3MVMA 4D58A 1WBPA 3EQCA 3W33A 4AXAA 4E73A 4C3RA 4JQEA 5ETCA 1OMWA 3BPRA 5LMAA 4HGEA 3TV4A 3MH1A 2YERA 5E1EA 1A06A 1BMKA 1YOLA 4B4LA 5EQYA 1JLUE 2XJ1A 3E92A 3HA8A 3Q4TA 1F5QA 4M8TA 4ARKA 5KHWA 1MRYA 3OD6X 2WNTA 3RAKA 5HVKA 4Q9SA 2WKMA 3OWLA 3GC8A 4UY9A 3R9NA 3BQRA 3WE8A 4J98A 5GJGA 5BVWA 3ZEPA 4YZBA 2ETMA 1UNHA 4C2WA 5ACBC 3DS6A 2C1BA 3FLSA 4KAOA 2PTKA 4ZLYA 1KWPA 2OW3A 4AGWA 1L3RE 4F70A 2AYPA 1NT2A 1H1WA 5FUTA 4MYGA 1FVVA 3I60A 3BYSA 3FMJA 2WB8A 4BDBA 4NT4A 4B8LA 4QYYA 4OLIA 2IZRA 2PMLX 4IACA 3LFAA 2X4FA 3JVSA 4MD8E 4OUCA 4V04A 3HMIA 3UMXA 2WQOA 4W8EA 4H3QA 2E9UA 3L8PA 2UW8A 5DT0A 3KCKA 4QMNA 3U6JA 3F3ZA 2UZNA 3DDQA 4ZLOA 1PJKA 3P7AA 4UZHA 5CNOA 5IUGA 2I0HA 4GJ2A 3CY3A 1SNXA 2QOIA 2R3LA 1JKKA 4CFWA 1FPUA 1PXPA 2R3FA 4LMNA 2UV2A 2A0CX 5KMOA 4EWQA 2NPQA 4FK3A 4UMTA 4DN5A 4M0ZA 2REIA 4BCMA 4LMUA 3VUKA 4JAJA 1OB3A 4PMSA 1NVRA 4RBLA 2JKOA 3BE2A 4K6ZA 4ASXA 4XLVA 3W2SA 5E7RA 3TIZA 3WI6A 2YIXA 4AA4A 3PJ8A 4BIBA 1SVGA 4EQCA 1GJOA 2OZOA 4USEA 2AC3A 3UVRA 2C3JA 4Y5HA 3L8VA 5IPJA 3NW7A 1P4OA 2C6LA 4GV1A 4QO9A 4WO5A 2ERZE 2J7TA 2OIDA 4CYIA 3R00A 3HP5A 4WHZA 2R9SA 5M06A 3NUNA 3ORMA 4WRSA 3CJGA 4U79A 1UA2A 3BLRA 3ZM4A 4DT9A 3NUYA 5ANJA 4A9UA 3VULA 3K3JA 4A4LA 2YACA 5I9WA 3BHVA 3UMWA 4R7IA 3U6IA 2QCSA 4FKSA 2ITQA 3TZ8A 2UW7A 3CC6A 5AR5A 2VWWA 4QMPA 1ZRZA 4BBFA 1YHVA 4GW8A 2FA2A 4QP7A 4XV2A 2CKQA 5I3OA 4S34A 5EYKA 1ZOGA 4L3LA 2DS1A 2QG5A 4BZDA 1Q3WA 2GQRA 5B2KA 4MXZA 5ACKA 4EUUA 2R3GA 4UV0A 5HX8A 4LGHA 5TR6A 3UO4A 2WEIA 4I22A 4IZ7A 4F0GA 4ZSAA 5CAUA 2G9XA 4CKRA 4LFIA 2CDZA 2ESMA 1Q4LA 4KSQA 3U87A 4AZEA 4CKJA 4OTFA 3TM0A 4U7ZA 4HGTA 4XRJA 3RZFA 3H9RA 5AAEA 3MFTA 5J1VA 4PPAA 3DGKA 4NIFA 3RZBA 4FL1A 4CEGA 5B2LA 5DEWA 3GENA 3IOKA 4FG9A 4FYOA 4G3DA 4I3ZA 4QP3A 3QHRA 4W4WA 1JSTA 4EC9A 5FEEA 2DUVA 3ZRMA 3TL8A 3T3VA 5CQWA 1W83A 4BCOA 3VUMA 5FXSA 3ERKA 3RCJA 3C0GA 2OF2A 1T45A 4RVTA 3UOHA 1VJYA 3IONA 4ZTSA 2Y7JA 1XWSA 1S9JA 1R39A 1M17A 2UW0A 5HD7A 3CGOA 5M56A 4V01A 2E9VA 2CMWA 3EZVA 4O0TA 4O2PA 4YJUA 5EK7A 4WRGA 2C6TA 4FL2A 4QMVA 2CJMA 2EB3A 2VTAA 1PMVA 4FTMA 1Y91A 3FKLA 3ZC6A 3JY9A 4RVLA 5G1XA 5EKNA 2VWVA 4DHFA 4IAIA 5CF8A 2BIYA 5K9IA 1HOWA 3ORZA 2O0UA 3Q2JA 4NM5A 3SV0A 2QOLA 4FSRA 4I5CA 4GRBA 3VBTA 4WT6A 3RPRA 4EWHA 5M4UA 5HESA 1B39A 3ZMMA 2XJ2A 4GFGA 4NWMA 5A14A 4DFBA 4MAOA 2C3IB 2YM6A 4NW6A 4DA5A 3PY3A 3PVWA 2VX3A 3RJCA 4QMUA 4R5YA 5CF5A 3FMLA 3UIXA 3SX9A 3P86A 5CSVA 2RG6A 5CVHA 3PP1A 4NJ3A 5BUEA 3BWJA 4QTCA 3KN6A 5CU6A 4B6LA 3TI1A 1MRVA 1P14A 2UZEA 3F3TA 4BTJA 5IA0A 1GZNA 2UW6A 2BHEA 4GS6A 5AM6A 5IEVA 4C62A 3Q32A 4FTRA 2PUIA 3REPA 1PY5A 2OBJA 2W9FB 4MF0A 4ZS0A 4BDAA 3ZUTA 4K9YA 1APME 3DLSA 4IBMA 5HIBA 4ZTHA 5AWMA 4H3PA 4MD7E 1BL7A 1W82A 1M2PA 2X2LA 4PDPA 3QTQA 4BY9E 5GHVA 2ZOQA 3F2RA 3I6WA 4FV4A 5CLPA 3TNPC 3A7IA 4P5QA 3ZUVA 4DH7A 3UOJA 4Q5HA 3EFKA 3K5VA 3LMHA 2ZAZA 4QMYA 3WF5A 4BGHA 4X2JA 1IA9A 3KULB 2EB2A 3VAPA 2RKUA 5CF4A 3EJ1A 2ZM3A 2UZWE 5L2SA 5JZNA 4QTEA 1SMHA 3AT2A 4CFVA 4M3QA 2GTMA 5AP3A 3FMEA 4FKUA 4R3CA 4QQCA 5BVEA 5L6OA 1TQPA 3ITZA 3MY5A 1OPKA 2OIQA 3PJ2A 4FODA 2VTOA 4HCVA 5IISA 3N9XA 5AP2A 2HY0A 2C5YA 3I4BA 2ZM4A 3ORNA 4YLJA 3A7JA 3LJ2A 3CSVA 4I5MA 3NVKI 1KUTA 5LCJA 4K33A 5M09A 1KE5A 3QWJA 4RZWA 2JIUA 3RM6A 5J8IA 4FSTA 3V5JA 3GBZA 2W1FA 4FSYA 1GIJA 4I5PA 3OROA 3ZSHA 4IWOA 3C5UA 4FVQA 5T3QA 4EORA 1HCLA 3ZHPC 3UG2A 2W5BA 2WQEA 2YM3A 4UN0C 4FUYA 4FMQA 3D5UA 3FI2A 5JKGA 5H8BA 1FQ1B 4U97A 4CRSA 1CDKA 5E92A 4JI9A 1OL1A 3G90X 4FA2A 1KE9A 4JT3A 4A06A 1RDQE 4ZEGA 4ALVA 2FYSA 4BRXA 5KMIA 4JDKA 1JKLA 3P1AA 3PFQA 4YJVA 3GCQA 3UIBA 2OFUA 4E4XA 2VWYA 4YHFA 3NLBA 3GQIA 2WMAA 2Y6OA 4I21A 1KE8A 4W4YA 4E7WA 3BV3A 2ZDTA 3KMUA 4PMPA 5AIKA 5M57A 4BI0A 4Z3VA 5AP5A 2CGVA 4G3EA 5HBEA 1ZMUA 3DA6A 4AAAA 4GKHA 3EIDA 4IM0A 3QTZA 3KF4A 2YCQA 3DOGA 5CENA 3LKMA 4J95A 3GCPA 5JQ8A 3V8TA 5K5XA 1UKIA 5AUWA 4MNEA 3MESA 1UU9A 3R28A 3C51A 5CEOA 2B9FA 2C69A 5DI1A 5HLNA 5D9HA 3LCDA 2I40A 3FQEA 3VUTA 5IQDA 4U9AA 4LI5A 1REJA 3OEFX 3ZXTA 4XS2A 4MBLA 4OBOA 4X3FC 3IW5A 4NL0A 3MTFA 4D2WA 2GHMA 4D1SA 3CQEA 2CKEA 3V01A 2F7ZE 1YDTE 4W9XA 4BN1A 4GL9A 4BZOA 3H30A 3WF9A 4KSPA 4J52A 3PSCA 4EOLA 1WCCA 2ONLA 2WOTA 4GT3A 4IC7A 4U42A 2UVXA 4NU1A 4W4VA 3F61A 1VEBA 3HAVA 4HYUA 1WBSA 4F6SA 3N4UA 4DEIA 3LFEA 2YIQA 4AGDA 4FSMA 3GEQA 2NRYA 1LUFA 2UVZA 4YJPA 3C4CA 4DGOA 4ZSGA 4EH3A 4F1MA 2EXCX 1YRPA 2J5EA 3NUAA 4EKKA 5C8KA 4O21A 3Q3BA 4B9DA 3UJGA 2JDTA 3PRIA 2WPAA 2BALA 1YXVA 4PL4A 4ACCA 4QP8A 2JKMA 2R3OA 4BDJA 4TRLA 3UVPA 1QPJA 1TKIA 2VUWA 4O6EA 4DGMA 1J7IA 4R1VA 1GZKA 1W0XC 3VF9A 3ZUUA 2SRCA 1JKTA 3QRKA 1J91A 1XBAA 2HZNA 3FSKA 1BI8A 1M7NA 4FZAB 4XP0A 4YJSA 3UIMA 2X8EA 3VRZA 2W1DA 5EYMA 3M1SA 1J1BA 4QMXA 3E8CA 2OIBA 5HQ0A 4S33A 4LV5A 4Q5EA 3FZTA 1DS5A 2OF4A 2QR8A 4FL3A 2CPKE 2CGWA 4QMWA 4LYNA 4M0YA 4HOKA 4WUAA 5CTPA 2P2IA 1UU3A 3MW1A 4ZSJA 3E63A 4FKQA 2UZBA 4I0SA 4J8MA 5A6OA 2I6LA 5HBJA 4DEDA 3PP0A 4DEEA 3NUSA 2YIWA 3ZC5A 3GFWA 3AC1A 4M15A 2Y8OA 2IPXA 1F3MC 1OZ1A 3MBLA 4TWOA 3VRYA 4QP6A 4QPSA 2ZB0A 1RW8A 2OJ9A 4YPSA 5HG7A 3QYWA 3NMUF 3MIYA 4E20A 5HIDA 3VS0A 3PRFA 4PTGA 2EXEA 4WSYA 4ZS4A 2RFEA 3FYJX 4FZDB 4BDHA 1OKZA 2O64A 3TTJA 3OFMA 4PX6A 3OOGA 2A1AB 3L8SA 4K1BA 1UVRA 4KIOA 5AP1A 3K3IA 3BBTB 2IVUA 4O7TA 2ETKA 3RP9A 3DB8A 4W9WA 5FLFA 5AADA 4BCHA 3DU8A 4QP4A 5I9YA 4TL0A 3PXYA 3C7QA 4PNKA 4FUXA 4RG0A 1NW1A 4YHJA 1YXSA 1PXKA 2C68A 4IANA 4JQ8A 4QOXA 4UYAA 3TJCA 5DLSA 2CNUA 4BCQA 4L53A 4IADA 4TYHA 4C33A 3GUBA 5GIOE 4F0IA 5CAQA 4XOYA 2GS6A 3GFEA 5J5SA 2JKKA 2PWLA 2WIPA 4YR8A 4ANBA 4F9BA 4I1ZA 2YISA 4TYIA 4UBAA 4L00A 3RM7A 4A9RA 4YTFA 3OZ6A 4OBQA 2ZB1A 5IH4A 2YM4A 3IOPA 2CNQA 2OKRA 4X2GA 4QTDA 1KOAA 5M4IA 5IDPA 4ZY5A 2OXXA 2ZMCA 4AOJA 3A60A 3ET7A 4IHPA 4NIFB 3TKUA 1IA8A 3K2LA 4I92A 2X8IA 2X2MA 2PE1A 5KX8A 1QL6A 4M7IA 4D2RA 2R2PA 3D7TA 3R9HA 3Q4ZA 2BILB 3NGAA 2ZMDA 3P9JA 4XHKB 3SXSA 2JDSA 2B54A 2EXMA 3QD2B 4XOZA 1M2RA 2NO3A 3R2BA 5CXZA 2O3PA 3BCEA 4KRCA 1PXIA 3VW6A 5D7VA 5FEQA 1WVYA 3ZCLA 3WYYA 2NNWB 2PULA 1LEZA 3LJ0A 4FV2A 2UUEA 2B4SB 4E26A 5FDPA 5HIEA 1XO2B 3FZ1A 5JGBA 4Y95A 2QOCA 5CEMA 1YOJA 2H34A 2IZUA 2Y4IC 3DTWA 5JMSA 4ONAA 3UG1A 5HTCA 5J9YA 4O83A 3W32A 4XEYA 5JK3A 2C3KA 5EOLA 4EK6A 4RC3A 2XYUA 3CE3A 1NVQA 4EOIA 2V0DA 4M13A 4RPVA 4TZRA 4DTKA 5F4NA 1KOBA 2OJIA 4BCJA 2QI8A 4FEQA 4ZP5A 4Q2AA 4DE4A 5F95A 2UW5A 5K4JA 1DI8A 3QXPA 4D28A 2PUNA 3OS3A 2F49A 4CTBA 1OITA 3GC0A 2OJGA 3PA3A 4IJPA 3VS6A 3W2QA 5M08A 3FLNC 4GK2A 4RIYA 1Q8UA 3KXXA 3LFQA 5FRIA 4QMQA 5AUTA 4ASZA 1VR2A 2IZTA 4AZSA 4UMRA 5AMNA 3PPJA 3ORIA 4XLIA 3TUCA 3TG1A 3QX2A 3H4JA 1KE7A 5L6WL 4ENXA 5E8VA 4AA0A 3HV3A 3JPVA 2VTHA 2XBAA 2GSFA 4BF2A 3ZTXA 2I0EA 5KMLA 3OC1A 5AIRA 2X39A 4M97A 4G5PA 3FZOA 4WBBB 3U8WA 5JSMA 4IE9A 4JVGA 4YU2A 3I7CA 1PKGA 2GHGA 3LCSA 2XRUA 4IQ6A 4F09A 4J53A 4ZLZA 2ZYBA 4FIFA 3F7WA 4FX3A 2BIKB 3ORLA 4L8MA 2X0GA 4RFMA 3GGFA 2GS7A 3DKCA 4XP3A 3WZUA 4KA3A 4H36A 2HK5A 3FC1X 2QD9A 3DFAA 2WTCA 2XKCA 3IKAA 4RX7A 5EW9A 3ZFYA 4C59A 3SG8A 4OGRA 3II5A 1Q97A 2B55A 3NW5A 2VAGA 3VUHA 4FSQA 3OWPA 2VX1A 3OY1A 4M68A 3Q60A 4LOQA 3EMGA 2QOQA 4G16A 4HGSA 4MXYA 2YEXA 5AR4A 2J0KA 3COMA 3MYGA 3Q9WA 4PWNA 4EQMA 3NEWA 4O7VA 2P33A 4PQNA 2X4ZA 5FDXA 2XH5A 3IW7A 3MGYA 4ZZMA 2F7EE 3RTPA 4MX9A
chains in the Genus database with same CATH superfamily
2BFXA 2HXQA 3F7ZA 4JDHA 4O0SA 2B53A 3PA5A 3ZYAA 4BBMA 3Q9XA 4ACMA 3PWYA 3I81A 5BUJA 3U54A 3GU6A 2HWPA 4YTIA 4AXEA 2WMSA 4CD0A 4YP8A 4PP9A 5HG8A 3I1AA 1J3HA 1J1CA 1NVSA 2BAQA 4AZVA 1MQBA 4F78A 4L44A 1DM2A 3SG9A 4KD1A 3TIYA 2E9NA 2CGUA 4O6LA 3ZS5A 4E5AX 4FK6A 4JQ7A 3HLLA 4X21A 5DH3A 3ZU7A 3U55A 3UZTA 2C6OA 4X0MA 3BHUA 4RWLA 2R4BA 1YKRA 4YZCA 3TWJA 4DLJA 4QMTA 1J7UA 3HV7A 5JH6A 2YWPA 5AEPA 3WZDA 4M69A 3GI3A 5J7BA 5A6NA 3ZO4A 2R3RA 3FMHA 1FVRA 1H1QA 2VTLA 4RFZA 1SVHA 3BBWA 2QOOA 3DBEA 4RX8A 2VU3A 5J7HA 4I6BA 4BDKA 3UNZA 4C0TA 3I0OA 4FTQA 5A54A 2YZLA 2C5OA 3FKOA 3UGCA 5BQ0A 1YI6A 4FBXA 4WOVA 5AUYA 2QHMA 4XG6A 3WF8A 3NUPA 4J1RA 4TKSA 2IZSA 3D2IA 5AJQA 4NSTA 3NUXA 2Z7LA 1UU7A 4OTIA 5BMSA 4P7EA 3HEGA 4CFMA 2J0JA 2X8DA 5TKDA 3G9NA 4PTCA 2QC6A 3R1QA 3KXNA 4GH2A 3DJ6A 5M4FA 4BYIA 4G6LA 3Q4UA 5BVNA 2BTSA 3F2NA 3VUIA 4BVUA 1SVEA 1FOTA 1UKHA 4ID7A 5DVRA 4BI2A 4DT8A 2Y0AA 5DYJA 1F0QA 5IUIA 3TZMA 3PXQA 3EYHA 2VTPA 3GU7A 2C0TA 5CU3A 4BI1A 4R1YA 3GCUA 4L6QA 4RQKA 3LIJA 5HEZA 4GYGA 3RAHA 4X3FA 4AOIA 2XAMA 3DY7A 4FG7A 4EH5A 4EEVA 4C38A 3RK7A 4XG2A 1BUHA 2OO8X 1W84A 5HX6A 5BVDA 5KMJA 1Q62A 4YZMA 4FTCA 2PPQA 3FDNA 3O7LD 3PSDA 4UMQA 1LR4A 4Y73A 2BPMA 1OL5A 2ZM1A 3PY0A 3FV8A 5C1QB 3QZIA 4D2TA 4MD9E 1YXUA 4IAZA 1XHAA 4J97A 5T6KA 4UB7A 1M14A 4BKJA 4DG3E 3KGAA 4CSVA 4N4SA 4DDGA 4RIWA 4C7TA 3M2WA 4DG0E 3W0NA 2WMXA 2G2IA 2ZV9A 3QAME 4JDIA 3CD8A 5HI2A 4DFLA 1G8JA 3MVLA 2BHHA 2PMNX 4KBAA 1PMUA 3EN7A 4LG4A 2W5AA 1RE8A 2Y4IB 4O1OA 4AQKA 2VX0A 2PE2A 2VD5A 3KMWA 3KQ7A 4FSZA 4QP9A 3QWKA 5CEPA 5FD2A 4EHEA 2XVDA 3DJ7A 3LXKA 5L2QA 4O7NA 1YW2A 3SVVA 2AUHA 3G33A 5DIAA 3LQ3A 4FV7A 5EI8A 3KMMA 1G8SA 3O0GA 3PVUA 3NAYA 4UYNA 3VF8A 4C02A 3CGFA 4DC2A 1PYEA 2QHNA 3VS5A 3MB7A 3A8WA 4O96A 4FG8A 4NFMA 3Q96A 1BX6A 2PVHA 3AQVA 5I5ZA 4PDYA 5CZHA 2IO6A 4X3FB 4FEXA 4IVCA 4I93A 5DEYA 1YI4A 2YIRA 1H08A 5CALA 2PMIA 1IEPA 3G0EA 3QX4A 2HZ4A 3AKKA 2GNGA 3QA8A 2YLEA 4GU9A 4J99A 3B2WA 2WQBA 3R63A 3ZZEA 3AC3A 2PK9A 2NRUA 3SRVB 3KK8A 4YC8A 3HRBA 5CI6A 2WMTA 3U9NA 3WYXA 2PZRA 2BZIB 3WARA 3G9LX 4LRMA 2UZLA 3FWQA 3QRTA 4RIXA 3ZZWA 4JRNA 4EHVA 4EK5A 5AR3A 3FLQA 3COKA 3E7VA 4AFJA 4BBEA 2VO3A 4G3FA 4FT9A 4AW2A 4ALUA 4KWPA 3W0QA 3ZLSA 3FY0A 5J1WA 1VLRA 4EOKA 3T8OA 3O51A 2I0VA 4YZ9A 4CLIA 3IPHA 1UNGA 4M69B 4CTCA 1B38A 4X6RA 3HUCA 2QLQA 2WU6A 4QRCA 3TEIA 5AP7A 4BDFA 4Z16A 2RF9A 4LUEA 3AC5A 3VS3A 2IN6A 4ZTMA 1MQ4A 4D4VA 5ICPA 5LQFA 3ZXZA 3O23A 3QBNA 5BPYA 5KMKA 5HVJA 4BJJB 4G6OA 3UO6A 4RJ7A 3FMMA 2CGXA 4BCNA 3UYSA 1STCE 4TXCA 4J8NA 2W1HA 3H9FA 3LW0A 5A4CA 3HMNA 3HP2A 2DWBA 4DH5A 4U80A 1U59A 1VZOA 5D7AA 2XM8A 3W8LA 4AAYA 2E2BA 4CMUA 2XK8A 4NM0A 3PFYA 4FT3A 3GC9A 4L7SA 4O0XA 2OWBA 4WSQA 1P2AA 3F2AA 4G3GA 4MWHA 4F1TA 4X2KA 4Q9ZA 4AUAA 3KRXA 4R6VA 2YDJA 3AD4A 5DRBA 3TCPA 4YJRA 4D4RA 4R3RA 3QZHA 3ZEWA 1O9UA 3ORKA 3KXHA 4E4NA 2X7OA 4AT5A 4IM3A 5IQBA 2UZTA 2E9PA 3UO5A 1Z9XA 3A8XA 3QALE 1K3AA 3CCNA 4RMZA 5IH6A 4CRLA 4AZFA 3WE4A 2XS0A 4UX9A 4WG3A 3VQHA 2UZUE 4ZZOA 2BMCA 4S2ZA 3CS9A 3V5WA 4HPTE 1YOMA 3RI1A 3LHJA 5GZAA 5L8KA 4DBNA 3SW7A 4AZWA 2YFXA 2W1GA 1AQ1A 4KKGA 3HKOA 4DEAA 4J7BA 4LGGA 4IB1A 3RPYA 4MNEB 5DR6A 2B9HA 3BLHA 1TQIA 3EQBA 2GNFA 2C6MA 1YI3A 3I5ZA 2WZJA 4JOAA 3EN6A 3RKBA 3F66A 3A4OX 4FIGA 3FPQA 3NYXA 1CSNA 3O96A 3DZQA 5L4QA 4MQ2A 4ZSLA 3FHIA 3TN8A 5BUIA 2PMOX 3FXZA 4QTAA 3S00A 3T9IA 4C4HA 4FSNA 3UE4A 2VO6A 3OEZA 3UDTA 1XBBA 3CIKA 1OKYA 3LFSA 3ZDIA 3GOKA 3VN9A 3OCSA 4EH7A 5AUUA 3R9RA 2Z7SA 4O91A 3PLAE 3FAAA 4DGNA 1G8AA 3FUPA 3W2CA 4HVGA 2F2CB 4BDIA 4UWYA 3OHTA 5CU0A 2H96A 4A9YA 4E8AA 2PVRA 3UYTA 5LOHA 1Y8YA 2FGIA 2C5VA 1W2FA 5CT0A 3W55A 1H8FA 3OT3A 3DAJA 4F7NA 4DFXE 4HCUA 2P2HA 5IQHA 3FI3A 4U43A 2KTYA 4IVAA 3BL9A 3KXGA 4WIHA 4DYMA 5IMEA 4ZTQA 3HYHA 4MWIA 3O17A 3IGGA 4QT1A 3MFSA 2R3PA 5AP0A 5HKMA 3KF7A 3GC7A 4EBVA 1OI9A 2JGZA 1JVPP 3FMDA 1YDRE 1CKPA 3PJCA 4RJ6A 2WTVA 1JAMA 5EH0A 4YUQA 5I9XA 3DT1A 3WBLA 3P78A 4GJ3A 5KO1A 4EH4A 4ANLA 3EKNA 3FXXA 3ANRA 5CU2A 3RNYA 4D9UA 5CAVA 1XH7A 3R9DA 5GZ9A 4HYIA 3TXOA 3ML1A 3DCVA 2X1NA 1PMNA 4FKTA 2CCIA 4MTAA 4ZY4A 3LPBA 4E5WA 1FINA 4USDA 3VW8A 4A9SA 4AGCA 4F99A 1ST4A 3QQHA 5J79A 5HO8A 3P5KA 4FIEA 3EN5A 4ZTNA 2RSVA 3RVGA 3FSFA 4OTGA 4KB8A 3TNIA 4F7SA 3EN4A 4FSWA 5CEIA 1Q8ZA 3MTLA 5I4NA 4RIXB 4BC6A 2B9IA 3B8QA 3DQWA 3OWKA 4USFA 4ACDA 3QQLA 4KBCA 3WZEA 3A99A 4DGGA 3PA4A 3BQCA 3BGQA 3DK3A 4GVAA 1PYXA 1J7LA 2R3NA 4FV0A 5JGDA 2ACXA 4IWQA 3HA6A 2BUJA 5IKWA 4O7WA 5EI2A 1ZY5A 5H9BA 3PDTA 2PVKA 3Q5ZA 5DA3A 3EH9A 4FTLA 4QYEA 4XV1A 4OAUC 4FEVA 4JG6A 5ANDA 4GIHA 2J51A 2R7IA 2ITTA 4XMOA 5DBXA 2PVLA 5ANGA 3A7GA 3E93A 3MVHA 3UC4A 1LPUA 4Y5QA 3ULIA 3ZONA 4D4SA 3QKLA 4OT5A 4DFZE 3ZRLA 3ORPA 3OVVA 4IFGA 2CN8A 2B9JA 4RVMA 5FQDC 5TF9A 1YWVA 3LCKA 4EQUA 2EWAA 3D5WA 3AC2A 3G51A 1EH4A 4XRLA 3P08A 4EK3A 2WEVA 4L3JA 5L3AA 3ATTA 4YNOA 4WNKA 4ACGA 2QLUA 3QF9A 4K18A 4AN3A 1CKJA 5CF6A 5C27A 5FTOA 4WNOA 3F3WA 4AN9A 4CG8A 4F7JA 2VWZA 4O1PA 4KUJA 3ZLYA 3NWWA 4EUTA 4IXPA 3TKHA 4FKPA 2VTTA 4JRVA 2C0IA 4O4EA 1JKSA 3FZSA 5JFXA 5M55A 2G01A 5L6PA 1BL6A 2VRXA 3P0MA 4ENYA 3MPMA 2R3MA 3MJ1A 4RWKA 3BLQA 4FIHA 4KIPA 4MXCA 3R7EA 4RIWB 4YLLA 1P5EA 3IG7A 3S4QA 3QD4A 4CLJA 4QPMA 4FGBA 5E91A 1UWHA 3ZO2A 3AD5A 3R21A 4CCBA 1H25A 3D5XA 4MQ1A 4RX5A 3ZBFA 3ID6C 1LP4A 1ATPE 5GJDA 3BWFA 4PP7A 3BLAA 4H3BA 4D2SA 5KMMA 4IVBA 5GZ8A 4IAAA 3HZTA 4D5KA 5D10A 5IEXA 3R6XA 2BDFA 5K0XA 5JFWA 4P90A 2OLCA 1IR3A 2Y9QA 2BKZA 4CXAA 3QQKA 2BFYA 4JBOA 2EVAA 4FIIA 3KREA 4IB0A 5DGZA 4EOPA 2FUMA 2R3KA 4QNAA 5AM7A 4D1ZA 5HORA 3WF7A 3FL5A 2GCDA 3QTWA 3QQGA 3MH2A 4A4XA 4B7TA 2OK1A 3PIXA 3E7OA 3NIZA 3MH0A 2XCHA 3V5LA 3OG7A 1SNUA 2Z7RA 2XYNA 4CT2A 4YZDA 4MF1A 3DKOA 3PXZA 4DAWA 2QR7A 3A2CA 3VUDA 5ITAA 3Q04A 1WBTA 3BHYA 3NDMA 4G9RA 3QGYA 3S0OA 3ODZX 2R3QA 4TNDA 3MY0A 2YAAA 2ZDUA 3DB6A 4XCUA 4XV3A 1QPEA 4W4XA 3COHA 1FMKA 5HNBA 4BYJA 1H01A 2DYLA 2VTRA 2BDJA 3WOWA 4O84A 3FLYA 2YA9A 3KB7A 4H39A 4DLIA 2PU8A 3NS9A 3P79A 2Q0BA 2XA4A 4FICA 4C34A 4RJ5A 3IW4A 4MXXA 5F9EA 4LRKA 4ZMFA 3ZRKA 3DBCA 2WTKB 4RJ3A 4UMPA 4PDOA 1ERKA 3BU5A 3H9OA 3HDNA 4F64A 5CI7A 4Z7HA 3QTRA 5L8LA 3VVHA 3EQHA 3LLTA 2HCKA 4KINA 2VTIA 1RJBA 3HMMA 3MY1A 5TOZA 4NW5A 3V5TA 2YIYA 3QTSA 3BEGA 2ITZA 1U5RA 4J71A 3VHKA 4IZ5A 1ST0A 3JXWA 4AP7A 4EOMA 4YTCA 2R5TA 5IU2A 3PPKA 2PVJA 4FKJA 3BL7A 3VC4A 2YWVA 3K5UA 4BTKA 2G2HA 1WVWA 4TYGA 4JR3A 5M07A 2WFYA 3LM5A 4BKYA 2XEYA 3S2PA 4BICA 1Y6AA 5KKRC 1CM8A 3QUDA 4NEUA 2CKPA 4AW0A 3F69A 4L45A 4U5JA 4W8DA 2OH0E 1YHWA 3C5IA 2XNMA 1H4LA 1XKKA 4FIJA 4WNPA 5EDRA 3N4VA 1LEWA 1T46A 3ROCA 4GUEA 5HE0A 3E8DA 4IWDA 4OTWA 4V0GA 5EOBA 5H8GA 4F63A 1Y57A 2Y6MA 5HOAA 3B8RA 1U54B 3BRBA 4V0GB 3HL7A 3O7LB 3QCQA 5FM3A 5L8JA 1Q61A 1YVJA 4RA5A 3VHEA 2IW8A 4FTIA 1TZDA 2O2UA 3OMVA 4JBPA 1M52A 3PSBA 5JFSA 1BKXA 5KBRA 2GNIA 3DKGA 3D83A 4YBKA 4ANOA 4N6ZA 1I09A 2PZ5A 4PTEA 4YC6A 4E93A 5GINE 2WTIA 3RALA 1IASA 3G6HA 4QYFA 3EHAA 4FV5A 5IA5A 4WUNA 4IMYA 4AF3A 2PZPA 3PIZA 5A4TA 4FGRA 3MFUA 3R7GA 4RSSA 4YZNA 4QMSA 5J9LA 3ATSA 5ETIA 3VBYA 3D15A 4U6RA 1GAGA 3FI4A 3MS9A 2GU8A 3W0MA 3BU6A 3LXNA 3R73A 3O8PA 3H3CA 3MH3A 5JRQA 1XMLA 5A3XA 5J95A 3GQLA 4U44A 3V8SA 3EQGA 3AD6A 3KRJA 2C0OA 3O8UA 3HDMA 3F5GA 2X9FA 4ITHA 4O7SA 2UW9A 1PXMA 4DITA 3MPTA 4O38A 4GEOA 3E8NA 2OU7A 3WILA 4BL1A 4MVFA 3W8QA 1Z5MA 1OIUA 3FZPA 3ODYX 4N0SA 1L8TA 3QHWA 4KIKB 4HVSA 4KRDA 4L46A 4EZ7A 4L43A 2YN8A 3MWUA 4GG5A 3AC4A 4C35A 3BIZA 5AV1A 4LV8A 3R02A 5AR7A 3VIDA 3ZSIA 3FMKA 2XBJA 1OPJA 3IK3A 4IC8A 4Y85A 4YJQA 1YHSA 3CJFA 3A62A 3SD0A 2EUFB 5FBNC 4HNFA 4C4FA 3TUBA 4EOJA 3KC3A 4FTKA 5HD4A 4NCTA 5AA8A 2HZIA 4WKQA 1FMOE 4BB4A 2IW9A 1JPAA 3SRVA 3EQDA 3NNXA 1R3CA 2J0IA 3NW6A 4TYEA 1XH8A 3PG1A 4TWPA 3NX8A 4E6QA 2O5KA 3R01A 4MH7A 3RPSA 2V7OA 5DOSA 5DN3A 3CKWA 2WMQA 4FTTA 1Q41A 3PWDA 5IQCA 3R1YA 3DXPA 4M66A 2W0JA 5IZFA 2FSTX 4O81A 2YM5A 1E1VA 4PDSA 4BCGA 4C3PA 1G3NA 3D7TB 1Y6BA 2QOKA 5LJJA 4S30A 3OWJA 4KABA 1FGKA 5CZIA 4XBUA 3EL8A 4C61A 4DG2E 4FNYA 2C47A 4FNZA 4ZIMA 3E5AA 3GP0A 3QRJA 4NCTC 4F9WA 2XK7A 5A4LA 2FB8A 3RGFA 3W2RA 1VYWA 2HXLA 1OUKA 2C3LA 5L2IA 3QQFA 4RRVA 3EB0A 1ZLTA 2JKQA 3KA0A 4FVPA 4HCTA 4N70A 1OUYA 3BELA 5DMZA 3UNKA 4R78A 3CPBA 5IQAA 1A48A 4ZOGA 3QUPA 3HMPA 1W2CA 2R3IA 3DAEA 4TNBA 3UZRA 4PMMA 1YDSE 3IW6A 4JDJA 5FG8A 2PSQA 5IG1A 1UU8A 5BV3A 2VNWA 3EFLA 2YM7A 3FPMA 2WMWA 3R7UA 1BI7A 4XG4A 2H6DA 4QQJA 4AZTA 3D9VA 2XP2A 4DCEA 3WIGA 5HICA 5D1JA 5DT4A 4ZJIA 2R3HA 5IQEA 1Y8GA 2QOFA 2QKRA 2R7BA 4H05A 2XNEA 3LCTA 2C6EA 2G2FA 3OP5A 3EWHA 4KKEA 4U41A 4F08A 3AGMA 5HGIA 4EH6A 2A2AA 3R1SA 4I6FA 5CY3A 3MVJA 4EHZA 4I6QA 3R0TA 4G6NA 5ANKA 4EYMA 5HTBA 2W5HA 2W06A 2Z60A 3G2FA 3QRIA 5CYIA 2IG7A 1I44A 3LXPA 2BTRA 4JX7A 4KS7A 4AT4A 4EOOA 2CHLA 5CSWA 2AQXA 2PZYA 3UQFA 3IW8A 4AN2A 2HELA 4AE9A 2BAKA 1OL7A 3HVCA 4PY1A 4CG9A 3PXRA 4YMJA 4L3PA 5IQGA 3E88A 4XH6A 4CV8A 4HVDA 2XK4A 3JR1A 3C13A 5IQFA 4QYHA 4UXQA 5CXHA 4ZJJA 1OPLA 3CPCA 3OUKA 4HVIA 3SA0A 5BYLA 3FMNA 3KRWA 4JBVA 3W10A 4DH8A 4D5HA 4I0TA 3Q9ZA 2YDIA 2XK9A 3L9NA 5EHYA 4JIKA 4AU8A 4C2VA 2NP8A 5AFVA 3EYGA 2UZVA 4MBJA 2GNHA 3KRLA 4FV1A 3VBWA 2HW6A 4P5ZA 5AV3A 2JFMA 1CMKE 3LFDA 3LQ8A 1TQMA 3NUUA 3Q4CA 3TNWA 4D0XA 2QONA 4YSJA 2GQSA 5C4KA 1OL2A 4RC2A 3M42A 1H1RA 5J5TA 5C9CA 1QPCA 3MDYA 5K3YA 4L67A 3R7IA 2XAOA 2ITWA 4FT0A 4QP2A 4G9CA 3I0QA 3PE2A 3W16A 4Y83A 4EI4A 5HO7A 3NZ0A 3QZFA 2JBPA 2PUPA 4IFCA 5BVFA 4Y72A 3QC4A 2F57A 4LL5A 4O2ZA 4ZK5A 2WOUA 4DGLC 4A4OA 3OF0A 4D2VA 1WBNA 2F9GA 5I9ZA 5E8UA 5H3QA 5HE1A 5AV4A 4JNWA 4C4JA 4N57A 1Q99A 1XH6A 3BKBA 3AXWA 4PNIA 4TWCA 5BVKA 3RMFA 3TNQB 4D1XA 4R77A 4H1MA 2YITA 2X7GA 1ZYDA 3DTCA 3C1XA 3N51A 3U51A 3LZBA 3UVQA 3SXFA 4BCFA 5GIPE 5JGAA 1OECA 4I4FA 3R8MA 4DEGA 4KBKA 5AX9A 1WBVA 3FXWA 3R8VA 4X3JA 1PXNA 2HY81 2WQMA 2XKEA 5CSHA 3UC3A 4CMOA 5JQ5A 3LMIA 3A7FA 1R0EA 3SAYA 2ITXA 4L52A 2HIWA 5HNGA 2XIYA 4C37A 3ALOA 3V5QA 3JUHA 2G1TA 2ITOA 3DBQA 2UZOA 4AWIA 4ZAUA 1H1PA 3GXLA 3H0ZA 3QLGA 1WZYA 4E6AA 5A46A 4QQ5A 1ZYJA 3PUPA 1V0PA 3LLAA 5CSPA 2J6MA 4O4BB 3OCGA 3QKMA 3EQIA 5HCXA 2PL0A 3PXFA 5ETFA 5BYZA 2J0LA 1GOLA 1H1SA 3V04A 1ZOHA 2BAJA 3L1SA 4C4GA 3CXWA 2FSLX 4E3CA 1YWNA 5K0KA 1JQHA 4YTHA 5D11A 4U45A 4NTTA 3CQWA 4HVHA 4JIAA 4G34A 4XG8A 3LFNA 3D5VA 5TT7A 3Q2MA 3LCOA 4XJ0A 4R8QA 4FZ7A 5FWKK 5AP4A 5J9ZA 3NAXA 3DBDA 5CANA 1YQJA 3E64A 3IECA 4KKHA 1U46A 2BRHA 3UQGA 3WF6A 3O50A 4ZJVA 4M14A 4FKIA 1E9HA 3NNVA 4IX3A 5HCYA 4AW1A 4J96A 4AT3A 4JXFA 3FL4A 2H9VA 4JBQA 4R7HA 4B0GA 5T68A 4FT7A 4GFMA 2A4LA 2OI4X 3W2OA 1WVXA 4IIRA 4K11A 4PRJA 3PG3A 4LL0A 1OGUA 1B6CB 4MEDA 3DV3A 5FTGA 5E8ZA 3PE1A 4I5HA 4APCA 4F1OA 5DHJA 5IH5A 1OBGA 2JBOA 4K77A 4LM5A 4U40A 2QO2A 3PY1A 3GU4A 4BHNA 3AOXA 3KN5A 4OTPA 4U0IA 4CYJA 3ELJA 4OAVB 2B7AA 4GU6A 4I94A 3C4EA 5LVOA 2J5FA 1BLXA 3GB2A 3CKXA 3IDPA 4NKAA 5EKOA 4UMUA 4CGAA 2P3GX 4FKVA 2W1ZA 3NNUA 1SYKA 4GT4A 3S1HA 2BKKA 1WBOA 4NKSA 2X0QA 2RG5A 3QTXA 3FQSA 4F9YA 2C30A 3PPZA 4AG8A 3L9PA 3QQUA 4NM7A 5CVGA 1OIQA 4YHTA 1ZAOA 4Z7GA 3TDVA 2QOHA 4BFMA 5CASA 1OIRA 4DFUA 4UZDA 3JVRA 2VTJA 2JDRA 3MB6A 5BVOA 4I24A 3QC9A 3QA0A 2WELA 5JFVA 1Q3DA 1ZZLA 5DNRA 4AXDA 4QPAA 2UZDA 4FJVA 3RHKA 3TKIA 4D55A 2C5XA 4QTBA 3KK9A 3H0YA 3MIAA 4EZ3A 4MXAA 4HZSA 5BYYA 3KULA 4DFNA 3RNIA 4EH9A 4FKOA 5IA3A 4EOSA 2A98A 2HW7A 5CSXA 5AR8A 5CX9A 2W7XA 2HENA 4FF8A 4DEHA 2I7QA 3C50A 2WTDA 2OZAA 3R30A 4R5SA 4JJRA 3RWPA 5KBQA 4IH8A 2WQNA 5HLWA 2VWBA 2WMRA 4MXOA 2RFNA 2VZ6A 4BDEA 3ENMA 4EONA 1KV2A 3PUFC 3CQUA 3CTQA 2JDVA 1XJDA 1R1WA 1URCA 3BYMA 4IEBA 3DZOA 3C0IA 2XUUA 1R0PA 3SDJA 4GKIA 5CQUA 4K8AA 1H0WA 2Y4PA 4D0WA 5CWZA 1RQQA 5FXQA 5E1SA 1AGWA 4RIOA 4FVRA 3U6HA 2BRMA 2Z8CA 2GFCA 3V3VA 1ZWSA 2O8YA 2OJJA 1MP8A 5I0BA 4GK3A 2W4KA 4DH3A 4U3ZA 3R8UA 3RCDA 2GS2A 1M2QA 3OXTA 2ITNA 3RWQA 2YABA 2XKDA 4O7LA 3KU2A 2BRNA 3IDCA 4RZVA 1JOWB 2VN9A 3EOCA 1W98A 3ZO3A 3DFCB 4IDTA 4JLCA 5DWRA 2FVDA 4CV9A 2J4ZA 3LFBA 4HPUE 3F82A 1UV5A 4D2PA 4XNEA 2HYYA 5IUHA 4ZMEA 5HHWA 1CKIA 3D7ZA 3MA6A 3HUBA 4GCJA 3QTIA 5KZIA 1W8CA 2WMUA 3HV4A 3FEGA 1PXJA 1PF8A 4EYJA 1U4DA 4HZRA 4NM3A 3DNEA 3ALNA 4FV8A 1VYZA 4FTOA 5KMNA 3W1FA 3Q53A 1H27A 4MHAA 5IEYA 1OIYA 5F94A 5H8EA 5EQEA 5G6VA 3NYVA 3U4UA 3WIKA 5A9UA 5KZ0A 2HWOA 2X7FA 2Q0NA 4AXFA 3NVMB 3VBQA 4P4CA 2WAJA 3L9MA 2BROA 2JD5A 4TW9A 3DAKA 5HU9A 4FKGA 4ASEA 4QMLA 3CTJA 3QD3A 4P2KA 4WA9A 5AR2A 2CSNA 3FE3A 4YO4A 5EDPA 2LAVA 1S9IA 3IGOA 4EK4A 4XV9A 4OT6A 2OFVA 3W18A 3AKLA 5TE0A 3VS7A 4U8ZA 4QD6A 1X8BA 5EM8A 4CMTA 3LAUA 3QRUA 5C8NA 4NJDA 1V1KA 3OY3A 3I6UA 3KEXA 3M11A 3PJ3A 3FI8A 1HCKA 1ZYLA 4HJOA 5L2TA 4XP2A 3AC8A 3FC2A 4EH2A 4BWXA 2ETRA 5LMKA 5LCKA 3EQFA 3HNGA 3UODA 1PW2A 3KVWA 5JT2A 2ZV8A 1KSWA 2VWUA 3R2YA 5C03A 3LE6A 4L42A 4QP1A 2H8HA 2V62A 2YCRA 5JRSA 5EI6A 2X0PA 1QPDA 4ANQA 5IDNA 4ZXTA 4UWBA 4OBPA 2IVTA 3CR0A 3ZSGA 2QO7A 4IVDA 4O27B 3UPXA 3UZPA 4YC3A 4UEUA 3O2MA 4CFNA 2O63A 5CEQA 4FR4A 5DG5A 4G2FA 4O0RA 3KKVA 3UDBA 2F7XE 2QNJA 5HVYA 3T3UA 3SXRA 3C4XA 4APPA 4JG8A 3UBDA 2DQ7X 3NIEA 4KIKA 3TUDA 3FZRA 2VO0A 5B2MA 1YWRA 4G3CA 2XJ0A 2YLFA 2OH4A 2A27A 2YHVA 2R64A 4WNMA 5AP6A 2XMYA 4DINA 5KNJA 2ONLC 4M84A 2Z7QA 2WGJA 5JEBA 3S3IA 5BX0A 3UTOA 3KFAA 1QMZA 3TZ7A 2AC5A 2XCKA 3DLZA 4L7FA 2F2UA 5FP6A 2UW4A 2W4OA 1XBCA 1H28A 4CQEA 1PKDA 4YURA 3R9OA 2R3JA 4ITIA 3ORTA 4WD5A 5EM5A 5IMXA 5I9UA 2QU5A 3PLSA 4UWCA 3F5PA 4XX9A 3SC1A 5CAPA 4O7YA 2GNLA 4GG7A 4JX3A 2GPHA 1Q8WA 1ZZ2A 3A61A 3HMOA 3ZFXA 2FSMX 3KCFA 5K4IA 4CFXA 3DPKA 3PIYA 4Z55A 3AKJA 2JLDA 4ACHA 2RFSA 5IA4A 2VV9A 3HECA 3OTVA 3ETAA 5GNKA 4X2NA 4RVKA 3OT8A 4FKLA 2HAKA 1Q5KA 2XNNA 4GK4A 4A9TA 2XIKA 3Q6UA 4KIQA 4L01A 4B99A 2W17A 3ZOSA 2BVAA 1V0BA 3G0FA 3VS1A 3OW4A 3P7BA 5H2UA 3F3UA 4FNXA 1DI9A 5LXMA 4FTJA 2W99B 4PL5A 4RWIA 3ROYA 3O8TA 2VTMA 1H26A 3F5XA 4Z9LA 3POZA 4G17A 3UIUA 3IO7A 1PRYA 3FHRA 4N6YA 3OCTA 4F4PA 5BMMA 3DNDA 3PTGA 3BHTA 2QVSE