5BUEA

Erk2 complexed with n-benzylpyridone tetrahydroazaindazole
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
348
structure length
329
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVATRWYRAPEIMLNTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Ligand efficient tetrahydro-pyrazolopyridines as inhibitors of ERK2 kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 109
structure length 329
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bueA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bueA01
4GRBA 5KMIA 4FV5A 4Z7HA 4KSQA 4EWQA 3U54A 3DKOA 5E8SA 3BEGA 3E87A 4IB1A 4FG8A 5HIBA 4MEDA 4BDHA 4ZJJA 4W4WA 3HDNA 1DAWA 2WU6A 4H39A 4FA2A 4XUFA 4DITA 4JDHA 2W06A 4MTAA 3UNZA 1ZARA 5EYCA 3R7GA 1M17A 4FOCA 4FODA 3MTLA 4R7HA 4WNPA 4BKYA 1IA9A 2R3PA 4EI4A 4E4NA 2WMUA 3HDMA 3KCKA 1KV2A 4RIXA 3WF7A 4W9XA 4ZZMA 4B99A 1OMWA 2J2IB 3FLQA 1BYGA 3U4WA 3F7ZA 2W1IA 5A3XA 1TQMA 4L43A 2YISA 4I21A 2VWBA 5EHOA 3LPBA 2QOOA 1H0VA 4UXQA 5ACKA 5EM8A 5IA1A 4G6LA 2BVAA 2QOBA 2WTCA 2B53A 3D5XA 5HBEA 2PUPA 4FV9A 4I20A 4YTHA 3QBNA 3L1SA 4NEUA 5AP2A 4LGHA 2C47A 5IU2A 4M7IA 5HE0A 1APME 4HGLA 3AD4A 4WD5A 5LMKA 3PJ8A 4E8AA 4EUTA 1LP4A 1QCFA 3BBWA 3PJCA 4CTCA 4A4OA 4QMSA 1YI3A 3LJ1A 3A4PA 4O0RA 3ACJA 5EYKA 4D0WA 3FYJX 2J6MA 3KULB 4O91A 3EFJA 4ANLA 1ZMWA 4KIKB 4O6EA 3VWAA 4BCFA 3FZPA 3TCPA 2WTVA 4J1RA 4DCEA 5BVDA 1KE6A 4O7VA 3CE3A 5T3QA 4C4JA 2YWPA 4IEBA 5CEQA 3UJGA 2C1AA 2BFYA 4MAOA 4QTCA 3UZPA 2YCFA 2QR7A 3OFMA 1ERKA 4FV3A 3SAYA 3QLGA 1XHAA 2VTMA 3NNVA 4N6YA 2J5EA 4BF2A 4C4GA 4L00A 5BYYA 4D2VA 1VYWA 1UVRA 5CSWA 5HCYA 4O0TA 2H6DA 2EB2A 4FV1A 5ANEA 3W2CA 1SZMA 3OXTA 5EW3A 2CKQA 5K4JA 1KUTA 3OEFX 5T6KA 2QCSA 2R3GA 4I6FA 4MNFA 5CQWA 5DFPA 5HG8A 5DT3A 5CEMA 3PRIA 4NYEA 4BR3A 4BDKA 4ZTSA 5KMMA 1P4OA 1EH4A 2CLXA 3FKLA 2P3GX 4HYUA 2GFSA 2ZMDA 1ZZ2A 3R63A 2UW5A 4QNYA 4KSPA 5LCKA 2XCKA 4F1TA 1QPJA 3IDCA 3ZDIA 1ZYDA 3REPA 1H08A 3ZRLA 1WBTA 1YXXA 4X6RA 3HV7A 3PXYA 4EOJA 4O7LA 2VWZA 3PXKA 4QP2A 2ITUA 4TNBA 4RX9A 4D9TA 3G5DA 3WZJA 4GUBA 4XHKB 3DDPA 1GZ8A 2P4IA 5D10A 5J5SA 5EW9A 4D2SA 4PV0A 5KX8A 4KRCA 2WEIA 4EQCA 2PVHA 3O71A 4H1MA 4G31A 2YIYA 3CTQA 5AR8A 3PVGA 4QYEA 2W5BA 4X3FC 3E62A 3DNEA 1ZYJA 1J7IA 4LFIA 4AT4A 2RSVA 3MFUA 1PXKA 3G9LX 4EBWA 2IW9A 4HPTE 1MQBA 1PHKA 3RK7A 3CPBA 3VIDA 3NMUF 2G01A 3LFEA 4MX9A 4U80A 3MVJA 3B8RA 4BDBA 2CSNA 4FTUA 4GFMA 2RG5A 4B4LA 4C4EA 1ZYCA 4IZAA 3EOCA 4GT5A 5J9LA 4ZSLA 3HX4A 2J9MA 5KCVA 5CEOA 2WKMA 2YDKA 3A62A 4EH4A 3PY3A 1UV5A 3QAME 2J90A 3RI1A 4MBIA 1U5RA 4LV5A 5M4CA 5FTGA 3EZRA 5AX3A 3HV6A 4CVAA 5J79A 4FSNA 4AZVA 4F0FA 4GW8A 2Z7RA 4CFMA 4OTWA 3HP5A 4QP8A 4RIWB 5CSVA 5KNJA 1IAJA 5CF5A 4R6VA 4IB3A 5HNBA 4C2WA 3IW8A 1FVTA 2YN8A 3BQCA 3P23A 3G0EA 3S2PA 4EH8A 3F82A 3EWHA 3PPJA 3I79A 5CU6A 2YZAA 5J8IA 4CQGA 2C6TA 4FKGA 1OKVA 4RX8A 5CLPA 4FEXA 3OF0A 4M67A 5EK7A 4FR4A 1U54B 5EH0A 5EDQA 5BX0A 2R3HA 4QD6A 4F4PA 3CXWA 2XKCA 1LPUA 4BZNA 2C68A 3C1XA 4FKOA 2OH4A 3V3VA 4IX4A 3W55A 1OM1A 4WG5A 3RTPA 3THBA 4USFA 4YO6A 4E93A 3UYSA 2OU7A 2UZNA 4S2ZA 3WZEA 5T68A 1UU3A 3EN7A 3G2FA 4BB4A 5CF6A 4FKIA 4APPA 3NUSA 1YKRA 2YDJA 5CALA 1Q41A 5KMOA 4FTIA 2UVYA 1U59A 1YOMA 4JR7A 4E4MA 1HCKA 5HE2A 2FSOX 4OGRA 1XBAA 3P9JA 4P5ZA 4CCBA 4EONA 4DT9A 4EK3A 2CGWA 2FGIA 3R8ZA 3C4CA 2I0EA 4CGAA 2RFSA 2RG6A 4B8MA 3QHWA 3EIDA 5DOSA 3RAHA 4FSUA 3DK6A 4LRJA 2X1NA 4NM5A 3GCUA 4ITHA 3HRBA 3FV8A 4ZSEA 4BCPA 3DNDA 4ZMFA 5JKGA 3NIZA 4DEGA 1Y8GA 4IDTA 4IM0A 3A61A 1NW1A 4UWYA 2X6EA 3VS7A 4AT5A 5IISA 3Q4UA 4FUXA 4IVDA 1ZZLA 4DG3E 3QLFA 5AV2A 3FDNA 2B9IA 3COIA 1OUYA 2C1BA 3Q32A 4WUNA 5H8GA 5TT7A 4EOOA 2CPKE 5CAPA 3SVVA 4O7WA 4HW7A 3TL8A 2BPMA 4E1ZA 2P2IA 1FPUA 5F94A 3NVKI 4CG9A 3PE2A 3QD2B 4R7BA 4ERKA 4GSBA 3MB6A 4IWOA 4QMZA 3W33A 4BYJA 1YW2A 4HYHA 2A4LA 4I6BA 1ZMUA 3QD4A 3F88A 3BYVA 2HWOA 3KRJA 5HD7A 3W18A 5IZFA 5AADA 4RIXB 5DEYA 3GT8A 5ETAA 4GG7A 3LMHA 5L2TA 4G3DA 3A4OX 2HOGA 2GQRA 1ZOEA 3AOXA 1RQQA 3IDBA 1U46A 3ZOSA 3T8OA 3TV6A 1IA8A 5DIAA 1JAMA 2QLUA 5HD4A 3WF5A 2YWVA 4DT8A 3KQ7A 3FI4A 1IEPA 3R28A 3LMGA 5CU3A 3TKIA 1H00A 4QMWA 3VHEA 5CF8A 4BICA 2XK3A 2ONLA 3ULZA 4EK5A 4GU9A 3UP2A 2ZAZA 3QQKA 4UY9A 3VULA 4MWHA 4HVGA 4DBXA 3QKKA 4X6QC 1XKKA 4PMTA 1H1WA 5JRSA 3S0OA 2WQNA 3BGPA 4FUYA 2YA9A 4L7SA 1R1WA 4C61A 3MA3A 1P2AA 2OJGA 2JIIA 3FXWA 4XP2A 2W4JA 4ZSGA 3SW7A 5D7VA 1JLUE 4HGEA 4USDA 5IQAA 3WYXA 3TUBA 5K5NA 3KEXA 3MIAA 4H1JA 2IN6A 3FMJA 5CS6A 1FQ1B 4I0RA 4AN2A 2XKFA 3GU8A 4QP9A 4Y5QA 4FSWA 4WKQA 3ODZX 2PMNX 4OTIA 4AXAA 5DRBA 4PDSA 2PK9A 3R04A 4CV8A 4PL5A 4JBQA 5CYIA 4D1XA 3MBLA 4FSTA 3UIMA 4MNEA 1MRYA 1XH7A 4QNAA 4TXCA 3KREA 4NW6A 5CXZA 2JIVA 5D7AA 5CWZA 5BQ0A 3C0HA 3F3UA 4MXCA 4ITIA 1Z9XA 4FKSA 3E7VA 3QCYA 3O8PA 5AA9A 4FOBA 3D0EA 4RQKA 4XS2A 3KC3A 4BDJA 2DS1A 2YLEA 3EQGA 2GHGA 1NXKA 3D14A 5AAGA 3KMWA 4BN1A 5J9ZA 4ANNA 1MQ4A 1KE8A 4A9SA 2Y4PA 3HNGA 1J7UA 3ZO4A 1V0PA 3NUNA 3C13A 3OOGA 2PVLA 4D2RA 5C27A 2OLCA 4C62A 3K5UA 5FXRA 3P5KA 4NTSA 4CKJA 3UOKA 3O23A 4GK2A 3ZMMA 1FGIA 2UZWE 3D9VA 4UMRA 3R8VA 5J1VA 3DBFA 4X2JA 5E4HA 4ZIMA 4C33A 5LVPA 2PVFA 4IM3A 2JBOA 3SDJA 3NS9A 4UWCA 1J1BA 3HP2A 5GINE 2WXVA 3QWKA 4BCMA 4OTGA 5AP5A 4ZP5A 4BDDA 3V6RA 3L8PA 4W9WA 2UW4A 4FX3A 2JDRA 2BDWA 3P7AA 5A9UA 5TOZA 2C6OA 4Y73A 3QQFA 4LOPA 1F0QA 1UU9A 2XRWA 2ZB1A 4O0UA 5CZIA 3ELJA 4LOQA 1E1VA 3EYGA 4N0SA 3V5PA 4KBCA 4ZZOA 5IUHA 5DGZA 3ID6C 3EQPA 3D94A 2IWIA 2VTTA 3NRMA 4UZHA 4MXOA 3AC2A 4RFYA 4U0IA 4W8EA 4M69A 5DN3A 4D1ZA 4ONAA 1PKDA 4M13A 4FEVA 3BWFA 4RRVA 3ZZEA 2UZOA 5AP4A 3VBXA 2VGOA 3TZMA 5EDPA 4YO4A 4IANA 2HZNA 2ETRA 2R3JA 3QTQA 4TNDA 4O27B 5DHJA 4LI5A 2XM9A 5CEKA 2J4ZA 3I7CA 4EZ3A 3PP0A 3PPKA 3VN9A 3OVVA 3CY2A 3DKFA 4W4VA 4AS0A 5CNNA 4X7QA 1F5QA 3GGFA 3QTZA 4FTLA 2B9JA 4I23A 2JDTA 3TIYA 5L4QA 2R3IA 3UNJA 5FM2A 4C34A 5CY3A 3BZ3A 4H3BA 4FYNA 3RPRA 5A46A 1XH6A 5DLSA 4RJ6A 2R0IA 3GQIA 3KFAA 3ATTA 1YOJA 3LCTA 4GMYA 4IC8A 4HVDA 3BYUA 3FC2A 2WNTA 3ZO3A 3I60A 4FVPA 3TTJA 4PPCA 3HUCA 5BVOA 2X9FA 4RA4A 4PRJA 3ZEWA 3TNWA 3ORIA 3GC0A 4M15A 2F9GA 3NW6A 3ZLSA 4ZXTA 5CZHA 5FXQA 4AGWA 3RZBA 5HBJA 3HYHA 2X39A 4MQ1A 4QT1A 2XKDA 4ALVA 2YM6A 3DA6A 4WBBB 4DFBA 2IO6A 1BKXA 3GI3A 4FV6A 3DB6A 5ANGA 3VAPA 3ZUVA 4ANSA 4FZAB 1ZMVA 3OROA 3RAWA 4EEVA 3Q96A 5M4UA 4RIOA 4DTAA 2X7FA 2G2IA 3OCGA 3EFWA 4BCGA 4F70A 5IQIA 4CFWA 4F0IA 5EG3A 3UMWA 4NT4A 1WAKA 1K3AA 3QXPA 4F63A 3OTUA 4X2FA 3BKBA 3NAXA 1HCLA 2ZM1A 4GUEA 2W17A 2JD5A 3MA6A 3FHIA 3F7WA 3VQHA 4YUQA 3UC3A 3E63A 2VX1A 3I7BA 2QOCA 5EFQA 2J0JA 2W9ZB 3GNIB 4IAFA 4AA0A 2EUFB 4CFNA 4IWPA 3DXNA 2GS7A 2HYYA 2J0IA 4EOQA 4C59A 2W1FA 3KK9A 1V0OA 3U6JA 2XBJA 2OICA 3ET7A 2ITQA 3FL4A 4FEQA 5HG7A 3Q60A 2QO9A 4BFMA 3RMFA 3I6UA 2PYWA 3GQLA 4FSQA 4GL9A 4CZTA 3O50A 3C5UA 2OJ9A 3PIXA 3PPZA 3RAIA 3WILA 4GVJA 4N70A 4W8DA 1KOBA 1XH5A 1ZOHA 4N4SA 4PUZA 4CG8A 3UG2A 4P7EA 4QRCA 2PZPA 4MXAA 3W32A 3A2CA 5CT0A 5KHWA 4CRSA 4R5SA 4LM5A 3EYHA 2ESMA 4YURA 1HOWA 1VR2A 4UV0A 2JLDA 2XCHA 1VEBA 4C3FA 2VNWA 1YXUA 4USEA 1YHSA 5BVFA 5JSMA 3K3JA 3TDWA 3IGGA 4EK6A 1ZYSA 4XOYA 2HZ4A 3VUHA 4IACA 3QRJA 2W7XA 2OI4X 5E8TA 3MI9A 4BGQA 4E20A 4FKLA 4LGGA 3MY0A 3OG7A 5EHYA 2OZOA 4KNBA 2PE2A 3OT3A 4L8MA 1F3MC 5H9BA 4S31A 1R3CA 3RBWA 3D7TA 3ZSGA 2VTJA 2HY81 2REIA 4DHFA 2E9VA 2ITYA 2PE0A 2VTOA 3TKUA 3QHRA 1V1KA 5GNKA 4QMUA 1PXIA 4BDEA 5HQ0A 2XZSA 3LFFA 4BDCA 3OBJA 3CBLA 1Q99A 2VTSA 3LCKA 3A99A 3TUCA 5CEPA 3R2BA 3KMUA 4DFZE 1FVRA 2QR8A 3DV3A 3NGAA 4CFUA 3O17A 4K1BA 4BI0A 4Q9SA 4BDAA 3IS5A 4Q5EA 4QMQA 3MS9A 5HX6A 2Y9QA 5IQGA 2HENA 3LFQA 3QUPA 2G2FA 4RPVA 3DAKA 5AUXA 3UO6A 1PRYA 3ZXZA 4JXFA 3R9OA 3C4EA 1KWPA 4ZSJA 1DM2A 3LLAA 5FD2A 5FBOA 3D2IA 5IH4A 1QL6A 2BRNA 2BZIB 2WOUA 3R6XA 3G90X 3IK3A 5CXHA 4FSMA 4ACGA 3W2PA 5L2WA 1CM8A 1IAHA 3QCQA 3ITZA 4MNEB 2CNVA 4K6ZA 5H8EA 2WTKC 1SVEA 1Q8UA 3P78A 3QF9A 2YJRA 2OFUA 3LFAA 4YSJA 4XLVA 4RJ8A 4QMLA 1Q8YA 1H26A 2JITA 4BCIA 5HO8A 2OO8X 2C6IA 4JIAA 4TYHA 1BL7A 3ORZA 1O6KA 4CTBA 4L6QA 4I5CA 4RQVA 3NR9A 2JKMA 2XB7A 4FG7A 3UODA 4CXAA 4D0XA 3CGFA 4DGLC 1Q61A 4EJ7A 1M2QA 2VO3A 2OJIA 2W1EA 3NYNA 4Q2AA 4XV1A 4JRVA 4PTCA 3JPVA 3S3IA 3AG9A 2XJ2A 2JFLA 4AOJA 4EH5A 5K0XA 5IEVA 3ZCLA 4FIEA 2WMVA 5B7VA 3TN8A 1WBWA 4FIGA 4K18A 4EOPA 3GU5A 2ZM4A 4U7ZA 4HCTA 1SMHA 2VWIA 2XIXA 3ZXTA 3EZVA 4CFXA 3RALA 3PIYA 5AMNA 2GSFA 2YIQA 3KRRA 5LJJA 4I0SA 3RWQA 5ETIA 2C5YA 1BX6A 5L2IA 2VUWA 3LFCA 3PA4A 4DGOA 3DKGA 2PVJA 2GQGA 3KXHA 1MRUA 2VTAA 3PP1A 3SG8A 4FZ6A 3SLSA 5BVNA 2ITXA 3N4TA 3B2TA 5C4KA 3T9IA 2IZTA 3BLRA 1H28A 2OKRA 3ZFXA 5JQ5A 3I6WA 4DFLA 1UA2A 2JBPA 1PXLA 2P33A 3RINA 3OWKA 4NTTA 3Q5IA 5CTPA 3SOAA 3SRVA 3BIZA 2A19B 4FMQA 2X2MA 2O65A 4TWOA 3WBLA 2WMRA 4IMYA 2UZTA 3IW6A 4FV2A 4QPAA 3WE4A 2VAGA 1FOTA 4H36A 4M69B 4YJSA 2C69A 4CLIA 4CNHA 2NPQA 4FKQA 5IG1A 1UU8A 2WQBA 3BLHA 4MXXA 4EQUA 3LZBA 3SV0A 3Q9XA 4AFJA 2XIZA 4IX3A 5A4QA 2J0MB 2O2UA 4C8BA 2C3JA 4NWMA 5KHXA 3ZEPA 3QGYA 4QYHA 5D11A 3C7QA 4QMVA 3VBQA 2XYUA 3M2WA 2WMSA 3T3VA 4DINA 4O82A 2QOIA 4BWXA 3MJ1A 3ROCA 2F7XE 4RSSA 4AW5A 2VU3A 4JI9A 2WMWA 5DMZA 3GFEA 1JSTA 2VTNA 4IXPA 3T3UA 3UYTA 2W1HA 2PVMA 1YWNA 5A4EA 2GNHA 3TUDA 4MK0A 3BE2A 4U43A 2YCRA 3KN5A 5HI2A 2IZRA 3ZSHA 4IZ5A 4K11A 4RMZA 4BCJA 4LRMA 1Q3DA 4MD9E 5FDXA 2CJMA 2ERKA 4AE9A 4S34A 3DLZA 1ZLTA 2YLFA 4JX3A 3B8QA 2QOHA 2EXCX 4O0YA 4XEYA 3DQXA 3R02A 3MGYA 3PA5A 4Z16A 3D4QA 2PHKA 4DBNA 3U51A 1CTPE 4FKPA 3PSBA 2EVAA 2VWWA 4FT3A 2ZMCA 4YC6A 4WIHA 4FVRA 4F6UA 4PL3A 2V7AA 3TG1A 3QA8A 4K9YA 4CZYB 4A4XA 5C4LA 1TQPA 4RC2A 5CAQA 4B6LA 4ZLZA 5JGBA 3Q9WA 3ZO2A 3QRUA 5LXMA 3FPQA 3QTWA 4XNEA 5J9YA 3EB0A 1ZAOA 1REJA 3BU6A 3CKWA 5HICA 1W82A 3U9CA 1XBCA 4EC8A 4G3CA 3VS0A 4O0VA 3ENMA 4EYJA 4QMXA 1URWA 1NVRA 4FNZA 3MFRA 4FKRA 3TKHA 3KL8A 4D4VA 3VUDA 2WAJA 2V0DA 2HK5A 3E8CA 3I1AA 4F08A 4JS8A 1JWHA 3NAYA 3RPSA 5HBHA 5BNJA 5JK3A 3F3WA 1J1CA 3GCPA 4WNMA 5KMNA 4M0YA 2EWAA 3PG1A 1W8CA 4XG3A 2H9VA 3VW6A 4CEGA 4E26A 2GHLA 4O7RA 3R8PA 5HVKA 4N6ZA 4E6AA 5CAOA 5AA8A 4PY1A 4L67A 1L8TA 3RP9A 3POOA 4RJ3A 3O8UA 4FVQA 4RZVA 2XK8A 4W4XA 3HL7A 2WMAA 3OZ6A 4ASXA 1JSVA 3TV4A 3ORPA 2J0LA 3OEZA 3DFCB 3R1YA 5DG5A 1FMKA 1SNUA 5E92A 3V5JA 3FI8A 4I3ZA 4XV9A 4XG7A 3FQHA 5J95A 3BHTA 2VX0A 1DS5A 3CQUA 4XP0A 2YEXA 1OIYA 3RM7A 4ASZA 3BHHA 4UMPA 3BBTB 4R3CA 2X4ZA 4CSVA 3JR1A 5AR5A 1MUOA 1NA7A 4KIPA 3COHA 5EI6A 2UW9A 1GZNA 3AGLA 3EQFA 3VS6A 3C4ZA 2QHMA 2CN8A 2WTWA 3RK9A 3UIBA 1ZYLA 5AUYA 3GOPA 3C4XA 3E88A 4BBMA 2G9XA 5AR4A 2XK9A 3ZFMA 2F2CB 1BI8A 3D7TB 4YJNA 2F7EE 3P08A 5IH6A 3QTXA 4NKSA 5CSXA 2GNIA 4YC3A 2XH5A 4CRLA 4D2PA 4Y83A 4F7LA 4BZOA 5C01A 4BBEA 2XEYA 4E5BA 1SVHA 2Y8OA 3EN9A 2C5VA 3ORLA 1FVVA 4EHZA 1CKIA 3EH9A 2BRMA 3SXRA 3UIUA 4U97A 3I0OA 4S32A 2JEDA 3DLSA 4UALA 4GEOA 4D55A 1YDTE 3OUKA 4TY1A 2BIYA 3L8VA 1ZXEA 3UPXA 1CMKE 2QURA 4GK3A 5FEEA 5I3OA 3ZLYA 5LMAA 4NM7A 1VYZA 3GBZA 4ACHA 4ZY5A 4IAYA 4JL9A 3UQCA 4CKRA 1QMZA 3UDBA 2XNNA 1SVGA 3F3VA 4TZRA 1RW8A 3ATSA 2QOKA 3IW7A 2QVSE 5IQCA 3VS1A 3BHVA 3W8LA 2ITTA 1BUHA 5G6VA 2C6EA 4NIFA 4Z7GA 1PXOA 3R8LA 3BYSA 1YXTA 4AN9A 3EQHA 5ANIA 4DFXE 4EKLA 3H0ZA 5A54A 1DI9A 2RIOA 2WO6A 3OT8A 1Y6BA 3VVHA 4BBFA 3MH0A 3O7LD 3AD6A 3NW5A 3KXGA 4TYHB 4WRGA 3WF6A 5LCJA 2Z8CA 2QKRA 3LQ8A 4UX9A 4F65A 4FGBA 4U3ZA 4YHTA 1PYXA 3GOKA 5L2SA 2JAMA 5TKDA 3N4VA 4OR5A 4TN6A 4O83A 2CKOA 4IAIA 5IEXA 5A6NA 1YXSA 1BLXA 2QOFA 4KS8A 4HJOA 4V04A 1W0XC 3OOMA 3CLYA 4UZDA 3F5XA 2UV2A 3PXQA 2C6MA 4J52A 4L42A 5EI2A 4F64A 3PVUA 3LXLA 2UZUE 4UBAA 1U4DA 4DEBA 4OTDA 3NPCA 4PDOA 4X2KA 5AP3A 4O7TA 1WZYA 4JQ7A 3MH2A 3AD5A 4I92A 4XBUA 1YHVA 5FBNC 5AUUA 5IQBA 3D5UA 4QYYA 4MD7E 5EQEA 4FSYA 4RC3A 5KBQA 5HHWA 3FBVA 3VW8A 3OCBA 3PSCA 4M14A 5EI8A 3TNHA 3QCXA 1GIJA 4YJRA 3A7FA 2BAKA 4BTFA 2VO6A 5IA0A 3RCDA 5HU9A 5M07A 1RE8A 5EYMA 3OBGA 5AUWA 4ASEA 2VZ6A 4RJ5A 5JGDA 1AQ1A 3QL8A 2B52A 2BRBA 2R3QA 4U8ZA 3QCSA 4XMOA 4DEAA 3OWLA 4IJ9A 4NL0A 3SRVB 3F6XA 4APCA 5ETFA 2EB3A 2BROA 4D1SA 2UUEA 3PFQA 4FICA 3UO5A 2JGZA 4RLLA 5E8WA 5CSPA 3LKMA 4EOMA 1OIQA 5HU3A 3FMMA 3HMNA 3KRXA 4DG0E 4OTPA 3NUAA 2X4FA 4HCUA 3EFLA 2E9PA 3SA0A 2UW7A 5IUIA 3H0YA 4C36A 2I0YA 4L3JA 4KRDA 2PVRA 4JQ8A 3BPRA 3CJGA 4LYNA 2XUUA 4D4SA 5M53A 5C8MA 4WBOA 1JNKA 1GZKA 3R73A 2NRYA 3V6SA 2R3NA 3Q3BA 2ZOQA 3FZSA 4KKEA 4MF1A 4ZS4A 2WQEA 4H3PA 5HCXA 4O2ZA 3CTJA 3MVHA 3PIZA 5AV3A 5AV4A 4X21A 3NDMA 3DKCA 4JBPA 3UVRA 4ZLOA 2QO7A 2OSCA 3BEAA 4TYGA 2X0GA 3IG7A 4FTAA 4AFEA 2OF2A 3NNXA 2C6LA 1JSUA 2KTYA 1XR1A 4QMTA 3R21A 5EOLA 5L6PA 2O3PA 3MPTA 4G3EA 3PJ2A 4JDJA 3II5A 5FGKA 3OHTA 5ANJA 3E8DA 5JFWA 2X7GA 3U87A 2XBAA 4A7CA 4G3GA 3LIJA 3OTVA 4M12A 3QQUA 3FZTA 2VWUA 1ZWSA 3FY2A 5EM5A 1P14A 1A9UA 4J98A 5M51A 3DBEA 1UU7A 4DTKA 4DH7A 4NU1A 4TTHB 4YTCA 3DZQA 3KN6A 4Y85A 5JH6A 2BMCA 4AN3A 2BIKB 2C6KA 2GS2A 3FEGA 2I0HA 4Y8DA 3V8SA 4RLKA 1S9JA 5LQFA 5BUEA 3TZ7A 2OH0E 3LCDA 2OJJA 4IJPA 4Z55A 4HZRA 1OL7A 3ZFYA 4QP1A 2NP8A 4RVLA 3G51A 3QQLA 4QP3A 3FLSA 4AU8A 4WNOA 3MB7A 4OAVB 2Z60A 3KB7A 4II5A 2LAVA 4QYGA 2ACXA 3EHAA 4RGJA 2HZIA 3AQVA 4AX8A 2FA2A 3VUIA 3OY1A 4A9RA 4EOKA 3ZUTA 4PDYA 4H3QA 4BHNA 1WVYA 1H27A 4QOXA 1OL1A 3F3ZA 4FL2A 3A7IA 3V01A 3D15A 4OTRA 3ORMA 4NW5A 3PA3A 3VS4A 4KIOA 2IW8A 5FG8A 4G34A 2Y0AA 2WEVA 2WGJA 3HMIA 3KF7A 2UVZA 4WSQA 4IM2A 2YM8A 4TRLA 5CI6A 4LUDA 3R9RA 4FNWA 2QNJA 4K8AA 3QD3A 2VTIA 4YP8A 5I3RA 4V05A 4ASDA 4BVUA 2YABA 3S00A 5F9EA 3LJ0A 2AYPA 3K2LA 2BRHA 1H1PA 2IVUA 4IAZA 4RBLA 3ZYAA 4ENYA 5ACBC 3KXZA 2XS0A 4J8NA 4KA3A 5K3YA 1UWJA 3DS6A 3DAEA 2IVTA 3UIXA 5M56A 1AGWA 1S9IA 2JIUA 4NSTA 3BHUA 2ZVAA 1OITA 4C37A 4RC4A 4AW0A 1KE7A 4ZZNA 5IQFA 2X7OA 2YIRA 2CGVA 5E1EA 3LOKA 5HNIX 2FVDA 2WMTA 4MVFA 5DNRA 5E90A 4DYMA 2I7QA 3OW4A 4XV2A 3IO7A 3KMMA 5ANKA 3ZONA 5IEYA 1W83A 4LOOA 5KE0A 3KA0A 1YDSE 3G6HA 4K33A 3DK7A 3WZUA 3UPZA 4YJVA 2WMQA 4X2NA 5HORA 3CR0A 2BZJA 2YM5A 3IDPA 4RIYA 5DR2A 4TW9A 4IQ6A 2QU5A 5BVEA 3BCEA 4YU2A 3U9NA 4D9UA 1M2PA 3GU7A 4DGGA 1KOAA 3AC1A 3TNIA 1H01A 4ZTLA 3PE1A 4RJ4A 2GDOA 3HV4A 3QKLA 3DBCA 4KS7A 4FT7A 5D1JA 2WMXA 3K54A 4WOVA 4FL1A 1OGUA 5HESA 3Q4ZA 2C0OA 4PP9A 5ANOA 4ZAUA 2Y4IB 3LAUA 3DXQA 2PZRA 2PWLA 2YM3A 5M44A 2X6DA 4GS6A 3S4QA 4AQCA 1SYKA 2XP2A 3GCQA 4U42A 4OTHA 4DLIA 4ENXA 3DPKA 4RWLA 5J7BA 2IG7A 4FC0A 4NIFB 3R7YA 2UZDA 2LGCA 2Z2WA 4FT9A 4D58A 4I1ZA 3A7GA 2OBJA 5LMKC 1JBPE 1UNHA 4R1VA 5AIKA 5DH3A 5GJDA 4DFUA 5B2KA 4C4FA 2VN9A 2R3OA 2YM4A 3C5IA 4GKIA 2HZ0A 5IKWA 2UW8A 3L9LA 2GPHA 1URCA 1IR3A 4LG4A 3CQWA 1PXJA 3O51A 3QXOA 4RWIA 3OWPA 3HKOA 3QALE 3IPHA 1U5QA 2WIHA 3QC4A 3JYAA 4YGAA 4AGDA 3GUBA 1WVWA 3DQWA 3ZDUA 5KMLA 4U5JA 3QKMA 3F5GA 3ANQA 4DA5A 3UGCA 3CEKA 4YJOA 4I5HA 5F1ZA 1UNGA 4I22A 4DGNA 3AXWA 4FIFA 2VNYA 4NJDA 3TI1A 1E9HA 4OBQA 4C2VA 3MY5A 3QTIA 1ATPE 2OWBA 2PVNA 4YZBA 5KMKA 5CU2A 4B0GA 2ITPA 2CN5A 3QGWA 4MBJA 3LM0A 2HW6A 4TWNA 4OUCA 3Q2MA 4R5YA 5KBRA 4F9AA 2B0QA 3R83A 4MF0A 5DA3A 5BMMA 2HAKA 2ZM3A 3UC4A 3MESA 4YTFA 3LQ3A 4F09A 3FPMA 4DE4A 3EQBA 1H1RA 3N9XA 2CDZA 5HG5A 2PVYA 2XIKA 5JEBA 4AOIA 5C8KA 4IDVA 3V04A 4WG4A 1Q24A 2H96A 4DG2E 2XNMA 3TNPC 3NIEA 2V5QA 3JUHA 4UYAA 4NCTC 3BX5A 4AW2A 4C4HA 4ERWA 3PYYA 1P5EA 4FNYA 4I5PA 4AGCA 3SXSA 1H24A 4FZFB 2QD9A 1WMKA 3FSFA 3FMEA 1SM2A 4BY9E 4IH8A 4QMNA 4LMNA 3HRFA 2PUIA 2OFVA 2J7TA 4G16A 3LLTA 4IBMA 2XEZA 4FYOA 5I9UA 1GJOA 2J51A 4EWHA 3U8WA 3LM5A 4G6OA 5AX9A 2R0UA 2GNGA 5HEZA 5EW8A 4KKHA 3EFKA 5A14A 1Y8YA 4FKJA 5HNGA 5C9CA 2XIRA 3QZHA 3I5ZA 4OBPA 3CGOA 3PXZA 3R1SA 3W10A 3LFSA 4RA5A 1G3NA 3ERKA 3OWJA 4MHAA 2Y6MA 2VD5A 3N4UA 2BAJA 4GT3A 3R00A 5HVYA 3TJCA 4UWBA 4BIBA 3UOJA 1PMVA 5GIPE 4DFNA 3AGMA 3MH1A 1FINA 4I4FA 1XBBA 3FMKA 4YLLA 3A60A 5EQPA 4F1MA 4C4IA 3MN3A 5AP7A 1YI4A 4HVIA 3EN4A 2EXEA 3FL5A 3VS3A 3CY3A 5DYJA 2OW3A 2ZDTA 1H1SA 3FXXA 1M2RA 4AAAA 5HLPA 2ETKA 4YZ9A 3KXNA 4ACCA 3HV5A 4IZYA 3G33A 2GTNA 3Q6UA 4O21A 3TEIA 3FMLA 4FV8A 3G9NA 4QQJA 4YBJA 4AZSA 5LVLA 1R39A 4PNKA 4YC8A 3TTIA 4NUSA 4F1OA 4E5WA 4R8QA 2ITZA 3DJ5A 3MVMA 5M55A 4JNWA 3CIKA 3O2MA 1XO2B 3RNYA 2UZVA 2GCDA 2W96B 3FYKX 3VRZA 4CYJA 1XJDA 3LCSA 4CZUA 4GYGA 3M42A 4WNKA 4EHGA 3ORNA 4QP6A 5CVFA 4IC7A 4I6HA 4NFNA 2IPXA 1UWHA 4IADA 4JDKA 2PZYA 4PPBA 5IDNA 3RJCA 3D7ZA 4O1PA 1T46A 5IF1A 5M06A 3BV2A 3RCJA 3CSVA 1Y57A 1IASA 3FY0A 3QFVA 3C0IA 5CQUA 2X2KA 3QTSA 3CC6A 4FE2A 4FTTA 4J96A 2H8HA 3UVQA 3UZTA 5L6WL 3RM6A 5AM7A 2OXXA 2PU8A 2ZB0A 3DFAA 3PVBA 3EQRA 3ZC6A 3RGFA 4EZ7A 3BU3A 3W8QA 1Y6AA 4FTKA 4IFCA 1GZOA 4UXLA 4A4LA 4OLIA 4E7WA 3IKAA 3SXFA 2FSTX 4QTAA 3LFBA 4O38A 3KF4A 1ND4A 4EK8A 2RFEA 3ANRA 1OIUA 4BL1A 3BLQA 4CFFA 4R3PA 2CGUA 5G1XA 5LWNA 3GEQA 2W1CA 2C0TA 2ZV7A 2BCJA 4FT5A 4X3FA 3UQGA 1R0EA 4L45A 2QKWB 3PVWA 4M66A 4BHZA 3IGOA 3QQGA 4DH1A 4ZTRA 5I5ZA 3BU5A 1H25A 2XJ1A 2OZAA 2W5HA 5AFVA 1JKLA 2CCHA 3E3PA 4FZDB 4LUEA 2HXLA 3WF9A 3FE3A 4RIYB 1R78A 1Q5KA 5CENA 2PUNA 4TPTA 1JKSA 2C3IB 4GK4A 4Y5HA 4Q9ZA 4R3RA 4HCVA 4YLKA 2BKZA 3PZHA 5A6OA 5FWKK 3MDYA 3D5WA 4C38A 3UE4A 4BIDA 2A1AB 4JQEA 5F4NA 4TWPA 4XG9A 5IA3A 1M52A 4IVCA 5CSHA 3ZC5A 4DEEA 4F6WA 3E3BX 3S1HA 4AT3A 2FSMX 3GVUA 4ZSAA 1OB3A 5ICPA 4QMPA 3LQ5A 5CI7A 4EUUA 3IOPA 4E6QA 2XA4A 5KKRB 2WTDA 1G8SA 5L8JA 3GCSA 2ONLC 4DN5A 5K5XA 4BZDA 3AT2A 5L2QA 3H30A 4O6LA 4QP4A 1FGKA 3EL7A 5JZNA 4FIJA 3F2RA 3UNKA 1OPKA 3NCZA 3JXWA 2XJ0A 2CNQA 3HEGA 1GNGA 2R3RA 1OKZA 4MYGA 2GU8A 3MSSA 3Q4CA 4K0YA 4YJUA 4KB8A 4EJNA 3GU4A 4HYSA 2OG8A 3KVWA 4DH5A 1H0WA 3M11A 5I0BA 5FUTA 4RJ7A 2B7AA 4RWKA 5TO8A 4TYIA 4YJTA 2F57A 4FG9A 1YOLA 2YAAA 2QHNA 3DOGA 5FEDA 4PF4A 3DXPA 4I24A 5ANDA 5CU0A 2PMIA 2JFMA 4AF3A 3N51A 4YJQA 4LMUA 2BFXA 2AC5A 3PWDA 3Q52A 3TM0A 2HW7A 5HE1A 3ORTA 3BWJA 2BILB 4ZS0A 4XX9A 4O7YA 2CKEA 2RFNA 4O86A 5LVNA 4CYIA 5IA4A 3W2RA 1NVSA 3MFSA 4RZWA 3LXPA 3CKXA 5AWMA 1A48A 1T45A 4OAUC 3F2AA 2W05A 2X8IA 3E64A 3L9MA 4ITJA 3AMYA 4M97A 2YHVA 3R2YA 3FZRA 3F9NA 4PNIA 4L7FA 4I0TA 5AM6A 5GHVA 2CNUA 4O22A 4DFYA 5A4LA 2PZIA 4XOZA 4L52A 4LV8A 5TE0A 4L68A 3JS2A 4RWJA 3QZIA 3KCFA 3CCNA 4AZFA 5KUPA 3WOWA 1CKJA 3QYWA 3ZM4A 2DUVA 4R77A 2R7BA 2VWXA 3D83A 3O0GA 4G1WA 4GIHA 4BTMA 4EC9A 4J53A 2HELA 5IA5A 4FIHA 5LMBA 2XNPA 4WG3A 3P79A 3NEWA 4FNXA 5K9IA 4MXZA 4BRXA 3FMHA 4A9UA 4OTFA 4ARKA 2BZKB 2C3KA 2W1ZA 5DRDA 4QMOA 4C58A 4EOSA 4GT4A 3CPCA 5AR2A 2ITWA 5D9HA 4HGTA 5AV0A 3T9TA 4ANQA 2F49A 1YRPA 3FMDA 3UOLA 4A06A 1DAYA 3P4KA 4QO9A 2JC6A 4CMUA 5AUVA 3JVSA 1PMNA 3R01A 3NUYA 4ZY6A 3TDVA 4C0TA 2A27A 3B2WA 3EKKA 3LFDA 3I81A 4GKHA 3BYOA 2VO7A 4BKZA 3ZBFA 4ZTNA 5JT2A 3JY9A 4CMOA 4KUJA 2QG5A 5AP6A 2HWPA 3F3TA 4D2WA 4GYIA 5AP1A 2FSLX 1GIHA 1PXPA 5HGIA 3LXNA 3H9RA 4FTQA 5AV1A 2I40A 4P4CA 5HZNA 3MYGA 2A0CX 2F2UA 1NVQA 2Q0NA 3UQFA 2JKOA 3HA6A 1WBNA 1PF8A 4EYMA 1MP8A 2EU9A 4BC6A 2QODA 3MTFA 2XM8A 3D2KA 4TYEA 4D28A 3R8MA 3VNTA 5C26A 1RDQE 3W2OA 3R8UA 2W4OA 2JDSA 5E9EA 4F7NA 4E4XA 5FM3A 2BTRA 3R7EA 4FI1A 3OY3A 4IX6A 2PY3A 4J99A 3PG3A 3O96A 4PX6A 3DAJA 3KXMA 5FXSA 1MRVA 4EOLA 3RHKA 3PWYA 5FTOA 1NT2A 4YZNA 5E91A 5KZIA 1AD5A 4EL9A 3SHEA 2VTQA 4D5KA 1JOWB 4XG4A 3EQCA 4AP7A 3PRFA 4AWIA 3F61A 5DR6A 5H8BA 1STCE 4KINA 4IB5A 3PXFA 4G6NA 1JQHA 2WIPA 3DTCA 4FTRA 3LXKA 5I9WA 3C9WA 4QYFA 1PXMA 2R3MA 2V55A 4DEDA 3IOKA 1TQIA 2VO0A 3TJDA 4RVTA 3FKOA 3OC1A 2R3FA 1W7HA 4F9BA 2WELA 4C3PA 3VS5A 2I0VA 4ZEGA 3LE6A 4V0GB 3L9NA 3AC5A 2QG7A 2V22A 4GCJA 4RFZA 1OECA 4J95A 4WHZA 3VJNA 4JAJA 5CVGA 5HX8A 1OZ1A 3PJ1A 4RT7A 4FIIA 5AUTA 3HVCA 3BE9A 4U6RA 5B2LA 4PP7A 2BTSA 4DF3A 3BGZA 2GNJA 2BR1A 3ZUUA 2UZEA 3G6GA 2YJSA 4AG8A 2CGXA 1SNXA 3NWWA 4I93A 2C0IA 4NKAA 3VBYA 2W5AA 3QWJA 2PVKA 3FJQE 3PJ3A 1Q8WA 3OP5A 4KBKA 4QP7A 4GU6A 3FI2A 3DU8A 4YTIA 3SKCA 1WBVA 4DEHA 5J5TA 4U81A 4X3FB 2P55A 4WA9A 3SC1A 4BI2A 3UOHA 3HAVA 2BDJA 2HCKA 4EQMA 2W0JA 3LVPA 4JOAA 4BDGA 1ZY4A 1TKIA 2OZAB 2X8DA 4XH6A 5FTQA 3P0MA 2B55A 2PSQA 4XCUA 5GJFA 2IVSA 5TF9A 4L3LA 5L8KA 5I9YA 2F7ZE 3RPOA 3QQJA 1OUKA 4F9WA 4ALUA 4AZEA 5CEIA 4ZOGA 1GY3A 2B9HA 3IECA 3NCGA 4NK9A 4JT3A 4BDIA 5A4TA 5BMSA 5C8NA 4B8LA 4O7NA 2ITNA 5D12A 5JZJA 1OVEA 3ALOA 3QYZA 2UZLA 4O81A 2C6DA 4FKWA 3TZ9A 3FQSA 4E6DA 5JMSA 3FWQA 4CFVA 5B0XA 4ZLYA 2VRXA 4RVKA 3CJFA 5CANA 1R0PA 3HRCA 2OXYA 3TXOA 4NCTA 5AR3A 3FUPA 2W1DA 5HOAA 2YCQA 2PPQA 2QU6A 4FBXA 3DGKA 5EQYA 1B38A 3ALNA 3QX4A 4HVSA 2Y6OA 3GB2A 2Q83A 2WMBA 2G2HA 4ZY4A 5JFVA 3QRKA 2CCIA 5IQDA 4F6SA 4YNEA 3HLLA 4E73A 4UB7A 2G1TA 2HIWA 3HZTA 3R9HA 4J8MA 5JFSA 3PXRA 4UYNA 4WT6A 5HTIA 4PWNA 3UG1A 5IMEA 5CVHA 3OCTA 3S95A 3SD0A 3ZU7A 3LW0A 3LCOA 4JG6A 3ZRKA 5GZ9A 3BELA 4MKCA 2H34A 2WZJA 4DH8A 3SGCA 1K9AA 2R5TA 5C03A 3AMBA 5I9VA 5KZ0A 3FSKA 4LGDA 3SOCA 2FB8A 2CHLA 4QMMA 4ZK5A 4BI1A 1PJKA 2WHBA 2XK4A 2YIXA 2YFXA 2XF0A 2F4JA 2W4KA 5H2UA 4IFGA 3EKNA 3GCVA 5E8UA 4D2TA 3V5QA 5K4IA 2JKQA 4M84A 3RPYA 3V8WA 1JKKA 4G5PA 2GNLA 3TT0A 2R3LA 5DT4A 2UZBA 3HGKA 4GIIA 3TZ8A 4D4YA 1IG1A 2B54A 4U41A 3OXIA 3VO3A 4D5HA 4F7JA 1K2PA 5HCZA 1WBOA 2GHMA 2CMWA 3ORXA 4Y46A 5AAEA 4AGUA 1YQJA 3NZ0A 3DJ7A 3NVMB 4BCHA 4HNFA 2RFDA 2VWYA 4DC2A 3VF9A 4XG8A 5GJGA 4G17A 2QONA 3ZBXA 4K77A 5DPVA 3VUMA 3V51A 2O63A 3F69A 2WB8A 4PMSA 4YLJA 4E4LA 4QTBA 2QC6A 4FF8A 4X0MA 4I6QA 4A9YA 1QPCA 4ALWA 4C57A 4CCUA 1UNLA 1YWVA 2GTMA 4OT6A 4DTBA 4N57A 4ID7A 3COKA 5CT7A 3KY2A 4HVHA 4O7ZA 3ULIA 2C5XA 4ANBA 1LUFA 4FTJA 5EDRA 2BALA 4F99A 4YSMA 1E1XA 2BAQA 3HAMA 3MPMA 5AUZA 5BPYA 4Z3VA 3P7BA 1Q3WA 2DQ7X 3AMAA 5FRIA 5IUGA 3LMIA 1O6LA 2VTPA 3EMGA 4O0SA 4HZSA 4WSYA 3FMNA 4G3FA 5I4NA 3NNWA 2XVDA 3G0FA 3VRYA 4FK3A 4LRKA 5CAUA 4S30A 1J7LA 5CASA 2EXMA 2YM7A 1PY5A 2E9UA 4EORA 2R64A 1ZOGA 5DT0A 1Z5MA 4PDPA 5JN2A 1Q4LA 3C4FA 3IQ7A 4KABA 2NRUA 1TVOA 4IB0A 3GU6A 3IONA 4NM3A 2CKPA 4XG2A 5J87A 3KKVA 4M0ZA 5AEPA 4QPSA 2ITOA 3PUPA 5J1WA 1I09A 1YWRA 5K0KA 4JBVA 2WPAA 3I5NA 3FLNC 4GG5A 1W98A 4RFMA 3PSDA 5AAFA 3CS9A 2O5KA 4DAWA 4MBLA 3PLAE 4WO5A 5ETCA 4I4EA 5CAVA 4XP3A 3ZRMA 5M09A 2OJFE 4D4RA 2Z7SA 3ORKA 4IVBA 3P1AA 2XNBA 4U9AA 5AJQA 2ETMA 3PY0A 3R7IA 3MPAA 4JG7A 4TYJA 4PL4A 4DH3A 4NM0A 3U55A 4L01A 3MW1A 4OTQA 1FBNA 3ZHPC 2I6LA 1O9UA 4R1YA 2QO2A 2C4GA 1RJBA 3DBDA 3F5PA 3U4UA 5E1SA 3UTOA 3E92A 4HGSA 4MH7A 2OXDA 2Z7QA 2GMXA 4XRJA 3P86A 4M3QA 5HE3A 3QX2A 2ZV9A 2P0CA 4KIQA 1Y91A 3U6IA 4FEUA 3BYMA 4G9RA 5IA2A 4GJ3A 1CKPA 4U79A 1H4LA 2GNFA 4KWPA 3SG9A 3VC4A 3EL8A 3RPVA 4FTOA 4JBOA 5DE2A 4I5MA 3R7OA 4QTEA 3FI3A 4EKKA 2QOQA 1X8BA 3AC8A 2UW0A 3ZO1A 2XIYA 3Q04A 4YHJA 1XQZA 4E6CA 2YIWA 5E7RA 2YCSA 4GJ2A 3R7UA 4O0WA 5HVJA 4J71A 4P5QA 4FGRA 4CT2A 4U44A 3V5LA 3Q5ZA 3HMMA 3NLBA 2XMYA 4LQMA 3VBWA 2WD1A 3ZSIA 3QU0A 4HYIA 2R7IA 3MVLA 2FYSA 2O0UA 3M1SA 4YZMA 2Y7JA 2PULA 2XYNA 3E8NA 3VUTA 1A06A 3O7LB 3Q53A 4QTDA 4JR3A 3WZKA 3FQEA 3ZLWA 1XH9A 2E2BA 4JLCA 2C30A 4UMUA 2C3LA 2VGPA 4FV4A 4RX5A 4IAAA 4CKIA 2QI8A 4L44A 3TIZA 2Z7LA 1YI6A 5LVMA 3NSZA 5DWRA 4ACDA 4XV3A 2W9FB 4FV0A 1YHWA 4YPSA 4FKTA 2QLQA 2YDIA 3QTRA 2P2HA 5HG9A 3WF8A 4DEIA 4O1OA 4BGHA 4FL3A 1UKIA 5DBXA 1IRKA 4ANMA 4FK6A 4AACA 4IWDA 2J50A 4M8TA 2NNWB 3H9FA 1KE9A 2O64A 2RKUA 5I9XA 4FSRA 4O2PA 4YHFA 4BGGA 1PMUA 1DI8A 5EM7A 2C5OA 3R71A 2YERA 3DY7A 3R7VA 3BQRA 3GC7A 3K3IA 3Q4TA 2IJMA 1OIRA 3RAKA 2DWBA 5HLNA 3GFWA 4IVAA 3MIYA 4X3JA 3ROYA 2Z02A 4WUAA 5GIOE 4EH2A 5KMJA 2I1MA 1ZY5A 3QRIA 3Q9ZA 4C3RA 2XKEA 4FEWA 4NZWB 4MWIA 3GC9A 4BCQA 4FT0A 3BI6A 5TR6A 5BUIA 3KGAA 3HMPA 4JJRA 3MWUA 2DYLA 4JRNA 4XRLA 1GAGA 1H1QA 5C1QB 1OBGA 4QQTA 4IAKA 5KO1A 2Y4IC 3HECA 5HIEA 5DEWA 3I4BA 2OGVA 2JAVA 3E7OA 4FKVA 2V7OA 4XBRA 4RG0A 4K2RA 3FZ1A 2XNGA 3FLZA 3FAAA 1PMEA 3BHYA 2XNEA 1Q97A 1LEZA 2R4BA 2WQMA 2WQOA 4OT5A 2J0KA 3ODYX 3UVPA 4EHEA 5BYLA 2YZLA 4BWPA 3RZFA 3PLSA 3UZRA 4PTGA 2WTJA 2CLQA 3IW5A 4IWQA 2IZSA 5F95A 4G9CA 3GENA 3FLWA 3BGQA 3C50A 1M7QA 3OMVA 4YPDA 4EH9A 1JKTA 3QRTA 3W2SA 4MCVA 3RNIA 3BV3A 5A4CA 1OBDA 1Q8ZA 3Q6WA 5IQHA 1XH8A 5JQ8A 3R1NA 2ZDUA 5LARA 1NY3A 3OW3A 3TNQB 4E3CA 5JGAA 2GQSA 3KRLA 1YXVA 3VJOA 1OKYA 3H3CA 2QOLA 5I9ZA 3D5VA 4EH7A 3NYXA 3L9PA 3LHJA 2R2PA 3NX8A 5IQEA 1OPLA 5D41A 5ITAA 4CQEA 2HXQA 5E8VA 4DLJA 4XYFA 4AUAA 2RF9A 2IW6A 4JIKA 2ERZE 4EOIA 4CV9A 5JRQA 1KE5A 2BUJA 4ZTHA 3UBDA 3P7CA 3W2QA 3OUNB 4EBVA 3R9DA 3VQUA 4ZMEA 2ITVA 3TV7A 4U45A 3A7HA 4FZ7A 3AC3A 1OKWA 4H58A 2ZYBA 4QQCA 1ZRZA 4O84A 2YAKA 3L8SA 4MD8E 4NFMA 1I44A 4JX7A 5F20A 4CT1A 2OIBA 3GXLA 4Y72A 4HNIA 4P90A 5CF4A 3PDTA 3WZDA 4KD1A 4NJ3A 3NUUA 2AC3A 2OK1A 4TWCA 5CX9A 4L9IA 1YDRE 2FH9A 4KBAA 2JDVA 1VZOA 4U3YA 3EJ1A 4ZTQA 4UMQA 3UO4A 4PMPA 4IIRA 3A8WA 4AZTA 1CSNA 3MY1A 4BTJA 1Q8TA 3CD8A 5IMXA 4S33A 2PE1A 2WFYA 2B9FA 3AT4A 4IZ7A 3EN6A 1WCCA 4C35A 4TL0A 4M68A 3ZTXA 4C7TA 4AOTA 1OI9A 2E9OA 2XK6A 5EOBA 5LWMA 1GIIA 3OD6X 4CMTA 5M4IA 4YR8A 2ZV8A 2BKKA 4QPMA 1OL5A 3QA0A 3ENHA 4BIEA 4BCKA 2PL0A 2RGPA 2PMLX 1JVPP 4JVGA 4Y95A 3MV5A 1JPAA 3W16A 3BRBA 2UW3A 1LR4A 4BKJA 3DBQA 3QZGA 4J97A 5M4FA 5L6OA 2AUHA 5HKMA 4G2FA 4V0GA 3LJ2A 2A2AA 3DZOA 3AC4A 4HPUE 5FP5A 3IW4A 2XNOA 3SW4A 2BHHA 3RK5A 4YZDA 4OW8A 2X81A 4AZWA 5DVRA 2WTKB 5DR9A 3SX9A 1YVJA 4BTKA 5EKOA 3A8XA 3R1QA 5HLWA 3F2NA 1OL2A 3C4WA 2R9SA 2UW6A 1XWSA 1GOLA 1G8AA 3NYVA 3FHRA 2VX3A 3I0QA 1KV1A 2FO0A 2B4SB 3QZFA 4J7BA 3NUXA 2V62A 2R3KA 3FLYA 3QTUA 2SRCA 3E93A 3KULA 4PQNA 3OXZA 5M08A 5IPJA 2OIDA 3NYOA 4KIKA 2RL5A 4O0XA 4XJ0A 5E8ZA 4F9YA 1WBPA 3R0TA 4YBKA 5IH5A 4WRSA 5GZAA 4MXYA 2VV9A 5HO7A 1OPJA 2VTRA 3CQEA 5AR7A 4EK4A 4PPAA 4LL0A 4CLJA 5LOHA 3A7JA 5H3QA 4AA4A 4C02A 5EKNA 5HTCA 3RVGA 3DB8A 4FV7A 5EHLA 4PMMA 4ZJVA 4OBOA 2WOTA 4A07A 2G15A 3V5WA 4BWKA 3EQIA 4FTMA 4IW0A 1QPDA 3WIKA 3Q2JA 3VHKA 4FTCA 3WE8A 3LFNA 5JFXA 4HOKA 3OS3A 4TKSA 3WIGA 3ACKA 4AE6A 5HIDA 1REKA 2VTHA 3MH3A 4Q5HA 1QPEA 4GV1A 3ZS5A 4EH3A 1XH4A 2PTKA 3V8TA 2C5NA 1UKHA 3DDQA 3WYYA 3U6HA 2X9EA 4PTEA 3R30A 3E5AA 3H4JA 4BDFA 3KXXA 5EM6A 3DT1A 4GFOA 4MQ2A 4QMYA 4NH1A 4GVAA 2IZUA 1M7NA 1PXNA 3FZOA 1KSWA 5CNOA 3VBTA 4TT7A 5L8LA 3W1FA 1B6CB 3QD0A 4BCNA 4YZCA 3COMA 5CU4A 4G5JA 4ANOA 3F66A 3WARA 4UMTA 1J3HA 5IDPA 2BRGA 1B39A 1O6YA 2PUUA 2YACA 4JAIA 4GFGA 4XG6A 4W4YA 3F5UA 2OIQA 4KAOA 4UEUA 4XLIA 4EH6A 2O8YA 1PW2A 2B1PA 4JG8A 1W84A 3TACA 4EZ5A 4O96A 2E9NA 4JDIA 4L3PA 3MFTA 4L46A 3V5TA 3PTGA 2Q0BA 1FMOE 2YITA 4FTNA 4YNOA 5FP6A 5BYZA 4E5AX 2XK7A 4BCOA 3ETAA 3E8EA 4AA5A 2GFCA 4F9CA 4V01A 3QUEA 2XRUA 3K5VA 3NNUA 5HO6A 5J7HA 2QQ7A 3CP9A 3DTWA 4QQ5A 3EN5A 3KK8A 2W1GA 5L3AA 2JKKA 2VWVA 3POZA 3C51A 3FKNA 3VUGA 3ZLXA 4BYIA 2BHEA 3CD3A 3FXZA 5E8YA 2PZ5A 3JY0A 3QC9A 1P4FA 4GH2A 5LVOA 3H10A 2JDOA 4B7TA 1BMKA 4RIWA 5KKRC 2FUMA 3GP0A 3NUPA 4Z9LA 3VUKA 4B9DA 5GZ8A 1H8FA 5B2MA 3R22A 4RVMA 5M57A 3ZM9A 4YMJA 1Q62A 1OL6A 1PYEA 2KULA 4R78A 5FLFA 1CDKA 5AP0A 1WFCA 4LL5A 3GC8A 3MJ2A 2ZV2A 2J5FA 3HMOA 4CD0A 4ACMA 4O7SA 3QUDA 1U54A 4DCAA 3EQDA 4F0GA 3KRWA 4ZJIA 4UN0C 3UP7A 2WTIA 2IVVA 3DK3A 2X8EA 3HUBA 2W99B 1H07A 4P2KA 3OCSA 3SQQA 3FC1X 3H9OA 4RX7A 3VS2A 2ZJWA 3L8XA 4FKUA 4I41A 4KKGA 4X2GA 1VJYA 5FDPA 3ZZWA 2VTLA 3WI6A 2UVXA 3UMXA 3KVXA 3DJ6A 3RHXA 5FEQA 4L53A 1Z57A 4AW1A 3DCVA 4IX5A 1M14A 3PZEA 3PY1A 4A9TA 1BI7A 3QQHA 3KU2A 3RKBA 5BVKA 3R9NA 3RWPA 4ZTMA 5E8XA 4IHPA 4H05A 5FQDC 2BZHB 2NO3A 3ZH8A 1PKGA 1J91A 4FSZA 5AIRA 5DI1A 4F7SA 3HV3A 3VF8A 4R7IA 4IE9A 5EYDA 1L3RE 2HY0A 3JVRA 1WVXA 2WU7A 2GS6A 1V0BA 3CTHA 5BVWA 3AT3A 3C0GA 2BDFA 3TWJA 4DGMA 4U40A 3VBVA 3G15A 3O8TA 4YJPA 2PMOX 3Q9YA 4ORKA 1G5SA 2OF4A 1LEWA 4I94A 5HTBA 4EHVA 3NW7A 1WBSA 2X2LA 3HA8A 1BL6A 5BUJA
chains in the Genus database with same CATH superfamily
4GRBA 5KMIA 4FV5A 4Z7HA 4KSQA 4EWQA 3U54A 3DKOA 5E8SA 3BEGA 3E87A 4IB1A 4FG8A 5HIBA 3W0OA 4MEDA 4BDHA 4O4CA 4ZJJA 4W4WA 3HDNA 1DAWA 2WU6A 4H39A 4FA2A 4XUFA 4DITA 4JDHA 3UDZA 2W06A 4MTAA 3UNZA 1ZARA 5EYCA 3TMOA 3R7GA 1M17A 4FOCA 4FODA 3MTLA 4R7HA 4WNPA 4BKYA 1IA9A 2R3PA 4EI4A 4E4NA 2WMUA 3HDMA 3KCKA 1KV2A 4RIXA 3WF7A 4W9XA 4ZZMA 4B99A 1OMWA 2J2IB 3FLQA 1BYGA 3U4WA 3F7ZA 2W1IA 5A3XA 1TQMA 4L43A 2YISA 4I21A 2VWBA 5EHOA 3LPBA 2QOOA 1H0VA 4UXQA 5ACKA 5EM8A 5IA1A 4G6LA 2BVAA 2QOBA 2WTCA 2B53A 3D5XA 5HBEA 2PUPA 4FV9A 4I20A 4YTHA 3QBNA 3L1SA 4NEUA 5AP2A 4LGHA 2C47A 5IU2A 4M7IA 5HE0A 1APME 4HGLA 3AD4A 4WD5A 5LMKA 3PJ8A 4E8AA 4EUTA 1LP4A 1QCFA 3BBWA 3PJCA 4CTCA 4A4OA 4QMSA 1YI3A 3LJ1A 3A4PA 4O0RA 3ACJA 5EYKA 4D0WA 3FYJX 2J6MA 3KULB 4O91A 3EFJA 4ANLA 1ZMWA 4KIKB 4O6EA 3VWAA 4BCFA 3FZPA 3TCPA 2WTVA 4J1RA 4DCEA 5BVDA 1KE6A 4O7VA 3CE3A 5T3QA 4C4JA 2YWPA 4IEBA 5CEQA 3UJGA 2C1AA 2BFYA 4MAOA 4QTCA 3UZPA 2YCFA 2QR7A 3OFMA 1ERKA 4FV3A 3SAYA 3QLGA 1XHAA 2VTMA 3NNVA 4N6YA 2J5EA 4BF2A 4C4GA 4DHZA 4L00A 5BYYA 4D2VA 1VYWA 1UVRA 5CSWA 5HCYA 4O0TA 2H6DA 2EB2A 4FV1A 5ANEA 3W2CA 1SZMA 3OXTA 5EW3A 2CKQA 5K4JA 1KUTA 3OEFX 5T6KA 2QCSA 2R3GA 4I6FA 4MNFA 5CQWA 5DFPA 5HG8A 5DT3A 5CEMA 3PRIA 4NYEA 4BR3A 4BDKA 4ZTSA 5KMMA 1P4OA 1EH4A 2CLXA 3FKLA 2P3GX 4HYUA 2GFSA 2ZMDA 1ZZ2A 3R63A 2UW5A 4QNYA 4KSPA 5LCKA 2XCKA 4F1TA 1QPJA 3IDCA 3ZDIA 1ZYDA 3REPA 1H08A 3ZRLA 1WBTA 1YXXA 4X6RA 3HV7A 3PXYA 4EOJA 4O7LA 2VWZA 3PXKA 4QP2A 2ITUA 4TNBA 4RX9A 4D9TA 3G5DA 3WZJA 4GUBA 4XHKB 3DDPA 1GZ8A 2P4IA 5D10A 5J5SA 5EW9A 4D2SA 4PV0A 5KX8A 4KRCA 3BL7A 4O4FA 2WEIA 4EQCA 2PVHA 3O71A 4H1MA 4G31A 2YIYA 3CTQA 5AR8A 3PVGA 4QYEA 2W5BA 4X3FC 3E62A 3DNEA 1ZYJA 1J7IA 4LFIA 4AT4A 2RSVA 3MFUA 1PXKA 3G9LX 4EBWA 2IW9A 4HPTE 1MQBA 1PHKA 3RK7A 3CPBA 3VIDA 3NMUF 2G01A 3LFEA 4MX9A 4U80A 3MVJA 3B8RA 4BDBA 2CSNA 4FTUA 4GFMA 2RG5A 4B4LA 4C4EA 1ZYCA 4IZAA 3EOCA 4GT5A 5J9LA 4ZSLA 3HX4A 2J9MA 5KCVA 5CEOA 2WKMA 2YDKA 3A62A 4EH4A 3PY3A 1UV5A 3QAME 2J90A 3RI1A 4MBIA 1U5RA 4LV5A 5M4CA 5FTGA 3EZRA 5AX3A 3HV6A 4CVAA 5J79A 4FSNA 4AZVA 4F0FA 4GW8A 2Z7RA 4CFMA 4OTWA 3HP5A 4QP8A 4RIWB 5CSVA 5KNJA 1IAJA 5CF5A 4R6VA 4IB3A 5HNBA 4C2WA 3IW8A 1FVTA 2YN8A 3BQCA 3P23A 3G0EA 3S2PA 4EH8A 3F82A 3EWHA 3PPJA 2IEWA 3I79A 2YZAA 5CU6A 5J8IA 2C6TA 4FKGA 1OKVA 4RX8A 5CLPA 4CQGA 4FEXA 3OF0A 4M67A 5EK7A 4FR4A 1U54B 5EH0A 5EDQA 5BX0A 2R3HA 4QD6A 4F4PA 3CXWA 2XKCA 1LPUA 4BZNA 2C68A 3C1XA 4FKOA 2OH4A 3V3VA 4IX4A 3W55A 1OM1A 4WG5A 3RTPA 3THBA 4USFA 4YO6A 4E93A 3UYSA 2OU7A 2UZNA 4S2ZA 3WZEA 5T68A 1UU3A 3EN7A 3G2FA 4BB4A 5CF6A 4FKIA 4APPA 3NUSA 1YKRA 2YDJA 5CALA 1Q41A 5KMOA 4AQKA 4FTIA 2UVYA 1U59A 1YOMA 4JR7A 4E4MA 1HCKA 5HE2A 2FSOX 4OGRA 1XBAA 3P9JA 4P5ZA 4CCBA 4EONA 4DT9A 4EK3A 2CGWA 2FGIA 3R8ZA 3C4CA 2I0EA 4CGAA 2RFSA 2RG6A 4B8MA 3QHWA 3EIDA 5DOSA 3RAHA 4FSUA 3DK6A 4LRJA 2X1NA 4NM5A 3GCUA 4ITHA 3HRBA 3FV8A 4ZSEA 4BCPA 1TFFA 3DNDA 4ZMFA 5JKGA 3NIZA 4DEGA 1Y8GA 4IDTA 4IM0A 3A61A 1NW1A 4UWYA 2X6EA 3VS7A 4AT5A 5IISA 3Q4UA 4FUXA 4IVDA 1ZZLA 4DG3E 3QLFA 5AV2A 3FDNA 2B9IA 3COIA 1OUYA 2C1BA 3Q32A 4WUNA 5H8GA 5TT7A 4EOOA 2CPKE 5CAPA 3SVVA 4O7WA 4HW7A 3TL8A 2BPMA 4E1ZA 2P2IA 1FPUA 5F94A 3NVKI 4CG9A 4DDIA 3PE2A 3QD2B 4R7BA 4ERKA 4GSBA 3MB6A 4IWOA 4QMZA 3W33A 4BYJA 1YW2A 4HYHA 2A4LA 4I6BA 1ZMUA 3QD4A 3F88A 3BYVA 2HWOA 3KRJA 5HD7A 3W18A 5IZFA 5AADA 4RIXB 5DEYA 3GT8A 5ETAA 4GG7A 3LMHA 5L2TA 4G3DA 3A4OX 2HOGA 2GQRA 1ZOEA 3AOXA 1RQQA 3IDBA 1U46A 3ZOSA 3T8OA 3TV6A 1IA8A 5DIAA 1JAMA 2QLUA 5HD4A 3WF5A 2YWVA 4DT8A 3KQ7A 3FI4A 1IEPA 3R28A 3LMGA 5CU3A 3TKIA 1H00A 4QMWA 3VHEA 5CF8A 4BICA 2XK3A 2ONLA 3ULZA 4EK5A 4GU9A 3UP2A 2ZAZA 3QQKA 4UY9A 3VULA 4MWHA 4HVGA 2XANA 4DBXA 3QKKA 4X6QC 1XKKA 4PMTA 1H1WA 5JRSA 3S0OA 2WQNA 3BGPA 4FUYA 2YA9A 4L7SA 1R1WA 4C61A 3MA3A 1P2AA 2OJGA 2JIIA 3FXWA 4XP2A 2W4JA 4ZSGA 3SW7A 5D7VA 1JLUE 4HGEA 4USDA 2ZFYA 3WYXA 3TUBA 5IQAA 5K5NA 3KEXA 3MIAA 4H1JA 4AAYA 2IN6A 3FMJA 5CS6A 1FQ1B 4I0RA 4AN2A 2XKFA 3GU8A 2X0PA 4QP9A 4Y5QA 4FSWA 4WKQA 1XMLA 3ODZX 2PMNX 4OTIA 4AXAA 5DRBA 4PDSA 2PK9A 3R04A 4CV8A 4PL5A 4JBQA 5CYIA 4D1XA 3MBLA 4FSTA 3UIMA 4MNEA 1MRYA 1XH7A 4QNAA 4TXCA 3KREA 4NW6A 5CXZA 2JIVA 5D7AA 5CWZA 2NYAA 5BQ0A 3C0HA 3F3UA 4MXCA 4ITIA 1Z9XA 4FKSA 3E7VA 3QCYA 3O8PA 5AA9A 4FOBA 3D0EA 4RQKA 4XS2A 3KC3A 4BDJA 2DS1A 2YLEA 3EQGA 2GHGA 1NXKA 3NFGB 3D14A 5AAGA 3KMWA 4BN1A 5J9ZA 4ANNA 1MQ4A 1KE8A 4A9SA 2Y4PA 3HNGA 1J7UA 3ZO4A 1V0PA 3NUNA 3C13A 3OOGA 2PVLA 4D2RA 5C27A 2OLCA 4C62A 3K5UA 5FXRA 3P5KA 4NTSA 4CKJA 3UOKA 3O23A 4GK2A 3ZMMA 1FGIA 2UZWE 3D9VA 4UMRA 3R8VA 5J1VA 3DBFA 4X2JA 5E4HA 4ZIMA 4C33A 5LVPA 2PVFA 4IM3A 2JBOA 3SDJA 3NS9A 4UWCA 3PFYA 1J1BA 3HP2A 5GINE 2WXVA 3QWKA 4BCMA 4OTGA 5AP5A 4ZP5A 4BDDA 3V6RA 3L8PA 4W9WA 2UW4A 4FX3A 2JDRA 2BDWA 3P7AA 5A9UA 5TOZA 2C6OA 4Y73A 3QQFA 4LOPA 1F0QA 1UU9A 2XRWA 2ZB1A 4O0UA 5CZIA 3ELJA 4LOQA 1E1VA 3EYGA 4N0SA 3V5PA 4KBCA 4ZZOA 5IUHA 5DGZA 3ID6C 3EQPA 3D94A 2IWIA 2VTTA 3NRMA 4UZHA 4AXDA 4MXOA 3AC2A 4RFYA 4U0IA 4W8EA 4M69A 5DN3A 4D1ZA 4ONAA 1PKDA 4M13A 4FEVA 3BWFA 4RRVA 3ZZEA 2UZOA 5AP4A 3VBXA 2VGOA 3TZMA 5EDPA 4YO4A 4IANA 2HZNA 2ETRA 2R3JA 3QTQA 4TNDA 4O27B 5DHJA 4LI5A 2XM9A 5CEKA 2J4ZA 3I7CA 4EZ3A 3PP0A 3PPKA 3VN9A 3OVVA 3CY2A 3DKFA 4W4VA 4AS0A 5CNNA 4X7QA 1F5QA 3GGFA 3QTZA 4FTLA 2B9JA 3AKKA 4I23A 2JDTA 3TIYA 5L4QA 2R3IA 3W0QA 3UNJA 5FM2A 4C34A 5CY3A 3BZ3A 4H3BA 4FYNA 3RPRA 5A46A 1XH6A 5DLSA 4RJ6A 2R0IA 3GQIA 3KFAA 3ATTA 1YOJA 3LCTA 4GMYA 4IC8A 4HVDA 3BYUA 3FC2A 2WNTA 3ZO3A 3I60A 4FVPA 3TTJA 4PPCA 3HUCA 5BVOA 2X9FA 4RA4A 4PRJA 3ZEWA 3TNWA 3ORIA 3GC0A 4M15A 2F9GA 3NW6A 3ZLSA 4ZXTA 5CZHA 5FXQA 4AGWA 3RZBA 5HBJA 3HYHA 2X39A 4MQ1A 4QT1A 2XKDA 4ALVA 2YM6A 3DA6A 4WBBB 4DFBA 2IO6A 1BKXA 3GI3A 4FV6A 3DB6A 5ANGA 1G8JA 3VAPA 3ZUVA 4ANSA 4FZAB 1ZMVA 3OROA 3RAWA 4EEVA 3Q96A 5M4UA 4RIOA 3PUFC 4DTAA 2X7FA 2G2IA 3OCGA 3EFWA 4BCGA 4F70A 5IQIA 4CFWA 4F0IA 5EG3A 3UMWA 4NT4A 1WAKA 1K3AA 3QXPA 4F63A 3OTUA 4X2FA 3BKBA 3NAXA 1HCLA 2ZM1A 4GUEA 2W17A 2JD5A 3MA6A 3FHIA 3F7WA 3VQHA 4YUQA 3UC3A 3E63A 2VX1A 3I7BA 2QOCA 5EFQA 2J0JA 2W9ZB 3GNIB 4IAFA 4AA0A 2EUFB 4CFNA 4IWPA 3DXNA 2GS7A 2HYYA 2J0IA 4EOQA 4C59A 2W1FA 3KK9A 1V0OA 3U6JA 2XBJA 2OICA 3ET7A 2ITQA 3FL4A 4FEQA 5HG7A 3Q60A 2QO9A 4BFMA 3RMFA 3I6UA 2PYWA 3GQLA 4FSQA 4GL9A 4CZTA 3O50A 3C5UA 2OJ9A 3PIXA 3PPZA 3RAIA 3WILA 4GVJA 4N70A 4W8DA 1KOBA 1XH5A 1ZOHA 4N4SA 4PUZA 4CG8A 3UG2A 4P7EA 4QRCA 2PZPA 4MXAA 3W32A 3A2CA 5CT0A 5KHWA 4CRSA 4R5SA 4LM5A 3EYHA 2ESMA 4YURA 1HOWA 1VR2A 4UV0A 2JLDA 2XCHA 1VEBA 4C3FA 2VNWA 1YXUA 4USEA 1YHSA 5BVFA 5JSMA 3K3JA 3TDWA 3IGGA 4EK6A 1ZYSA 4XOYA 2HZ4A 3VUHA 4IACA 3QRJA 2W7XA 2OI4X 5E8TA 3MI9A 4BGQA 4E20A 4FKLA 4LGGA 3MY0A 3OG7A 5EHYA 2OZOA 4KNBA 2PE2A 3OT3A 4L8MA 1F3MC 5H9BA 4S31A 1R3CA 3RBWA 3D7TA 3ZSGA 2VTJA 2HY81 2REIA 4DHFA 2E9VA 2ITYA 2PE0A 2VTOA 3TKUA 3QHRA 1V1KA 5GNKA 4QMUA 1PXIA 4BDEA 5HQ0A 2XZSA 3LFFA 4BDCA 3OBJA 3CBLA 1Q99A 2VTSA 3LCKA 3A99A 3TUCA 5CEPA 3R2BA 3KMUA 4DFZE 1FVRA 2QR8A 3DV3A 3NGAA 4CFUA 3O17A 4K1BA 4BI0A 4Q9SA 4BDAA 3IS5A 4Q5EA 4QMQA 3MS9A 5HX6A 2Y9QA 5IQGA 2HENA 3LFQA 3QUPA 2G2FA 4RPVA 3DAKA 5AUXA 3UO6A 1PRYA 3ZXZA 4JXFA 3R9OA 3C4EA 1KWPA 4ZSJA 1DM2A 3LLAA 5FD2A 5FBOA 3D2IA 5IH4A 1QL6A 2BRNA 2BZIB 2WOUA 3R6XA 3G90X 3IK3A 5CXHA 4FSMA 4ACGA 3W2PA 5L2WA 1CM8A 1IAHA 3QCQA 3ITZA 4MNEB 2CNVA 4K6ZA 5H8EA 2WTKC 1SVEA 1Q8UA 3P78A 3QF9A 2YJRA 2OFUA 3LFAA 4YSJA 4XLVA 4RJ8A 4QMLA 1Q8YA 1H26A 3P5JC 2JITA 4BCIA 5HO8A 2OO8X 2C6IA 4JIAA 4TYHA 1BL7A 3ORZA 1O6KA 4CTBA 4L6QA 4I5CA 4RQVA 3NR9A 2JKMA 2XB7A 4FG7A 3UODA 4CXAA 4D0XA 3CGFA 4DGLC 1Q61A 4EJ7A 1M2QA 2VO3A 2OJIA 2W1EA 3NYNA 4Q2AA 4XV1A 4JRVA 4PTCA 3JPVA 3S3IA 3AG9A 2XJ2A 2JFLA 4AOJA 4EH5A 5K0XA 5IEVA 3ZCLA 4FIEA 2WMVA 5B7VA 3TN8A 1WBWA 4FIGA 4K18A 4EOPA 3GU5A 2ZM4A 4U7ZA 4HCTA 1SMHA 2VWIA 2XIXA 3ZXTA 3EZVA 4CFXA 3RALA 3PIYA 5AMNA 2GSFA 2YIQA 3KRRA 5LJJA 4I0SA 3RWQA 5ETIA 2C5YA 1BX6A 5L2IA 2VUWA 3LFCA 3PA4A 4DGOA 3DKGA 4LDTA 2PVJA 2GQGA 3KXHA 1MRUA 2VTAA 3PP1A 3SG8A 4FZ6A 3SLSA 5BVNA 2ITXA 3N4TA 3B2TA 5C4KA 3T9IA 2IZTA 3BLRA 1H28A 2OKRA 3ZFXA 5JQ5A 3I6WA 4DFLA 1UA2A 2JBPA 1PXLA 2P33A 3RINA 3OWKA 4NTTA 3Q5IA 5CTPA 3SOAA 3SRVA 3BIZA 2A19B 4FMQA 2X2MA 2O65A 4TWOA 3WBLA 2WMRA 4IMYA 2UZTA 3IW6A 4FV2A 4QPAA 3WE4A 2VAGA 1FOTA 4H36A 4M69B 4YJSA 2C69A 4CLIA 4CNHA 2NPQA 4FKQA 5IG1A 1UU8A 2WQBA 3BLHA 4MXXA 4EQUA 4DDGA 3LZBA 3SV0A 3Q9XA 4AFJA 2XIZA 4IX3A 5A4QA 2J0MB 2O2UA 4C8BA 2C3JA 4NWMA 5KHXA 3ZEPA 3QGYA 4QYHA 5D11A 3C7QA 4QMVA 3VBQA 2XYUA 3M2WA 2WMSA 3T3VA 4DINA 4MUQA 2QOIA 4BWXA 4O82A 3MJ1A 3W0MA 3ROCA 2F7XE 4RSSA 4AW5A 2VU3A 4JI9A 2WMWA 5DMZA 3GFEA 1JSTA 2VTNA 4IXPA 3T3UA 3UYTA 2W1HA 2PVMA 1YWNA 5A4EA 2GNHA 3TUDA 4MK0A 3BE2A 4U43A 2YCRA 3KN5A 5HI2A 2IZRA 3ZSHA 4IZ5A 4K11A 4RMZA 4BCJA 4LRMA 1Q3DA 4MD9E 5FDXA 2CJMA 2ERKA 4AE9A 4S34A 3DLZA 1ZLTA 2YLFA 4JX3A 3B8QA 2QOHA 2EXCX 4O0YA 4XEYA 3DQXA 3R02A 3MGYA 3PA5A 4Z16A 3D4QA 2PHKA 4DBNA 3U51A 1CTPE 4FKPA 3PSBA 2EVAA 2VWWA 4FT3A 2ZMCA 4YC6A 4WIHA 4FVRA 4F6UA 4PL3A 2V7AA 3TG1A 3QA8A 4K9YA 4CZYB 2XAMA 4A4XA 5C4LA 1TQPA 4RC2A 5CAQA 4B6LA 4ZLZA 5JGBA 3Q9WA 3ZO2A 3QRUA 5LXMA 3FPQA 3QTWA 4XNEA 5J9YA 3EB0A 1ZAOA 1REJA 3BU6A 3CKWA 5HICA 1W82A 3U9CA 1XBCA 4EC8A 4G3CA 3VS0A 4O0VA 3ENMA 4EYJA 4QMXA 1URWA 1NVRA 4FNZA 3MFRA 4FKRA 3TKHA 3KL8A 4D4VA 3VUDA 2WAJA 2V0DA 2HK5A 3E8CA 3I1AA 4F08A 4JS8A 1JWHA 3NAYA 3RPSA 5HBHA 5BNJA 5JK3A 3F3WA 1J1CA 3GCPA 4WNMA 5KMNA 4M0YA 2EWAA 3PG1A 1W8CA 4XG3A 2H9VA 3VW6A 4CEGA 4E26A 2GHLA 4O7RA 3R8PA 5HVKA 4N6ZA 4E6AA 5CAOA 5AA8A 4PY1A 4L67A 1L8TA 3RP9A 3POOA 4RJ3A 3O8UA 4FVQA 4RZVA 2XK8A 4W4XA 3HL7A 2WMAA 3OZ6A 4ASXA 1JSVA 3TV4A 3ORPA 2J0LA 3OEZA 3DFCB 3R1YA 5DG5A 1FMKA 1SNUA 5E92A 3V5JA 3FI8A 4I3ZA 4XV9A 4XG7A 3FQHA 5J95A 3BHTA 2VX0A 1DS5A 3CQUA 4XP0A 2YEXA 1OIYA 3RM7A 4ASZA 3BHHA 4UMPA 3BBTB 4R3CA 2X4ZA 4CSVA 3JR1A 5AR5A 1MUOA 1NA7A 4KIPA 3COHA 5EI6A 2UW9A 1GZNA 3AGLA 3EQFA 3VS6A 3C4ZA 2QHMA 2CN8A 2WTWA 3RK9A 3UIBA 1ZYLA 5AUYA 3GOPA 3C4XA 3E88A 4BBMA 2G9XA 2XARA 5AR4A 2XK9A 3ZFMA 2F2CB 1BI8A 3D7TB 4YJNA 2F7EE 3P08A 5IH6A 3QTXA 4NKSA 5CSXA 2GNIA 4YC3A 2XH5A 4CRLA 4D2PA 4Y83A 4F7LA 4BZOA 5C01A 4BBEA 2XEYA 4E5BA 1SVHA 2Y8OA 3EN9A 2C5VA 3ORLA 1FVVA 4EHZA 1CKIA 3EH9A 2BRMA 3SXRA 3UIUA 4U97A 3I0OA 4S32A 2JEDA 3NFFB 3DLSA 4UALA 4GEOA 4D55A 1YDTE 3OUKA 4TY1A 2BIYA 3L8VA 1ZXEA 3UPXA 1CMKE 2QURA 4GK3A 5FEEA 5I3OA 3ZLYA 5LMAA 4NM7A 1VYZA 3GBZA 4ACHA 4ZY5A 4IAYA 4JL9A 3UQCA 4CKRA 1QMZA 3UDBA 2XNNA 1SVGA 3F3VA 4TZRA 1RW8A 3ATSA 2QOKA 3IW7A 2QVSE 5IQCA 3VS1A 3BHVA 3W8LA 2ITTA 1BUHA 5G6VA 3W0RA 2C6EA 4NIFA 4Z7GA 1PXOA 3R8LA 3BYSA 1YXTA 4AN9A 3EQHA 5ANIA 4DFXE 4EKLA 3H0ZA 5A54A 1DI9A 2RIOA 2WO6A 3OT8A 1Y6BA 3VVHA 4BBFA 3MH0A 3O7LD 3AD6A 3NW5A 3KXGA 4TYHB 4WRGA 3WF6A 5LCJA 2Z8CA 2QKRA 3LQ8A 4UX9A 4F65A 4FGBA 4U3ZA 4YHTA 1PYXA 3GOKA 5L2SA 2JAMA 5TKDA 3N4VA 4OR5A 4TN6A 2XAOA 4O83A 2CKOA 4IAIA 5IEXA 5A6NA 1YXSA 1BLXA 2QOFA 4KS8A 4HJOA 4V04A 1W0XC 3OOMA 3CLYA 4UZDA 3F5XA 2UV2A 3PXQA 2C6MA 4J52A 4L42A 5EI2A 4F64A 3PVUA 3LXLA 2UZUE 4UBAA 1U4DA 4DEBA 4OTDA 3NPCA 4PDOA 4X2KA 5AP3A 4O7TA 1WZYA 4JQ7A 3MH2A 3AD5A 4I92A 4XBUA 1YHVA 5FBNC 5AUUA 5IQBA 3D5UA 4QYYA 4MD7E 5EQEA 4FSYA 4RC3A 5KBQA 5HHWA 3FBVA 3VW8A 3OCBA 3PSCA 4M14A 5EI8A 3TNHA 3QCXA 1GIJA 4YJRA 3A7FA 2BAKA 4BTFA 2VO6A 5IA0A 3RCDA 5HU9A 5M07A 1RE8A 5EYMA 3OBGA 5AUWA 4ASEA 2VZ6A 4RJ5A 5JGDA 1AQ1A 3QL8A 2B52A 2BRBA 2R3QA 4U8ZA 3QCSA 4XMOA 4QDEA 4DEAA 3OWLA 4IJ9A 4NL0A 3SRVB 3F6XA 4APCA 5ETFA 2EB3A 2BROA 4D1SA 2UUEA 3PFQA 4FICA 3UO5A 2JGZA 4RLLA 5E8WA 5CSPA 3LKMA 4EOMA 1OIQA 5HU3A 3FMMA 3HMNA 3KRXA 4DG0E 4OTPA 3NUAA 2X4FA 4HCUA 3EFLA 2E9PA 3SA0A 2UW7A 5IUIA 3H0YA 4C36A 2I0YA 4L3JA 4KRDA 2PVRA 4JQ8A 3BPRA 3CJGA 4LYNA 2XUUA 4D4SA 5M53A 5C8MA 4WBOA 1JNKA 1GZKA 3R73A 2NRYA 3V6SA 2R3NA 3Q3BA 2ZOQA 3FZSA 4KKEA 4MF1A 4ZS4A 2WQEA 4H3PA 5HCXA 4O2ZA 3CTJA 3MVHA 3PIZA 1W2CA 5AV3A 5AV4A 4X21A 3NDMA 3DKCA 4JBPA 3UVRA 4ZLOA 4FRFA 2QO7A 2OSCA 3BEAA 4TYGA 2X0GA 3IG7A 4FTAA 4AFEA 2OF2A 3NNXA 2C6LA 1JSUA 2KTYA 1XR1A 4QMTA 3R21A 5EOLA 5L6PA 2O3PA 3MPTA 4G3EA 3PJ2A 4JDJA 3II5A 5FGKA 3OHTA 5ANJA 3E8DA 5JFWA 2X7GA 3U87A 2XBAA 4A7CA 4G3GA 3LIJA 3OTVA 4M12A 3QQUA 3FZTA 2VWUA 1ZWSA 3FY2A 5EM5A 1P14A 1A9UA 4J98A 5M51A 3DBEA 1UU7A 4DTKA 4DH7A 4NU1A 4TTHB 4YTCA 3DZQA 3KN6A 4Y85A 5JH6A 2BMCA 4AN3A 2BIKB 2C6KA 2GS2A 3FEGA 2I0HA 4Y8DA 3V8SA 4RLKA 1S9JA 5LQFA 5BUEA 3TZ7A 2OH0E 3LCDA 2OJJA 4IJPA 4Z55A 4HZRA 1OL7A 4O4BB 3ZFYA 4QP1A 2NP8A 4RVLA 3G51A 3QQLA 4QP3A 3FLSA 4AU8A 4WNOA 3MB7A 4OAVB 2Z60A 3KB7A 4II5A 2LAVA 4QYGA 2ACXA 3EHAA 4RGJA 2HZIA 3AQVA 4AX8A 2FA2A 3VUIA 3OY1A 4A9RA 4EOKA 3ZUTA 4PDYA 4H3QA 4BHNA 1WVYA 1H27A 4QOXA 1OL1A 3F3ZA 4FL2A 3A7IA 3V01A 3D15A 4OTRA 3ORMA 4NW5A 3PA3A 3VS4A 4KIOA 2IW8A 3UDSA 5FG8A 4G34A 2Y0AA 2WEVA 2WGJA 3HMIA 3KF7A 2UVZA 4WSQA 4IM2A 2YM8A 4TRLA 5CI6A 4LUDA 3R9RA 4FNWA 2QNJA 4K8AA 3QD3A 2VTIA 4YP8A 5I3RA 4V05A 4ASDA 4BVUA 2YABA 3S00A 5F9EA 3LJ0A 2AYPA 3K2LA 2BRHA 1H1PA 2IVUA 4IAZA 4RBLA 3ZYAA 4ENYA 5ACBC 3KXZA 2XS0A 4J8NA 4KA3A 5K3YA 1UWJA 3DS6A 3DAEA 2IVTA 3UIXA 5M56A 1AGWA 1S9IA 2JIUA 4NSTA 3BHUA 2ZVAA 1OITA 4C37A 4RC4A 4AW0A 1KE7A 4ZZNA 5IQFA 2X7OA 2YIRA 2CGVA 5E1EA 3LOKA 5HNIX 2FVDA 2WMTA 4MVFA 4O4DA 5DNRA 5E90A 4DYMA 2I7QA 3OW4A 4XV2A 3IO7A 3KMMA 5ANKA 3ZONA 5IEYA 1W83A 4LOOA 5KE0A 3KA0A 1YDSE 3G6HA 4K33A 3DK7A 3WZUA 3UPZA 4YJVA 2WMQA 4X2NA 5HORA 3CR0A 2BZJA 2YM5A 3IDPA 4RIYA 5DR2A 4TW9A 4IQ6A 2QU5A 5BVEA 3BCEA 4YU2A 3U9NA 4D9UA 1M2PA 3GU7A 4DGGA 1KOAA 3AC1A 3TNIA 1H01A 4ZTLA 3PE1A 4RJ4A 2GDOA 3HV4A 3QKLA 3DBCA 4KS7A 4FT7A 5D1JA 2WMXA 3K54A 4WOVA 4FL1A 1OGUA 5HESA 3Q4ZA 2C0OA 4PP9A 5ANOA 4ZAUA 2Y4IB 3LAUA 3DXQA 2PZRA 2PWLA 2YM3A 5M44A 2X6DA 4GS6A 3S4QA 4AQCA 1SYKA 2XP2A 3GCQA 4U42A