3C7QA

Structure of vegfr2 kinase domain in complex with bibf1120
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
301
structure length
286
Chain Sequence
RLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKDFLTLEHLIYSFQVAKGMEFLASRKIHRDLAARNILLSEKNVVKICDFDIKDPDVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vascular endothelial growth factor receptor 2
publication title BIBF 1120: triple angiokinase inhibitor with sustained receptor blockade and good antitumor efficacy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 286
sequence length 301
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3c7qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3c7qA01
4Y72A 3NUUA 4QP7A 4ALUA 3E7VA 5AV0A 5K5XA 4DG3E 3ORTA 4I6QA 3RHXA 4YO4A 2W5BA 3SHEA 2OGVA 4AT3A 5J9LA 3WILA 3RM6A 4V0GA 3PA5A 1CSNA 3G9NA 1ZOHA 2XNEA 1ZMWA 5AAFA 2R3LA 4FYNA 4TL0A 3OZ6A 4R5SA 4B0GA 1E1XA 2LAVA 4D1XA 2XJ2A 2OXDA 2EVAA 2PY3A 3JY9A 2DWBA 4BKZA 3FZPA 4FGBA 1AGWA 2PTKA 3I7BA 3M42A 4NFMA 3VJOA 2ITOA 1GZNA 4EH9A 4FKLA 1QPEA 2XP2A 3G0EA 4O7TA 4XLVA 4FG9A 3BLRA 2X81A 5DBXA 5A14A 1FVVA 2R9SA 3H9RA 3LM0A 2FSMX 4ZTLA 3S95A 3ZLWA 4PP9A 4RX5A 3D94A 3OWJA 1HCLA 4KSPA 3ZBXA 2QOIA 4AGDA 2BRNA 3SGCA 3WYXA 4FE2A 3L9PA 3SW4A 4PY1A 2F7XE 3OTVA 4IZAA 4J97A 1T46A 4O27B 3V01A 4QT1A 1OUKA 1NXKA 2UW8A 1BL7A 4M68A 4BDGA 3QUPA 4L45A 3VUGA 1KWPA 2XIKA 4J95A 4I6FA 2HY0A 3OG7A 2YLEA 1ZARA 2JFLA 3Q4CA 4QMTA 3G15A 4MXYA 3BV2A 3Q6UA 3D9VA 4O6LA 1GJOA 4NT4A 3D5WA 4GH2A 4Z9LA 2GFCA 3W33A 3ENHA 4G9RA 4F9BA 3QRJA 4E6QA 4RQVA 4AG8A 1XBAA 4RJ8A 2BFYA 4FL3A 3UOHA 3HNGA 2IPXA 4ZTMA 3MESA 5DRDA 4FSQA 2G2FA 3NDMA 4IM3A 3QCSA 1H27A 4U9AA 1YHWA 1FPUA 4CG8A 1NVSA 4I5CA 2IJMA 4ACGA 5TT7A 3ZUUA 4HGEA 5FM3A 1XR1A 4ANSA 3IONA 5CEMA 5DEWA 4UV0A 4C4HA 4FKTA 2Q0BA 2OH0E 3IW4A 4FEXA 2QOLA 3DKFA 4N6YA 3TDVA 5LARA 2CNVA 2XVDA 4CEGA 4DN5A 4PMMA 1OITA 5AP2A 4YJVA 4R1YA 4XMOA 5DH3A 5HOAA 5HBJA 3QGYA 4H1JA 2FO0A 2IW6A 1G8AA 3LOKA 4Y73A 2ZV2A 2XH5A 3FMJA 3A7GA 4TN6A 2GMXA 2ESMA 4FG8A 4XCUA 3R9HA 3W2SA 3W32A 1LR4A 5CVFA 3BHHA 1FMKA 3OCGA 4YC3A 2OXYA 4D4SA 5L2WA 3VC4A 4UALA 4D2SA 3HGKA 4ITIA 5DI1A 1YI6A 2EXCX 3QX2A 5FEEA 3KRJA 1Q8WA 2VX0A 2ZMDA 3Q5ZA 4FKUA 4L6QA 4O81A 3U54A 5FTGA 3GU8A 5AUXA 3DXQA 4RT7A 3U6JA 1UNLA 2Z7SA 3DJ6A 4ASZA 3BEAA 4V01A 4DAWA 3VS2A 2HELA 4L67A 4M69A 3SA0A 3Q4UA 3WOWA 3R04A 5ANOA 2OJJA 3FZRA 4K0YA 4WNOA 4O7LA 2XM9A 3QQLA 4ITHA 3TZ9A 4BZNA 4ZLOA 3UOKA 3WF5A 5EDPA 2QHMA 2XK4A 5GZAA 3UNZA 3VQHA 3TNPC 4QO9A 4L3LA 4IWPA 4LG4A 4B8MA 4JBOA 3DJ5A 3EN5A 4EQCA 4GVAA 4YC8A 3P4KA 5AUTA 1OPJA 3NAXA 5AM6A 2PL0A 5AR2A 1ZYJA 4G1WA 4F9YA 5DLSA 3VBWA 2X0GA 1MRYA 3DBFA 4FNXA 4L7FA 4D9TA 3LFSA 1YW2A 4W4WA 3MGYA 4PMPA 1K2PA 3A4OX 3VW6A 4D1ZA 4D58A 4GIIA 2OI4X 4UXLA 4X3FC 5CSPA 4NTSA 4QP4A 5K4IA 3RAHA 4TT7A 3ERKA 5FBNC 4IMYA 3SX9A 3ULIA 3U6IA 5M07A 2W0JA 3P79A 3F7ZA 4JBQA 3AQVA 2ONLC 5IQGA 3R7UA 4PX6A 1Q8ZA 4M14A 4ZJVA 3EZVA 3EN7A 4O7YA 2WELA 3AMBA 1OVEA 3P7CA 4O91A 3CE3A 3NAYA 2PVKA 5B2LA 1TQIA 5A9UA 2YAAA 1OIRA 2WTCA 3Q32A 3F82A 1YWVA 2WTWA 3BQCA 2PVJA 4O96A 4FEVA 2QO9A 3IOPA 3HMNA 4EHVA 2Y7JA 4PL5A 2OFUA 4PPAA 4U3YA 3BEGA 2PHKA 1VYZA 1WBNA 4RVLA 3MW1A 4FKPA 4JIAA 1FVTA 4F0IA 5F94A 3RAIA 3ORNA 4JRNA 1Q97A 2VTSA 4XP0A 1JSUA 1YXVA 2C5YA 3E3BX 4I0TA 1ZMUA 3AMAA 2VWYA 3Q04A 4RMZA 5GJGA 2F49A 3RJCA 4O7NA 4YC6A 2QU5A 3R8MA 3LLAA 3HRFA 3R21A 3A99A 3GNIB 4EOMA 3FMMA 4BHNA 2VGOA 1XQZA 1XJDA 3G6GA 4RSSA 3VS5A 5BMMA 2OK1A 1TKIA 4KIQA 3ZTXA 3VULA 3DT1A 5EW9A 4ERKA 4EOLA 2HY81 2OO8X 2C0IA 2BROA 5EKOA 5EW3A 5FLFA 4GFMA 2A4LA 3Q4ZA 3KRRA 5J8IA 5IG1A 4O7SA 3ORXA 3MTLA 3QKMA 3R2BA 4NW5A 3MN3A 3LQ3A 1STCE 2ITYA 4FTLA 4ANMA 2XZSA 2PVMA 3AD5A 4EONA 2YM4A 4L01A 5HBEA 3IKAA 3NW5A 4L46A 3RWQA 4FOBA 3CD8A 2VTPA 3NCZA 4YMJA 1OMWA 4G16A 2QOCA 4AGWA 1X8BA 4OTIA 5JKGA 3LM5A 4XNEA 4YHTA 4QYGA 2GHGA 4GUEA 4R77A 3C0IA 3Q9YA 4QMMA 3PPJA 4CLIA 3OT3A 3RPRA 5JFWA 4B6LA 2GCDA 4GT3A 3WE4A 5FUTA 1W83A 2HXLA 2CHLA 4P4CA 3U4UA 4O1PA 2JDOA 1P4OA 2JKOA 3CLYA 5DE2A 2OIDA 3S4QA 1B39A 5IDPA 5L2IA 1G8SA 2C1AA 4JG8A 1QPDA 3U8WA 4PV0A 4ACDA 5F9EA 4J52A 3R7OA 2F7EE 2R7BA 3CKWA 3GGFA 2HW6A 3RVGA 3SRVA 4ZY4A 3GBZA 1WBWA 3WBLA 1NW1A 1RQQA 4ZSLA 5EH0A 3CS9A 5L8KA 4NSTA 1VZOA 2P55A 3BHYA 2ZM3A 3I0OA 3NNWA 1AQ1A 3Q60A 5LQFA 3LPBA 4BWKA 3FEGA 2XYNA 3HRCA 4FVPA 3KREA 3MWUA 3NX8A 4FIFA 3DAJA 1OKVA 2ZAZA 3GEQA 1UVRA 5DR6A 3KFAA 1DAYA 4FSUA 4E5WA 5D41A 4C2WA 1IR3A 4N0SA 4GL9A 4ANNA 4LFIA 4E26A 2R3JA 2JIUA 1Q8TA 2J9MA 2VWWA 4P5QA 2JFMA 4YZMA 4JG6A 5ANEA 4FKOA 3W18A 2OJFE 5A3XA 4G2FA 4IC7A 5JFSA 5CAPA 3FY0A 1JSTA 3FPMA 4X2FA 3CGOA 4QMWA 3DBQA 3OHTA 4NKSA 3UP2A 3W2QA 3VS6A 2A1AB 3Q3BA 2QOBA 4OT5A 3UYTA 1ZAOA 4B4LA 4F9AA 4PPCA 1QMZA 2GNJA 2W9FB 4F6SA 3ZO3A 4JX3A 4M15A 4OGRA 4M69B 5KMIA 2WMRA 2J2IB 3O8PA 2J0LA 4JBVA 5AV4A 3LJ0A 3P78A 3P5KA 1J91A 5EI6A 2F4JA 5M44A 3KK9A 5C8NA 4GMYA 4RA5A 4LUDA 3EQPA 2WQBA 4F0FA 2VTJA 5IUIA 5C1QB 1OL6A 3E88A 3PXQA 4IFGA 3WIGA 3I60A 5CEPA 5JN2A 5JEBA 4P7EA 4DFZE 1ZOEA 3NR9A 2UZTA 4EZ3A 3TI1A 4G3CA 4AF3A 5HX8A 4E8AA 3DBCA 2ITTA 4BIEA 4GKIA 4K2RA 4BI2A 4UWYA 1KOAA 3V8TA 5TOZA 4FSNA 3FAAA 2EU9A 2PVRA 1REJA 5CSXA 1KE5A 3V5LA 5HLWA 1YVJA 4QMOA 4K1BA 3C4CA 2YZLA 2VO6A 4O0VA 4DLJA 2Y9QA 3NUNA 3NVKI 1OUYA 2BRMA 2ERZE 2YCSA 1OGUA 3FMEA 2QQ7A 4HYIA 5I9VA 3AC2A 3EQFA 4AA5A 4YGAA 3GU7A 2H9VA 1R0PA 4IFCA 1S9IA 3GC7A 1YOLA 2OXXA 3BYOA 3PUPA 4DTBA 4HNIA 2QHNA 3G0FA 3S00A 1H4LA 2GNFA 2VD5A 3QTSA 3FI2A 5K0KA 4EK8A 5FBOA 4IX6A 4E93A 4HPTE 4RVKA 5EYKA 2XNOA 4D2WA 5CY3A 4PUZA 2IN6A 1LP4A 3EQRA 3KA0A 4J8NA 3ZXZA 2XCHA 3HDMA 3MYGA 3Q5IA 3F9NA 5L6OA 4O0SA 2Z7RA 3W2CA 5T3QA 5BVDA 5KHWA 3ORMA 4GUBA 4U80A 4TWPA 4QP1A 4USDA 4HYUA 3VJNA 4QTCA 3C4FA 3I1AA 4RJ6A 5E8SA 3O71A 1NT2A 3BHVA 3D7TB 4H58A 4OR5A 1KUTA 2XB7A 5EHOA 4IVBA 5IF1A 3JVSA 4FT3A 5KBRA 3HAMA 2BZIB 2X7OA 4ASXA 4YJRA 4FIIA 2OLCA 3V5PA 4OAUC 3LQ5A 2YHVA 3L8SA 3PIXA 3V3VA 5A54A 3D2KA 2FA2A 4IWDA 4BWXA 3F3VA 4FODA 3LMHA 5CQWA 5FEDA 1IA9A 4IVCA 2PVNA 4WNPA 3UO6A 5KNJA 3WZDA 4QQTA 3RPSA 4ZZMA 2J5EA 3VUDA 4AFJA 1IA8A 3BX5A 4KKEA 4D4RA 5ICPA 5LVNA 5AV1A 4L8MA 3H30A 3HV3A 3MFSA 3MIYA 3FPQA 4AW1A 4YBJA 5AUVA 4JNWA 4MWHA 4UY9A 3UNJA 3QALE 4U0IA 4DH8A 3ODYX 3AGLA 3OFMA 5ANGA 3SXFA 4CXAA 4BCJA 1DI9A 2GHLA 4E20A 4O7ZA 4I41A 3FQEA 3LQ8A 3KL8A 1KE6A 3UGCA 3Q6WA 4GFOA 2UZBA 3H0YA 4L42A 3GQLA 1B38A 2W99B 2CN8A 3D83A 4WHZA 4M66A 4S31A 1GIJA 3BGZA 3KXHA 4ZXTA 1ZYSA 3A4PA 2XF0A 4M13A 4QP9A 2W7XA 1YXXA 4QOXA 2XRWA 3E8NA 2YLFA 1O9UA 2IZTA 4KIKA 1BI7A 5HNIX 3MVJA 3W2RA 4PP7A 1M2RA 4D5KA 3PVWA 4I4EA 4FF8A 4YSMA 4UN0C 3HX4A 2WTKB 3PZEA 4ITJA 5IA1A 2C1BA 4FKIA 3LLTA 4O7VA 4GYGA 5HGIA 3L9LA 4BRXA 2UZDA 4RBLA 2OZAA 3DQWA 2CN5A 4GS6A 3JS2A 3G6HA 3WF7A 1OL5A 3R1SA 4GU6A 4MH7A 5IA4A 4N6ZA 4J1RA 3PY1A 3HP2A 4ZZOA 2E2BA 5J7BA 3QUDA 3W16A 4MXXA 2CKOA 3DK7A 4M7IA 3PZHA 4L3JA 4BCOA 1BX6A 1GAGA 4J71A 4S33A 2PZ5A 2UVXA 4IAKA 3D15A 5EG3A 3QQJA 2IZSA 1ZMVA 3R6XA 4IANA 2GNLA 3OY1A 3ZLYA 5HI2A 4BGHA 3CXWA 4QQJA 5H3QA 4X7QA 5DT4A 1UWHA 4OUCA 2HAKA 2QNJA 4OT6A 4CFWA 3EFWA 4FICA 4AA4A 1HOWA 3TNHA 4G17A 3ZM9A 3TTIA 3IGOA 3NLBA 3OOMA 1DI8A 2W4JA 3FXZA 2VAGA 4NIFA 4F7NA 2J7TA 3AC1A 3O23A 5BUJA 3OMVA 3VUKA 2CGXA 5AR5A 3PA3A 4TYJA 4DLIA 3IW8A 2CKEA 2R3MA 3O7LB 3BBWA 4XS2A 5AP7A 4XV1A 3QYWA 4LV5A 5BYYA 3S0OA 2B9HA 2XUUA 3FDNA 3RMFA 4ZLYA 3NEWA 4KA3A 4M12A 2XA4A 4FKVA 4GU9A 4MBIA 4XOZA 2YIXA 4BDEA 2BRGA 2FSLX 5H9BA 3MPAA 3QGWA 5EYDA 4W4XA 4Y5HA 3DU8A 2Y4IC 2R3FA 3RK5A 2VTTA 4BTKA 5KX8A 3NUAA 4FC0A 4ZIMA 3FL4A 2R4BA 2CLXA 4U8ZA 4QQCA 4Z7HA 4D0XA 4N70A 3GCPA 3VBVA 4BYIA 4L68A 1H07A 3A7IA 3WF9A 3TIZA 5EOBA 3BIZA 5IQBA 4BDAA 3FLSA 2NNWB 3H0ZA 3BPRA 2FVDA 3BI6A 5IISA 4X3FA 4XG6A 3EKNA 2YIWA 3AG9A 4B9DA 5JT2A 4DT8A 3HA6A 4IE9A 4KNBA 5DT3A 2PZRA 1BL6A 3DGKA 3WIKA 4ZTQA 2BILB 2ITWA 3HMOA 2BHHA 3DKOA 4U5JA 1WAKA 4NFNA 3UMXA 4EC8A 2Z02A 1PMUA 3ORZA 3R71A 3O17A 1SVGA 3CTHA 4MXCA 3LXKA 3G51A 5H2UA 3FWQA 3IW6A 3QWKA 1T45A 4BBMA 4EH2A 4EKKA 4RLLA 4DE4A 2Y4PA 2C30A 4FIGA 4CG9A 2ZM4A 1M52A 5JGBA 2W1CA 3REPA 2GQGA 3KXZA 3DV3A 1WMKA 5C4LA 3PG1A 4YJUA 2GTNA 3HKOA 4JDJA 5ETFA 4DH3A 4F1TA 4HCVA 4L53A 2WQNA 2IW8A 2YM8A 3NZ0A 3KRLA 4HVSA 4GSBA 4IDTA 3NYOA 3C4XA 3NS9A 4YZDA 4O7WA 3TIYA 4TYGA 4FOCA 3IGGA 1I44A 4IBMA 2ZV8A 4WOVA 2R2PA 3COHA 3VRYA 5KO1A 1REKA 3FZOA 2QD9A 2UZLA 2X2LA 3VVHA 4FTJA 2CGVA 3KC3A 3A7FA 3VS7A 2WMWA 5FP6A 3PFQA 3Q96A 2WOUA 3LW0A 5LVMA 5TO8A 2PVYA 5DN3A 4AT5A 4PTGA 3NYXA 1NVQA 2F2CB 3DFCB 4BKYA 2OF4A 3EN9A 3CGFA 3UIUA 1TVOA 1GZKA 3N51A 4FVQA 3B2TA 3UTOA 4FEQA 1M2PA 3LAUA 5AFVA 4IQ6A 2JIIA 2DYLA 3QHWA 3LMIA 3NVMB 1MUOA 3F5PA 3GFWA 2VO0A 4IH8A 2E9OA 5CNOA 1UKHA 1UWJA 3KXNA 4FT0A 3OD6X 3BELA 1BUHA 4RLKA 3GOPA 2B9IA 1SVHA 2E9UA 1FGIA 5AP5A 1MP8A 2EXEA 3ZSGA 3OROA 1LEZA 3HMPA 3P23A 1JKSA 3F5XA 3OF0A 4D4VA 3TACA 3BU3A 1GOLA 4DG2E 5J95A 5J5TA 5HG5A 2XJ0A 4KIKB 4NWMA 3NNXA 2J90A 3PJCA 3EH9A 3R22A 1UV5A 3VO3A 1YI3A 2NP8A 4ARKA 5IQAA 1U5QA 5DNRA 4HYSA 4I5PA 2ITPA 2JDSA 3EOCA 4WBBB 1ZLTA 2AC5A 2UW7A 4BICA 2B9FA 2WEIA 4KD1A 3UOLA 3SD0A 4A4OA 4FA2A 3OTUA 4FNYA 2OJIA 5JQ5A 5LJJA 2OZAB 4LGGA 5HO7A 2C3JA 4HZRA 3OT8A 1L3RE 4IX3A 4JOAA 4QPSA 4BL1A 3UDBA 2CGUA 3N4VA 4RWKA 1ATPE 5KE0A 3FYJX 4XYFA 3BE9A 4IC8A 4R3PA 3F2RA 4AOJA 1OECA 2FGIA 4XV9A 5LWNA 2PUIA 3NCGA 2WEVA 4IAFA 2JDVA 3QTQA 4F7JA 4LOPA 4RIXA 3VS0A 4CZTA 5DR2A 4F09A 5BYLA 2JBOA 5DHJA 3T9TA 3I5ZA 4TYHA 5E8YA 2BKZA 5BVKA 5HVJA 5JSMA 3B2WA 5K3YA 2GS2A 2R5TA 2CGWA 3E8CA 4I24A 3TZ7A 4F4PA 3OBJA 2GDOA 3P1AA 4E4NA 3MH2A 5DIAA 1MQ4A 5KBQA 5JQ8A 3VWAA 1M7QA 4U97A 3B8RA 4MWIA 4NIFB 5HD7A 4DFLA 4B8LA 2CKPA 4CYIA 3QA0A 4TWOA 4CQGA 2IVTA 2E9NA 2JGZA 2PUUA 3H9OA 3QZIA 4FV4A 4KBCA 4NYEA 4GRBA 3I6UA 2BUJA 2ETMA 3KMUA 5I5ZA 2Z60A 2FYSA 3MIAA 3NMUF 5KCVA 4FTCA 4JL9A 3KN6A 5I9WA 2ZM1A 4ANLA 2C6EA 2P2IA 2XS0A 4C59A 1YXUA 5IDNA 4C3RA 4EORA 1LPUA 3IDCA 5HNGA 5T6KA 3BE2A 4B99A 2PYWA 1Q3DA 3D5XA 2VNWA 3KRXA 2ZJWA 3PYYA 5IA2A 5HIBA 2X6DA 3W8QA 3C5UA 5HE0A 4TYEA 4JDKA 3QX4A 4YJSA 5E8XA 4TYIA 4L9IA 1ZRZA 5CU0A 2O64A 2X9FA 2XEZA 4YLJA 4OTFA 1V0PA 2I1MA 1OL2A 5IMEA 5DVRA 1JNKA 3QRKA 3LCSA 3TKHA 4L3PA 4CKIA 5KMKA 1QPCA 2RKUA 3TN8A 4EUTA 4UZDA 4LRKA 5EM7A 4IW0A 2WOTA 2WMSA 3FY2A 4QNAA 4BIBA 4PDSA 1PXNA 4CFFA 3CTQA 2JIVA 5L2QA 4G6NA 2P0CA 5M4IA 2BPMA 4BCGA 3C4ZA 3R73A 3IK3A 2F9GA 4NM7A 4A9SA 4EOIA 1BKXA 3TUBA 4AT4A 2X8IA 1PXOA 2X39A 3QRUA 4MF0A 3PY0A 2QCSA 4EZ5A 5AAGA 3BV3A 4IB0A 4QMYA 4EOOA 3EWHA 5EKNA 4MEDA 3KK8A 4GT4A 4EYMA 3HEGA 3VBTA 3R9RA 3D14A 3IDPA 2AUHA 4S34A 5FP5A 5FWKK 4IZ5A 4AN9A 2R7IA 3FKOA 4FTAA 4U42A 1KV1A 5F95A 5DYJA 2VTOA 5DEYA 5I3OA 1WVWA 3H3CA 5JH6A 5FGKA 4C4GA 4C34A 5KKRC 4MD9E 5FG8A 2VTRA 3RCDA 4F64A 5BYZA 2J0KA 1Y6AA 4AZWA 4KAOA 3F69A 4UEUA 5J7HA 1XH9A 4R8QA 5JMSA 4RJ7A 2QO7A 4U41A 5CU2A 3EQIA 4L52A 4YHFA 3WZEA 3V8SA 3MH0A 4G31A 4IXPA 4OTDA 4BCNA 4F7LA 3G90X 4YZNA 4YSJA 3EFLA 5J1WA 3MY5A 4M67A 3RZFA 1H01A 1WVXA 1OL7A 3I0QA 4AE6A 5JGDA 2CPKE 5ANIA 4MQ1A 2CCHA 4ZLZA 4U40A 3O8TA 4O84A 4D2TA 4UWBA 1DS5A 3LXPA 4TXCA 2UZOA 4XV3A 1M2QA 1WBPA 3QQHA 5AR3A 4WUNA 4RC3A 2GTMA 2QKRA 3IW5A 3POOA 3MY0A 3ZFMA 4EBWA 3NSZA 2BR1A 1CKIA 2VWXA 4RRVA 2W05A 3L9NA 4HNFA 4I93A 3DXNA 2A2AA 3QAME 4KINA 5L6PA 4S2ZA 3UIBA 1BLXA 3EQCA 4XRJA 3A7HA 4AN2A 1JKLA 5AA9A 1U46A 3HL7A 2HWPA 3GC0A 3MPTA 5A46A 5AEPA 3BBTB 5HVKA 1GZ8A 3L1SA 1OZ1A 4OTPA 1BI8A 4PNIA 3F3ZA 3PVBA 4EH6A 5LCJA 3ZRLA 5IQDA 5GJFA 4LUEA 1UNGA 5M4FA 3Q9WA 4F1MA 4ID7A 2RFDA 4IAIA 3QTUA 4QP2A 2QOKA 3QLFA 4EK5A 3NYNA 4IZYA 3QUEA 5CI6A 3QQUA 2OBJA 3CBLA 5IA0A 2Q0NA 4NM3A 5J5SA 2ZDUA 4ENXA 4H05A 4CTCA 3QTZA 2EUFB 4A4XA 1ZXEA 1YKRA 3QCYA 2PMIA 4ZTHA 5LVPA 3AGMA 2JKKA 3CY2A 2WU7A 2YN8A 2R3IA 4GJ3A 1CDKA 5BVNA 4YU2A 3P9JA 3FV8A 2WTJA 3R9DA 5IEVA 4GVJA 4QPMA 4DEAA 2R0UA 3P86A 3L9MA 4BWPA 3KULA 2UW9A 1UU7A 4QD6A 4BTJA 4C33A 1FMOE 5HTIA 3DB6A 1Z5MA 2ERKA 2VO3A 4XHKB 3ZCLA 3RKBA 3PVUA 4FKGA 4F1OA 5E9EA 2I0EA 3FI8A 5EI2A 4UMPA 3RPVA 1KOBA 5H8BA 1JVPP 2A19B 2XK3A 4FI1A 3HYHA 2P3GX 3PJ3A 3ZUVA 5KHXA 2UV2A 5DT0A 4ZK5A 2O8YA 3HA8A 5J87A 5FQDC 3QQFA 5M51A 1PY5A 1P4FA 3FL5A 3NPCA 4L00A 3QYZA 4W8DA 2WHBA 4C57A 4BVUA 4E73A 4LM5A 5CF5A 4V0GB 4NEUA 4DEBA 5JFXA 2QLUA 4RIYA 5HCYA 2NRYA 3DFAA 4J7BA 3CCNA 1VYWA 3COIA 5IUHA 5HIDA 2KULA 4KSQA 2JITA 3LJ2A 4QMQA 2ZB0A 3TJCA 3OEFX 4ACCA 1Q8UA 3HV6A 2VTQA 3LCDA 3ATSA 5IA5A 4J8MA 3EL8A 3GUBA 3FHIA 4APCA 4DINA 4FYOA 5IPJA 5HORA 1YOJA 2UW0A 5CT0A 5J1VA 1QL6A 3OXZA 3EQDA 5D9HA 4FNWA 2PMLX 4LRMA 3OWPA 3TEIA 2OIQA 3FMHA 1W0XC 4RGJA 3A8WA 5EYMA 3RZBA 5AA8A 3KXXA 3FSKA 3ZO2A 5IEXA 3ZLXA 3RI1A 3QD0A 5ANDA 4L44A 1JOWB 3C7QA 4HW7A 2F57A 2V0DA 3TCPA 5M4UA 4WRGA 4WBOA 3JVRA 3SLSA 2B52A 2XKDA 4YHJA 5HCZA 5CEIA 3F66A 1SYKA 1YXSA 4KIPA 1OKWA 3QD3A 5BVEA 4BDFA 2IG7A 3QZGA 4R3CA 4JQ8A 4ORKA 2X4FA 2BFXA 2ETRA 4AAAA 1YHVA 3I81A 4FTOA 4MHAA 4R1VA 5L4QA 3EQBA 2YITA 3LMGA 4BDIA 4E4MA 3VUHA 3QD2B 4QTBA 3K5VA 2XNGA 4TY1A 4Q5HA 3R8UA 2JC6A 3KY2A 3R2YA 4Z3VA 1H0VA 2C0TA 4FK3A 4IWQA 4FEWA 4PWNA 2WXVA 4FIJA 4RWIA 4C35A 5CAQA 3UQFA 5GIPE 4FSRA 2BDJA 3HV4A 1JKKA 3TXOA 2ETKA 3DKGA 4MNEA 5EOLA 4MXOA 3RALA 4GEOA 3TM0A 4NCTC 3TKUA 2J6MA 3SV0A 2YWPA 4ZY5A 5JRQA 4KRDA 3FLNC 2VX1A 3F61A 2XJ1A 3QC4A 1FOTA 3WARA 4EHEA 2XK7A 2C6DA 3ENMA 5GZ8A 2C5NA 2RL5A 3JY0A 2BRHA 3LIJA 4RIOA 3W1FA 5M08A 3VS4A 4CFXA 2HK5A 2C6OA 1QPJA 5M56A 4UBAA 3PRFA 1IASA 3QXPA 3R7GA 3K3IA 1KE9A 3AT4A 3U51A 2WAJA 2CSNA 3A2CA 3Q9ZA 3DNDA 4NUSA 4P5ZA 4S30A 3LFAA 3Q9XA 3DZQA 5D1JA 2HW7A 2I0VA 1PMVA 4IVDA 1WCCA 3PTGA 3MA3A 4GK4A 3RAWA 5K9IA 3EZRA 3R8VA 3VHEA 2C6TA 2Z7QA 3TV6A 4E6CA 2RF9A 2BMCA 3GU5A 5HG9A 2WNTA 5EQYA 5CS6A 4TNDA 5CALA 1OKYA 4YJQA 3FQSA 4DH5A 2V7OA 2PZPA 3IECA 4MF1A 4O0TA 3VUIA 5L8LA 4PDYA 3MB7A 5GJDA 3F3TA 2WTVA 4NKAA 2HXQA 3QFVA 4HGLA 2J4ZA 5CX9A 2C3LA 4D9UA 3H4JA 3D2IA 5CVHA 2PVLA 4CT2A 2XRUA 2VU3A 5D7AA 3U9CA 2JAMA 4OTHA 3KVXA 4FL1A 4BCPA 3UJGA 4KABA 4C4EA 3PP1A 4APPA 2FB8A 4O83A 3U6HA 4FIEA 4CV8A 1SNUA 5IUGA 5HX6A 5KUPA 3VAPA 3PSDA 5ETCA 3PLSA 4FT5A 4CVAA 2C68A 5CYIA 4YNEA 3K3JA 3EQGA 4RX8A 4ZMFA 3UMWA 1AD5A 2HWOA 1M17A 3MJ1A 3PE2A 4BBFA 4I0RA 5CAUA 2XM8A 4OW8A 4BIDA 3C4WA 1OPLA 2REIA 4BCQA 1UKIA 5JZNA 3OWLA 3TUCA 1KE7A 4PMTA 2ZB1A 3KULB 4RFYA 2P4IA 4UMQA 3IW7A 3NUYA 3UO4A 3T9IA 3GCUA 4QMVA 5E91A 2HZIA 3ZOSA 2ZDTA 4G5PA 4G34A 3R1QA 4PDOA 2OH4A 4MYGA 2B55A 3FLWA 3MJ2A 5GIOE 4WRSA 2YJSA 2OF2A 5DRBA 3C50A 2C0OA 3POZA 2B7AA 4NJ3A 2O0UA 3DLZA 5E8ZA 2NRUA 4J99A 3KEXA 5HKMA 4AOTA 4CD0A 4BCIA 4ZSAA 2OW3A 5C4KA 1B6CB 3QTWA 4R78A 3QTIA 2R3GA 1U59A 4JVGA 1VEBA 4RIYB 5H8GA 2EWAA 3UYSA 3KRWA 4IADA 5B7VA 4KBKA 4Y8DA 3ROYA 3FLYA 3M11A 3UBDA 4CMUA 4E6AA 2RG6A 2PVHA 2ZMCA 2PZYA 4FSYA 3CJGA 2QKWB 2WZJA 3UNKA 3R8LA 5BVFA 4FVRA 4D2RA 2E9PA 3NW7A 4LL5A 1OPKA 3R02A 4YLLA 4ASEA 3LKMA 1R78A 5HBHA 4FUXA 5ETIA 3IDBA 4I4FA 4CFUA 4QYFA 4XP2A 2V7AA 4FTRA 3DDPA 4IM2A 4Y46A 2GPHA 3ORPA 1VR2A 2R3PA 3HDNA 4ASDA 4EK6A 4HVIA 4WO5A 1DAWA 4QPAA 1IAHA 2VRXA 2HOGA 4YUQA 3FC1X 2Y4IB 3NRMA 4Y83A 3AC8A 4YJPA 3C1XA 3ZDUA 4BDHA 5K0XA 4U44A 3LHJA 4QNYA 5IQIA 3OCBA 1Z57A 2PUNA 4MAOA 3R30A 4G5JA 3KN5A 4FTUA 1UU3A 2UZUE 3OCSA 5IQHA 4R3RA 4C2VA 4X2NA 2YFXA 5M06A 3ACJA 5KZIA 4XG8A 1PHKA 4HVHA 1PKGA 5T68A 4Y5QA 5HEZA 1ZY5A 4LOQA 1XHAA 5K4JA 4NL0A 3FZSA 3BGQA 4FTNA 5CASA 4UXQA 1Q41A 4IX5A 1ZYCA 5IH5A 5LWMA 4IM0A 4FV2A 4TTHB 1PMEA 2R0IA 3GCSA 2ZV7A 4ZJJA 1H1QA 2YIYA 4BCFA 4BTMA 2PE0A 4QMLA 4TWNA 4F9WA 3QU0A 4QP6A 3DXPA 2PSQA 2QG5A 5DWRA 3UQGA 4PNKA 3E87A 5HU9A 3QKKA 4MX9A 3ZC5A 3RPYA 4MNEB 1XH5A 2BHEA 2R3QA 3KCKA 3BU6A 2XNNA 5TF9A 3TJDA 4AZVA 5LXMA 4O82A 3R7IA 3ZO1A 5CSHA 4IEBA 4AGUA 4EJ7A 1DM2A 1ZYLA 1VJYA 3LFBA 3MH1A 3SRVB 4EH8A 5EM5A 4EH4A 5LVOA 4U81A 5TR6A 3TDWA 4HOKA 4UMTA 4KKGA 2A0CX 4NW6A 5FTOA 3LCKA 4EK4A 4F0GA 2WFYA 2BRBA 2I0HA 3EJ1A 3DQXA 5HICA 2YM6A 3I79A 1O6KA 1YDSE 4IAZA 4ONAA 2GQRA 2Q83A 1XH7A 3PSBA 3KB7A 4XG4A 2FUMA 1KE8A 3SXSA 3WZJA 2XIZA 4ANQA 2C47A 3F5GA 3PJ2A 3EFJA 3QQGA 3H9FA 1Q99A 3CKXA 4JQ7A 4UB7A 4XP3A 3ZU7A 3N4TA 3QD4A 4PQNA 1V1KA 1ZZLA 3CP9A 5AR4A 2XBJA 4CFNA 3HMIA 3OUKA 1GZOA 2IVSA 4DFBA 5B2KA 3MDYA 1XBCA 5E92A 2QOHA 5IQCA 4DEEA 4YTHA 2I0YA 4LQMA 1BMKA 4CV9A 5FXRA 3G2FA 4EJNA 5AM7A 4C38A 3ZLSA 3ZZEA 3NW6A 4XRLA 5IZFA 5IKWA 4YTIA 4X2KA 2WPAA 3EB0A 4HPUE 2J0IA 4I6BA 2C5VA 3ZHPC 4FKJA 4C37A 3U55A 4GYIA 1TQPA 5HE1A 4RG0A 3D4QA 2W06A 2VTIA 3KCFA 3V5TA 4DEDA 3R01A 2CNUA 4C3FA 4AZFA 4EWQA 4DF3A 3UO5A 2R3NA 3OVVA 1CM8A 3RPOA 4FV1A 4ERWA 1RJBA 3QWJA 5AR8A 2UVZA 4NTTA 5FM2A 4LL0A 5CSWA 3TNQB 4B7TA 3PXFA 4G3EA 4UYAA 4I0SA 2WMVA 5HNBA 3MVLA 3M1SA 3WF8A 3BYMA 5CSVA 5AP4A 4FZAB 3VHKA 3QCQA 4FBXA 4E4XA 2YDIA 1Q61A 2YACA 3QCXA 3MA6A 3GU4A 3DBEA 4FTIA 4XUFA 4IIRA 5AP1A 4AN3A 3RINA 3LFNA 3GC9A 2WMXA 5E8TA 4C0TA 3V5QA 2DS1A 4I21A 4NM0A 4EC9A 2R3RA 2JD5A 3AC3A 2OZOA 3LCTA 4U45A 2YAKA 4K8AA 4TNBA 4KKHA 3R9OA 3U87A 3WE8A 4DBXA 3GC8A 5DR9A 1XH4A 5D11A 3PP0A 5A4QA 1OIUA 4FV0A 3VF8A 4A9UA 5CEOA 1JAMA 2VZ6A 5CF4A 5D7VA 3UG1A 3FBVA 2ONLA 4FG7A 3DBDA 3L8XA 3UPXA 4Q9ZA 2P33A 2XK9A 2WIHA 3KKVA 3ETAA 2BZKB 3ACKA 1ZOGA 5AADA 4F6UA 3E64A 4RQKA 2YA9A 4X6QC 4BI0A 2IVVA 3FI3A 2V62A 2ITQA 4JDHA 4RX9A 2W5HA 2YM7A 4NU1A 5CANA 1CMKE 1V0OA 1E9HA 4PF4A 5GZ9A 4WIHA 5HO8A 2J51A 3FMDA 4HJOA 3KXGA 2WMUA 3QZFA 4JBPA 1FVRA 3UIMA 3ZMMA 2PU8A 4JQEA 2YDKA 3GFEA 1F5QA 1YWNA 1GIIA 2XYUA 2QONA 3L8VA 5IU2A 4A9YA 3SG9A 4YTFA 4H39A 4KB8A 3DCVA 2GNGA 2ITUA 4JRVA 5AV2A 2YIQA 4HYHA 3PDTA 5ETAA 3AOXA 2HENA 5KMLA 2XIYA 2R3KA 1F0QA 4EI4A 2WB8A 2CDZA 4PTEA 4LV8A 4FSWA 3E3PA 2PVFA 4UYNA 4Q2AA 4YZ9A 1Y6BA 3LFDA 2OSCA 1ERKA 3E92A 4LGHA 4BBEA 3NIEA 3WZKA 2GHMA 1YQJA 4FIHA 3ANRA 1J7IA 1Y8GA 4RFZA 4I5HA 4II5A 4EL9A 4W4VA 3GCQA 1XWSA 4L7SA 4ALWA 2QC6A 2X2MA 3ODZX 4R6VA 4RPVA 1W84A 2GNIA 3O51A 3KMMA 2X7GA 5D12A 3FKLA 4A4LA 4C02A 3R7YA 3ZFYA 4MK0A 4E4LA 5E8UA 5F1ZA 5I9UA 4FZ6A 2QU6A 2WTDA 3C9WA 3FKNA 5EHYA 3UZPA 4JT3A 4F6WA 3UC3A 3ATTA 2J50A 3ROCA 3G9LX 4K11A 4U6RA 5ACKA 2YCQA 1WBVA 4X2JA 2CCIA 2IWIA 2XNMA 3QHRA 3TWJA 2RFSA 3F5UA 1Y91A 2YABA 3HVCA 4NCTA 2XKCA 3RM7A 4P90A 3TNWA 5KMNA 2PUPA 4JLCA 4XG7A 1MRVA 4XG3A 3T8OA 3F6XA 2FH9A 2JDRA 4RC2A 3SOCA 4E5BA 5BMSA 3OY3A 1J1BA 4BTFA 3DDQA 1LUFA 4RJ4A 5AMNA 4CFMA 1SVEA 2G1TA 4RA4A 2WMBA 2V5QA 4RZVA 4FV5A 2BDFA 5FRIA 4BB4A 2ITXA 4CMTA 3PLAE 4IWOA 2A27A 4BZOA 3TZ8A 3PY3A 5CT7A 4DA5A 3V6RA 2C3IB 4IVAA 3VBYA 2YJRA 4HGTA 3VQUA 2XCKA 4UZHA 3RK9A 3LFEA 1P14A 5BNJA 3DLSA 2IZUA 1WBSA 2VGPA 5CZHA 5HCXA 5KZ0A 4R7IA 3Q4TA 4KBAA 5AX9A 2BTRA 2IVUA 4J53A 3PA4A 3A61A 2Y6MA 3A7JA 4D2VA 2GQSA 3COKA 3IS5A 4O2ZA 2VNYA 4F99A 3OXTA 4DFNA 3CY3A 2NO3A 3GI3A 3EYHA 4IJ9A 4EH7A 3BWFA 2YWVA 4S32A 4IB3A 3SAYA 4N4SA 1OL1A 4FEUA 3B8QA 3AT3A 3II5A 5EW8A 3P0MA 5CEQA 3DTWA 3KF4A 2FSTX 3UODA 2PMOX 3KF7A 4GK2A 4K18A 2B1PA 2IW9A 3TUDA 3A62A 3DTCA 5M4CA 1GY3A 4YBKA 1WBTA 5CTPA 2KTYA 1E1VA 4MQ2A 2H34A 4AE9A 3GQIA 4DYMA 3BZ3A 3PPKA 2C5OA 4OBQA 5FXSA 4CQEA 5I9ZA 4AU8A 1KSWA 1FINA 5HO6A 1BYGA 4GV1A 4JR3A 3DY7A 1YI4A 4XJ0A 3I6WA 4BDDA 5LMKC 2JKQA 4LYNA 3ZRKA 3UZRA 4ZAUA 2Y0AA 4X3FB 2YCRA 4AQCA 5EFQA 4ZTSA 4H3BA 4DH1A 4E6DA 2W1DA 3R1YA 5HE3A 1OBGA 3F2NA 3NYVA 4EBVA 2E9VA 1RE8A 5L8JA 1H8FA 1ZY4A 2GS6A 5ANKA 3D7ZA 2X8DA 3SQQA 1JLUE 4M3QA 2HIWA 3HLLA 4YPSA 2UW4A 1UNHA 4USFA 1PRYA 3RBWA 3DNEA 3OC1A 4JAIA 1I09A 5J9YA 3QF9A 3S1HA 4DGOA 2VTHA 4BF2A 4BKJA 4JXFA 2WGJA 3OUNB 3NNVA 2W1ZA 2C3KA 4V05A 2VWIA 4FV6A 5DGZA 3SVVA 4DEHA 3OXIA 1IAJA 3QTRA 3SDJA 2BVAA 3BWJA 4IAAA 3MTFA 1PXIA 2ZYBA 4Y95A 5JRSA 3VRZA 4U7ZA 3ZO4A 4BDCA 4BFMA 4EQUA 4CKRA 5I9YA 3VS3A 3O96A 3F3UA 2YISA 4NH1A 1GNGA 4O0RA 4W9XA 2RG5A 3C0GA 3GCVA 4WT6A 4Q5EA 1JKTA 1G5SA 4G6OA 2AYPA 2QURA 3ORIA 4F70A 3UPZA 4D5HA 3AMYA 5KMJA 4F7SA 4MVFA 1M14A 2V22A 5CNNA 5FD2A 4DEIA 2OICA 4EOKA 1Q62A 3EIDA 3HV7A 4IDVA 3UVPA 4DC2A 4YTCA 3MFTA 3AC5A 4AACA 2XNPA 4EOQA 2YDJA 2Z8CA 5AP3A 3EN6A 2C69A 4QTAA 3V5JA 3ZDIA 4C61A 3QZHA 3DS6A 3UE4A 4BCHA 1OIYA 5JFVA 4RWJA 4O0WA 5GINE 1Q4LA 1H1SA 4QRCA 2BZHB 4DFXE 4EHGA 5FDPA 1FBNA 4O86A 2QR7A 3TT0A 3ALOA 5HU3A 3HP5A 3R83A 4ZJIA 4PPBA 1K3AA 4WD5A 3O2MA 2B54A 4U3ZA 2ITNA 5LCKA 3VN9A 1WVYA 3RCJA 4CNHA 5IH4A 1APME 5HG7A 4O21A 5CQUA 4W9WA 2QVSE 3HAVA 3R63A 3C4EA 4DTAA 3AD6A 3V51A 3PSCA 2ZOQA 2G2HA 1H1RA 3EQHA 4XBRA 1CKJA 4F9CA 1Q8YA 1PXKA 5CAVA 2JBPA 4I3ZA 4XLIA 3HUCA 3W10A 3O50A 3LJ1A 3QRIA 3TL8A 4XG9A 4EKLA 2P2HA 4QMXA 4JS8A 3R00A 1SMHA 2UW3A 4AZEA 2EB3A 5EDRA 5EM6A 3RP9A 4BDBA 4C7TA 4FZDB 4FSTA 4GJ2A 4PTCA 5E90A 4DITA 3ALNA 2J0MB 3THBA 3UZTA 3LZBA 4J98A 2WQEA 3PPZA 5E8VA 1PXLA 2YZAA 4ZSJA 4KS8A 5HLPA 4YZBA 2DQ7X 1RDQE 4RIXB 2F2UA 1R3CA 3E5AA 3MVMA 4HCUA 3V5WA 3TV7A 4F08A 1W82A 3BQRA 4TYHB 4OTRA 2UZWE 4ACMA 3K5UA 3R28A 4QTDA 3ORKA 4DBNA 3KQ7A 3P08A 5I0BA 4YLKA 4D2PA 3IG7A 2BDWA 4IB1A 3I7CA 2PWLA 4ZY6A 4A06A 4YR8A 2HZ0A 3FLQA 5A4CA 4I1ZA 3LFCA 4BYJA 3K54A 4U79A 1Y57A 2R64A 4FR4A 5IMXA 5E8WA 3OEZA 4FKSA 4OTGA 3FZTA 3O7LD 3BCEA 3O0GA 4JDIA 5A4EA 1IEPA 3EHAA 3QRTA 4MBJA 4CKJA 1Q5KA 5FDXA 3DAKA 5AUUA 4MXZA 5HLNA 5H8EA 2PULA 2VUWA 2W96B 4BI1A 2RSVA 3TZMA 3JR1A 4PMSA 4CT1A 5AV3A 5HVYA 2WO6A 1FQ1B 4CCUA 4DG0E 3UQCA 4CZYB 4CRLA 4EWHA 4LOOA 3ZEWA 2OWBA 5EQEA 3WYYA 3V6SA 4HZSA 4AXAA 3R1NA 4C4JA 4H3QA 2IZRA 2CNQA 3OW4A 4E5AX 4FV7A 2X8EA 3EMGA 4G6LA 5CI7A 3MSSA 2V55A 5M57A 5I3RA 5M53A 4I94A 2CKQA 4RVTA 3CPBA 1R0EA 4FV3A 2BKKA 2VN9A 2WTIA 3VW8A 4CSVA 3QQKA 1ZYDA 3QL8A 3VF9A 2RIOA 3R8ZA 3VBQA 3ZYAA 3LE6A 2PK9A 4X0MA 3UIXA 2EB2A 4QMPA 3KMWA 3BGPA 4AW0A 4RWLA 3D7TA 3CPCA 4XH6A 2XEYA 3W2OA 4QP3A 5HE2A 4E1ZA 5AX3A 4C3PA 3GP0A 4C4FA 4D55A 4GIHA 3CR0A 3FXWA 2B53A 4LI5A 5AIRA 3TNIA 4DGMA 2OIBA 3GVUA 2W1IA 4TZRA 3OOGA 1YDTE 3D5UA 4G9CA 4ZSGA 4KUJA 4CCBA 4FUYA 4R7HA 5J79A 2JLDA 3ID6C 1PXJA 5L2SA 3Q52A 4OBOA 5GHVA 3RAKA 4WSQA 5HHWA 4FTMA 4EUUA 3QBNA 2O65A 3BU5A 2WKMA 1IRKA 1NVRA 2X1NA 5KMMA 3BHUA 4DFUA 4P2KA 4HCTA 1UU8A 2BALA 1S9JA 3F7WA 4GK3A 4WA9A 4ANOA 4YNOA 3EFKA 2OKRA 3MH3A 4FTKA 5FXQA 5CF8A 1SM2A 4WUAA 1OM1A 1YXTA 3E7OA 3NUSA 3Q2MA 4FGRA 4WG3A 1W98A 4K77A 1UA2A 2B4SB 2GS7A 5EM8A 2I6LA 5EDQA 4DFYA 3GOKA 3FHRA 4YJOA 3UVRA 3N4UA 1JBPE 4HVGA 5ITAA 4DCEA 1YHSA 4MD8E 4QYYA 4YO6A 1PJKA 3FQHA 5CU6A 3FC2A 3KU2A 3OS3A 4BCMA 4ENYA 2VWUA 2Y8OA 3FXXA 4J96A 5AJQA 4ANBA 3ZC6A 4XX9A 2UVYA 3A8XA 4FSMA 4E7WA 4XV2A 4EOPA 4YJTA 3COMA 4ACHA 3FYKX 5AP0A 4ZTNA 4M97A 3ZZWA 4I22A 1J7UA 4DCAA 5F4NA 3PXRA 2ZV9A 5TE0A 1PXMA 1F3MC 4MXAA 4MNFA 4DT9A 5KMOA 4D28A 4EYJA 5HQ0A 5B2MA 2X9EA 2B9JA 3UG2A 2VX3A 3SW7A 3EKKA 3HZTA 2QO2A 4FT9A 3E63A 1J3HA 2QR8A 1H24A 4EOSA 2C6KA 3CQWA 3ET7A 3MI9A 3MV5A 3ANQA 3EYGA 1PYEA 4CGAA 4WNMA 3TV4A 4YZCA 1NY3A 3MFUA 3HMMA 3DKCA 1W7HA 4EH5A 2G9XA 5AR7A 2XIXA 3WF6A 4E3CA 2I7QA 2X4ZA 5CAOA 3DA6A 3T3UA 4MKCA 2JEDA 5ANJA 1H08A 3CIKA 4TW9A 4ZS0A 4DHFA 1H26A 3CC6A 2H6DA 5BPYA 3ZH8A 4I23A 4PL4A 4QYHA 3JYAA 4OLIA 3ZBFA 3ZONA 3Q2JA 3D5VA 4QYEA 4O22A 1JWHA 5DFPA 2QLQA 3I4BA 5IQFA 4YURA 5CU3A 2G15A 4KRCA 4FV8A 1ZZ2A 4EQMA 1SZMA 3L8PA 4FZ7A 2RGPA 4U43A 5EI8A 4WKQA 3UOJA 2QOFA 4JAJA 1EH4A 1UU9A 2XIRA 4CRSA 5DMZA 5J9ZA 2YCFA 5BVOA 4I6HA 5C9CA 1H25A 3LCOA 3S3IA 3PIYA 5AUZA 3I5NA 3RK7A 4UWCA 5M09A 4W4YA 4CMOA 2Y6OA 5BX0A 2XKFA 3N9XA 3Q53A 3R7VA 4D1SA 4XBUA 3VIDA 3LFFA 1Q24A 3OBGA 4PL3A 3QC9A 4QMNA 1M7NA 3AT2A 2WMQA 3KGAA 5EYCA 5C01A 4H3PA 4EH3A 2QODA 3NGAA 2BCJA 3HECA 4WSYA 4USEA 3CSVA 5E1SA 5BQ0A 1OI9A 4M0ZA 2QOOA 3FI4A 1JQHA 3GU6A 4RIWA 4FT7A 4F63A 4AOIA 4FKWA 3BLQA 5IH6A 2CLQA 5DPVA 3ZUTA 4KS7A 3WZUA 4JR7A 3RHKA 2OFVA 5CVGA 5CWZA 3AXWA 4RC4A 1K9AA 4ZZNA 3ZFXA 4BDKA 3OCTA 4RVMA 5DA3A 3HRBA 5DOSA 3AC4A 4D4YA 4A9RA 5A6NA 4L43A 2G01A 5CLPA 5K5NA 4EHZA 2BTSA 3RWPA 4Z7GA 2WMTA 1JPAA 4WG5A 4M84A 3FMNA 3RNIA 5LMKA 3M2WA 2VTLA 2WU6A 3R7EA 3UVQA 4K33A 2OJGA 4O0UA 4DGNA 5JK3A 2O3PA 3CJFA 2JDTA 3DB8A 4DEGA 4DTKA 2G2IA 5HD4A 3CQUA 5L6WL 2BAKA 4AA0A 3ORLA 4K9YA 5LVLA 2BAJA 1OIQA 4JI9A 2VWBA 4AP7A 4AS0A 2YM3A 2VTMA 1H1PA 4Y85A 4CYJA 4EK3A 1L8TA 2NPQA 4G3GA 1GIHA 4AZSA 2QI8A 2W4OA 5AAEA 5C8MA 5CF6A 2W1GA 3NUPA 1PXPA 3T3VA 4MTAA 5HTCA 5BVWA 2YIRA 4PRJA 3BYUA 3VBXA 1YOMA 4Z55A 2HZ4A 3VUMA 3ELJA 5IEYA 3SKCA 1URWA 4O7RA 1XKKA 3E62A 4AFEA 1Y8YA 2QG7A 4FSZA 2GNHA 3VUTA 2YEXA 2XKEA 3P7BA 4UMUA 4NZWB 4OTQA 1OB3A 2F7ZE 4RJ3A 4DGGA 2PPQA 2W1EA 2GFSA 2I40A 1R39A 4IHPA 3PG3A 1V0BA 3G5DA 1XBBA 3BYSA 2UW6A 3PRIA 4QMUA 2W1HA 5HESA 4QMSA 4ALVA 2BIKB 4I92A 2XK8A 3UC4A 4R5YA 4EEVA 1FGKA 1U54A 2C6LA 4I5MA 2O63A 4C62A 3CD3A 2WQOA 3BKBA 3F2AA 4JJRA 3IPHA 4ZOGA 5DG5A 3F3WA 4HVDA 2Z7LA 4W8EA 5I9XA 4OAVB 4GKHA 4O0XA 3CEKA 3PJ8A 2CJMA 5HIEA 5CXZA 4XG2A 4ZTRA 3PXKA 4GFGA 4G3FA 4GG5A 4TPTA 4TWCA 4LGDA 1IG1A 2JKMA 4AZTA 3BHTA 4C36A 4F65A 5L3AA 5LMBA 3WI6A 4BC6A 3PWDA 4O38A 3FSFA 4QMZA 4C8BA 4A9TA 1O6LA 3ZM4A 4AGCA 5EQPA 4YP8A 3QLGA 4QTEA 5BUEA 4MCVA 1P2AA 3ZEPA 2C4GA 3HUBA 1HCKA 3DK6A 2B0QA 2AC3A 3JUHA 3PXYA 4NM5A 4O6EA 2WMAA 4AUAA 4X21A 4AW5A 4MBLA 3OW3A 4GT5A 1J1CA 3DOGA 5A4TA 2O2UA 1Q3WA 4O1OA 3CQEA 2XBAA 1PYXA 3MPMA 4FTQA 1CKPA 4GW8A 1H28A 3E8DA 3PXZA 3MB6A 3W55A 3FZ1A 5FTQA 2C6IA 2J5FA 3SXRA 4G3DA 1H00A 1KV2A 4ZSEA 5TKDA 3VNTA 4AX8A 5AP6A 3LVPA 1JSVA 1R1WA 5HZNA 3MBLA 4D0WA 4JG7A 4ZMEA 4IZ7A 3BLHA 2W17A 4TKSA 5ACBC 5C8KA 5IQEA 2VV9A 2GU8A 3GENA 5CU4A 1RW8A 1U4DA 1XH6A 3MVHA 3R9NA 4FV9A 4XEYA 5AIKA 3ZS5A 2VO7A 3MY1A 3JXWA 5G6VA 4FKRA 5I4NA 4NK9A 2R3HA 1O6YA 3LFQA 5F20A 4FK6A 5C27A 3SC1A 5BUIA 2FSOX 2W5AA 4ZEGA 5AWMA 4R7BA 5HTBA 2WD1A 5AUWA 4FNZA 5EK7A 3P7AA 2C6MA 3GXLA 3FMKA 4IJPA 5A6OA 3FUPA 1WZYA 1XH8A 2DUVA 4GCJA 3GT8A 4RZWA 2C5XA 2EXMA 3NIZA 3OWKA 3CTJA 1Z9XA 4OBPA 3RNYA 3JPVA 3C5IA 2QOQA 2WIPA 1PF8A 4LMNA 3S2PA 4WNKA 5B0XA 3IQ7A 5E7RA 1YDRE 3BRBA 4FMQA 2H96A 3PJ1A 3TKIA 3A60A 3G33A 4N57A 2RFNA 1YRPA 2VTAA 4CLJA 3C0HA 1PKDA 5G1XA 3V8WA 4EOJA 3IO7A 1A9UA 3LXLA 2PMNX 1U5RA 5D10A 5CEKA 4BR3A 2VWVA 5A4LA 1YWRA 2YERA 5GNKA 2HCKA 5CENA 3MS9A 3NNUA 4RIWB 3E8EA 3PWYA 4BN1A 2PE1A 4Z16A 2WTKC 4CZUA 3DPKA 4IAYA 4YJNA 3ZSIA 2GSFA 3FJQE 4LRJA 4O0YA 3QTXA 3RTPA 1MRUA 1XO2B 1P5EA 4X6RA 3W2PA 3R8PA 2LGCA 2UUEA 4K6ZA 2IO6A 4KIOA 3W8LA 1J7LA 2BZJA 2X2KA 2H8HA 4KWPA 5CXHA 5E1EA 3TTJA 3VS1A 4I20A 4BZDA 5IA3A 2W1FA 2UW5A 1URCA 3KVWA 3R0TA 5HG8A 3C51A 5C26A 2HZNA 5LOHA 1WFCA 3QA8A 4FL2A 3MFRA 3ULZA 4CFVA 4C4IA 3RGFA 4V04A 1SNXA 3O8UA 4OTWA 1PMNA 4XOYA 1A48A 5CZIA 3FE3A 4AW2A 5L2TA 4GG7A 4JIKA 3V04A 1OBDA 5FEQA 4A7CA 2ITZA 2XNBA 3ZRMA 2CMWA 2X6EA 4MD7E 4NJDA 4Q9SA 3NWWA 4EZ7A 3QXOA 1WBOA 1QCFA 3F88A 4A07A 3FMLA 4RJ5A 4IACA 3PVGA 4RFMA 2YM5A 1ZWSA 3K2LA 2O5KA 4O2PA 3DAEA 4C58A 2OU7A 3DJ7A 3DK3A 4M0YA 3SG8A 3ZXTA 4BDJA 4DGLC 4M8TA 2Z2WA 3QKLA 3GB2A 3IOKA 3H10A 4FTTA 2W4KA 4LMUA 3NUXA 5EHLA 5C03A 3E93A 5KKRB 1H0WA 2OJ9A 4BGQA 4UMRA 2JAVA 1A06A 2UZEA 4JX7A 4ZP5A 3EN4A 4UX9A 3DZOA 4ZS4A 4AWIA 2BIYA 2VWZA 1G3NA 2UZNA 3ITZA 4H36A 4IB5A 1CTPE 3FLZA 1PW2A 3TG1A 3U9NA 5JZJA 2BAQA 3PE1A 2J0JA 4X2GA 1H1WA 2SRCA 1U54B 3KXMA 4H1MA 4TRLA 3EL7A 1MQBA 4FKQA 4FX3A 4RX7A 4WG4A 3BYVA 4QP8A 1ND4A 3U4WA 4FZFB 4IX4A 2ITVA 2HYYA 3LXNA 2W9ZB 2PZIA 2XMYA 2WQMA 2UZVA 3AD4A 2R3OA 2OG8A 5E4HA 1LEWA 5JGAA 1W8CA 2PE2A 2X7FA 4BGGA 4X3JA 1NA7A 4QQ5A 4BHZA 4YPDA 4BCKA 1OKZA 1TQMA 2VTNA 4DH7A 3SOAA 3D0EA 5LMAA 3UP7A 3PIZA 4BY9E 4HGSA 4CTBA 2ACXA 5M55A 4PDPA 3C13A 2RFEA 3OP5A 3ZSHA 3HV5A 2XK6A 2ZVAA 5AUYA
chains in the Genus database with same CATH superfamily
4Y72A 3NUUA 4QP7A 4ALUA 3E7VA 5AV0A 5K5XA 4DG3E 3ORTA 4I6QA 3RHXA 4YO4A 2W5BA 3SHEA 2OGVA 4AT3A 5J9LA 3WILA 3RM6A 4V0GA 3PA5A 1CSNA 3G9NA 1ZOHA 2XNEA 1ZMWA 1VLRA 5AAFA 2R3LA 4FYNA 4TL0A 3OZ6A 4R5SA 4B0GA 1E1XA 2LAVA 4D1XA 2XJ2A 2OXDA 2EVAA 2PY3A 3JY9A 2DWBA 4BKZA 3FZPA 4FGBA 1AGWA 2PTKA 3I7BA 3M42A 4NFMA 3VJOA 2ITOA 1GZNA 4EH9A 4FKLA 1QPEA 2XP2A 3G0EA 4O7TA 4XLVA 4FG9A 3BLRA 2X81A 5DBXA 5A14A 1FVVA 2R9SA 3H9RA 3LM0A 2FSMX 4ZTLA 3S95A 3ZLWA 4PP9A 4RX5A 3D94A 3OWJA 1HCLA 4KSPA 3ZBXA 2QOIA 4AGDA 2BRNA 3SGCA 3WYXA 4FE2A 3L9PA 3SW4A 4PY1A 2F7XE 2NYAA 3OTVA 4IZAA 4J97A 1T46A 4O27B 3V01A 4QT1A 1OUKA 1NXKA 2UW8A 1BL7A 4M68A 4BDGA 3QUPA 4L45A 3VUGA 1KWPA 2XIKA 4J95A 4I6FA 2HY0A 3OG7A 2YLEA 1ZARA 2JFLA 3Q4CA 4QMTA 3G15A 4MXYA 3BV2A 3Q6UA 3D9VA 4O6LA 1GJOA 4NT4A 3D5WA 4GH2A 4Z9LA 2GFCA 3W33A 3ENHA 4G9RA 4F9BA 3QRJA 4E6QA 4RQVA 4AG8A 1XBAA 4RJ8A 2BFYA 4FL3A 3UOHA 3HNGA 2IPXA 4ZTMA 3MESA 5DRDA 4FSQA 2G2FA 3NDMA 4IM3A 3QCSA 1H27A 4U9AA 1YHWA 1FPUA 4CG8A 1NVSA 4I5CA 2IJMA 4ACGA 5TT7A 3ZUUA 4HGEA 2IEWA 1XR1A 5FM3A 4ANSA 3IONA 5CEMA 5DEWA 4UV0A 4C4HA 4FKTA 2Q0BA 2OH0E 3IW4A 4FEXA 2QOLA 3DKFA 4N6YA 3TDVA 5LARA 2CNVA 2XVDA 4CEGA 4DN5A 4PMMA 1OITA 5AP2A 4YJVA 4R1YA 4XMOA 5DH3A 5HOAA 5HBJA 3QGYA 4H1JA 2FO0A 2IW6A 1G8AA 3LOKA 4Y73A 2ZV2A 2XH5A 3FMJA 3A7GA 4TN6A 2GMXA 2ESMA 4FG8A 4XCUA 3R9HA 3W2SA 3W32A 1LR4A 5CVFA 3BHHA 1FMKA 3OCGA 4YC3A 2OXYA 4D4SA 5L2WA 3VC4A 1G8KA 4UALA 4D2SA 3HGKA 4ITIA 5DI1A 1YI6A 2EXCX 3QX2A 5FEEA 3KRJA 1Q8WA 2VX0A 2ZMDA 3Q5ZA 4FKUA 4L6QA 4O81A 3U54A 5FTGA 3GU8A 5AUXA 3DXQA 4RT7A 3U6JA 1UNLA 2Z7SA 3DJ6A 4ASZA 3BEAA 4V01A 4DAWA 3VS2A 2HELA 4L67A 4M69A 3SA0A 3Q4UA 3WOWA 3R04A 5ANOA 3UDSA 2OJJA 3FZRA 4K0YA 4WNOA 4O7LA 2XM9A 3QQLA 4ITHA 3TZ9A 4BZNA 4ZLOA 3UOKA 3WF5A 5EDPA 2QHMA 2XK4A 4QEBA 5GZAA 3UNZA 3VQHA 3TNPC 4QO9A 4L3LA 4IWPA 4LG4A 4B8MA 4JBOA 3DJ5A 3EN5A 4EQCA 4GVAA 4YC8A 3P4KA 5AUTA 1OPJA 3NAXA 5AM6A 2PL0A 5AR2A 1ZYJA 4G1WA 4F9YA 5DLSA 3VBWA 2X0GA 1MRYA 3DBFA 4FNXA 4L7FA 4D9TA 3LFSA 1YW2A 4W4WA 3MGYA 4PMPA 1K2PA 3A4OX 3VW6A 4D1ZA 4D58A 4GIIA 2OI4X 4UXLA 4X3FC 5CSPA 4NTSA 4QP4A 5K4IA 3RAHA 4TT7A 3ERKA 5FBNC 4IMYA 3SX9A 3ULIA 3U6IA 5M07A 2W0JA 3P79A 3F7ZA 4JBQA 3AQVA 2ONLC 5IQGA 3R7UA 4PX6A 1Q8ZA 1W2CA 4M14A 4ZJVA 3EZVA 3EN7A 4O7YA 2WELA 3AMBA 1OVEA 3P7CA 4O91A 3CE3A 3NAYA 2PVKA 4DDGA 5B2LA 1TQIA 5A9UA 2YAAA 1OIRA 2WTCA 3Q32A 3F82A 1YWVA 2WTWA 3BQCA 2PVJA 4O96A 3O5AA 4FEVA 2QO9A 3IOPA 3HMNA 4EHVA 2Y7JA 4PL5A 2OFUA 4PPAA 4U3YA 3BEGA 2PHKA 1VYZA 1WBNA 4RVLA 3MW1A 4FKPA 4JIAA 1FVTA 4F0IA 5F94A 3RAIA 3ORNA 4JRNA 1Q97A 2VTSA 4XP0A 1JSUA 1YXVA 2C5YA 3E3BX 4I0TA 1ZMUA 3AMAA 2VWYA 3Q04A 4RMZA 5GJGA 2F49A 3RJCA 4O7NA 4YC6A 2QU5A 4AAYA 3R8MA 3LLAA 3HRFA 3R21A 3A99A 3GNIB 4EOMA 3FMMA 4BHNA 2VGOA 1XQZA 1XJDA 3G6GA 4RSSA 3VS5A 5BMMA 2OK1A 1TKIA 2XARA 4KIQA 3ZTXA 3VULA 3DT1A 5EW9A 4ERKA 4EOLA 2HY81 2OO8X 2C0IA 2BROA 5EKOA 5EW3A 5FLFA 4GFMA 2A4LA 3Q4ZA 3KRRA 3W0SA 5J8IA 5IG1A 4O7SA 3ORXA 3MTLA 3QKMA 3R2BA 4NW5A 3MN3A 3LQ3A 1STCE 2ITYA 4FTLA 4ANMA 4BJJA 2XZSA 2PVMA 3AD5A 4EONA 2YM4A 4L01A 5HBEA 3IKAA 3NW5A 4L46A 3RWQA 4FOBA 3CD8A 2VTPA 3NCZA 4YMJA 1OMWA 4G16A 2QOCA 4AGWA 1X8BA 4OTIA 5JKGA 3LM5A 4XNEA 4YHTA 4QYGA 2GHGA 4GUEA 4R77A 3C0IA 3Q9YA 4QMMA 3PPJA 4CLIA 3OT3A 3RPRA 5JFWA 4B6LA 2GCDA 4GT3A 3WE4A 5FUTA 1W83A 2HXLA 2CHLA 4P4CA 3U4UA 4O1PA 2JDOA 1P4OA 2JKOA 3CLYA 5DE2A 4LV7A 2OIDA 3S4QA 1B39A 5IDPA 5L2IA 1G8SA 2C1AA 4JG8A 1QPDA 3U8WA 4PV0A 4ACDA 5F9EA 4J52A 3R7OA 2F7EE 2R7BA 3CKWA 3GGFA 2HW6A 3RVGA 3SRVA 4ZY4A 3GBZA 1WBWA 3WBLA 1NW1A 1RQQA 4ZSLA 5EH0A 3CS9A 5L8KA 4NSTA 1VZOA 2P55A 3BHYA 2ZM3A 3I0OA 3NNWA 4FRFA 1AQ1A 3Q60A 5LQFA 3LPBA 4BWKA 3FEGA 2XYNA 3HRCA 4FVPA 3KREA 3MWUA 3NX8A 4FIFA 3DAJA 1OKVA 2ZAZA 3GEQA 1UVRA 5DR6A 3KFAA 1DAYA 4FSUA 4E5WA 5D41A 4C2WA 1IR3A 4N0SA 4GL9A 4ANNA 4LFIA 4E26A 2R3JA 2JIUA 1Q8TA 2J9MA 2VWWA 4P5QA 2JFMA 4YZMA 4JG6A 5ANEA 4FKOA 3W18A 2OJFE 5A3XA 4G2FA 4IC7A 5JFSA 2X0PA 5CAPA 3FY0A 1JSTA 3FPMA 4X2FA 3CGOA 4QMWA 3DBQA 3OHTA 4NKSA 3UP2A 3W2QA 3VS6A 3W0RA 2A1AB 3Q3BA 2QOBA 4OT5A 3UYTA 1ZAOA 4B4LA 4F9AA 4PPCA 1QMZA 2GNJA 2W9FB 4F6SA 3ZO3A 4JX3A 4M15A 4OGRA 2XANA 4M69B 5KMIA 2WMRA 2J2IB 3O8PA 2J0LA 4JBVA 5AV4A 3LJ0A 3P78A 3P5KA 1J91A 5EI6A 2F4JA 5M44A 3KK9A 5C8NA 4GMYA 4RA5A 4LUDA 3EQPA 2WQBA 3W0MA 4F0FA 2VTJA 5IUIA 5C1QB 1OL6A 3E88A 3PXQA 4IFGA 3WIGA 3I60A 5CEPA 5JN2A 3NFFB 5JEBA 4P7EA 4DFZE 1ZOEA 3NR9A 2UZTA 4EZ3A 3TI1A 4G3CA 4AF3A 5HX8A 4E8AA 3DBCA 2ITTA 4BIEA 4GKIA 4K2RA 4BI2A 4UWYA 1KOAA 3V8TA 5TOZA 4FSNA 3FAAA 2EU9A 2PVRA 1REJA 5CSXA 1KE5A 3V5LA 5HLWA 1YVJA 4QMOA 4K1BA 3C4CA 2YZLA 2VO6A 4O0VA 4DLJA 2Y9QA 3NUNA 3NVKI 1OUYA 2BRMA 2ERZE 2YCSA 1OGUA 3FMEA 2QQ7A 4HYIA 5I9VA 3AC2A 3EQFA 4AA5A 4YGAA 3GU7A 2H9VA 1R0PA 4IFCA 1S9IA 3GC7A 1YOLA 2OXXA 3BYOA 3PUPA 4DTBA 4HNIA 2QHNA 3G0FA 3S00A 1H4LA 2GNFA 2VD5A 3QTSA 3FI2A 5K0KA 4EK8A 5FBOA 4IX6A 4E93A 4HPTE 4RVKA 5EYKA 1TZDA 2XNOA 5CY3A 4D2WA 4PUZA 2IN6A 1LP4A 3EQRA 3KA0A 4J8NA 3ZXZA 2XCHA 3HDMA 3MYGA 3Q5IA 3F9NA 5L6OA 4O0SA 2Z7RA 3W2CA 5T3QA 5BVDA 5KHWA 3ORMA 4GUBA 4U80A 4TWPA 4QP1A 4USDA 4HYUA 3VJNA 4QTCA 3C4FA 3I1AA 4RJ6A 5E8SA 3O71A 1NT2A 3BHVA 3D7TB 4H58A 4OR5A 1KUTA 2XB7A 5EHOA 4F78A 4IVBA 5IF1A 3JVSA 4FT3A 5KBRA 3HAMA 2BZIB 2X7OA 4ASXA 4YJRA 4FIIA 2OLCA 3V5PA 4OAUC 3LQ5A 2YHVA 3L8SA 3PIXA 3V3VA 5A54A 3D2KA 2FA2A 4IWDA 4BWXA 3F3VA 4FODA 3LMHA 5CQWA 5FEDA 1IA9A 4IVCA 2PVNA 4WNPA 3UO6A 5KNJA 3WZDA 4QQTA 3RPSA 4ZZMA 2J5EA 3VUDA 4AFJA 1IA8A 3BX5A 4KKEA 4D4RA 5ICPA 5LVNA 5AV1A 4L8MA 3H30A 3HV3A 3MFSA 3MIYA 3FPQA 4AW1A 4YBJA 5AUVA 4JNWA 4MWHA 4UY9A 3UNJA 3QALE 4U0IA 4DH8A 3ODYX 3AGLA 4BJJB 3OFMA 5ANGA 3SXFA 4CXAA 4BCJA 1DI9A 2GHLA 4E20A 4O7ZA 4I41A 3FQEA 3LQ8A 3KL8A 1KE6A 3UGCA 3Q6WA 4GFOA 2UZBA 3H0YA 4L42A 3GQLA 1B38A 2W99B 2CN8A 3D83A 4WHZA 4M66A 4S31A 1GIJA 3BGZA 3KXHA 4ZXTA 1ZYSA 3A4PA 2XF0A 4M13A 4QP9A 2W7XA 1YXXA 4QOXA 2XRWA 3E8NA 2YLFA 1O9UA 2IZTA 4KIKA 1BI7A 5HNIX 3MVJA 3W2RA 4PP7A 1M2RA 4D5KA 3PVWA 4I4EA 4FF8A 4YSMA 4UN0C 3HX4A 2WTKB 3PZEA 4ITJA 5IA1A 2C1BA 4FKIA 3LLTA 4O7VA 4GYGA 5HGIA 3L9LA 4BRXA 2UZDA 4RBLA 2OZAA 3DQWA 2CN5A 4GS6A 3JS2A 3G6HA 3WF7A 1OL5A 3R1SA 4GU6A 2XALA 4MH7A 5IA4A 4N6ZA 4J1RA 3PY1A 3HP2A 4ZZOA 2E2BA 5J7BA 3QUDA 3W16A 4MXXA 2CKOA 3DK7A 4M7IA 3PZHA 4L3JA 4BCOA 1BX6A 1GAGA 4J71A 4S33A 2PZ5A 2UVXA 4IAKA 3D15A 5EG3A 3QQJA 2IZSA 1ZMVA 3R6XA 4IANA 2GNLA 3OY1A 3ZLYA 5HI2A 4BGHA 3CXWA 4QQJA 5H3QA 4X7QA 5DT4A 1UWHA 4OUCA 2HAKA 2QNJA 4OT6A 4CFWA 3EFWA 4FICA 4AA4A 1HOWA 3TNHA 4G17A 3ZM9A 3TTIA 3IGOA 3NLBA 3OOMA 1ST4A 1DI8A 2W4JA 3FXZA 2VAGA 4NIFA 4F7NA 4AXCA 2J7TA 3AC1A 3O23A 5BUJA 3OMVA 3VUKA 2CGXA 5AR5A 3PA3A 4TYJA 4DLIA 3IW8A 2CKEA 2R3MA 3O7LB 3BBWA 4XS2A 5AP7A 4JMQA 4XV1A 5BV3A 3QYWA 4LV5A 5BYYA 3S0OA 2B9HA 2XUUA 3FDNA 3RMFA 4ZLYA 3NEWA 4KA3A 4M12A 2XA4A 4FKVA 4GU9A 4MBIA 4XOZA 2YIXA 4BDEA 2BRGA 2FSLX 5H9BA 3MPAA 3QGWA 5EYDA 4W4XA 4Y5HA 3DU8A 2Y4IC 2R3FA 3RK5A 2VTTA 4BTKA 5KX8A 3NUAA 4FC0A 4ZIMA 3FL4A 2R4BA 2CLXA 4U8ZA 4QQCA 4Z7HA 4D0XA 4N70A 3GCPA 3VBVA 4BYIA 3UDTA 4L68A 1H07A 3A7IA 3WF9A 3TIZA 5EOBA 3BIZA 5IQBA 4BDAA 3FLSA 2NNWB 3H0ZA 3BPRA 2FVDA 3BI6A 5IISA 2AQXA 4X3FA 4XG6A 3EKNA 2YIWA 3AG9A 4B9DA 5JT2A 4DT8A 3HA6A 4IE9A 4KNBA 5DT3A 2PZRA 3AKJA 1BL6A 3DGKA 3WIKA 4ZTQA 2BILB 2ITWA 3HMOA 2BHHA 3DKOA 4U5JA 1WAKA 4NFNA 3UMXA 4EC8A 2Z02A 1PMUA 3ORZA 3R71A 3O17A 1SVGA 3CTHA 4MXCA 3LXKA 3G51A 5H2UA 3FWQA 3IW6A 3QWKA 1T45A 4BBMA 4EH2A 4EKKA 4RLLA 4DE4A 2Y4PA 2C30A 4FIGA 3W0PA 4CG9A 2ZM4A 3VONA 1M52A 5JGBA 2W1CA 3REPA 2A98A 2GQGA 3KXZA 3DV3A 1WMKA 5C4LA 3PG1A 4YJUA 2GTNA 3HKOA 4JDJA 5ETFA 4DH3A 4F1TA 4HCVA 4L53A 2WQNA 2IW8A 2YM8A 3NZ0A 3KRLA 4HVSA 4GSBA 4IDTA 3NYOA 3C4XA 3NS9A 4YZDA 4O7WA 3TIYA 4TYGA 4FOCA 3IGGA 3BLAA 1I44A 4IBMA 2ZV8A 4WOVA 2R2PA 3COHA 3VRYA 5KO1A 1REKA 3FZOA 2QD9A 2UZLA 2X2LA 3VVHA 4FTJA 2CGVA 3KC3A 3A7FA 3VS7A 2WMWA 5FP6A 3PFQA 3Q96A 2WOUA 3LW0A 5LVMA 5TO8A 2PVYA 5DN3A 4AT5A 4PTGA 3NYXA 1NVQA 2F2CB 3DFCB 4BKYA 2OF4A 3EN9A 3CGFA 3UIUA 1TVOA 1GZKA 3N51A 4FVQA 3B2TA 3UTOA 4FEQA 1M2PA 3LAUA 5AFVA 4IQ6A 2JIIA 2DYLA 3QHWA 3LMIA 3NVMB 1MUOA 3F5PA 3GFWA 2VO0A 4IH8A 2E9OA 5CNOA 1UKHA 1UWJA 3KXNA 4FT0A 3OD6X 3BELA 1BUHA 4RLKA 3GOPA 2B9IA 1SVHA 2E9UA 1FGIA 5AP5A 1MP8A 2EXEA 3ZSGA 3OROA 1LEZA 3HMPA 3P23A 1JKSA 3F5XA 3OF0A 4D4VA 3TACA 3BU3A 1GOLA 4DG2E 5J95A 5J5TA 5HG5A 2XJ0A 4KIKB 4NWMA 3NNXA 2J90A 3PJCA 3EH9A 3R22A 1UV5A 3VO3A 1YI3A 2NP8A 4ARKA 5IQAA 1U5QA 5DNRA 4HYSA 4I5PA 2ITPA 2JDSA 3EOCA 4WBBB 1ZLTA 2AC5A 2UW7A 4BICA 2B9FA 2WEIA 4KD1A 3UOLA 3SD0A 4A4OA 4FA2A 3OTUA 4FNYA 2OJIA 5JQ5A 5LJJA 2OZAB 4LGGA 5HO7A 2C3JA 4HZRA 3OT8A 1L3RE 4IX3A 4JOAA 4QPSA 4BL1A 3UDBA 2CGUA 3N4VA 4RWKA 1ATPE 5KE0A 3FYJX 4XYFA 3BE9A 4IC8A 4R3PA 3F2RA 4AOJA 1OECA 2FGIA 4XV9A 5LWNA 2PUIA 3NCGA 2WEVA 4IAFA 2JDVA 3QTQA 4F7JA 4LOPA 4RIXA 3VS0A 4CZTA 5DR2A 4F09A 5BYLA 2JBOA 5DHJA 3T9TA 3I5ZA 4TYHA 5E8YA 2BKZA 5BVKA 5HVJA 5JSMA 3B2WA 5K3YA 2GS2A 2R5TA 2CGWA 3E8CA 4I24A 3TZ7A 4F4PA 3OBJA 2GDOA 3P1AA 4E4NA 3MH2A 5DIAA 1MQ4A 5KBQA 5JQ8A 3VWAA 1M7QA 4U97A 3B8RA 4MWIA 4NIFB 5HD7A 4DFLA 4B8LA 2CKPA 4CYIA 3QA0A 4TWOA 4CQGA 2IVTA 2E9NA 2JGZA 2PUUA 3H9OA 3QZIA 4FV4A 4KBCA 4NYEA 4GRBA 3I6UA 2BUJA 2ETMA 3KMUA 5I5ZA 2Z60A 2FYSA 3MIAA 3NMUF 5KCVA 4FTCA 4JL9A 3KN6A 5I9WA 2ZM1A 4ANLA 2C6EA 2P2IA 2XS0A 4C59A 1YXUA 5IDNA 4C3RA 4EORA 1LPUA 3IDCA 5HNGA 5T6KA 3BE2A 4B99A 2PYWA 1Q3DA 3D5XA 2VNWA 3KRXA 2ZJWA 3PYYA 5IA2A 5HIBA 2X6DA 3W8QA 3C5UA 5HE0A 4TYEA 4JDKA 3QX4A 4YJSA 5E8XA 4TYIA 4L9IA 1ZRZA 5CU0A 2O64A 2X9FA 2XEZA 4YLJA 4OTFA 1V0PA 2I1MA 1OL2A 5IMEA 5DVRA 1JNKA 3QRKA 3LCSA 3TKHA 4L3PA 4CKIA 5KMKA 1QPCA 2RKUA 3TN8A 4EUTA 4UZDA 4LRKA 5EM7A 4IW0A 2WOTA 2WMSA 3FY2A 4QNAA 4BIBA 4PDSA 1PXNA 4CFFA 3CTQA 2JIVA 5L2QA 4G6NA 2P0CA 5M4IA 2BPMA 4BCGA 3C4ZA 3R73A 3IK3A 2F9GA 4NM7A 4A9SA 4EOIA 1BKXA 3TUBA 4AT4A 2X8IA 1PXOA 2X39A 3QRUA 4MF0A 3PY0A 2QCSA 4EZ5A 5AAGA 3BV3A 4IB0A 4QMYA 4EOOA 3EWHA 5EKNA 4MEDA 3KK8A 4GT4A 4EYMA 3HEGA 3VBTA 3R9RA 3D14A 3IDPA 2AUHA 4S34A 5FP5A 5FWKK 4IZ5A 4AN9A 2R7IA 3FKOA 4FTAA 4U42A 1KV1A 5F95A 5DYJA 2VTOA 5DEYA 5I3OA 1WVWA 3H3CA 5JH6A 5FGKA 4C4GA 4C34A 5KKRC 4MD9E 5FG8A 2VTRA 3RCDA 4F64A 5BYZA 2J0KA 1Y6AA 4AZWA 4KAOA 3F69A 4UEUA 5J7HA 1XH9A 4R8QA 5JMSA 4RJ7A 2QO7A 4U41A 5CU2A 3EQIA 4L52A 4YHFA 3WZEA 3V8SA 3MH0A 4G31A 4IXPA 4OTDA 4BCNA 4F7LA 3G90X 4YZNA 4YSJA 3EFLA 5J1WA 3MY5A 4M67A 3RZFA 1H01A 4DHZA 1WVXA 1OL7A 3I0QA 4AE6A 5JGDA 2CPKE 5ANIA 4MQ1A 2CCHA 4ZLZA 4U40A 3O8TA 4O84A 4D2TA 4UWBA 1DS5A 3LXPA 4TXCA 2UZOA 4XV3A 1M2QA 1WBPA 3QQHA 5AR3A 4WUNA 4RC3A 2GTMA 2QKRA 3IW5A 3POOA 3MY0A 3ZFMA 4EBWA 3NSZA 2BR1A 1CKIA 2VWXA 4RRVA 2W05A 3L9NA 4HNFA 4I93A 3DXNA 2A2AA 3QAME 4KINA 2IF8A 5L6PA 4S2ZA 3UIBA 1BLXA 3EQCA 4XRJA 3A7HA 4AN2A 1JKLA 5AA9A 1U46A 3HL7A 4DHIB 2HWPA 3GC0A 3MPTA 5A46A 5AEPA 3BBTB 5HVKA 1GZ8A 3L1SA 1OZ1A 4OTPA 1BI8A 4PNIA 3F3ZA 3PVBA 4EH6A 5LCJA 3ZRLA 5IQDA 5GJFA 4LUEA 1UNGA 5M4FA 3Q9WA 4F1MA 4ID7A 2RFDA 4IAIA 3QTUA 4QP2A 2QOKA 3QLFA 4EK5A 3NYNA 4IZYA 3QUEA 5CI6A 3QQUA 2OBJA 3CBLA 5IA0A 2Q0NA 4NM3A 5J5SA 2ZDUA 4ENXA 4H05A 4CTCA 3QTZA 2EUFB 4A4XA 1ZXEA 1YKRA 3QCYA 2PMIA 4ZTHA 5LVPA 3AGMA 4DDIA 2JKKA 3CY2A 2WU7A 2YN8A 2R3IA 4GJ3A 1CDKA 5BVNA 4YU2A 3P9JA 3FV8A 2WTJA 3R9DA 5IEVA 4GVJA 4QPMA 4DEAA 2R0UA 3P86A 3L9MA 4BWPA 3KULA 2UW9A 1UU7A 4QD6A 4BTJA 4C33A 1FMOE 5HTIA 3DB6A 1Z5MA 2ERKA 2VO3A 4XHKB 3ZCLA 3RKBA 3PVUA 4FKGA 4F1OA 4MUQA 5E9EA 2I0EA 3FI8A 5EI2A 4UMPA 3RPVA 1KOBA 5H8BA 1JVPP 2A19B 2XK3A 4FI1A 3HYHA 2P3GX 3PJ3A 3ZUVA 5KHXA 2UV2A 5DT0A 4ZK5A 2O8YA 3HA8A 5J87A 5FQDC 3QQFA 5M51A 1PY5A 1P4FA 3FL5A 3NPCA 4L00A 3QYZA 4W8DA 2WHBA 4C57A 4BVUA 4E73A 4LM5A 5CF5A 4V0GB 4NEUA 4DEBA 5JFXA 2QLUA 4RIYA 5HCYA 2NRYA 3DFAA 4J7BA 3CCNA 1VYWA 3COIA 5IUHA 5HIDA 2KULA 4KSQA 2JITA 3LJ2A 4QMQA 2ZB0A 3TJCA 3OEFX 4ACCA 1Q8UA 3HV6A 2VTQA 3LCDA 3ATSA 5IA5A 4J8MA 3EL8A 3GUBA 3FHIA 4APCA 4DINA 3PFYA 4FYOA 5IPJA 5HORA 1YOJA 2UW0A 5CT0A 5J1VA 1QL6A 3OXZA 3EQDA 5D9HA 4FNWA 2PMLX 4LRMA 3OWPA 3TEIA 2OIQA 3FMHA 1W0XC 4RGJA 3A8WA 5EYMA 3RZBA 5AA8A 3KXXA 3FSKA 3ZO2A 5IEXA 3ZLXA 3RI1A 3QD0A 5ANDA 4L44A 1JOWB 3C7QA 4HW7A 2F57A 2V0DA 3TCPA 5M4UA 4WRGA 4WBOA 3JVRA 3SLSA 2B52A 2XKDA 4YHJA 5HCZA 5CEIA 3F66A 1SYKA 1YXSA 4KIPA 1OKWA 3QD3A 5BVEA 4BDFA 2IG7A 3QZGA 4R3CA 4JQ8A 4ORKA 2X4FA 2BFXA 2ETRA 4AAAA 1YHVA 3I81A 4FTOA 4MHAA 4R1VA 5L4QA 3EQBA 2YITA 3LMGA 4BDIA 4E4MA 3VUHA 3QD2B 4QTBA 3K5VA 2XNGA 4TY1A 4Q5HA 3R8UA 2JC6A 3KY2A 3R2YA 4Z3VA 1H0VA 2C0TA 4FK3A 4IWQA 4FEWA 4PWNA 2WXVA 4FIJA 4RWIA 4C35A 5CAQA 3UQFA 5GIPE 4FSRA 2BDJA 3HV4A 1JKKA 3TXOA 2ETKA 3DKGA 4MNEA 5EOLA 4MXOA 3RALA 4GEOA 3TM0A 4NCTC 3TKUA 2J6MA 3SV0A 2YWPA 4ZY5A 5JRQA 4KRDA 3FLNC 2VX1A 3F61A 2XJ1A 3QC4A 1FOTA 3WARA 4EHEA 2XK7A 2C6DA 3ENMA 5GZ8A 2C5NA 2RL5A 3JY0A 2BRHA 3LIJA 4RIOA 3W1FA 5M08A 3VS4A 4CFXA 2HK5A 2C6OA 1QPJA 5M56A 3BL9A 4UBAA 3PRFA 1IASA 3QXPA 3R7GA 3K3IA 1KE9A 3AT4A 3U51A 2WAJA 2CSNA 3A2CA 3Q9ZA 3DNDA 4NUSA 4P5ZA 4S30A 3LFAA 3Q9XA 3DZQA 5D1JA 2HW7A 2I0VA 1PMVA 4IVDA 1WCCA 3PTGA 3MA3A 4GK4A 3RAWA 5K9IA 3EZRA 3R8VA 3VHEA 2C6TA 2Z7QA 3TV6A 4E6CA 2RF9A 2BMCA 3GU5A 5HG9A 2WNTA 5EQYA 5CS6A 4TNDA 5CALA 1OKYA 4YJQA 3FQSA 4DH5A 2V7OA 2PZPA 3IECA 4MF1A 4O0TA 3VUIA 5L8LA 4AXEA 4PDYA 3MB7A 5GJDA 3F3TA 2WTVA 4NKAA 2HXQA 3QFVA 2XAMA 4HGLA 2J4ZA 5CX9A 2C3LA 4D9UA 3H4JA 1ST0A 3D2IA 5CVHA 2PVLA 4CT2A 2XRUA 2VU3A 5D7AA 3U9CA 2JAMA 4OTHA 3KVXA 4FL1A 4BCPA 3UJGA 4KABA 4C4EA 3PP1A 4APPA 2FB8A 4O83A 3U6HA 4FIEA 4CV8A 1SNUA 5IUGA 5HX6A 5KUPA 3VAPA 3PSDA 5ETCA 3PLSA 4FT5A 4CVAA 2C68A 5CYIA 4YNEA 3K3JA 3EQGA 4RX8A 4ZMFA 3UMWA 1AD5A 2HWOA 1M17A 3MJ1A 3PE2A 4BBFA 4I0RA 5CAUA 2XM8A 4OW8A 4BIDA 3C4WA 1OPLA 2REIA 4BCQA 1UKIA 5JZNA 3OWLA 3TUCA 1KE7A 4PMTA 2ZB1A 3KULB 4RFYA 2P4IA 4UMQA 3IW7A 3NUYA 3UO4A 3T9IA 3GCUA 4QMVA