3C7QA

Structure of vegfr2 kinase domain in complex with bibf1120
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
301
structure length
286
Chain Sequence
RLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKDFLTLEHLIYSFQVAKGMEFLASRKIHRDLAARNILLSEKNVVKICDFDIKDPDVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Vascular endothelial growth factor receptor 2
publication title BIBF 1120: triple angiokinase inhibitor with sustained receptor blockade and good antitumor efficacy.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 286
sequence length 301
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3c7qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3c7qA01
2YZAA 4F65A 3DK6A 2JFMA 3B2TA 3MB7A 5EM5A 3UO5A 4I93A 4Y73A 1CKPA 4CG8A 3VS3A 4OTPA 1Q99A 3HMPA 4F7SA 3BWFA 3KF4A 2R0IA 3P0MA 2VO0A 3FMJA 5CZIA 4DH3A 4PL4A 1H1WA 3RM7A 2FUMA 3QLGA 2BMCA 3Q6WA 3AC1A 4IM0A 4D1XA 3VNTA 3CQWA 2XEZA 3FWQA 5IKWA 3Q04A 3DXPA 3EYGA 3FBVA 3KA0A 3LJ0A 3NUNA 4WKQA 3F2RA 3TDWA 4RGJA 4WBOA 3DAJA 3HRFA 3U8WA 1PMUA 3EOCA 1ZOEA 5BVNA 4KIKB 4N70A 2EB2A 3UJGA 2G2HA 5DEYA 2YDJA 4A9UA 4BCIA 1SVGA 3ZFYA 1UKIA 3AC8A 2PUIA 4E7WA 1OUYA 2PHKA 1GJOA 3VS6A 4WSQA 1M7QA 4MYGA 4LMUA 4Z7HA 4BYJA 5LWMA 1KOAA 2OJIA 2PVJA 2W5AA 3KKVA 5EHOA 3SLSA 5A4LA 5TO8A 4I24A 4JG7A 4N6YA 3W10A 3FJQE 4IDVA 2VX1A 4M68A 3VS2A 4JAIA 4XH6A 4Y72A 2JC6A 3FXZA 4BDCA 1ZYCA 3BZ3A 2XNEA 2G2IA 3E62A 4R7IA 4C4EA 5BMSA 2Y6MA 3PP0A 4ACMA 2VWVA 2CCIA 4BCKA 3NUYA 4GYGA 4AOJA 5A4TA 5EQPA 2CN5A 2X4FA 4DEIA 2JITA 4OBOA 4CLJA 5D9HA 1J1CA 4GFOA 4BDKA 5HIDA 4G17A 4F0IA 4IC8A 2WMVA 5BYLA 3C0HA 2J6MA 3VQHA 2XA4A 3AMBA 2B52A 2VTPA 3NW6A 4HZRA 4JBPA 4LI5A 2F7EE 3UG2A 3HV7A 1W84A 4GT5A 4TT7A 3DJ6A 3NCZA 3F61A 3E5AA 4UZHA 5GJGA 4FKJA 5AUYA 4FK3A 4PDSA 3ZCLA 4EUUA 4O1PA 4XOZA 3ZLXA 4YLJA 2ZOQA 2GNFA 5AUXA 3ERKA 4DG0E 5M07A 5CSHA 3EQRA 2VWIA 2XIYA 1FVVA 5H9BA 3UIBA 3EN6A 3RM6A 5FDPA 4GVJA 2HWPA 3ZYAA 3O0GA 3SVVA 1PXOA 3O50A 4H1JA 1SVHA 4HVHA 3K3JA 4MXAA 5CXZA 4ENXA 3NYNA 2X8EA 3EB0A 1T45A 3R73A 4G9CA 3KXXA 4RBLA 2ITWA 5IDNA 2JBOA 4XG9A 2C6KA 3V04A 1V1KA 2AYPA 3II5A 4IX4A 5AP4A 5EH0A 5BYZA 3DB6A 4FV2A 3U4WA 4BCMA 2XCHA 2XJ0A 4ZY6A 3KVWA 5CAPA 4AX8A 1Y57A 1G3NA 4L68A 1JPAA 2HY81 2PTKA 4QMTA 1CMKE 4FKWA 2YITA 2YABA 3EFJA 3QC4A 5ANKA 2QVSE 3WOWA 3PWYA 4ZMEA 4E4NA 4R7BA 2B53A 4DA5A 1LP4A 3BBTB 3LW0A 4I1ZA 1WMKA 4FX3A 4EK6A 4C35A 5M08A 5KBRA 2B9JA 3F3ZA 2BHHA 5C03A 4ANOA 4DH5A 4A9RA 4QMQA 2JKOA 3LPBA 4DF3A 2BTRA 4KIQA 5ITAA 4JNWA 4AA0A 3VVHA 3TUDA 2P4IA 4RC2A 2GHGA 2HW6A 4YHFA 3ZC5A 4PF4A 4DFUA 3DLZA 5IQCA 3COMA 4EKLA 4KUJA 2PY3A 3WZUA 5K0XA 3HDNA 2ZVAA 3KL8A 4PPCA 2VU3A 2QOQA 4QYGA 3UOJA 2C6IA 2H34A 4HCUA 4MD8E 3GGFA 5KKRB 4AT4A 1Z9XA 4MBLA 4JX7A 3VS7A 3PJ3A 1YWRA 5EOBA 1Z5MA 3CD8A 3P4KA 4PQNA 2XK3A 3FHRA 3U9NA 4J8MA 3EN4A 3IPHA 2J90A 2GS2A 3CD3A 4XP0A 2OIQA 4CZUA 2LGCA 3E87A 4E93A 4E20A 4C33A 4KSPA 2W9ZB 4O0SA 2FSMX 4R3CA 2YWPA 5B2LA 5AJQA 5EM6A 3PFQA 1W0XC 2C5OA 4JI9A 4ZTSA 4QP4A 1G8SA 3MY1A 3NYXA 3HA6A 4PMTA 3UP2A 5BPYA 2C3KA 3TUBA 3Q2MA 4F7LA 2XBJA 4KINA 4ANNA 4AN2A 3FZRA 5HNBA 2CN8A 5K5XA 5LMBA 2X7GA 4HGTA 3R8PA 1Y6AA 1MQ4A 4MWHA 3TZ9A 3EQBA 3F3TA 3SQQA 3MIAA 3OEFX 2R3PA 3ORNA 3I6UA 4ITHA 3MGYA 5DMZA 1K2PA 4FKUA 1YHVA 5LJJA 3PVBA 4AOTA 2BIYA 3AXWA 2CNQA 4AZSA 4DGMA 3F3WA 2BZIB 3COHA 4RWIA 4FGBA 4B0GA 5HZNA 1Q3DA 4DE4A 2WTJA 3LMIA 2JIIA 5M4IA 2IN6A 3E3PA 3QRKA 4DEAA 2FYSA 2GNLA 4RLKA 3PA3A 1A48A 2FH9A 4L3JA 1ZZ2A 3WF5A 1YXSA 3QGYA 5K5NA 3RBWA 5CS6A 4CZTA 3FXXA 4YPSA 2SRCA 4G6OA 3E8CA 4HVDA 1OBDA 4BBEA 2VGOA 4L52A 5FRIA 3N4UA 4GFMA 2VUWA 3EQPA 3HMNA 5I3RA 4H58A 4OUCA 4M12A 4R5SA 2XBAA 2JDRA 1WBSA 2NO3A 2VTQA 2WQOA 4CFVA 3H9OA 3QX4A 3ZC6A 3CSVA 4A4OA 4AW0A 4GMYA 1OBGA 2YCRA 4P7EA 5GIPE 2C6DA 4TXCA 1UWJA 3GXLA 4NK9A 4TYGA 4DFYA 5CT7A 4UEUA 4AT3A 4ZXTA 1G5SA 3QC9A 4G5JA 4L00A 2IG7A 2IZSA 5FTOA 3RK5A 3UC4A 1F5QA 3ZLYA 5M06A 3LFFA 4WIHA 2YM4A 3DBFA 2VTTA 5FTQA 3QCQA 4EOOA 5I9XA 5M4FA 1YQJA 4O38A 3Q9XA 4H36A 2UVZA 3QRIA 3ZEWA 4OTHA 1MP8A 4DEDA 3F9NA 4UYAA 2J5EA 4IE9A 5ANIA 5DE2A 4OBPA 5L2IA 4IH8A 3NUUA 3WF9A 1JOWB 4I5PA 3MB6A 3DQWA 5EI2A 2JBPA 3H3CA 2ETMA 1XKKA 2UW3A 3DK7A 4X2NA 1KSWA 2W1DA 5CYIA 4DEHA 3PP1A 1ZZLA 1XBBA 2QKWB 3QZIA 4DN5A 4FTOA 4DH7A 3PE2A 3BHTA 3NZ0A 5KE0A 3EQFA 4CQGA 3EL8A 5M53A 3IW4A 2REIA 4L67A 4CD0A 4R78A 5JEBA 3TN8A 5CF5A 4FTTA 2YIQA 1PJKA 4I23A 2YM5A 5E8UA 2UZWE 1UA2A 2CCHA 3PPKA 1E1VA 3Q32A 2EVAA 4EI4A 4E4XA 1Z57A 2GTNA 3L9LA 3PVUA 5AX9A 3R22A 3QZFA 3QYWA 4IFCA 3F82A 3S00A 4TYJA 4EH6A 2XNGA 3DA6A 3IW7A 4YGAA 1UU7A 4XLVA 1ZWSA 4QP2A 1JKSA 4F9YA 3RCJA 2RSVA 5LMAA 2QHNA 2PMLX 3BEAA 5M4UA 1OL1A 4C2VA 4YR8A 4FKSA 4MTAA 4DEEA 5E4HA 3OXZA 4RVTA 5HU3A 2V22A 3VUKA 2P2HA 3ZU7A 4FV7A 4FIJA 2YA9A 4O7LA 3TUCA 5B0XA 3S95A 4TNDA 1CKIA 4D2WA 1PKDA 3MV5A 3LQ8A 1HOWA 2RFNA 2XJ1A 1PMNA 3L8SA 3F3VA 1F0QA 2WTIA 4YC6A 4GIHA 2IVVA 4GS6A 4B9DA 4AW5A 1QL6A 2R3FA 3DJ5A 5H2UA 4C61A 3QQJA 3KRRA 4K9YA 2WFYA 4U97A 1PF8A 4UWYA 4IW0A 4K1BA 3EN5A 1REKA 4A07A 3OG7A 3RMFA 3FDNA 4IVAA 4A4LA 4F1TA 4FMQA 2BAJA 2VTIA 4L7SA 3FYJX 2NPQA 1H1PA 3VS0A 4IB5A 4B4LA 4XG4A 4I6HA 3TTJA 2YERA 3R04A 3ZBFA 3H0ZA 5T6KA 4PNKA 3FSKA 4PNIA 5HIEA 3ITZA 3EN9A 2YEXA 2X4ZA 3I7CA 4L3PA 4EOPA 4Z3VA 2YN8A 3HGKA 3RWPA 3TZ8A 3QCXA 4XV9A 4PUZA 4TWNA 5KHXA 3ROYA 5GIOE 4GK2A 4BZDA 4WUAA 4ASZA 3GCSA 4BGGA 5HLWA 4IZYA 4HZSA 2O5KA 2WB8A 3UOHA 4N6ZA 3QTWA 2W4OA 5J95A 4CQEA 4DLJA 4ZMFA 5K4IA 1M52A 4GG7A 2G15A 4D5KA 3KMUA 1XBAA 3GC9A 1OL5A 4FA2A 4FF8A 3RPRA 2DQ7X 4H39A 2ITTA 1H28A 3M11A 5C1QB 4TWOA 3MH0A 2PVNA 5JZJA 3I0OA 3EQDA 2F7ZE 4EL9A 4FEXA 2VWUA 3AD6A 5JGAA 3IKAA 4TWCA 3LMHA 2QD9A 4JIAA 3R6XA 4NUSA 4X2KA 4ZOGA 3QZGA 2QONA 4F09A 2QO9A 2CGXA 4IB1A 2UW8A 3OMVA 3ZDUA 5IEVA 2YCFA 5J7BA 3WIGA 3MESA 4YSMA 1XH4A 4CKRA 3B8RA 4ORKA 5EW3A 2UW5A 3CKWA 4AZWA 4WG3A 1U5RA 1KE7A 2HIWA 3KXMA 2UZEA 4X3FB 4FL2A 3OCSA 3NNUA 4O1OA 4DGNA 3HDMA 4MCVA 5A14A 3LLTA 1PW2A 4OTRA 4V05A 4MD9E 3QWJA 3TXOA 2GMXA 3QKMA 3PY0A 5FDXA 3P7BA 4GV1A 1YOJA 1GNGA 1ZYSA 1U46A 4AZVA 4F1OA 1IAJA 4S30A 3QHRA 1WBPA 5G6VA 4C37A 3V8WA 4CKJA 5F4NA 4QNYA 3C4XA 3MW1A 2JKQA 3O8TA 3HV3A 3UO6A 1RQQA 1V0PA 3IGOA 4EC9A 4UN0C 3MTLA 1URCA 4KD1A 2X7OA 3UNZA 2EXMA 2XRWA 4M8TA 3MSSA 4QMOA 3NUAA 2W1FA 4FIHA 4GU9A 2X81A 4DINA 4YSJA 1CSNA 3E88A 4KBKA 2GU8A 1FBNA 2ZV8A 4C3PA 4M3QA 4BDHA 5LWNA 3PE1A 3C5UA 2YLFA 2VZ6A 4D2SA 3EKNA 4UV0A 5HD7A 2OH0E 4A9YA 3W16A 3OWPA 4W8DA 4F6SA 3QTSA 5F1ZA 3ODZX 4ZY4A 3MPTA 2I7QA 4JG8A 3TWJA 4FEVA 3KVXA 2EWAA 1UU3A 5EM8A 3R7OA 4WHZA 2XYUA 5DVRA 2OXDA 4DFLA 1E9HA 3FI2A 4BDAA 3S0OA 2C5YA 1JAMA 1OPJA 2QG5A 1B38A 1H08A 1U5QA 3CCNA 4QQCA 5AUWA 4CFMA 4AU8A 3VAPA 3SOCA 4JRVA 5DPVA 3Q4ZA 4X2FA 4CGAA 4U41A 2ITPA 1FQ1B 4E73A 4FNZA 2NRYA 2X9FA 3OW3A 1KE9A 3C4ZA 3JS2A 4RJ7A 1PYEA 3NGAA 3GCQA 2W0JA 3LZBA 3PXRA 4ACGA 4EHZA 4W4WA 4E6AA 4GKHA 2X7FA 4XG6A 2ZB0A 5DH3A 5LOHA 3C5IA 5CY3A 2A2AA 3FPMA 3TL8A 3MA6A 2ITYA 1OM1A 4BI2A 4M7IA 1JSVA 2XKDA 3PXFA 3G90X 2FSLX 4LGGA 4E4MA 2W1GA 5AP5A 3BPRA 1NVQA 3VQUA 3AC4A 4ZLOA 4H1MA 4XBUA 3K3IA 2C6MA 3AC5A 1LUFA 4FZFB 1TQMA 5L8JA 2NNWB 2GNHA 3DTWA 5TF9A 4EZ7A 4IZAA 3KK8A 4QYFA 4CMTA 1Q8YA 5LVLA 4QMLA 5L2TA 4QPSA 3VUGA 3NCGA 5KMNA 5F20A 1G8AA 1UNLA 3R7IA 3ZMMA 4GT4A 4FGRA 3GU5A 2ZV9A 3ORXA 4J71A 4XP2A 4QQJA 1HCKA 1STCE 3A7JA 3HL7A 2H9VA 3DXQA 2HZIA 4TYIA 2BRMA 4G3FA 1OIYA 4EJ7A 1CTPE 4MF1A 3SXRA 4X3JA 4XEYA 3P79A 4QRCA 2JDOA 3FQSA 1SYKA 3DGKA 4YJVA 3KXHA 3FI3A 1WVWA 4USEA 4ASDA 5HD4A 3V8TA 3DDPA 3OY3A 5CU4A 1M7NA 3ZFMA 5HICA 3JVRA 2VGPA 3U6IA 2CSNA 2QR8A 4M69B 3F5PA 4ACHA 5E8ZA 4PV0A 2C4GA 3BKBA 4EUTA 5L2WA 4U80A 3P23A 2IW9A 3OT8A 2R3QA 1IR3A 3UOKA 3TACA 4IB0A 2X39A 1SNUA 4HYUA 3D15A 5FM2A 5A46A 1P4OA 5J5SA 2GSFA 2QCSA 1XH5A 5FBNC 1PMEA 4FG9A 3Q96A 3DBDA 3OWJA 3JYAA 4FTLA 4JVGA 3TTIA 4EOQA 5IG1A 4AXAA 3TNIA 4USFA 1YVJA 2YM7A 1OKVA 5HNGA 3T8OA 2R3KA 3GU7A 3BYVA 5EFQA 5EYKA 5C27A 2PZRA 5HCXA 4V0GB 3ZUVA 4NKSA 2YIWA 2CMWA 3BYSA 2BFXA 3EJ1A 4EZ5A 5L4QA 4YJOA 2O2UA 1QPEA 1UKHA 5EI6A 5K0KA 4CZYB 4HVGA 3MJ2A 4EOMA 5B2MA 5A4CA 2IWIA 2JIVA 3NX8A 3PY1A 4EK3A 3PPJA 5E92A 1Q3WA 4AA4A 4ZP5A 4EH2A 4UXLA 3QA0A 4PL3A 4EOSA 2WEVA 1M2QA 1Q8TA 3QLFA 4IAFA 2XCKA 3OW4A 3LFQA 4RFZA 2WQBA 5C8KA 3DAEA 3PUPA 2OJJA 4GIIA 3PVGA 4WG4A 4HYSA 4RIWB 3NAYA 4EOJA 4G1WA 3V8SA 2WTDA 3BEGA 4J52A 2ZYBA 5FGKA 3LCOA 4GVAA 3PIYA 2R3HA 3SDJA 5J8IA 3MBLA 2I0HA 1ND4A 4S31A 5EM7A 4KB8A 1PXJA 3BI6A 3QQKA 3R1SA 3WARA 1JNKA 3ZZWA 5I9YA 3I6WA 3UQCA 2NRUA 3BCEA 2R3MA 1H24A 3IO7A 4OTFA 1UNGA 2VTHA 3F2AA 4CV9A 4U9AA 2VTNA 3SRVA 3A8WA 1UV5A 3AC3A 3ZSHA 4DTBA 3DQXA 4O0UA 4J95A 3WE8A 3UTOA 2X2LA 3TV6A 2CKOA 1GY3A 4YZ9A 4BWPA 4PTEA 3UOLA 1H1RA 5E8YA 2AUHA 5HO7A 4I5MA 5TT7A 5AV4A 5AP7A 3K5VA 3Q6UA 2VX0A 1YXTA 4MWIA 4V04A 2J9MA 4ALWA 2XH5A 5CAOA 2VWWA 4U42A 5C26A 3EMGA 5DGZA 4JDJA 2WTKC 5AA9A 4OTIA 4EK8A 3ODYX 2XS0A 3GU8A 2R2PA 3PSDA 4BKYA 5JRSA 3PRIA 4M14A 2I40A 3UIMA 3SHEA 1JSUA 4ANBA 1IASA 3H0YA 2P0CA 3HP5A 4IZ7A 4F99A 2WTVA 3DB8A 5K4JA 4O0WA 5FD2A 2CGUA 3ZUUA 4BCNA 2QOHA 4F1MA 2QOFA 4O21A 3LJ2A 3OCGA 3QQHA 1J7IA 1Q8ZA 1ZY4A 3E7VA 4FTIA 5AAEA 4F6WA 1YKRA 4XV3A 3MH1A 4EH4A 4BDBA 2F2UA 4LUEA 5E91A 2UZLA 4E26A 3L9PA 4O81A 3O7LB 2Z02A 3Q3BA 2WMRA 3RHKA 4FT7A 3P7CA 4O7VA 2BVAA 3CS9A 2C3IB 5AX3A 3GCPA 1GZKA 1ZAOA 3TZMA 4ONAA 5E8WA 3UE4A 2QOOA 5KNJA 4FSZA 4GKIA 3TJCA 1H25A 4IC7A 2J0MB 2V7OA 3E92A 3EZRA 3PYYA 3SRVB 4GH2A 4UMQA 1KOBA 3AQVA 4I6BA 2H6DA 4Q9SA 4M84A 3EH9A 1ZY5A 4YJPA 3W2OA 1XWSA 2I0EA 3FMLA 5CSXA 3R63A 4NW6A 5FEQA 2OI4X 1L3RE 3RPSA 3MFRA 4NW5A 4XUFA 5IQDA 4DEBA 5IF1A 3ZXZA 4O96A 2RL5A 2UW7A 1J7LA 3D4QA 4TTHB 5AIKA 4QTDA 2G01A 5JFXA 5A6OA 1BL6A 1ZLTA 4FV4A 4JDHA 4AW2A 2JDSA 4GL9A 4IQ6A 2QLQA 4DBNA 3F5XA 3QCYA 3ANRA 2B9HA 2QHMA 4DGOA 3MVMA 5LVMA 1RW8A 3NS9A 1WFCA 2BRBA 2HENA 5CAVA 5C4LA 4BY9E 4FVPA 5M09A 4J96A 3AGLA 3HVCA 3KN6A 4ASEA 4UMPA 3OEZA 1ZXEA 3K5UA 4G3EA 4XP3A 4BZNA 4HVSA 4GEOA 3WBLA 4HGSA 3GENA 5D12A 3ZLSA 2ZV7A 3VBQA 2JLDA 2IZUA 5CVFA 1BLXA 1OIRA 4O6EA 2C0OA 2OO8X 4W4VA 2B7AA 4FOBA 2WPAA 2A4LA 5IA1A 5GJDA 2E9PA 3U9CA 4E1ZA 4BDDA 4KRDA 3WZEA 4JOAA 2HCKA 4JX3A 2WKMA 3PVWA 4YMJA 5CU0A 2XNPA 4C4FA 4G31A 1JQHA 3TIYA 2ITOA 2OGVA 5KMIA 4QNAA 2I1MA 4F0FA 1CM8A 1LEZA 4K0YA 3BHYA 5HCYA 4I22A 3ROCA 5DEWA 5JN2A 1XHAA 4QO9A 2V62A 5CZHA 5CEKA 5E90A 2WOUA 2WIPA 3ORIA 1H26A 3ALNA 3IG7A 1S9JA 3A7FA 3GCUA 2XNBA 3IOKA 5JZNA 3W2RA 3ET7A 2PUPA 2R7BA 3DS6A 4ANSA 1UU8A 2YZLA 1QPJA 3I81A 3EZVA 4ZSJA 4K11A 4F0GA 1ATPE 1OL7A 4DAWA 3R1YA 2VTMA 3NIEA 4M67A 1GOLA 1XR1A 3TCPA 4ZTHA 4BBFA 2OWBA 3WE4A 5CALA 5E8XA 1GIHA 5CSPA 2A1AB 2R0UA 4NL0A 4IJPA 4B6LA 1JWHA 3A7HA 3TKHA 2BKKA 1P5EA 3FMMA 3R21A 2W1HA 4OLIA 5LMKC 5JT2A 4KIPA 4BTMA 4E5AX 3ORPA 1UVRA 4A4XA 3OD6X 4AQCA 3D94A 5HOAA 3C13A 4F9WA 2GQGA 3RZFA 3QWKA 2R3NA 3R71A 1WZYA 3ATSA 2OIDA 3OOGA 3WYXA 1NVSA 1RDQE 3POOA 4FKIA 4WNKA 4TRLA 2W4JA 4JQEA 5CU2A 5JKGA 5JGDA 3CQUA 3Q4UA 5DLSA 3ZDIA 3CXWA 4FTUA 4ZS0A 2OH4A 5EOLA 4BDFA 4FV5A 3NUXA 3UP7A 1XH9A 2DS1A 3LAUA 5IPJA 3MN3A 4B8MA 4Y95A 1GZNA 4ZSEA 3L8VA 4RVKA 5DR9A 4RJ4A 2QR7A 3C51A 3O71A 3QL8A 4FI1A 2BTSA 4IACA 4WUNA 4XBRA 5FP6A 4FSNA 5IA4A 3QFVA 4EHEA 3MDYA 3PPZA 4EH3A 1M17A 5A4EA 5DWRA 2VWYA 2UW4A 4NCTC 3FLWA 3I60A 2XIXA 3O51A 4OTGA 5HBEA 1R0PA 4EWQA 3LLAA 5IDPA 4UBAA 1UWHA 4D2PA 4YLKA 1H01A 3PY3A 1WBTA 4RMZA 2BR1A 2OFVA 3Q52A 1R3CA 2BRGA 3GT8A 3GP0A 4IM3A 2EXCX 4S33A 1LEWA 2IPXA 4MXOA 3PSCA 5KMKA 2ETRA 4OT5A 3FL4A 3TV7A 3G9NA 3G5DA 4IEBA 4MK0A 5BVDA 3IDCA 1OZ1A 4O7YA 2J51A 4FSTA 2CHLA 4X0MA 4QQTA 4EWHA 4FG8A 4DEGA 3TZ7A 4FYOA 1NA7A 2W5BA 2XIZA 3DBQA 4JL9A 3ELJA 3U55A 2VN9A 3VWAA 2PMOX 3C50A 4D1ZA 3GOKA 4CRSA 3D7ZA 5AMNA 3R00A 3Q4CA 3KCKA 1J1BA 3P78A 4RC4A 5K3YA 3R8LA 4V01A 2QO2A 1SMHA 3N9XA 5AFVA 2X2MA 1URWA 2J2IB 5GHVA 4PMMA 3QD0A 3EQCA 4FKOA 2E2BA 2YM6A 4TYEA 1JKTA 2GDOA 2JFLA 3H4JA 5CENA 4D1SA 1QPCA 2J7TA 2Y4IB 4RWLA 4EHGA 4NJ3A 1IA8A 3MVHA 3WF8A 4C4JA 2Y6OA 2ZJWA 5IMEA 3S4QA 4YC8A 2ZDTA 4W9WA 4QMXA 3O7LD 4L45A 3JR1A 4AF3A 2XM9A 2PVHA 5KBQA 4ALVA 3QQGA 4NFNA 2FO0A 4EH9A 1TQPA 3HAVA 2E9VA 4YJSA 5EK7A 2YM3A 2JEDA 1P4FA 4LG4A 4RVMA 3PZHA 4FT9A 5E8SA 3VS4A 4RQVA 4LMNA 5H8BA 4D58A 4Z9LA 3NIZA 2QO7A 3R28A 2X2KA 4E5WA 2ZMCA 4FIGA 5HESA 4GU6A 4I0RA 3UVRA 3UVQA 3G6GA 3KFAA 1A06A 2C30A 3BHHA 3GCVA 3OS3A 4PL5A 5CSVA 5HBJA 5JFVA 4NTTA 3NUSA 2CKEA 4PDOA 4YURA 5DR6A 3W8LA 4IDTA 4LRJA 3D83A 4BDGA 4DTKA 3LVPA 3QBNA 3TM0A 2JAMA 1M14A 4WNMA 4WSYA 2IVTA 3DT1A 4MD7E 2ZM3A 4S2ZA 2ZMDA 4PDPA 4QYEA 4NYEA 4HPUE 5HQ0A 4X21A 2UW0A 4YO4A 3FLQA 4JXFA 3FYKX 5C8MA 1AGWA 4YBJA 4G34A 3PWDA 4C38A 2J50A 4P5QA 5GZAA 3TKIA 3LFNA 3IW6A 1OL2A 5FP5A 4CCBA 4DGGA 3GOPA 3BX5A 5BVEA 4C62A 4ZTNA 1H07A 3VW8A 3KXNA 3BGPA 4FODA 2OFUA 4KIOA 3L8XA 4JAJA 4H3QA 4HPTE 3ACKA 2UZVA 2Z7QA 5BUJA 5IH4A 3RPOA 3BLRA 1I09A 5DOSA 2J0KA 3TKUA 5BVWA 4RX5A 3FE3A 2BIKB 4FL1A 5KKRC 3MVJA 4FTKA 1FGIA 2ITVA 1OIQA 3ALOA 4JR7A 4ZSLA 3QUDA 3W33A 5HNIX 4ZSGA 3G0FA 3ACJA 3PZEA 2PPQA 4WD5A 2YFXA 2Z7RA 5EYCA 4YTIA 4ERKA 2RFEA 3RK7A 4DH8A 2WGJA 3A62A 4WRSA 2GNGA 3LXLA 4PTGA 2GNIA 3NW5A 3QGWA 4IAYA 3CQEA 4O0YA 3V5QA 4ZLZA 1APME 2CDZA 3DBEA 4I20A 4FKVA 4FTCA 4FVQA 4ZY5A 3S1HA 4PRJA 4GUEA 5JSMA 1K9AA 3JPVA 4I3ZA 4KBCA 5I4NA 3ATTA 4O7ZA 4B7TA 2QU5A 3HUBA 4F9CA 4D28A 2PUNA 1O6YA 3FV8A 3QUPA 3FZ1A 2OICA 2YACA 5CQWA 3THBA 2CGWA 2C6LA 5AUZA 1FGKA 1YHSA 2WMBA 4MXCA 5HEZA 5HTIA 3FZTA 2RFSA 3D2IA 3ORKA 3FPQA 5L8LA 2WQNA 3H30A 2C5VA 3DKFA 4C58A 3JY0A 5M4CA 4BR3A 4J53A 3LCTA 2WOTA 4I5CA 5DNRA 4A9TA 1SVEA 4EH7A 4LOPA 2F9GA 3GC0A 4CMUA 4B99A 2RG6A 4FNXA 4C3FA 4DHFA 2EXEA 4BCQA 3ZLWA 4N0SA 2WTCA 3FLYA 4F6UA 5H8GA 4E5BA 2VTLA 2WU6A 4FVRA 5KZIA 4Y5HA 4F9BA 5GINE 2PE1A 3PDTA 2QC6A 5FXSA 5BQ0A 4IJ9A 3EQHA 4U0IA 2P2IA 4UY9A 4IAAA 4BCJA 4H05A 3KXZA 3PSBA 3F2NA 4RJ5A 4EJNA 2WEIA 2R4BA 3RAHA 5AP0A 3HZTA 4X6RA 3IS5A 2PZIA 3E8DA 2C6EA 3V51A 1Q62A 4ZEGA 3BHVA 3GI3A 2J0LA 3QTUA 1V0OA 3R8ZA 5IEYA 1YOLA 3E64A 4KSQA 2QKRA 2XYNA 3NUPA 5AP1A 3ZXTA 3HP2A 1W7HA 5I0BA 3K54A 4L43A 4CRLA 1BI7A 1B6CB 1WBOA 4HOKA 3VHKA 4ZZOA 3SKCA 1CKJA 4EHVA 3GBZA 5BUIA 4J97A 3DCVA 4W4YA 2R3IA 3GB2A 3ANQA 2HXQA 3O96A 2IZTA 1SNXA 4O83A 4QMMA 3G33A 2ERKA 4NIFA 5IQGA 2PVRA 4S34A 4U45A 4XG2A 3ZFXA 5J5TA 5HO6A 3DLSA 1ZYDA 1KV2A 3BV2A 4MNEA 4HW7A 3ULZA 3KN5A 5HE3A 2FB8A 5ANEA 5IQEA 2F4JA 4CYIA 1RE8A 2C47A 2XVDA 3TNWA 2W9FB 3KQ7A 4E6DA 4N57A 4HNFA 2BRHA 4MNFA 1ZARA 4EQMA 4EBVA 2W5HA 4ARKA 3KULA 4IVBA 4OT6A 4J8NA 4F64A 1KE5A 3PJCA 4FK6A 1FVTA 3UIXA 3AMYA 3RI1A 3V6SA 3U6JA 2E9NA 3QKLA 5ICPA 2ITXA 4XX9A 3MIYA 3OCTA 4Y46A 4YHTA 5KHWA 2Z2WA 1H1SA 3OBGA 5GJFA 3RK9A 1NW1A 3I0QA 4ZTRA 2XMYA 3T9IA 3AT4A 3IOPA 3VBXA 3RWQA 5HE0A 1VZOA 2X9EA 4MX9A 4F08A 2BAQA 2C0TA 3ORLA 5DRDA 4RIYA 5HU9A 4PPBA 1ZYLA 1VYZA 5AP6A 5I9VA 3HX4A 1R39A 2KULA 4FZ7A 4O0RA 4QD6A 2C1BA 1KE8A 3AD5A 4KKGA 3VUTA 4QP1A 2C6TA 3OBJA 4YZDA 4AAAA 3I7BA 5I5ZA 2VD5A 2X6DA 3MFUA 3SAYA 3LHJA 4RVLA 4QMPA 4BCHA 3TI1A 5HE1A 2XZSA 4BIEA 1E1XA 2OW3A 5DIAA 2CGVA 4L44A 3D7TA 5CT0A 4GJ3A 4DC2A 3EQGA 4XOYA 1H1QA 3WF7A 3Q5ZA 5L2SA 2CNUA 3VC4A 4CXAA 3FQHA 4Y83A 3QRUA 3W2QA 3R8UA 4CG9A 1M2RA 4K33A 4NM7A 1PKGA 5J1WA 4YZNA 4XV1A 4XYFA 5IEXA 2WQEA 4FTMA 5DN3A 4IAZA 2F2CB 4ANLA 4TL0A 3WI6A 5AP3A 1PXKA 3CGFA 3MH2A 2PL0A 5FBOA 3WIKA 4BFMA 4D4VA 5HX8A 3PG1A 4DFZE 4CKIA 3W2CA 4LRMA 4FV1A 4ZZMA 2W7XA 4EZ3A 5IQIA 5DR2A 2HW7A 3R8VA 3G15A 4RWKA 5AUTA 5EQEA 4CTCA 3O23A 5IU2A 5CANA 2W17A 5E1EA 3FC1X 3MFSA 3D14A 3Q2JA 2YJRA 3FZPA 5DG5A 3OWKA 4ZTLA 2DWBA 1KWPA 3O17A 3ZO4A 4AW1A 1MRUA 3ZRLA 5DA3A 3R7UA 1JBPE 3W2PA 4FC0A 4KS7A 4WRGA 4CCUA 5HHWA 2EU9A 2WTKB 3H9RA 5LCKA 3T3UA 4CTBA 3ZUTA 3FEGA 2WZJA 3QUEA 4O7WA 3HECA 4FYNA 4BTJA 2QLUA 3L8PA 4AT5A 1H4LA 2GFCA 4PMSA 3NNXA 3L9MA 4QYYA 4TYHA 3SG9A 3V01A 4AGWA 3LIJA 2ONLC 4AGUA 4Q9ZA 3RALA 5F94A 4RWJA 5CASA 2UZDA 2A27A 1YHWA 3LJ1A 3SOAA 3ZOSA 2XKEA 5KMMA 5JQ8A 2BFYA 1OITA 3CBLA 4X3FC 5G1XA 2W1EA 2JDVA 5D7VA 5IISA 3D9VA 4GK4A 4AE9A 4CNHA 2WMQA 2PVYA 3GU6A 3UO4A 4C3RA 4CT1A 1BUHA 2UZUE 1XJDA 3POZA 1YDSE 3LMGA 5CF8A 3OXTA 2UZBA 3MS9A 4O2ZA 5EDPA 2WMUA 4FUYA 4G3DA 4RLLA 1Q8WA 4AFEA 2X8DA 2FA2A 2XIKA 2C1AA 3IW5A 4J1RA 4M15A 2XUUA 4D2VA 4D2TA 4ENYA 3BU3A 3C7QA 3JVSA 5HG8A 3C4CA 3LOKA 2HAKA 4ZAUA 4AZFA 2XK9A 5L2QA 4HCTA 2YDIA 1ZMVA 4U44A 4IFGA 1W83A 3A4OX 3MJ1A 4FR4A 4XV2A 1PXNA 4AOIA 3D5UA 2JIUA 3KRWA 4FTQA 4MVFA 1YI4A 1U54A 1YWNA 1TQIA 2R64A 3H10A 3QQFA 4M97A 5CI6A 5DT0A 5FEEA 2NP8A 4Q5EA 1NVRA 3VHEA 4APPA 5HG7A 4BDIA 5E9EA 5EQYA 4CSVA 3VJOA 4JDKA 2OSCA 2YAAA 3UGCA 3TG1A 2YLEA 3E7OA 2C6OA 4E8AA 4ASXA 3AT3A 2ZDUA 5HLNA 2XK8A 3FMHA 4XRJA 2VWBA 3BE9A 4XMOA 1ZYJA 3PLAE 2RIOA 2C3LA 2I0VA 4FSRA 4PP9A 4FV8A 5E7RA 2C3JA 3DFAA 5FM3A 5AADA 2OU7A 3ZBXA 1JKKA 3QXOA 3QALE 5LMKA 4Y5QA 4BRXA 4BCFA 5IH5A 3AMAA 3F5GA 3LQ3A 4ERWA 4HCVA 4U3YA 3N4TA 3MFTA 5KMLA 3OF0A 5EDRA 2E9UA 2OJ9A 4NFMA 3NEWA 4RX9A 3ZONA 4LQMA 3FAAA 4CYJA 4QMVA 2WMWA 2QOKA 2B55A 2W1CA 2PYWA 2C0IA 1M2PA 3FXWA 5FXQA 3CEKA 4UMTA 4ZJIA 4O27B 2WELA 3UYTA 2FSTX 4F7JA 3FC2A 3UMWA 3DJ7A 4D5HA 3JY9A 5C01A 5IQHA 3VN9A 4F4PA 3TV4A 3EFWA 3FLSA 2PVLA 2WNTA 4TKSA 3M42A 3ZRKA 5C4KA 3RINA 1XH7A 3MTFA 4J99A 4RQKA 4DH1A 5CSWA 2GQSA 4RA4A 1UNHA 4FBXA 1WVYA 4ANQA 2ZM4A 5CVHA 4FNYA 4EEVA 3FKOA 3KXGA 3L1SA 2Z8CA 2BDJA 2YDKA 3BLQA 1PRYA 3D5XA 3WZDA 2V0DA 4JQ8A 1H0VA 4ACCA 1U54B 4G5PA 4YZMA 4WOVA 2C5XA 4HYHA 3ZSGA 3D2KA 5HVKA 4QMWA 2RGPA 4K2RA 4ZLYA 2PE2A 4NCTA 5HGIA 3QX2A 5FWKK 3AG9A 5FEDA 1GZOA 3I4BA 2PMNX 3QQLA 4D4RA 3UDBA 3LFCA 2ITUA 4R5YA 3SXSA 3BBWA 3G9LX 4O7TA 4BTKA 2VTAA 3F88A 1NY3A 3LFAA 3QXPA 4QTAA 2BAKA 2VTSA 3HV6A 3KCFA 2F49A 2VO7A 3A7IA 4IX6A 5J1VA 3SGCA 2OZAA 5CX9A 5M44A 4XG7A 3GUBA 4K18A 4YP8A 4FSUA 3TEIA 1KV1A 4O2PA 3W1FA 5CEPA 2QOIA 4LYNA 4KIKA 4AS0A 3QRJA 3DTCA 4L8MA 4JBVA 3M1SA 5DYJA 2CPKE 3LKMA 2GNJA 4IWPA 5FTGA 4EQCA 1MQBA 3E3BX 3TNHA 3R8MA 5A54A 5CEOA 3ETAA 3CJFA 4MF0A 1NXKA 3HV4A 5ETAA 3VUHA 3R9OA 4HVIA 3PIZA 1Q24A 3AD4A 4FKPA 4MXXA 3PXKA 4W9XA 3Q53A 3CY2A 3DAKA 3QYZA 1Q97A 4AP7A 4KBAA 4N4SA 1WVXA 4BTFA 3HUCA 3Q60A 1JLUE 3RGFA 3W55A 5JGBA 3NWWA 3C1XA 3RCDA 5TE0A 1NT2A 4HGLA 2WIHA 5I3OA 4IZ5A 3UG1A 4FZAB 3FY0A 5EW8A 5D1JA 3CJGA 3H9FA 3KRJA 3LCDA 4I0SA 1OKYA 4U3ZA 3P08A 5AAGA 2B0QA 2Y8OA 4RT7A 2UZNA 2BALA 4U81A 5KMJA 2C69A 5I9UA 1YW2A 4NH1A 4GG5A 2W96B 2PVFA 2ITNA 3R2YA 4DITA 3CTJA 2BDWA 3DKCA 3OHTA 1H00A 2X0GA 3F6XA 3MY5A 4RZWA 3OP5A 2HZ4A 3KB7A 4E6QA 5LVOA 1XBCA 2YAKA 3KRXA 4R8QA 3LXKA 2GQRA 4IANA 5LXMA 2WMXA 3SA0A 3VS1A 3UQFA 2PULA 2PU8A 4X6QC 3AGMA 2OZAB 4CEGA 2Q0BA 4RX8A 4GT3A 4OTQA 3I5NA 4MAOA 3VUDA 3A60A 1R0EA 4AE6A 4BI1A 2WHBA 3F7WA 5CTPA 2OZOA 3BRBA 3DY7A 3V3VA 2YWVA 3GC7A 3LQ5A 4UXQA 5EKOA 5KCVA 4NSTA 4OTWA 4ITIA 4WNPA 4EORA 1FPUA 2O65A 1B39A 5CU6A 2BROA 3EYHA 5J87A 3VIDA 4KRCA 5A3XA 3KREA 2R3OA 5HCZA 5CNNA 4MQ2A 4YJTA 2ZM1A 3LFDA 3BYUA 5FLFA 2OG8A 3KF7A 4FIFA 4IX3A 5HO8A 3VBVA 5HTBA 4LOQA 2BZHB 4FEWA 3GC8A 2PZ5A 4WNOA 4BKZA 2W1ZA 3A7GA 4QP8A 2O8YA 1BMKA 1Y8YA 3GQIA 5JQ5A 3SW7A 3EFKA 3PA5A 4QOXA 2VWXA 5D7AA 4ZJJA 2R7IA 4DCAA 1BL7A 2WQMA 2Y4PA 4H3PA 3FMDA 3I79A 3CTQA 4WBBB 3VW6A 4F70A 2VTRA 4GYIA 5CWZA 3UNKA 4L01A 4C4GA 4OAUC 2B1PA 2VV9A 4IMYA 3UPXA 4NKAA 5L8KA 3NMUF 3DZOA 3R9HA 3C4EA 4FTRA 3I1AA 2O0UA 2PWLA 2QURA 4RJ6A 5F95A 3GEQA 2P3GX 3HMIA 3QTZA 3FLNC 1DM2A 3QKKA 4EOIA 1QCFA 2V7AA 3PJ8A 5AR3A 1VYWA 4WO5A 5H3QA 3RPVA 4DLIA 3E8EA 4KABA 3NNVA 3EN7A 2OJFE 3UYSA 4EOLA 3FZOA 1FMOE 3R01A 5AV3A 3REPA 2GCDA 4PY1A 1REJA 1UU9A 4U7ZA 1PXLA 4CVAA 2VRXA 3PIXA 5ANDA 3TT0A 5ACKA 3R83A 1T46A 2UZOA 4IADA 2BKZA 3R30A 3PRFA 3ZTXA 4Z7GA 3OVVA 2JGZA 2ITQA 4EQUA 2XNNA 5KMOA 2X6EA 1ERKA 2WO6A 2HXLA 1GIIA 3IK3A 3TDVA 3UQGA 1R1WA 2BPMA 4U8ZA 2XK4A 4O91A 1PY5A 4GSBA 1ZMWA 3NSZA 4BKJA 3UVPA 4KAOA 3UIUA 5AIRA 4UMRA 2OF2A 4G3CA 2R9SA 3BGQA 3B8QA 2OF4A 5DT3A 5J7HA 5JK3A 4TW9A 1OGUA 4PDYA 4BWXA 2WAJA 4L46A 4D2RA 1PYXA 3FMNA 4YJQA 1YOMA 3D0EA 5CF6A 4MBJA 3W32A 4XG8A 2P33A 4JR3A 3NVMB 4FV6A 4BICA 4R7HA 5ANGA 3B2WA 4Q2AA 4IIRA 5E1SA 3WILA 4FTAA 4F7NA 3PA4A 5DT4A 3LXNA 5IA2A 1Q61A 2JD5A 4YBKA 4YJRA 5HBHA 3BHUA 3KK9A 4I6FA 4HJOA 4X2JA 3U87A 4II5A 5IA0A 3N4VA 3G51A 3SD0A 3R2BA 4AUAA 1LR4A 3DKGA 3SX9A 3L9NA 2IW6A 3HEGA 4UX9A 3WYYA 4HGEA 4JLCA 4M66A 3RAIA 5J9LA 1OKWA 4YNOA 4TN6A 3Q5IA 4FSWA 4YTHA 3DBCA 4JRNA 2EUFB 1P2AA 4FKGA 4IXPA 3SXFA 4A7CA 4EONA 5KUPA 2R3JA 4IWQA 4P2KA 4PTCA 2AC3A 4RIOA 1ZOGA 3FI4A 3QTQA 3ZEPA 4CFNA 4O82A 4GJ2A 5I9WA 2BRNA 4FEQA 2GS7A 1YDTE 2XEYA 4OTDA 2V5QA 5BVOA 2VTOA 3R1QA 3CLYA 1JSTA 4P4CA 4XCUA 4YC3A 3DFCB 3WZKA 3GQLA 5EI8A 4LL0A 4QTEA 1DI9A 3QD3A 2PMIA 3NNWA 5LVNA 5M51A 4C8BA 5CAQA 4O7NA 5AR7A 3R7VA 1W82A 3PXZA 5EW9A 5JRQA 3ZM9A 1A9UA 4X7QA 3UC3A 4OBQA 1O6KA 4DT9A 3MA3A 5H8EA 3KGAA 4EYJA 4YZCA 3VS5A 5KX8A 4YLLA 4P5ZA 2OJGA 3R7EA 2PVKA 3FMEA 3VRYA 2ZV2A 2OXXA 4JT3A 2GS6A 4XNEA 4O7SA 3OUNB 3QCSA 3DDQA 1DI8A 1JKLA 4FL3A 1DS5A 2XM8A 2QG7A 1AD5A 3NYVA 3V5PA 1XH6A 1CDKA 5GZ8A 1GAGA 1KE6A 1SZMA 4R1YA 3VUIA 4FE2A 3F3UA 4D9TA 4B8LA 3M2WA 3F7ZA 5HTCA 3C4FA 2RG5A 3I5ZA 5HLPA 4O7RA 4NEUA 5L3AA 3E8NA 3RHXA 4EKKA 2GPHA 2ZB1A 3HV5A 2PZPA 4M13A 5T68A 3ULIA 3IDPA 4BHZA 3QTXA 4BGQA 3LM0A 3FSFA 3D5WA 3OY1A 2BZKB 4YTFA 4QMUA 3DKOA 4ACDA 3QF9A 5HG5A 1OKZA 4E6CA 5DFPA 4R3PA 3A61A 4O0TA 3MVLA 2G2FA 1VJYA 3HKOA 3IONA 2ETKA 3LFEA 3ORMA 4NM5A 1KUTA 2IJMA 3LE6A 1O6LA 3OWLA 3F5UA 1DAWA 5EDQA 2UUEA 4NZWB 3SV0A 2YIYA 4IVCA 4CMOA 4GRBA 2BDFA 4RJ3A 3TIZA 2QOLA 3BYOA 2GTMA 3OTUA 1IG1A 4W4XA 1F3MC 1Q5KA 2OK1A 1K3AA 1YI6A 2LAVA 4DG2E 4EYMA 5DHJA 3R7YA 5JFSA 1TKIA 3PXQA 3ENMA 4O22A 3LFBA 5ANOA 3OTVA 4RG0A 3HAMA 4FIEA 3RJCA 5AEPA 4LUDA 5EHLA 4K8AA 5C8NA 4PX6A 4R6VA 3T3VA 4JS8A 3IQ7A 1PXPA 2ITZA 4DBXA 4QT1A 5JH6A 4LV5A 5AWMA 4PPAA 4O86A 1PXIA 2CLQA 5HVYA 1FOTA 1WBNA 2YISA 3V6RA 4ZJVA 3HA8A 3IECA 2Z7LA 4UALA 3ID6C 3ZS5A 4K77A 4RPVA 5EHYA 5K9IA 4Y85A 3BU6A 3NYOA 3ZHPC 4C36A 3QHWA 4M0ZA 5CQUA 3IGGA 3UZRA 4MEDA 5I9ZA 3DZQA 4D0WA 5BVFA 4TZRA 4C02A 4YUQA 3FI8A 3VRZA 1YXVA 2O63A 5AUVA 3KMWA 5FQDC 5E8VA 2YJSA 4IAKA 5ETCA 4APCA 3R9RA 3Q9ZA 4PP7A 3BQRA 2PSQA 3FZSA 2XRUA 1OPLA 4NT4A 2Y4IC 3KU2A 2XB7A 4NJDA 3FL5A 4FKRA 4QPAA 4W8EA 4A9SA 3CR0A 3S3IA 2QI8A 2EB3A 1S9IA 2HWOA 3CIKA 3ZSIA 3WF6A 4UB7A 5D41A 2IVUA 2PK9A 4OAVB 4IM2A 4QP7A 2FVDA 4BDJA 4BCPA 4IBMA 4NTSA 4BHNA 5M57A 4D9UA 4GW8A 2H96A 1I44A 4QP9A 2XNOA 4RA5A 4DFBA 4DFNA 2UW9A 3BE2A 4HNIA 4RC3A 2ONLA 3PJ1A 5D10A 2W06A 1WAKA 2OLCA 5CXHA 3RVGA 2WTWA 3FHIA 2DYLA 2QODA 4G6LA 5BMMA 3FKLA 4JIKA 4EK4A 1YDRE 4O0XA 3JXWA 3U4UA 3EWHA 5CVGA 4L53A 4M0YA 4PMPA 3VBTA 5BX0A 5IQFA 4X3FA 4NM3A 3V5WA 3NLBA 5B2KA 2XNMA 4CLIA 2Q83A 3QD2B 1QPDA 4IVDA 2J5FA 3R02A 4ANMA 4U5JA 4QMNA 5IMXA 4BCGA 3U6HA 3CE3A 4EK5A 2XF0A 5L6PA 2JAVA 3A8XA 3OXIA 1U59A 4Y8DA 4AN9A 2ZAZA 4QPMA 2FSOX 3BWJA 3O8PA 4I5HA 3GFWA 3Q9YA 4LGHA 2J4ZA 2HZ0A 2QOCA 3P7AA 4PWNA 2UV2A 1U4DA 4LGDA 2O64A 4J98A 2HOGA 3DV3A 3HYHA 5ANJA 4ZTMA 4F9AA 5KO1A 4QMSA 4XLIA 2PZYA 1Y8GA 4EC8A 4MKCA 2I0YA 5TR6A 5F9EA 5AR2A 5CEQA 1J3HA 2JKMA 4JBOA 4DCEA 2R3RA 5AUUA 4YJNA 3C4WA 2VTJA 2YIRA 4AN3A 4G6NA 3BV3A 1Y6BA 3CGOA 3P5KA 4QP3A 4RZVA 2QNJA 2OIBA 4LL5A 2A0CX 3MWUA 3HMOA 4E4LA 2VO6A 1PXMA 1VR2A 2HYYA 4IHPA 5IUHA 4LV8A 3RAKA 3PG3A 3LXPA 2BILB 1Q41A 2HELA 3NRMA 4OGRA 4QTBA 3KMMA 3CY3A 4RFMA 4U6RA 1XQZA 3GVUA 2CJMA 4MXZA 4C4IA 4CFFA 4Q5HA 2PE0A 4XJ0A 5TOZA 2JKKA 3COKA 2PVMA 4AZTA 1IEPA 3ENHA 1V0BA 2GHLA 4LFIA 4YJUA 4YU2A 1YI3A 3MY0A 4CFWA 2OXYA 3PLSA 2Y7JA 4U79A 4DT8A 2HY0A 3NPCA 5HORA 4CT2A 4RSSA 4OW8A 3K2LA 2IVSA 2YIXA 3QTRA 3VBWA 3U54A 5BYYA 4F63A 2Z60A 3IW8A 1Y91A 3UODA 2YCSA 4BWKA 3HNGA 2BHEA 2VNYA 3R7GA 2O3PA 2RKUA 1R78A 3CKXA 4RJ8A 3KEXA 1QMZA 1MRVA 4I21A 3UBDA 3RAWA 3TNPC 1OMWA 1WCCA 3RPYA 4AACA 1IA9A 2UVYA 3Q9WA 4H3BA 1PMVA 3D5VA 5EG3A 4Z16A 4AGCA 3MH3A 4GCJA 3FLZA 3W8QA 4C2WA 1XH8A 3LFSA 4GFGA 3DNEA 4TNBA 3QRTA 5DBXA 4FICA 5CAUA 2CNVA 4NIFB 5DI1A 4DFXE 5AR8A 5IQBA 2XK6A 4UYNA 4MNEB 2B54A 3FQEA 5FXRA 3CTHA 4IWDA 5IA5A 5CI7A 5JFWA 4YHJA 5EYMA 5L6WL 3AOXA 4DG3E 4FIIA 2XKCA 4G9RA 5FG8A 2KTYA 5AR5A 4FSMA 4ZK5A 3ZO1A 1ZMUA 5AV1A 4MQ1A 2IW8A 4FOCA 3VBYA 4TPTA 5AV0A 2A19B 4AG8A 5AA8A 4BI0A 2VO3A 5HVJA 5BNJA 4S32A 4M69A 3MPMA 3KULB 3VUMA 3OT3A 5ETFA 2PUUA 2WMSA 3ORZA 3LCSA 5TKDA 4CFUA 1OL6A 1IRKA 4ZIMA 2VAGA 2R5TA 1OUKA 4IWOA 3ZRMA 1PHKA 2UZTA 3EFLA 4FT3A 3VULA 1Q4LA 2Z7SA 4RIXA 4BGHA 4FV0A 3SW4A 4BN1A 3RTPA 1FMKA 5AM7A 4AWIA 4BDEA 4KKHA 4AA5A 4R1VA 2E9OA 5LQFA 2XKFA 2BZJA 3A2CA 2WXVA 4FZDB 4RRVA 5KZ0A 3BELA 3EIDA 4FV3A 3FUPA 3UPZA 3GNIB 4KS8A 4RIYB 3BGZA 2QU6A 4BBMA 1YWVA 1OPKA 2XJ2A 5FUTA 4V0GA 1H0WA 4FNWA 4BCOA 5CEMA 3FMKA 3W18A 1GZ8A 1HCLA 3EHAA 3Q4TA 3WZJA 1OB3A 3VF9A 3SG8A 4MH7A 4BVUA 4QQ5A 3KY2A 1J91A 3V5JA 2G9XA 3HRBA 4EOKA 4FV9A 4RFYA 3ORTA 4TY1A 1SM2A 5T3QA 3W2SA 2Q0NA 2P55A 4TWPA 1DAYA 5AM6A 4ITJA 1MUOA 2AC5A 2XP2A 5HG9A 3BLHA 3D7TB 1BX6A 3RNYA 3AC2A 3QQUA 2IZRA 3A99A 5CNOA 3RNIA 5HKMA 5HIBA 4WT6A 4JDIA 3CP9A 4QMYA 3VO3A 2I6LA 1BI8A 4RIWA 4U43A 3ZH8A 4IAIA 4WA9A 3C0IA 2X1NA 3AT2A 4YNEA 4ID7A 2J0JA 4DGLC 5IH6A 5IUGA 4I4FA 3IDBA 3BYMA 3MYGA 3UZTA 3P1AA 4DYMA 1YXXA 2GHMA 4FT5A 4YZBA 5B7VA 1OIUA 3R9DA 1X8BA 2VNWA 2OKRA 3O8UA 3RZBA 4I4EA 1Q8UA 1H8FA 4J7BA 3V5TA 4NWMA 3QZHA 2ACXA 3HMMA 4RIXB 5BVKA 4UMUA 1FINA 2VX3A 4D55A 4FT0A 1JVPP 5AAFA 5EKNA 5M55A 3E93A 3G0EA 4ZTQA 5J79A 2R3GA 4EH5A 1OI9A 4YTCA 4KNBA 5HE2A 4BB4A 4FTNA 4I94A 2RF9A 4AFJA 3OCBA 3ZO3A 3LM5A 5CU3A 4D0XA 4YPDA 4G2FA 5AV2A 3UMXA 4IB3A 3PXYA 4QTCA 2F57A 2B9IA 3OFMA 2HZNA 3QU0A 1XO2B 3OOMA 4FG7A 5ETIA 5BUEA 5LCJA 5A4QA 4I92A 3G6HA 3NR9A 1MRYA 2BCJA 1YRPA 3SC1A 3CPBA 1ZOHA 3N51A 5J9YA 4TYHB 4GUBA 4C4HA 3LCKA 4JBQA 2J0IA 2WMAA 4U40A 4CV8A 4DTAA 4UWCA 4BIDA 3TNQB 4AGDA 4X2GA 3V5LA 4FUXA 1WBVA 4FSYA 4R3RA 1J7UA 4LM5A 3UNJA 4R77A 1WBWA 4JG6A 4ZZNA 4KA3A 4I41A 5CF4A 5GNKA 4C0TA 3DOGA 3QD4A 3PJ2A 3U51A 4LOOA 5IQAA 3ZZEA 1YXUA 3MPAA 2ERZE 2B9FA 4KWPA 2ESMA 3HLLA 4QP6A 2FGIA 4EBWA 2Y0AA 2IO6A 1GIJA 2HK5A 4FZ6A 1OVEA 1O9UA 5AP2A 3VF8A 1W8CA 1FVRA 2JDTA 2YM8A 3R9NA 3BQCA 3DK3A 4D4SA 4XS2A 3CC6A 2CLXA 4L9IA 3ZM4A 3UZPA 2C5NA 4E3CA 4HYIA 3RP9A 1ZRZA 4G16A 2W99B 4QMZA 4G3GA 4C7TA 2W4KA 5A9UA 2CKPA 4A06A 2BUJA 3QTIA 4ZS4A 4FKTA 4WG5A 2WU7A 5HX6A 4FSQA 3GU4A 3DU8A 5JMSA 4XG3A 1BKXA 2RFDA 4I6QA 4OR5A 3P86A 4BF2A 3OZ6A 4EH8A 5DRBA 4O6LA 3E63A 3BIZA 3C0GA 3FY2A 4I0TA 4RX7A 3NDMA 4USDA 4C59A 4MHAA 4O84A 2UW6A 3KC3A 5AR4A 1W98A 3C9WA 3QAME 3NVKI 5HI2A 3OC1A 1OECA 2F7XE 2Y9QA 4MBIA 1VEBA 1BYGA 2H8HA 4C34A 5L6OA 3NAXA 3JUHA 4ALUA 3O2MA 5CLPA 4P90A 5E8TA 2G1TA 3TJDA 2V55A 4K6ZA 2X8IA 2W1IA 1RJBA 5GZ9A 3ZO2A 4FKQA 4JJRA 4ZSAA 5A6NA 4CFXA 3FKNA 4IX5A 4YO6A 3EL7A 4AZEA 4L42A 3COIA 4NU1A 4Z55A 3EKKA 1P14A 2OBJA 2WD1A 4LRKA 5CEIA 4FTJA 5IA3A 4BIBA 3MI9A 4UWBA 5IZFA 4KKEA 3F66A 4XHKB 5LVPA 2YHVA 1TVOA 2QQ7A 3EQIA 3KRLA 3OUKA 1H27A 4C57A 3VJNA 3BU5A 3DNDA 2XIRA 4D4YA 4NM0A 3QA8A 3T9TA 4FEUA 2WMTA 3G2FA 3P9JA 3PTGA 5ACBC 4BYIA 1AQ1A 4UZDA 3S2PA 1LPUA 2B4SB 5IUIA 4O0VA 3DPKA 1IAHA 2DUVA 2W05A 4BC6A 1EH4A 4MXYA 4XRLA 3A4PA 3OROA 2R3LA 2VWZA 2C68A 4FKLA 2YCQA 3R1NA 5C9CA 1L8TA 4L6QA 4JQ7A 3GFEA 3NW7A 2GFSA 3RKBA 3CPCA 3F69A 5LARA 5J9ZA 5D11A 4L7FA 4BZOA 3R0TA 2CKQA 5M56A 2QOBA 4GK3A 2XK7A 3DXNA 4L3LA 4QYHA 2UVXA 5EYDA 3HRCA 4BL1A
chains in the Genus database with same CATH superfamily
2YZAA 4F65A 3DK6A 2JFMA 3B2TA 3MB7A 5EM5A 3UO5A 4I93A 4Y73A 1CKPA 4CG8A 3VS3A 4OTPA 1Q99A 3HMPA 4F7SA 3BWFA 3KF4A 2R0IA 3P0MA 2VO0A 3FMJA 5CZIA 4DH3A 2X0QA 1H1WA 4PL4A 2FUMA 3QLGA 2BMCA 3Q6WA 3AC1A 4IM0A 3RM7A 3VNTA 4D1XA 3CQWA 2XEZA 3FWQA 5IKWA 3Q04A 3DXPA 3EYGA 3FBVA 3KA0A 3LJ0A 3NUNA 4WKQA 3F2RA 3TDWA 4RGJA 4WBOA 3DAJA 3HRFA 3U8WA 1PMUA 3EOCA 1ZOEA 5BVNA 4KIKB 4N70A 2EB2A 3UJGA 2G2HA 5DEYA 2YDJA 4A9UA 4BCIA 1SVGA 3ZFYA 1UKIA 3AC8A 2PUIA 4E7WA 1OUYA 2PHKA 1GJOA 3VS6A 4WSQA 1M7QA 4MYGA 4LMUA 4Z7HA 4BYJA 5LWMA 1KOAA 2OJIA 2PVJA 2W5AA 3KKVA 5EHOA 3SLSA 5A4LA 5TO8A 4I24A 4JG7A 4N6YA 3W10A 3FJQE 4IDVA 2VX1A 4M68A 3VS2A 4JAIA 4XH6A 4Y72A 2JC6A 3FXZA 4BDCA 1ZYCA 3BZ3A 2XNEA 2G2IA 3E62A 4R7IA 4C4EA 5BMSA 2Y6MA 3PP0A 4ACMA 2VWVA 2CCIA 4BCKA 3NUYA 4GYGA 4AOJA 5A4TA 5EQPA 2CN5A 2X4FA 4DEIA 2JITA 4OBOA 4CLJA 5D9HA 1J1CA 4GFOA 4BDKA 5HIDA 4G17A 4F0IA 4IC8A 2WMVA 5BYLA 3C0HA 2J6MA 3VQHA 2XA4A 3AMBA 2B52A 2VTPA 3NW6A 4HZRA 4JBPA 4LI5A 2F7EE 3UG2A 3HV7A 1W84A 4GT5A 4TT7A 3DJ6A 3NCZA 3F61A 3E5AA 4UZHA 5GJGA 4FKJA 5AUYA 4FK3A 4PDSA 3ZCLA 4EUUA 4O1PA 4XOZA 3ZLXA 4YLJA 2ZOQA 2GNFA 5AUXA 3ERKA 4DG0E 5M07A 5CSHA 3EQRA 2VWIA 2XIYA 1FVVA 2X0OA 5H9BA 3EN6A 3RM6A 3UIBA 4GVJA 2HWPA 3ZYAA 3O0GA 3SVVA 1PXOA 3O50A 4H1JA 1SVHA 4HVHA 3K3JA 4MXAA 5CXZA 4ENXA 3NYNA 2X8EA 3EB0A 1T45A 3R73A 4G9CA 3KXXA 4RBLA 2ITWA 5IDNA 2JBOA 4XG9A 4MUQA 2C6KA 3V04A 1V1KA 2AYPA 3II5A 4IX4A 5AP4A 5EH0A 5BYZA 3DB6A 4FV2A 3U4WA 4BCMA 2XCHA 2XJ0A 4ZY6A 3KVWA 5CAPA 4AX8A 1Y57A 1G3NA 4L68A 1JPAA 2HY81 2PTKA 4QMTA 1CMKE 4FKWA 2YITA 2YABA 3EFJA 3QC4A 5ANKA 2QVSE 3WOWA 3PWYA 4ZMEA 4E4NA 4R7BA 2B53A 4DA5A 1LP4A 3BBTB 3LW0A 4I1ZA 1WMKA 4FX3A 4EK6A 4C35A 5M08A 5KBRA 2B9JA 3F3ZA 2BHHA 5C03A 4ANOA 4DH5A 4A9RA 4QMQA 2JKOA 3LPBA 4DF3A 2BTRA 4KIQA 5ITAA 4JNWA 4AA0A 3VVHA 3TUDA 2P4IA 4RC2A 2GHGA 2HW6A 4YHFA 3ZC5A 4PF4A 4DFUA 3DLZA 5IQCA 3COMA 4EKLA 4KUJA 2PY3A 3WZUA 5K0XA 3HDNA 2ZVAA 3KL8A 4PPCA 2VU3A 2QOQA 4QYGA 3UOJA 2C6IA 2H34A 4FJVA 4HCUA 4MD8E 3GGFA 5KKRB 4AT4A 1Z9XA 4MBLA 4JX7A 3VS7A 3PUFC 3PJ3A 1YWRA 5EOBA 1Z5MA 1ST4A 3CD8A 3P4KA 4PQNA 2XK3A 3FHRA 3U9NA 4J8MA 3EN4A 3IPHA 2J90A 2GS2A 3NFFB 3CD3A 4XP0A 2OIQA 4CZUA 2LGCA 3W0MA 3E87A 4E93A 4E20A 4C33A 4KSPA 2W9ZB 4O0SA 2FSMX 4R3CA 2YWPA 5B2LA 5AJQA 5EM6A 3PFQA 1W0XC 2C5OA 4JI9A 4ZTSA 4QP4A 1G8SA 3MY1A 3NYXA 3HA6A 4PMTA 3UP2A 5BPYA 2C3KA 3TUBA 3Q2MA 4F7LA 2XBJA 4KINA 4ANNA 3AKLA 4AN2A 3FZRA 5HNBA 2CN8A 5K5XA 5LMBA 2X7GA 4HGTA 3R8PA 1Y6AA 1MQ4A 4MWHA 3TZ9A 3EQBA 3F3TA 3SQQA 3MIAA 3OEFX 2R3PA 3ORNA 3I6UA 4ITHA 3MGYA 5DMZA 1K2PA 4FKUA 1YHVA 5LJJA 3PVBA 4AOTA 2BIYA 3AXWA 2CNQA 4AZSA 4DGMA 3F3WA 2BZIB 3COHA 4RWIA 4FGBA 4B0GA 5HZNA 1Q3DA 4DE4A 2WTJA 3LMIA 2JIIA 5M4IA 2IN6A 3E3PA 3QRKA 4DEAA 2FYSA 2GNLA 4RLKA 3PA3A 1A48A 2FH9A 4L3JA 1ZZ2A 3WF5A 1YXSA 3QGYA 5K5NA 3RBWA 5CS6A 4CZTA 3FXXA 4YPSA 2SRCA 4G6OA 3E8CA 4HVDA 1OBDA 4BBEA 2VGOA 4L52A 5FRIA 3N4UA 4GFMA 3AKKA 2VUWA 3EQPA 3HMNA 5I3RA 4H58A 4OUCA 4M12A 4R5SA 2XBAA 2JDRA 1WBSA 2NO3A 2VTQA 2WQOA 4CFVA 3H9OA 3QX4A 3ZC6A 3CSVA 4A4OA 4AW0A 4GMYA 1OBGA 2YCRA 4P7EA 5GIPE 2C6DA 4TXCA 1UWJA 3GXLA 4NK9A 4TYGA 4DFYA 5CT7A 4UEUA 4AT3A 4ZXTA 1G5SA 3QC9A 4G5JA 4L00A 2IG7A 2IZSA 5FTOA 3RK5A 3UC4A 1F5QA 3ZLYA 5M06A 3LFFA 4WIHA 2YM4A 3DBFA 2VTTA 5FTQA 3QCQA 4EOOA 5I9XA 5M4FA 1YQJA 4O38A 3Q9XA 4H36A 2UVZA 3QRIA 3ZEWA 4OTHA 1MP8A 4DEDA 3F9NA 4UYAA 2J5EA 4IE9A 5ANIA 5DE2A 4OBPA 5L2IA 4IH8A 3NUUA 3WF9A 1JOWB 4I5PA 3MB6A 3DQWA 5EI2A 3TMOA 2JBPA 3H3CA 2ETMA 1XKKA 2UW3A 3DK7A 4X2NA 1KSWA 2W1DA 5CYIA 4DEHA 3PP1A 1ZZLA 1XBBA 2QKWB 3QZIA 4DN5A 4FTOA 4DH7A 3PE2A 3BHTA 3NZ0A 5KE0A 3EQFA 4CQGA 3EL8A 5M53A 3IW4A 2REIA 4L67A 4CD0A 4R78A 1OGYA 5JEBA 3TN8A 5CF5A 4FTTA 3W0NA 2YIQA 1PJKA 4I23A 2YM5A 5E8UA 2UZWE 1UA2A 2CCHA 4F78A 3PPKA 1E1VA 3Q32A 2EVAA 4EI4A 4E4XA 1Z57A 2GTNA 3L9LA 3PVUA 5AX9A 3R22A 3QZFA 3QYWA 4IFCA 3F82A 3S00A 4TYJA 4EH6A 2XNGA 3DA6A 3IW7A 4YGAA 1UU7A 4XLVA 1ZWSA 4QP2A 1JKSA 4F9YA 3RCJA 2RSVA 5LMAA 2QHNA 2PMLX 3BEAA 5M4UA 1OL1A 4C2VA 4YR8A 4FKSA 4MTAA 4DEEA 5E4HA 3OXZA 4RVTA 5HU3A 1XMLA 2V22A 3VUKA 2P2HA 3ZU7A 4FV7A 4FIJA 2YA9A 4O7LA 3TUCA 5B0XA 3S95A 4TNDA 1CKIA 4D2WA 3W0PA 1PKDA 3MV5A 3LQ8A 1HOWA 2RFNA 2XAOA 2XJ1A 1PMNA 3L8SA 3F3VA 1F0QA 2WTIA 4YC6A 4GIHA 2IVVA 4GS6A 4B9DA 4AW5A 1QL6A 2R3FA 3DJ5A 5H2UA 4C61A 3QQJA 3KRRA 4K9YA 2WFYA 4U97A 1PF8A 4UWYA 4IW0A 4K1BA 3EN5A 1REKA 4A07A 3OG7A 3RMFA 3FDNA 4IVAA 4A4LA 4F1TA 4FMQA 2BAJA 2VTIA 4L7SA 3FYJX 2NPQA 1H1PA 3VS0A 4IB5A 4B4LA 4XG4A 4I6HA 3TTJA 2YERA 3R04A 3ZBFA 3H0ZA 5T6KA 4PNKA 3FSKA 4PNIA 5HIEA 3ITZA 3EN9A 2YEXA 2X4ZA 3I7CA 4L3PA 4EOPA 4Z3VA 3ML1A 2YN8A 3HGKA 3RWPA 3TZ8A 3QCXA 4XV9A 4PUZA 4TWNA 5KHXA 3ROYA 5GIOE 4GK2A 4BZDA 4WUAA 4ASZA 3GCSA 4BGGA 5HLWA 4IZYA 4HZSA 2O5KA 2WB8A 3UOHA 4N6ZA 3QTWA 2W4OA 5J95A 4CQEA 4DLJA 4ZMFA 5K4IA 1M52A 4GG7A 2G15A 4D5KA 3KMUA 1XBAA 3GC9A 1OL5A 4FA2A 4FF8A 3RPRA 2DQ7X 4H39A 2ITTA 1H28A 3M11A 5C1QB 4TWOA 3MH0A 2PVNA 5JZJA 3I0OA 3EQDA 2F7ZE 4EL9A 4FEXA 2VWUA 3AD6A 5JGAA 3IKAA 4TWCA 3LMHA 2QD9A 4JIAA 3R6XA 4NUSA 4X2KA 4ZOGA 3QZGA 2QONA 4F09A 2QO9A 2CGXA 4IB1A 2UW8A 3OMVA 3ZDUA 5IEVA 2YCFA 5J7BA 3WIGA 3MESA 4YSMA 1XH4A 4CKRA 4I6LA 3B8RA 4ORKA 5EW3A 2UW5A 3CKWA 4AZWA 4WG3A 1U5RA 1KE7A 2HIWA 3KXMA 2UZEA 4X3FB 4FL2A 3OCSA 3NNUA 4O1OA 4DGNA 3HDMA 4MCVA 5A14A 3LLTA 1PW2A 4OTRA 4V05A 4MD9E 3QWJA 3TXOA 2GMXA 3QKMA 3PY0A 5FDXA 3P7BA 4GV1A 1YOJA 1GNGA 1ZYSA 1U46A 4AZVA 4F1OA 1IAJA 3UDSA 4S30A 3QHRA 1WBPA 5G6VA 4C37A 3V8WA 4CKJA 5F4NA 4QNYA 3C4XA 3MW1A 2JKQA 3O8TA 3HV3A 3UO6A 1RQQA 1V0PA 3IGOA 4EC9A 4UN0C 3MTLA 1URCA 4KD1A 2X7OA 3UNZA 2EXMA 2XRWA 4M8TA 3MSSA 4QMOA 3NUAA 2W1FA 4FIHA 4GU9A 2X81A 4DINA 4YSJA 1CSNA 3E88A 4KBKA 2GU8A 1FBNA 2ZV8A 4C3PA 4M3QA 4BDHA 5LWNA 3PE1A 3C5UA 2YLFA 2VZ6A 4D2SA 3EKNA 4UV0A 5HD7A 2OH0E 4A9YA 3W16A 3OWPA 4W8DA 4F6SA 3QTSA 5F1ZA 3ODZX 4ZY4A 3MPTA 2I7QA 4JG8A 3TWJA 4FEVA 3KVXA 2EWAA 1UU3A 5EM8A 3R7OA 4WHZA 2XYUA 5DVRA 2OXDA 4DFLA 1E9HA 3FI2A 4BDAA 3S0OA 2C5YA 1JAMA 1OPJA 2QG5A 1B38A 1H08A 1U5QA 3CCNA 4QQCA 5AUWA 4CFMA 4AU8A 3AKJA 3VAPA 3SOCA 4JRVA 5DPVA 3Q4ZA 4X2FA 4CGAA 4U41A 2ITPA 1FQ1B 4E73A 4FNZA 2NRYA 2X9FA 3OW3A 1KE9A 3C4ZA 3JS2A 4RJ7A 1PYEA 3NGAA 3GCQA 2W0JA 3LZBA 3PXRA 4ACGA 4EHZA 4W4WA 4E6AA 4GKHA 2X7FA 4XG6A 2ZB0A 5DH3A 5LOHA 3C5IA 5CY3A 2A2AA 3FPMA 4FRFA 3TL8A 3MA6A 2ITYA 1OM1A 4BI2A 4M7IA 1JSVA 2XKDA 3PXFA 3G90X 2FSLX 4LGGA 4E4MA 2W1GA 5AP5A 3BPRA 1NVQA 3VQUA 3AC4A 4ZLOA 4H1MA 4XBUA 3K3IA 2C6MA 3AC5A 1LUFA 4FZFB 1TQMA 5L8JA 4AXEA 2NNWB 2GNHA 3DTWA 5TF9A 4EZ7A 4IZAA 3KK8A 4QYFA 4CMTA 1Q8YA 5LVLA 4QMLA 5L2TA 4QPSA 3VUGA 3NCGA 5KMNA 5F20A 1G8AA 1UNLA 3R7IA 3ZMMA 4GT4A 4FGRA 3GU5A 2ZV9A 3ORXA 4J71A 4XP2A 4QQJA 1HCKA 1STCE 3A7JA 3HL7A 2H9VA 3DXQA 2HZIA 4TYIA 2BRMA 4G3FA 1OIYA 4EJ7A 1CTPE 4MF1A 3SXRA 4X3JA 4XEYA 3P79A 4QRCA 2JDOA 3FQSA 1SYKA 3DGKA 4YJVA 3KXHA 3FI3A 1WVWA 4USEA 4ASDA 5HD4A 3V8TA 3DDPA 3OY3A 5CU4A 1M7NA 3ZFMA 5HICA 3JVRA 2VGPA 3U6IA 2CSNA 2QR8A 4M69B 3F5PA 4ACHA 5E8ZA 4PV0A 2C4GA 3BKBA 4EUTA 5L2WA 4U80A 3P23A 2IW9A 3OT8A 2R3QA 1IR3A 3UOKA 2ZFYA 3TACA 4IB0A 2X39A 1SNUA 4HYUA 3D15A 5FM2A 5A46A 1P4OA 5J5SA 2GSFA 2QCSA 1XH5A 5FBNC 1PMEA 4FG9A 3Q96A 3DBDA 3OWJA 3JYAA 4FTLA 4JVGA 3TTIA 4EOQA 5IG1A 3BL7A 4AXAA 3TNIA 4USFA 1YVJA 2YM7A 1OKVA 5HNGA 3T8OA 2R3KA 3GU7A 3BYVA 5EFQA 5EYKA 5C27A 2PZRA 5HCXA 4V0GB 3ZUVA 4NKSA 2YIWA 2CMWA 3BYSA 2BFXA 3EJ1A 4EZ5A 5L4QA 4YJOA 2O2UA 1QPEA 1UKHA 5EI6A 5K0KA 4CZYB 4HVGA 3MJ2A 4EOMA 5B2MA 5A4CA 2IWIA 2JIVA 3NX8A 3PY1A 4EK3A 3PPJA 5E92A 1Q3WA 4AA4A 4ZP5A 4EH2A 4UXLA 3QA0A 4PL3A 4EOSA 2WEVA 1M2QA 1Q8TA 3QLFA 4IAFA 2XCKA 3OW4A 3LFQA 4RFZA 2WQBA 5C8KA 3DAEA 3PUPA 2OJJA 4GIIA 3PVGA 4WG4A 4HYSA 4RIWB 3NAYA 4EOJA 4G1WA 3V8SA 4JMQA 2WTDA 3BEGA 4J52A 2ZYBA 5FGKA 3LCOA 4GVAA 3PIYA 2R3HA 3SDJA 5J8IA 3MBLA 2I0HA 1ND4A 4S31A 5EM7A 4KB8A 1PXJA 3BI6A 3QQKA 3R1SA 3WARA 1JNKA 3ZZWA 5I9YA 3I6WA 3UQCA 2NRUA 3BCEA 2R3MA 4AXCA 3W0QA 1H24A 4O4BB 3IO7A 4OTFA 1UNGA 2VTHA 3F2AA 4CV9A 4U9AA 2VTNA 3SRVA 3A8WA 1UV5A 3AC3A 3ZSHA 4DTBA 3DQXA 4O0UA 4J95A 3WE8A 3UTOA 2X2LA 3TV6A 2CKOA 1GY3A 4YZ9A 4BWPA 4PTEA 3UOLA 1H1RA 5E8YA 2AUHA 5HO7A 4I5MA 5TT7A 5AV4A 5AP7A 3K5VA 3Q6UA 2VX0A 1YXTA 4MWIA 4V04A 2J9MA 4ALWA 2XH5A 5CAOA 2VWWA 4U42A 5C26A 3EMGA 5DGZA 4JDJA 2WTKC 5AA9A 4OTIA 4EK8A 3ODYX 2XS0A 1G8KA 3GU8A 2R2PA 3PSDA 4BKYA 5JRSA 3PRIA 4M14A 2I40A 3UIMA 3SHEA 1JSUA 4ANBA 1IASA 3H0YA 2P0CA 3HP5A 4IZ7A 4F99A 2WTVA 3DB8A 5K4JA 4O0WA 5FD2A 5FDPA 2CGUA 3ZUUA 4BCNA 2QOHA 4F1MA 2QOFA 4O21A 3LJ2A 3OCGA 3QQHA 1J7IA 1Q8ZA 1ZY4A 3E7VA 4FTIA 5AAEA 4F6WA 1YKRA 4XV3A 3MH1A 4EH4A 4BDBA 2F2UA 4LUEA 5E91A 2UZLA 4E26A 3L9PA 4O81A 3O7LB 2Z02A 3Q3BA 2WMRA 3RHKA 4FT7A 3P7CA 4O7VA 2BVAA 3CS9A 2C3IB 5AX3A 3GCPA 1GZKA 1ZAOA 3TZMA 4ONAA 5E8WA 3UE4A 2QOOA 5KNJA 4FSZA 4GKIA 3TJCA 1H25A 4IC7A 2J0MB 2V7OA 3E92A 3EZRA 3PYYA 3SRVB 4GH2A 4UMQA 1KOBA 3AQVA 4I6BA 2H6DA 4Q9SA 4M84A 3EH9A 1ZY5A 4YJPA 3W2OA 1XWSA 2I0EA 3FMLA 5CSXA 3R63A 4NW6A 5FEQA 2OI4X 1L3RE 3RPSA 3MFRA 4NW5A 4XUFA 5IQDA 4DEBA 5IF1A 3ZXZA 4O96A 2RL5A 2UW7A 1J7LA 3D4QA 4TTHB 5AIKA 4QTDA 2G01A 5JFXA 5A6OA 1BL6A 1ZLTA 4FV4A 4JDHA 4AW2A 2JDSA 4GL9A 2NYAA 4IQ6A 2QLQA 4DBNA 3F5XA 3QCYA 3ANRA 2B9HA 2QHMA 4DGOA 3MVMA 5LVMA 1RW8A 3NS9A 1WFCA 2BRBA 2HENA 5CAVA 5C4LA 4BY9E 4FVPA 5M09A 4J96A 3AGLA 3HVCA 3KN6A 4ASEA 4UMPA 3OEZA 1ZXEA 3K5UA 4G3EA 4XP3A 4BZNA 4HVSA 4GEOA 3WBLA 4HGSA 3GENA 5D12A 3ZLSA 2ZV7A 3VBQA 2JLDA 2IZUA 5CVFA 1BLXA 1OIRA 4O6EA 2C0OA 2OO8X 4W4VA 2B7AA 4FOBA 2WPAA 2A4LA 5IA1A 5GJDA 2E9PA 3U9CA 4E1ZA 4BDDA 4DHJA 4KRDA 3WZEA 4JOAA 2HCKA 4JX3A 2WKMA 3PVWA 4YMJA 5CU0A 4LDTA 2XNPA 4C4FA 4G31A 1JQHA 3TIYA 2ITOA 2OGVA 5KMIA 4QNAA 2I1MA 4F0FA 1CM8A 1LEZA 4K0YA 3BHYA 5HCYA 4I22A 3ROCA 5DEWA 5JN2A 1XHAA 4QO9A 2V62A 5CZHA 5CEKA 5E90A 2WOUA 2WIPA 3ORIA 1H26A 3ALNA 3IG7A 1S9JA 3A7FA 3GCUA 2XNBA 3IOKA 5JZNA 3W2RA 3ET7A 2PUPA 2R7BA 3DS6A 4ANSA 1UU8A 2YZLA 1QPJA 3I81A 3EZVA 4ZSJA 4K11A 4F0GA 1ATPE 1OL7A 4DAWA 3R1YA 2VTMA 3NIEA 4M67A 1GOLA 1XR1A 3TCPA 4AQKA 4ZTHA 4BBFA 2OWBA 3WE4A 5CALA 5E8XA 1GIHA 5CSPA 2A1AB 2R0UA 4NL0A 4IJPA 4B6LA 1JWHA 3A7HA 3TKHA 2BKKA 1P5EA 3FMMA 3R21A 2W1HA 4OLIA 5LMKC 5JT2A 4KIPA 4BTMA 4E5AX 3ORPA 1UVRA 4A4XA 3OD6X 4AQCA 3D94A 5HOAA 3C13A 4F9WA 2GQGA 3RZFA 3QWKA 2R3NA 3R71A 1WZYA 3ATSA 2OIDA 3OOGA 3WYXA 1NVSA 1RDQE 3POOA 4FKIA 4WNKA 4TRLA 2W4JA 4JQEA 5CU2A 5JKGA 5JGDA 3CQUA 3Q4UA 5DLSA 3ZDIA 3CXWA 4FTUA 4ZS0A 2OH4A 5EOLA 4BDFA 4FV5A 3NUXA 3UP7A 1XH9A 2DS1A 3LAUA 5IPJA 3MN3A 4B8MA 4Y95A 1GZNA 4ZSEA 3L8VA 4RVKA 5DR9A 4RJ4A 2QR7A 3C51A 3O71A 3QL8A 4FI1A 2BTSA 4IACA 4WUNA 4XBRA 5FP6A 4FSNA 5IA4A 3QFVA 4EHEA 3MDYA 3PPZA 4EH3A 1M17A 2A98A 5A4EA 5DWRA 2VWYA 2UW4A 4NCTC 3FLWA 3I60A 2XIXA 3O51A 4OTGA 5HBEA 1R0PA 4EWQA 3LLAA 5IDPA 4UBAA 1UWHA 4D2PA 4YLKA 1H01A 3PY3A 1WBTA 4RMZA 2BR1A 2OFVA 3Q52A 1R3CA 2BRGA 3GT8A 3GP0A 4IM3A 2EXCX 4S33A 1LEWA 2IPXA 4MXOA 3PSCA 5KMKA 2ETRA 4OT5A 3FL4A 3TV7A 3G9NA 3G5DA 4IEBA 4MK0A 5BVDA 3IDCA 1OZ1A 4O7YA 2J51A 4FSTA 2CHLA 4X0MA 4QQTA 4EWHA 4FG8A 4DEGA 3TZ7A 4FYOA 1NA7A 2W5BA 2XIZA 3DBQA 4JL9A 3ELJA 3U55A 2VN9A 3VWAA 2PMOX 3C50A 4D1ZA 3GOKA 4CRSA 3D7ZA 5AMNA 3R00A 3Q4CA 3KCKA 1J1BA 3P78A 4RC4A 5K3YA 3R8LA 4V01A 2QO2A 1SMHA 3N9XA 5AFVA 2X2MA 1URWA 2J2IB 5GHVA 4PMMA 3QD0A 3EQCA 4FKOA 2E2BA 2YM6A 4TYEA 1JKTA 2GDOA 2JFLA 3H4JA 5CENA 4D1SA 1QPCA 2J7TA 2Y4IB 4RWLA 4EHGA 4NJ3A 1IA8A 3MVHA 3WF8A 4C4JA 2Y6OA 2ZJWA 5IMEA 3S4QA 4YC8A 2ZDTA 4W9WA 4QMXA 3O7LD 4L45A 3JR1A 4AF3A 2XM9A 2PVHA 5KBQA 4ALVA 3QQGA 4NFNA 2FO0A 4EH9A 1TQPA 3HAVA 2E9VA 4YJSA 5EK7A 2YM3A 2JEDA 1P4FA 4LG4A 4RVMA 3PZHA 4FT9A 5E8SA 3VS4A 4RQVA 4LMNA 5H8BA 4D58A 4Z9LA 3NIZA 2QO7A 3R28A 2X2KA 4E5WA 2ZMCA 4FIGA 5HESA 4GU6A 4I0RA 3UVRA 3UVQA 3G6GA 3KFAA 1A06A 2C30A 3BHHA 3GCVA 3OS3A 4PL5A 5CSVA 5HBJA 5JFVA 4NTTA 3NUSA 2CKEA 4PDOA 4YURA 5DR6A 3W8LA 4IDTA 4LRJA 3D83A 4BDGA 4DTKA 3LVPA 3QBNA 3TM0A 2JAMA 1M14A 4WNMA 4WSYA 2IVTA 3DT1A 4MD7E 2ZM3A 4S2ZA 2ZMDA 4PDPA 4QYEA 4NYEA 4HPUE 5HQ0A 4X21A 2UW0A 4YO4A 3FLQA 4JXFA 3FYKX 5C8MA 1AGWA 4YBJA 4G34A 3PWDA 4C38A 2J50A 4P5QA 5GZAA 3TKIA 3LFNA 3IW6A 1OL2A 5FP5A 4CCBA 4DGGA 3GOPA 3BX5A 5BVEA 4C62A 4ZTNA 1H07A 3VW8A 3KXNA 3BGPA 4FODA 2OFUA 4KIOA 3L8XA 4JAJA 4H3QA 4HPTE 3ACKA 2UZVA 2Z7QA 5BUJA 5IH4A 3RPOA 3BLRA 1I09A 5DOSA 2J0KA 3TKUA 5BVWA 4RX5A 3FE3A 2BIKB 4FL1A 5KKRC 3MVJA 4AAYA 4FTKA 1FGIA 2ITVA 1OIQA 3ALOA 4JR7A 4ZSLA 4BJJA 3QUDA 3W33A 4QDEA 5HNIX 4ZSGA 3G0FA 3ACJA 3PZEA 2PPQA 4WD5A 2YFXA 2Z7RA 5EYCA 4YTIA 4ERKA 2RFEA 3RK7A 4DH8A 2WGJA 3A62A 4WRSA 2GNGA 3LXLA 4PTGA 2GNIA 3NW5A 3QGWA 4IAYA 3CQEA 4O0YA 3V5QA 4ZLZA 1APME 2CDZA 3DBEA 4I20A 4FKVA 4FTCA 4FVQA 4ZY5A 3S1HA 4PRJA 4GUEA 5JSMA 1K9AA 3JPVA 4I3ZA 4KBCA 5I4NA 1XMMA 3ATTA 3BLAA 4O7ZA 4B7TA 2QU5A 3HUBA 4F9CA 4D28A 2PUNA 1O6YA 3FV8A 3QUPA 3FZ1A 2OICA 2YACA 5CQWA 3THBA 2CGWA 2C6LA 5AUZA 1FGKA 1YHSA 2WMBA 4MXCA 5HEZA 4O4EA 5HTIA 3FZTA 2RFSA 3D2IA 3ORKA 3FPQA 5L8LA 2WQNA 3H30A 2C5VA 3DKFA 4C58A 3JY0A 5M4CA 4BR3A 4J53A 3LCTA 2WOTA 4I5CA 5DNRA 4A9TA 1SVEA 4EH7A 4LOPA 2F9GA 3GC0A 4CMUA 4B99A 2RG6A 4FNXA 4C3FA 4DHFA 2EXEA 4BCQA 3ZLWA 4N0SA 2WTCA 3FLYA 4F6UA 5H8GA 4E5BA 2VTLA 2WU6A 4FVRA 5KZIA 4Y5HA 4F9BA 5GINE 2PE1A 3PDTA 2QC6A 5FXSA 5BQ0A 4IJ9A 4BJJB 3EQHA 4U0IA 2P2IA 4UY9A 4IAAA 4BCJA 4H05A 3KXZA 3PSBA 3F2NA 4RJ5A 4O4DA 4EJNA 2WEIA 2R4BA 3RAHA 4AXFA 5AP0A 3HZTA 4X6RA 3IS5A 2PZIA 3E8DA 2C6EA 3V51A 1Q62A 4ZEGA 3BHVA 3GI3A 2J0LA 3QTUA 1V0OA 3R8ZA 5IEYA 1YOLA 3E64A 4KSQA 2QKRA 2XYNA 3NUPA 5AP1A 3ZXTA 3HP2A 1W7HA 5I0BA 3K54A 4L43A 4CRLA 1BI7A 1B6CB 1WBOA 4HOKA 3VHKA 4LV7A 4ZZOA 3SKCA 1CKJA 4EHVA 3GBZA 5BUIA 4J97A 3DCVA 4W4YA 2R3IA 3GB2A 3ANQA 2HXQA 3O96A 2IZTA 1SNXA 4O83A 4QMMA 3G33A 2ERKA 4NIFA 5IQGA 2PVRA 4S34A 4U45A 4XG2A 3ZFXA 5J5TA 5HO6A 3DLSA 1ZYDA 1KV2A 3BV2A