3C7QA

Structure of vegfr2 kinase domain in complex with bibf1120
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
301
structure length
286
Chain Sequence
RLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKDFLTLEHLIYSFQVAKGMEFLASRKIHRDLAARNILLSEKNVVKICDFDIKDPDVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vascular endothelial growth factor receptor 2
publication title BIBF 1120: triple angiokinase inhibitor with sustained receptor blockade and good antitumor efficacy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 286
sequence length 301
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3c7qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3c7qA01
4A4OA 1UV5A 4AN2A 4ZLZA 4PMMA 3IO7A 4QMVA 4Z3VA 1NW1A 3F2AA 3ENHA 3HRBA 3DBEA 4IAFA 3F5XA 5CT0A 3ROYA 3UDBA 4DGOA 5FWKK 2G15A 2O63A 3ORMA 3ZO3A 2G01A 4V0GA 3E7OA 3R8LA 5A14A 4MQ2A 4C61A 5I9UA 3HYHA 2RG5A 2A0CX 3CSVA 4M69B 2XYNA 4LOQA 3HUBA 4I6HA 4MTAA 4U9AA 3D94A 4B4LA 5CU0A 4ENYA 2PMOX 5EK7A 1QMZA 3UBDA 3WZJA 4FKLA 3ZYAA 2Z02A 4DFLA 4QMXA 4QD6A 1JWHA 3KL8A 1KSWA 2GHLA 3PVGA 5C8MA 2BAQA 3MPTA 3FUPA 3PPJA 2XKCA 1QPCA 4HNFA 4I4FA 4R5SA 1Q99A 3R7IA 3HUCA 1HCKA 2XNEA 3E93A 3KF4A 3EN9A 2QO2A 3PFQA 4L3JA 4M15A 4HYIA 4K2RA 3AC1A 1J1BA 2W5AA 4I94A 4C7TA 5HE0A 1VEBA 1XWSA 3OBJA 3DK7A 5FTQA 4M3QA 4UB7A 4CG8A 3C4FA 4TTHB 1W83A 5DFPA 4G6LA 4YBJA 4G5PA 4O0SA 3BKBA 5GNKA 3RINA 2ZB0A 3LMGA 4FKUA 4ENXA 1PRYA 4IWQA 5HBJA 3OCTA 4AE6A 4L8MA 2VTMA 1OUKA 1REJA 4L43A 3SXRA 4D2TA 3ORKA 4JBPA 5J87A 4DH8A 2G2IA 3JYAA 4RT7A 3R7GA 4IAYA 3I5NA 3A4PA 2R3GA 2XK7A 3UNZA 2PUUA 2HY81 3CQEA 3PVBA 3N9XA 3TKIA 4EK3A 3G15A 4LUEA 2VWYA 3DTWA 3D0EA 3F5PA 4YLKA 2ZM3A 2WELA 5DPVA 2ZDUA 1XH9A 2ITZA 4CV9A 1CKPA 5KMIA 3FZPA 4GH2A 4YJOA 2QHMA 3LFNA 3DBCA 5FXQA 2RF9A 3KVXA 5IQIA 3VHEA 3GC9A 3EQPA 3WOWA 2C6TA 3BZ3A 4DITA 1PJKA 4DCAA 4O82A 4Y85A 4DGGA 5EOBA 5HEZA 4ANQA 3JR1A 2CGWA 4JDHA 5C9CA 4FTRA 4W4WA 3E63A 5DR9A 3OD6X 3WF8A 4F6WA 2J0JA 3C5UA 4C59A 4FZFB 4XYFA 5DLSA 4R5YA 5I5ZA 3ACJA 1UNLA 3F9NA 4IZ7A 4BVUA 1H1WA 4FV7A 4YO4A 2CGXA 4FIGA 1TVOA 1KWPA 2XMYA 2JEDA 4AA5A 3UPXA 2WTKB 2G9XA 3EZRA 4TWPA 4FGBA 4ZJJA 3FMNA 4FG9A 4FKTA 4CCUA 2Z7SA 3GU7A 2HXLA 1UKHA 3L8VA 3F7ZA 3R2YA 4FTNA 3FI4A 4O0YA 3TXOA 4BZOA 4YTIA 3AD4A 2BKKA 3QD4A 2REIA 4YJQA 3A8WA 4LFIA 5CI6A 5DA3A 1F5QA 5J5SA 5A3XA 5TF9A 2OW3A 2W9ZB 5EYMA 3FPQA 4AFJA 3RHKA 3W2CA 1SYKA 2ITOA 4C62A 5IA2A 2CKOA 1J3HA 3VS6A 5KKRB 4IWPA 3T3VA 2WU6A 4Z9LA 2OJIA 3GC7A 4FG7A 4NJ3A 4RIXA 3ROCA 4E5BA 1YWNA 1WMKA 1YDRE 2JD5A 3EYHA 3TNIA 5JSMA 3MESA 3UZRA 5IQEA 5CS6A 2PZRA 4JBOA 4ASDA 5IQAA 2VO0A 2CSNA 3CIKA 3AT3A 3VBWA 1UNHA 5CLPA 2CKQA 5KMNA 2GS6A 4IIRA 1GZ8A 3VRZA 2XJ1A 5CZIA 3NMUF 5JGDA 2GQRA 1L3RE 2W9FB 2RFDA 4QP1A 4DEAA 5DN3A 4G9RA 4CMTA 2WNTA 4BTFA 3NS9A 4G2FA 1PXOA 4C4JA 3DGKA 3GB2A 3JPVA 4F7LA 4PL4A 4XHKB 5AMNA 3TZ7A 5KBQA 5HG7A 5CALA 2R7IA 2ETKA 3FBVA 3FMJA 3C50A 3N4VA 4NZWB 4EK4A 3MFTA 3NUSA 3V01A 3ZO4A 4U80A 1IAHA 4FTQA 3NVMB 5BMMA 1Z9XA 1E9HA 5G6VA 3I5ZA 3V5LA 4E7WA 4M67A 1ZYDA 4HGTA 2WMVA 2BHEA 3WF6A 1AGWA 3QUDA 3DOGA 4ANSA 4O27B 5B2MA 5FDPA 5H2UA 4KUJA 3QTSA 3BYUA 3COKA 2ERZE 1H26A 2ZOQA 3WILA 5M4FA 3NWWA 4DFZE 4FE2A 2R5TA 3FZ1A 4J99A 3R7YA 5L4QA 1G5SA 4ZSGA 3K5VA 2C0TA 1ZOHA 3DNEA 4O38A 4ZZOA 2W1CA 4IB1A 2IW8A 3KXXA 2H9VA 3UO4A 4N4SA 2BRMA 4EYMA 2X6DA 2W1EA 2Y4IC 3NNUA 4CRSA 4BCQA 4S32A 2GNLA 4H05A 2QR8A 5EKOA 3JVSA 2CNVA 5FQDC 1DS5A 4QT1A 4OW8A 5DBXA 5M53A 3RPSA 4PY1A 4GCJA 3QQKA 2ONLC 5L2TA 5DOSA 3HMOA 4H1JA 4HVGA 4I4EA 2V7AA 4TWOA 5ANOA 3R8PA 3TG1A 3BU5A 4R7BA 2R3FA 4W9XA 3NAYA 3EZVA 5F95A 4ZSEA 4MD7E 2JDSA 4CRLA 2NRYA 3BYMA 5T6KA 3ZLXA 4A9SA 4RJ7A 2BZHB 1OIQA 2H96A 4KSQA 2OFUA 2QO7A 1HOWA 3KXMA 3OTVA 1WBWA 2B0QA 4II5A 3VUGA 1P14A 2XS0A 3CPCA 3OEFX 3FQHA 4G9CA 3VHKA 5LXMA 2Y9QA 3IGOA 4RIWA 4K11A 3ORIA 1ZLTA 2OU7A 3L8PA 2FYSA 3W18A 4N6YA 2YLFA 3UODA 3O96A 2XIYA 3R71A 4I6QA 2X1NA 2XIXA 3PXFA 2G2FA 3LZBA 4FTOA 4O0UA 5KHWA 4QPMA 4DC2A 3I7CA 3EQBA 2NNWB 1OIRA 1ZMVA 2XNBA 3RVGA 3ZO1A 4ZTRA 1U5QA 1LP4A 4RJ5A 5ANJA 2X2KA 4K18A 3F5UA 4N0SA 4ANMA 4YPDA 1OL5A 4FV0A 4JT3A 4CQGA 4PWNA 4RA5A 3TN8A 4BDEA 4QMTA 1O9UA 3PXYA 2JC6A 5L2IA 3WZKA 3FV8A 4GKIA 2G1TA 1GAGA 2R3OA 3NW7A 4G31A 3Q2JA 3OUKA 2C30A 4L7FA 1JAMA 4M13A 2VUWA 3FE3A 4KIQA 1WBTA 1M7QA 3GCQA 2XNOA 3ATSA 5CSHA 4NEUA 5AJQA 3C4WA 3V8TA 3ZRMA 2PHKA 1FQ1B 2QONA 5AV3A 5KMLA 4XLVA 4HVHA 1Q5KA 2VX0A 2BFYA 2WTWA 2B9FA 4CVAA 2YCQA 3A99A 4ANLA 2YIXA 4WSQA 3RHXA 1QPDA 2R2PA 4QQJA 4IAKA 4Y5HA 2QCSA 3D4QA 1H08A 2BRNA 2R3IA 4WD5A 4QP9A 2WTJA 2C3IB 4YUQA 2PY3A 5JT2A 4L3PA 3DS6A 1CKIA 3HECA 3TIZA 5CSWA 4L6QA 3A2CA 3EKNA 5GIOE 3LAUA 2HELA 2J7TA 5JK3A 3BHUA 5EI6A 3I0OA 3KFAA 4C35A 5FM2A 3L9MA 3PJ3A 4C4HA 3KRRA 3QTRA 4S34A 4R7HA 3OT3A 4CZTA 2YACA 4KIOA 2HYYA 5ACKA 3WYYA 5EQYA 1DI9A 1WZYA 5H8BA 2OJFE 3DK3A 2VWUA 3G2FA 4IDVA 5JFVA 3OF0A 5HBEA 4QRCA 3VRYA 4LMNA 3WF5A 4LRKA 4MAOA 2EXEA 4AU8A 2J5EA 3VBVA 3P23A 3O0GA 3KRXA 5BYZA 4BCPA 4AGWA 5D7VA 3MTFA 3Q60A 3P7BA 1U5RA 4CKJA 4JOAA 4L68A 2WU7A 3QCQA 5AAGA 2UVZA 3MVLA 4EOIA 3KB7A 5HVKA 4EOMA 2JDTA 4EKKA 4ZAUA 2XK4A 2Y0AA 5AP3A 3ZLSA 4B99A 1VZOA 4F9WA 2UW6A 1Q97A 2OJJA 3MFRA 5DYJA 4FSTA 2IZUA 4FT0A 4ZTQA 4RWJA 5EYKA 3DKCA 2YCSA 2BZIB 4FTAA 3LPBA 5M09A 1GJOA 1ZOEA 3RPVA 2O5KA 3VIDA 5I3OA 4ANBA 3SGCA 3HA6A 3TV6A 2P55A 4KRDA 4CG9A 3CCNA 5A4QA 3AMYA 3POZA 4IZ5A 4F6SA 5AP6A 4GIHA 4O6LA 4RJ4A 3S1HA 3D5XA 2WIHA 3BBWA 3FKLA 3SX9A 5L6OA 4GG7A 2HIWA 4PP7A 5EI2A 1U46A 2UZNA 2AC3A 3V8SA 3ZFYA 3I6UA 3NRMA 4KSPA 4MWHA 4NM5A 5K5NA 4EZ7A 4FV9A 3OUNB 3VC4A 1GZKA 3RAWA 4BKZA 4FKRA 4CKIA 3JY0A 4F9BA 4DG3E 5LMBA 2VTNA 2BALA 4BI0A 1RJBA 3KGAA 3EQGA 4XMOA 4ZLOA 3LLTA 4AACA 3QLFA 2XKFA 3DAJA 3U9CA 4M8TA 4O0WA 3LVPA 3G33A 2WMTA 4AZWA 1V0PA 5CANA 5LVPA 3AC8A 4L01A 4FVRA 1Q8WA 4EYJA 2HY0A 3E3PA 3QCYA 4YLJA 3VAPA 5AV2A 1XBAA 3G9NA 3VQHA 4QPSA 4D0XA 1YVJA 1UWJA 3DXNA 3SQQA 2VTJA 4CT2A 4W4XA 2GS7A 2YJSA 3D15A 5DG5A 3QTXA 5BVWA 3ZH8A 2YITA 3VBTA 3BQRA 2WTKC 3LFAA 4DGLC 1YXVA 4YJUA 2PMNX 3BRBA 4TY1A 5EOLA 5IKWA 3WF9A 5IQGA 3QGWA 2BTSA 5EM8A 1YXUA 4EH5A 3RP9A 4IADA 2C5VA 3FWQA 4QTAA 3OWJA 2BDFA 4MXXA 4IWOA 4AP7A 3BGQA 2WMBA 4TWCA 2C6IA 5CVGA 2EB3A 3R30A 3BU6A 3SW7A 1YHSA 3NIEA 4O0RA 4YHTA 2J50A 5M55A 5A4TA 5KKRC 2IO6A 3PLSA 2OWBA 3DLSA 4FMQA 3T3UA 4X6QC 2XCKA 3E3BX 5KO1A 3RNIA 2WQNA 3E87A 3D7ZA 4BCGA 4I22A 4FSMA 5AR2A 3MSSA 3IGGA 4XG8A 3NNVA 4HYSA 4E4NA 4M69A 4AA4A 5ANDA 5HCZA 4TT7A 2V62A 5AA9A 1LR4A 3MVMA 4M12A 4IE9A 5LJJA 2GTNA 4YZBA 3GCVA 4BBMA 4FZ7A 4GT5A 3IW8A 2FGIA 4U0IA 4BIBA 5E9EA 3S2PA 4BKJA 4XP0A 5A6NA 4A7CA 5T3QA 4CLJA 4GVJA 4KAOA 3HAMA 2IW9A 2C0IA 4U7ZA 3RAKA 2JDOA 2OXDA 3GU6A 1CM8A 2F7ZE 4KBCA 3UQGA 4DEHA 4BTMA 3TZ8A 5HNIX 4I21A 3MN3A 3GC8A 4G3FA 4D55A 3MI9A 3UVPA 4DG2E 4FOBA 3ZRLA 3NNWA 2FSMX 2XJ2A 2OFVA 4RRVA 4WNPA 5ANIA 1VYZA 4D4VA 3DAEA 1F3MC 1ZYCA 2C1BA 5LOHA 3E8NA 4ANOA 4O86A 3ODZX 5JZJA 2QG7A 4J95A 4PUZA 5H9BA 2CCHA 3F5GA 2Y7JA 3IKAA 4UMQA 2OF4A 1W98A 4USFA 3SD0A 2YLEA 5EFQA 4IX5A 1H24A 2J9MA 2GHGA 5H8EA 3SOAA 4JRVA 4BCFA 2X7GA 3KCKA 4KS8A 3DAKA 3MY1A 5HI2A 3R9DA 4BDJA 5CAOA 4ZOGA 3U6IA 1PXLA 4MNEB 1M2PA 1ZWSA 1WVYA 4GS6A 4IB3A 3PSDA 3KK9A 4HGLA 2X9EA 3KULB 1H8FA 2ZJWA 2YA9A 4CLIA 2WHBA 4BI1A 4XG7A 3VQUA 3AGLA 4KIKA 4FTLA 4EOJA 2OK1A 2XNMA 4F70A 4RJ8A 4MXOA 4PL3A 3Q32A 4RFZA 2W1FA 2C1AA 3HV4A 3KY2A 5F1ZA 2ETMA 2BAKA 4DTAA 3GCPA 4MF1A 2VWVA 3RM6A 4DH3A 3PP1A 1FVTA 3P78A 1FVVA 4XJ0A 2AYPA 4ZTSA 4XV1A 3ZS5A 3HMNA 5KMKA 4FNZA 4FEWA 1O6LA 4FGRA 3AT2A 3TNPC 3EIDA 4ASZA 4WUAA 3NCZA 3ULZA 3LM0A 4EHGA 2YCRA 3MW1A 1ZYLA 5HNBA 4KBAA 4XG9A 3KC3A 1H1SA 2PVRA 4ERWA 4YJTA 3MFUA 4D9TA 3TUDA 5HORA 4E6QA 5HU3A 4JX3A 3QRJA 4YLLA 4IZYA 2J0KA 1GIJA 3ALNA 4D28A 4F0FA 3FXXA 5AV4A 2PZPA 5LMKC 1UU3A 3GUBA 3KN5A 3R0TA 5A54A 4FKQA 5HLWA 1JOWB 4L45A 4UYAA 2I40A 5CVHA 4RWLA 2PL0A 2F57A 3OZ6A 4A06A 3BBTB 4LOPA 5F9EA 5JFSA 3MA6A 2PUPA 1CTPE 4FT7A 4F9AA 4D5HA 3E5AA 4FIEA 3H9OA 3LLAA 3GOKA 4ZMFA 1ATPE 2YAAA 3TDWA 3UMXA 4OTQA 5GZ9A 4FSNA 4A9RA 5CTPA 3BHTA 4EOKA 3LHJA 5AAFA 5BQ0A 1I44A 2BIYA 4YTCA 5IQHA 3R22A 5CU4A 4U97A 4U6RA 3LCOA 4AN9A 5LCKA 5G1XA 2WXVA 4IFGA 3GBZA 1BL6A 4IW0A 4M7IA 4PX6A 5E8SA 3F82A 5HE1A 3MH0A 4NCTA 5DVRA 5KCVA 5IA0A 3VS3A 3BE9A 3MFSA 4G3CA 1YXXA 4I24A 4BDGA 4E5WA 2C68A 3CC6A 4JIKA 4D2WA 4QP8A 2UW8A 5AR8A 3ITZA 4I0RA 5I0BA 4NK9A 5M4CA 3AC4A 4E6CA 4IAAA 4X3JA 4QYGA 4ZTHA 3BX5A 4EH9A 2X2LA 3G6GA 4EH7A 2XCHA 4J7BA 5IEXA 3BHHA 3KF7A 5BYLA 2O2UA 2DS1A 2OZAB 4JJRA 3UC3A 5K4JA 3E62A 3RI1A 5DEWA 2QU5A 3VBXA 5TO8A 1GNGA 3RM7A 5JH6A 5IZFA 3HV7A 4MEDA 4C4EA 3TWJA 5AP5A 3DBDA 4KA3A 4A9UA 3W2RA 3NX8A 3ORLA 3QRUA 4RIOA 4X7QA 4ZMEA 2GMXA 4E3CA 1J7UA 3W2QA 3DFAA 3BEGA 3BLRA 3NYNA 2CGVA 3WZEA 3MPMA 4CFUA 3CKWA 4O7YA 4PNKA 4QP7A 4QOXA 2QLUA 2NRUA 4D2SA 1KUTA 4ACGA 5D9HA 2PVYA 3JY9A 4O1PA 1XH7A 1BMKA 2XP2A 4GVAA 2C5YA 3QZFA 5FD2A 4ALWA 4ALUA 4UMPA 5AUUA 2VWBA 4BDHA 3HNGA 2FSTX 4IX6A 3QQGA 3AGMA 1CMKE 3EFJA 3OG7A 5CWZA 5FP5A 3AG9A 3ATTA 4GKHA 2JFLA 2C6EA 4NM3A 2OZOA 2R3HA 4FTUA 2XUUA 5C26A 4DE4A 3NUYA 4FIHA 2PZIA 4DFNA 3TJDA 3R1QA 4DAWA 5HE3A 2DWBA 3O23A 4IC8A 1UA2A 2XKEA 2GFSA 3GP0A 3HDMA 4ANNA 2ZM4A 4HVDA 4PL5A 3LMIA 4FZDB 1UU7A 3P79A 1UKIA 2GQSA 2WIPA 4IB0A 4RGJA 4FYOA 4WO5A 4MX9A 4IM2A 4X2JA 5IUIA 3R9NA 5DMZA 4M14A 2WMXA 3OHTA 5CNNA 3SKCA 3T9TA 3V5PA 3ZBXA 3BHYA 2A19B 2ZV7A 4EOLA 3L8XA 4F9CA 3QQHA 4U79A 2CKPA 4YC8A 3VUHA 3UVRA 5CF5A 4FKIA 3B2WA 3IS5A 4IAIA 4CT1A 4D2RA 4MD9E 3TUBA 3NUXA 2ITTA 3EQDA 4KB8A 5AIKA 3BI6A 4FSZA 3UPZA 1TKIA 3EFKA 2WKMA 4KKGA 5HO8A 5L2QA 4ORKA 1O6KA 2YIWA 1RE8A 4XOYA 3V5WA 2Z2WA 1IAJA 1PF8A 3DKFA 3LFFA 4APPA 2BROA 4FODA 3OCBA 4PP9A 2EU9A 4FNWA 2P0CA 2XYUA 3TV7A 4NM0A 4FUYA 3UMWA 1BKXA 2O8YA 4NUSA 1LUFA 4KS7A 4RZVA 4CFWA 3BWJA 3NDMA 1Q8UA 3ZBFA 4AW2A 3OS3A 3CTHA 3FQSA 3QAME 2I0EA 4ID7A 3S3IA 3GFEA 5HTIA 3PTGA 3F3VA 1P4FA 3FLYA 4OBPA 2PE1A 2Z7LA 4P90A 2HZIA 3OT8A 4IX3A 4RJ3A 4EORA 5EKNA 4C02A 3MWUA 1SNXA 4FX3A 3ZUUA 4BGHA 3PYYA 1S9JA 4AOTA 4TWNA 3ZSGA 3CXWA 4AOIA 4NIFA 2WMUA 1FVRA 2VD5A 1KOAA 4P2KA 2IVVA 5ANEA 4AN3A 4JNWA 5C01A 2BUJA 3GCUA 4IVCA 4EH3A 1H27A 5DWRA 5JEBA 3NUUA 4EWQA 5CXZA 1Q8YA 2E9VA 3D9VA 3ORTA 4O7WA 2C6KA 3K3JA 5E7RA 2IVTA 3UGCA 4AT3A 2A4LA 4YNEA 1SMHA 1K9AA 5CF4A 1JSTA 2HZ4A 3KRLA 4NU1A 4RWIA 4XG4A 3TI1A 4F1TA 2E9UA 3FHRA 3M2WA 5KX8A 3IOPA 4XP2A 2VO6A 3HL7A 4PDSA 5M4UA 3QXOA 4XG6A 3PA5A 2RFEA 3M42A 3C5IA 5KMMA 1NVSA 1ZARA 4ACDA 2PVHA 4AZEA 4F1MA 2XH5A 3LXPA 3VW6A 2QQ7A 4JS8A 4XV2A 3L9LA 5A4LA 4XX9A 3CR0A 4TRLA 3P1AA 3GENA 3FY0A 2CLXA 2GSFA 3FLQA 4J8NA 3FXWA 2OH4A 4UXLA 3H9RA 4Q2AA 5AP0A 3ZDUA 4EEVA 2V7OA 4G34A 3AMBA 4J96A 4YC3A 4C3FA 2XM9A 3QWKA 5JN2A 4IJ9A 4QYHA 3VW8A 3FEGA 3F66A 1S9IA 2RG6A 3EQFA 3HV5A 2XIZA 4O21A 2Q0NA 3H0ZA 2HXQA 3NYXA 4Y72A 3LFEA 2Y8OA 3TIYA 2W5BA 5A6OA 2UZWE 4ZZMA 3FLZA 4KINA 4QMUA 2Z60A 3DK6A 4CQEA 5AP1A 4F64A 2W1DA 3CGOA 3RZBA 4BCJA 4HPTE 5HZNA 3Q6WA 4PRJA 5CAQA 5CEMA 2HK5A 3GU4A 1OZ1A 1QPJA 3IECA 3ENMA 4LYNA 2KULA 4R77A 1R78A 2XIKA 3ODYX 3RCJA 2JKMA 2FSLX 3OW3A 4FNXA 4UWYA 1UU9A 3LQ3A 3CTJA 2YM3A 4RC2A 3ZZWA 2AUHA 4YZ9A 3NSZA 3E64A 1CDKA 4RPVA 2R3PA 3PY3A 2GNHA 1OMWA 5C8NA 2PSQA 2VTLA 5KHXA 3SA0A 1IA8A 3KCFA 4FG8A 1YWRA 1JPAA 5ETAA 3OTUA 1E1XA 1WBPA 5AUXA 2EUFB 3VNTA 3P9JA 4G6OA 4LGDA 1B6CB 4PMPA 2IZRA 4Q9ZA 1OBDA 4GU6A 1R39A 2UZBA 4GFOA 1Q24A 3Q5ZA 4IC7A 4MBJA 3CLYA 4FTJA 1H00A 4WBBB 4DT8A 3PZEA 4TL0A 2UVXA 2VWZA 4I5HA 5E8YA 2PMIA 4U81A 3W55A 5GHVA 1OPLA 1NA7A 4QO9A 2WFYA 3COHA 4X6RA 4MF0A 4WG5A 2BIKB 2WEVA 1GIHA 5FRIA 4CZYB 4IACA 2E9OA 1KE7A 4I20A 5EHOA 4UXQA 5EH0A 2HENA 3NR9A 2FVDA 4FI1A 5EM7A 4GSBA 3F2NA 3OCGA 4UEUA 4EQUA 5HIDA 3GU5A 4WHZA 4WIHA 5DH3A 4UMUA 1SVGA 2XF0A 3V5QA 2CJMA 3A61A 2W1ZA 2A2AA 4E5AX 3GXLA 5AAEA 1PXIA 3NGAA 4ZXTA 2X8EA 3O8UA 4J71A 4LMUA 3TZ9A 3T8OA 3U87A 5L6PA 4X2GA 2NP8A 2E9PA 4O81A 4U43A 3ZTXA 4EH2A 4DYMA 3R21A 1X8BA 3NW6A 1OKYA 1PXNA 2EB2A 2B9JA 3Q4ZA 3RAHA 5K5XA 5M4IA 4YTHA 3DXPA 5FP6A 4BN1A 3K5UA 2C6OA 4DEDA 2P4IA 4KRCA 2YM7A 4OTWA 2GPHA 3VF9A 3UIXA 4BGGA 3PXRA 3QD2B 4A9TA 3O8PA 5KNJA 2OLCA 3P08A 4HW7A 3EQIA 2BPMA 3MJ2A 4FVQA 2J6MA 5EYDA 4Y8DA 1I09A 4RC4A 4IEBA 1MUOA 4Q5HA 5HTCA 4BCIA 4G17A 5J1WA 5DHJA 3R2BA 4Q5EA 4BYIA 3ALOA 1XKKA 1GY3A 4I23A 1DAYA 1LEWA 1OI9A 2Z7RA 1WAKA 2CN8A 3RK5A 5LVMA 1G8SA 4DEIA 4FV2A 3E8EA 4ITJA 2WB8A 5DEYA 2X7OA 2XBJA 4FTCA 5E92A 2DUVA 4PDPA 1DI8A 3MIYA 5HCXA 4MWIA 1WBOA 4CEGA 5FTGA 4DT9A 4QP3A 3BGZA 4OBOA 2W4OA 5IMEA 3I60A 3TTIA 5HIEA 4IFCA 2FH9A 4ZSAA 5BUJA 2QG5A 4UWBA 5I9WA 2ITNA 2XJ0A 4JRNA 4U8ZA 4BWXA 3WE4A 4EOOA 5D12A 2X7FA 3UJGA 3FQEA 4NTSA 2CCIA 3D7TA 4DEEA 4YJSA 1JKLA 3IDCA 2VTSA 4K8AA 2QOOA 3P7CA 3S0OA 3OEZA 2B7AA 3IW5A 5BYYA 2PE2A 1JQHA 1KOBA 3PZHA 1KE8A 5E8VA 2WMQA 1Y6BA 2W7XA 3LE6A 2W1GA 3CQUA 4EH8A 5E1SA 4G1WA 4F99A 5IEYA 3PJCA 4HNIA 1DAWA 3HAVA 4ZSJA 4FT3A 1AQ1A 3Q04A 2UZDA 4QMZA 1RQQA 1M7NA 4BHZA 3DCVA 4IM3A 4E26A 2CMWA 2J2IB 2C69A 5EQEA 3HKOA 5HLPA 2GTMA 3UNKA 4O2PA 5L8KA 4HJOA 4RX8A 1Y8YA 4G6NA 5GJFA 3R8ZA 4PDOA 1QL6A 3NUPA 4MK0A 2B55A 2RFNA 4FSQA 4R78A 1ZAOA 4C33A 4F0GA 1YDSE 2PK9A 3RJCA 1LEZA 2YCFA 5HX8A 1XHAA 5DR6A 4ASXA 4EC8A 4DFUA 4X2NA 5E8XA 5M56A 1PHKA 4F7JA 1W0XC 4XEYA 2R3MA 4RZWA 4U44A 3UIMA 2UZEA 4YC6A 4JLCA 4B6LA 3OROA 4IVBA 1JSUA 1GIIA 3DT1A 4FTTA 1JKKA 2V5QA 5JFXA 2YIYA 2ERKA 2ZVAA 5KZ0A 3EYGA 3F3WA 1PXKA 2PUIA 3DLZA 5HBHA 3BGPA 4CMOA 4FC0A 4A9YA 4ARKA 1OM1A 4BR3A 2C47A 3ACKA 2VTTA 3LQ8A 4YSMA 2X8IA 4PV0A 4JR7A 5CU2A 4FZ6A 3MDYA 5CT7A 3HMMA 2WGJA 2UZLA 3Q6UA 3D5VA 3QQUA 4FV8A 2DQ7X 5CEPA 5CU3A 4L44A 2ONLA 3HZTA 4UBAA 3PSBA 3LXNA 2PVNA 3L9PA 4TW9A 3TV4A 3WBLA 4YNOA 1XQZA 5JQ8A 4N57A 3HP5A 5AR4A 3FKNA 1YI3A 5E8ZA 1YXTA 3Q2MA 3WIKA 4JR3A 2R3KA 3BLQA 4IBMA 3ZHPC 2J5FA 2JBOA 3IOKA 3DA6A 3HEGA 3I6WA 4FK3A 3F7WA 2OZAA 1J7IA 2JBPA 3LIJA 2I1MA 3PWYA 5J1VA 1V1KA 3SRVB 2WOUA 4Y46A 4RLKA 2ZMCA 2ZV2A 3GQIA 3OP5A 3Q9WA 4LM5A 5CX9A 5BMSA 5FBNC 5CSPA 5IPJA 1IG1A 4J53A 3PRFA 1LPUA 2CDZA 4BDDA 1H0WA 1OL6A 2W06A 4FL1A 4FKVA 3R7UA 2X81A 3VF8A 4LUDA 3VUKA 4AX8A 2RFSA 3R8MA 3V8WA 1WCCA 1PKDA 2PYWA 4AUAA 4MQ1A 1UNGA 4BRXA 4ZS4A 3MS9A 1Z5MA 1BI7A 4AG8A 2XNPA 4EK8A 4I3ZA 4A07A 4RIXB 1FBNA 3C51A 4BC6A 2I0HA 3ID6C 3A7JA 5J79A 1V0BA 1WFCA 1YKRA 2GDOA 1XBBA 3E7VA 1WBVA 4NFNA 1W82A 1IEPA 2IZSA 3UZTA 1M14A 1P5EA 3GNIB 2HW6A 4YMJA 5KZIA 3ZSHA 4XLIA 3QHWA 4ALVA 3W33A 1H1PA 1XBCA 2RGPA 2Z7QA 2UV2A 2GFCA 4W8DA 5IDPA 5IUHA 4B9DA 3G0FA 3G9LX 2I0YA 1OKZA 2NPQA 3ZU7A 1JLUE 4W4YA 5B2LA 2OF2A 5A46A 4O7SA 3D2IA 3EFWA 3KXGA 2QR7A 4OT5A 1SVEA 2HOGA 3QTZA 1OBGA 4OGRA 2QOQA 5HVYA 3PJ2A 4R3CA 4H3PA 3SW4A 4XRLA 1U54B 1GZOA 3ERKA 3QX2A 2RL5A 4BB4A 3HRCA 1REKA 3R1YA 3QRIA 5EDPA 4EUTA 2VGPA 3F69A 3M1SA 2JDVA 2GS2A 1IA9A 1BX6A 5D10A 4UN0C 2OICA 4P7EA 3CD3A 5JRQA 5KMJA 4XUFA 3SXFA 3TUCA 2RIOA 2JIUA 3AD6A 3BELA 3M11A 4GG5A 5K0KA 2J0LA 3AQVA 4F4PA 4C3RA 4R1YA 4N6ZA 2XK9A 2R0UA 2A1AB 2QURA 2VWIA 5GJDA 4AGUA 2BCJA 2FUMA 2XNGA 3DV3A 3FMHA 3GFWA 4GU9A 4Q9SA 5AUZA 5AIRA 3RCDA 3RMFA 1OIYA 4HCTA 3LCDA 3L8SA 3QZGA 4U45A 3R02A 2EXMA 4OAUC 3KK8A 4APCA 4NYEA 4ZTLA 4XRJA 4X3FB 2BFXA 4ZZNA 3R28A 3OOGA 3PG1A 2WOTA 4JQEA 4R3RA 3WZDA 3VBQA 4WKQA 3FLNC 3QRKA 5CAPA 5ACBC 4IB5A 3U4WA 3L9NA 4CFVA 4DFXE 5J9YA 5IQBA 1STCE 3DDPA 4ITIA 4EZ3A 1M2QA 2R4BA 2UZOA 3ZRKA 5A4CA 3CEKA 3A8XA 2UZVA 1PW2A 3KKVA 2WZJA 4PPCA 4DHFA 4O7RA 2UVYA 2C3JA 4XBRA 3MV5A 4MH7A 3QTUA 4NW5A 4YJNA 3UYTA 4EHZA 3DQWA 2I7QA 5GIPE 4BWPA 4FL3A 3QXPA 2QOIA 3E88A 3A7IA 3UIUA 1JNKA 5ANGA 3PA3A 2OXXA 3NZ0A 5CNOA 4BBEA 4FYNA 2ZM1A 3P5KA 5IA3A 3FL4A 1Q61A 4O0VA 3VJOA 4BF2A 4BCNA 1SM2A 2XM8A 3KU2A 3VO3A 1OVEA 4QQ5A 4RWKA 2NO3A 2J0MB 3Q53A 4K9YA 3D83A 3FLWA 3DJ6A 4JQ7A 2F2UA 4RIYB 3U51A 4ACCA 3LJ0A 4JBVA 2ITPA 5HESA 3S00A 4IMYA 4QMNA 3EMGA 5IMXA 2WPAA 2JIIA 2VZ6A 3BYSA 4I6BA 1TQMA 3UO6A 2GHMA 3VUTA 2O65A 3W10A 4DTKA 5A4EA 4IDTA 5FTOA 4PMSA 3PLAE 1MQBA 4ZTNA 3V6SA 3L1SA 1ZZLA 2EVAA 4P4CA 3F61A 4O96A 4O7NA 3NEWA 2HZNA 4FEQA 3H10A 4FOCA 4JDJA 5GZ8A 4GJ2A 5DRBA 3CTQA 2WQEA 4DEGA 1YXSA 3VN9A 4YTFA 4CFFA 2I0VA 5FM3A 4O22A 2C6DA 2P33A 1YQJA 2QO9A 4BZDA 4C4IA 5CSXA 1FGKA 4F09A 3RTPA 4EZ5A 3Q4UA 1H01A 2BRGA 5CEOA 4AZTA 3ZM9A 3CD8A 4AT4A 3HP2A 3HMPA 5JQ5A 2FO0A 4LRJA 5DT3A 5ETIA 4WRSA 4D1SA 2WQBA 5AUVA 3WF7A 4AWIA 3UQCA 4EC9A 5CEIA 5KMOA 4BDBA 3C1XA 1NY3A 4IXPA 4AT5A 3QD0A 4WOVA 2XRUA 3DQXA 4IAZA 4IVDA 5E90A 3PA4A 4MYGA 4QP4A 4EHEA 1YHWA 1DM2A 2XIRA 3OCSA 2P2HA 4L7SA 4RVTA 4S31A 4P5QA 5EM6A 4OAVB 2C5OA 4FKJA 4OTFA 3RWQA 3UP2A 5M44A 4ZY4A 2PUNA 2VTPA 2BRBA 3F6XA 3A62A 2UW3A 2R0IA 3PRIA 2XB7A 2HWPA 3QQJA 4XH6A 4Y83A 2C5XA 3ZMMA 1P4OA 1ZY5A 4DINA 4L53A 4D1XA 1YWVA 2H6DA 4QQCA 5ETCA 5KUPA 4EOSA 2VN9A 5ETFA 3SXSA 5FEDA 3UVQA 3TACA 4F63A 2VWWA 4X2FA 4EK5A 1H1QA 4QTDA 4QYFA 1U4DA 4AZVA 1ERKA 1PY5A 2R3JA 1Q62A 5F4NA 3TNWA 2PU8A 3U54A 4YURA 4M0YA 4EOPA 3Q52A 4QMMA 5TT7A 2PMLX 4PNIA 1GOLA 4ONAA 4RG0A 3W8LA 4O1OA 5J7BA 5IQDA 1Y91A 3A60A 1G8AA 2XK3A 4E4LA 5J9ZA 4Z7GA 3UG1A 2X4ZA 3VVHA 1H07A 5CAVA 2X39A 3KRWA 4WRGA 4FTMA 3MYGA 3TEIA 3WYXA 4CSVA 4IWDA 1CKJA 4WG4A 4C2VA 1YHVA 3O8TA 1VYWA 4E93A 2OJGA 3REPA 2PZ5A 4D1ZA 2E2BA 1UU8A 4U3ZA 3EH9A 3BIZA 2X0GA 1Q41A 4WBOA 1H25A 3DU8A 4RSSA 4LL5A 4ZEGA 3WIGA 4RX5A 5E1EA 4S33A 4TYGA 4I5MA 4BTKA 4CV8A 4V04A 2PVMA 1BI8A 3PE1A 5J8IA 4QMPA 3RWPA 3RZFA 2W4JA 4DFYA 5AR7A 3QF9A 2PPQA 1ZZ2A 4HZSA 4KD1A 4FIJA 4NW6A 4Z16A 4EONA 5FXRA 4F7SA 5TE0A 3PP0A 1B38A 2C3KA 2VO7A 3QTIA 5AV0A 4ERKA 5AEPA 5LWMA 4BDFA 5HX6A 2IPXA 3E92A 3HGKA 1YOLA 4F7NA 3FAAA 2UW9A 3DZOA 4JAIA 4YU2A 2P3GX 3IDPA 3ZUVA 3AD5A 4BKYA 2YM6A 1NVRA 3MTLA 3O2MA 4QTCA 3F3ZA 4UY9A 4EOQA 2UZUE 3DJ5A 3LFBA 4GJ3A 4C38A 4FEUA 3GEQA 4U42A 1FOTA 2H8HA 5BPYA 3FZRA 3ZOSA 3EQHA 4RVMA 1KE6A 5C1QB 3JVRA 3ZLWA 1M2RA 2QOKA 5DI1A 4GUBA 4R3PA 4FKSA 4IVAA 4GT4A 4TNDA 1Y57A 4CXAA 4EH4A 2ESMA 1SVHA 4U41A 3DXQA 5LMAA 4AGDA 4X21A 2O0UA 5LMKA 3FKOA 2P2IA 2B9IA 3ZUTA 3HMIA 5DIAA 5E91A 3PXKA 3FXZA 3VS7A 3MH3A 4YJRA 3KA0A 3FSKA 3ZEPA 3LKMA 4V01A 2YERA 2RSVA 4U3YA 4FNYA 4KWPA 4RC3A 4UV0A 4E6AA 4DTBA 4UWCA 1E1VA 2LAVA 4RX9A 4JIAA 4ZJVA 5D41A 4H36A 5EI8A 4H1MA 3FDNA 3SV0A 3FYJX 3I81A 3K3IA 3VULA 2J51A 3NVKI 5EG3A 2GNFA 3T9IA 4DH1A 4FKOA 5AWMA 1YDTE 2IWIA 4WNOA 2YZLA 4FIFA 3MH2A 4O7ZA 3R83A 4YSJA 1ZYJA 4R1VA 5F20A 2OH0E 2XK6A 4EHVA 4LL0A 4NFMA 1QCFA 4D4RA 3W1FA 3R73A 4E6DA 3I79A 4LOOA 4QYEA 3SG9A 3SG8A 5GZAA 1B39A 1WBNA 3KRJA 3QC9A 1MRVA 5EDQA 3EOCA 2R64A 4C2WA 4XV3A 4TKSA 2QD9A 2A27A 3AOXA 3V51A 4WT6A 3FPMA 2ZV9A 4HPUE 3CBLA 3ZEWA 3ZXTA 3KXNA 5JRSA 4O83A 3HV6A 3EB0A 3QRTA 4I41A 4ZSLA 1H0VA 4AGCA 4WUNA 2X2MA 4FVPA 3OVVA 4HCUA 2J4ZA 4D2PA 3N4UA 2BRHA 3U6JA 4CGAA 3EHAA 2YM8A 5BX0A 1YOJA 4YO6A 5E8WA 4PTGA 2R3NA 4TYHB 3ELJA 3R9OA 5CASA 3SLSA 2IZTA 2DYLA 5IISA 3VS0A 3QWJA 1YRPA 3NW5A 4GYIA 5BVKA 3RK7A 4WA9A 1WBSA 3BE2A 5JFWA 3G6HA 2YDJA 2WTVA 2ITQA 3FHIA 3H3CA 1OKVA 3CS9A 5HNGA 3UC4A 4QTEA 2QOFA 4KIPA 5K4IA 1FINA 4W4VA 5BVDA 3FI8A 3MGYA 2ETRA 4MKCA 4FSRA 5CYIA 5FBOA 3UOKA 4L67A 5HQ0A 4O84A 4K1BA 3OMVA 3B8QA 3PVUA 3AT4A 3UIBA 1PMVA 3Q5IA 5LVNA 2BKZA 1PMUA 4ZP5A 1H28A 2CNUA 3UOJA 2R3LA 2Q83A 4X0MA 4L3LA 2BAJA 3DKGA 1H1RA 3EJ1A 3G0EA 3LXKA 4BIEA 4C8BA 1OB3A 4KIKB 5BUIA 3ORNA 3PXQA 4MBLA 2C3LA 2QOLA 4H58A 3UYSA 3PWDA 2QKRA 2XVDA 4YPSA 3ZFXA 4X3FC 1KE9A 4GUEA 1VR2A 4A4LA 3SOCA 4U40A 4C58A 2WEIA 1R1WA 4LI5A 4DLJA 5CF6A 4RQVA 5HO7A 3OW4A 4C3PA 4RBLA 4EKLA 5HLNA 1BYGA 3A7FA 3PUPA 4AOJA 1URWA 3I1AA 2PWLA 2VU3A 1RW8A 1GZNA 4IQ6A 4XBUA 2OO8X 4I0TA 5IG1A 4KABA 4IH8A 4OTPA 5T68A 5I9ZA 4IX4A 4M0ZA 3FMDA 3I0QA 4MNFA 3IONA 2F7XE 4DBNA 5J9LA 3F3TA 3KMUA 3GGFA 4ZK5A 3PJ1A 5L2WA 3QA8A 5CSVA 2ITXA 2PZYA 4ZJIA 3R7EA 4F0IA 4D0WA 4CZUA 4BCOA 3SRVA 2HZ0A 3D14A 5IA4A 1W8CA 1Y8GA 2WMSA 4UALA 1ZRZA 3ZZEA 4LGGA 3OXIA 4CKRA 5CU6A 4IANA 4BZNA 5J95A 4O91A 3ZDIA 4ACHA 3WZUA 3GT8A 2QOHA 4GK3A 3TZMA 2V55A 2QODA 3C7QA 4GFGA 1MP8A 5FDXA 1JBPE 4C57A 3RPYA 2Y6OA 2BVAA 3QA0A 3W16A 2R3RA 3GC0A 4CYJA 2XNNA 3ZLYA 2X6EA 2R3QA 2XRWA 4C0TA 3A4OX 3SVVA 5L3AA 4OTIA 4C37A 3EFLA 3FZOA 3QZHA 4GIIA 3BEAA 3PY0A 3EL8A 3R1SA 3U4UA 3RAIA 5AR3A 3RPRA 1J7LA 3W2OA 4PDYA 3FLSA 4GYGA 5B2KA 4MD8E 4M84A 3RGFA 4CD0A 5J5TA 4BGQA 3W2PA 4AAAA 2W5HA 4HGSA 4JDKA 2JAVA 5IF1A 2QC6A 4K6ZA 1WVXA 3IK3A 1W84A 4FKPA 4DCEA 5H3QA 2C6MA 4EUUA 5IQFA 1ZYSA 3LXLA 4AZFA 4F65A 4JXFA 5BNJA 3KREA 4LG4A 4EK6A 4GMYA 1OL7A 2JLDA 2EWAA 2B53A 2HAKA 4QMOA 4ZIMA 5LARA 5D7AA 4DGMA 3TM0A 1PXMA 4IM0A 2YM4A 2VX3A 1BLXA 4M68A 4DH5A 3Q9YA 3BV2A 1U59A 3TTJA 5IQCA 3VUMA 3C4XA 2F4JA 4HVSA 4B0GA 2PVLA 1MRUA 2UW7A 5AX9A 3ZFMA 5FEQA 5IDNA 4PPBA 4QNAA 3R01A 5FXSA 3LFSA 4RA4A 4NKAA 2GNGA 5IEVA 3OC1A 4FK6A 4BTJA 3QD3A 1BUHA 4YZMA 4AW0A 3BYOA 1U54A 3P7AA 5EM5A 2QOCA 4LGHA 2R7BA 3BLHA 4Y73A 3AC2A 3ORZA 4XV9A 3NAXA 2GU8A 4JG8A 2GQGA 1G3NA 1PYEA 2ZB1A 3A7HA 4GW8A 3OBGA 5BVOA 4FV3A 1M52A 3II5A 1J91A 3OWKA 4RQKA 2ITWA 4ZS0A 1PYXA 2VO3A 4QP2A 3QGYA 3V5JA 4QPAA 4NL0A 5IUGA 5DT0A 4BWKA 5AP4A 3MVJA 4LV8A 4LRMA 3CPBA 5K3YA 5AX3A 2WTIA 3EKKA 3LCTA 4FIIA 4R6VA 2OG8A 5HICA 2JAMA 5HOAA 3UZPA 3VBYA 4BDKA 3N51A 4X3FA 4J1RA 2QVSE 2XZSA 2WTDA 5IA5A 1XH8A 3O7LD 1XJDA 1RDQE 4BIDA 4FEVA 2JKOA 4FICA 3VJNA 1YOMA 1XR1A 2WD1A 1FPUA 3ZC6A 2VNWA 3SC1A 4AQCA 2UZTA 4FF8A 5LVOA 3OWPA 3OXTA 3ET7A 2C5NA 5B0XA 3FL5A 2X8DA 3HA8A 4O0TA 3WI6A 4F6UA 3SDJA 5DGZA 3Q4TA 3FJQE 4FTIA 1Q8ZA 2QOBA 2W99B 3DBQA 3K54A 4HOKA 3DPKA 4MBIA 5AFVA 2OI4X 4JL9A 5JKGA 3NPCA 4CMUA 1OITA 2ITYA 4YHJA 5D1JA 4MNEA 4GK4A 2V22A 3E8CA 4AS0A 3LCSA 4HGEA 3SHEA 4BCMA 3KXZA 4WNKA 4I0SA 3KULA 3VS1A 4TPTA 4BICA 5A9UA 2ZV8A 5CVFA 5BVFA 3PG3A 5F94A 3QHRA 2OKRA 3BYVA 4TYIA 3ZO2A 4KBKA 5LVLA 4J52A 5C27A 3THBA 4V0GB 2B9HA 2YAKA 4XS2A 4Z7HA 4G3DA 2CNQA 3HLLA 2JKKA 4H39A 3FYKX 4BDCA 2GCDA 4N70A 4RIYA 4ZLYA 4YZDA 5E4HA 3IG7A 3UOLA 3QFVA 2BTRA 1R3CA 1Y6AA 4PTEA 4BYJA 4YR8A 4DF3A 5C4LA 1HCLA 1JVPP 2XBAA 4MXZA 5E8UA 3ZCLA 5CZHA 4DN5A 2YABA 4V05A 4NWMA 4ZY5A 1A48A 3U9NA 5EW8A 1VJYA 2B4SB 4F1OA 3COMA 3VS5A 3U55A 2F2CB 3QKLA 4IZAA 4Y5QA 4B7TA 2PTKA 3R00A 3LM5A 3R8UA 4NJDA 1V0OA 1PXPA 4ZY6A 2VRXA 3NYVA 4NSTA 4QNYA 3VS2A 3O17A 3FY2A 3QCXA 2FA2A 3CJFA 3EQRA 4D9UA 1FGIA 5E8TA 2BDJA 2RKUA 3MB7A 5EYCA 5C8KA 3I4BA 4P5ZA 4NTTA 3R9HA 2XEYA 4OUCA 4RX7A 4CTCA 4FV1A 1OKWA 3C13A 2ZYBA 3CJGA 2YDIA 4B8LA 4E73A 3IQ7A 4H3BA 4OTRA 4UZHA 2GNJA 4G5JA 4G3EA 3FZSA 4FR4A 4ZTMA 5HG9A 4QMWA 2QLQA 1UWHA 4E8AA 4F9YA 3C9WA 3G90X 5HG5A 3B8RA 5HIBA 4CCBA 4E4XA 3C4CA 4NIFB 4EH6A 3ORPA 4NT4A 2HW7A 2PVJA 1K3AA 3ULIA 5HVJA 4FL2A 4HVIA 4I6FA 4HZRA 4BBFA 5BUEA 4D4YA 3C4ZA 3S95A 3TKUA 4BHNA 2C6LA 1KV1A 4FBXA 4O7LA 2Z8CA 5L6WL 5HE2A 5HCYA 4RVLA 1KV2A 3BCEA 5AR5A 2WMRA 4OTHA 4NM7A 4K77A 4QMLA 5CEKA 4J98A 4O7TA 4TNBA 5B7VA 5HD4A 2WQMA 5CENA 3QUEA 3IDBA 5I9VA 4QMSA 3TT0A 1QPEA 2R9SA 2EXCX 3UE4A 5EQPA 4PQNA 4I5CA 4UZDA 3DJ7A 2VTIA 1Q4LA 4YBKA 1FMOE 4IHPA 3EL7A 2IJMA 3IW7A 3VUDA 4BDIA 5LCJA 4J97A 3K2LA 3MPAA 4GFMA 4GL9A 4EJNA 3NLBA 2LGCA 3PJ8A 5I9YA 3EQCA 3R04A 3FMMA 2BR1A 3FMKA 2XEZA 3BV3A 4S30A 5ITAA 5EW3A 3OOMA 3NUAA 1F0QA 4JBQA 2OJ9A 1OECA 4JI9A 2Q0BA 5HKMA 2CLQA 5K0XA 1SNUA 3VWAA 5HG8A 4I5PA 3KN6A 1XH5A 3TDVA 3H0YA 4FV5A 3O50A 3R6XA 1OL1A 2AC5A 3FZTA 4DFBA 2CKEA 2QHNA 2ZAZA 4IJPA 2OBJA 2HCKA 4FZAB 3FI2A 1KE5A 3GCSA 3KVWA 4AF3A 2CPKE 3P86A 2JDRA 4O0XA 3P4KA 2WQOA 5C03A 3V5TA 3O51A 4DBXA 3AMAA 2ZDTA 3PE2A 2VNYA 2W17A 2B52A 1M17A 3PIXA 4FKWA 4PPAA 2FB8A 4MXCA 4W9WA 4WSYA 4CTBA 2HWOA 3H9FA 4G3GA 5FEEA 5KE0A 2W1IA 4JVGA 5DT4A 3O7LB 4RMZA 1APME 4UYNA 3D5WA 4D4SA 2YM5A 2XA4A 2VGOA 4AXAA 4HCVA 5HD7A 3ZXZA 5AUTA 2W0JA 2W05A 4BCHA 2F7EE 4C36A 3BWFA 1ZMUA 3IPHA 1CSNA 3LQ5A 4J8MA 4MHAA 4TYJA 1PMEA 5EHLA 4CFXA 4EWHA 3TKHA 4FV6A 3QBNA 3EN7A 4PMTA 4QMQA 2QU6A 5IH5A 2YWVA 1XH6A 3LFCA 3QQFA 1PMNA 3KQ7A 3OXZA 3ANRA 4YZNA 5CXHA 3W32A 5GINE 4X2KA 1YW2A 3MVHA 3FMEA 4PTCA 5LQFA 4AZSA 3ANQA 1Q3DA 3TCPA 3QYZA 3LFQA 3Q3BA 4FSYA 5CAUA 2UW0A 5M07A 4JDIA 2WMWA 4MXAA 3V6RA 4USDA 5CI7A 3FI3A 3MY5A 5AP2A 1XO2B 2G2HA 2X9FA 3UOHA 3R9RA 2O3PA 2YN8A 3E8DA 3CE3A 3UQFA 5CQUA 1XH4A 4XG2A 2PULA 4WNMA 3HX4A 5H8GA 1YI4A 1O6YA 3RNYA 1MQ4A 3C0IA 5I3RA 3WARA 2QI8A 4ACMA 3H4JA 4AW5A 3H30A 4TZRA 3RKBA 3EN4A 3BPRA 4JAJA 3QLGA 1A06A 4RJ6A 1T45A 2OSCA 3DB6A 3O71A 3A7GA 2YHVA 3QC4A 4I93A 3SAYA 5LWNA 5JZNA 3G5DA 1W7HA 2XK8A 2F49A 4FV4A 4OLIA 4XNEA 5BVNA 4EQCA 3RK9A 3ETAA 3LOKA 4YGAA 3I7BA 3Q96A 3ZONA 3U6HA 2VTOA 2WAJA 1NVQA 4NCTC 3PPKA 3EWHA 5TOZA 3D2KA 3FC1X 3V04A 5HTBA 4AE9A 3DY7A 1J1CA 2QKWB 2CHLA 3KXHA 1BL7A 3S4QA 3UNJA 4UX9A 3C0GA 4B8MA 3PVWA 4CYIA 1EH4A 5M51A 3JUHA 3PSCA 3BHVA 4LQMA 4QQTA 3W8QA 5AUWA 4Z55A 5L8JA 4EBWA 3NCGA 2X4FA 2OGVA 4TYHA 4Y95A 4M97A 5DNRA 3WE8A 4DG0E 4H3QA 4GV1A 3TJCA 2OIDA 3R63A 3GVUA 3CY2A 2W1HA 4RIWB 4EBVA 2O64A 4C4FA 4OR5A 3QKMA 5ICPA 4WG3A 3QALE 4FSWA 4GEOA 2B54A 1OPKA 2YIRA 3LFDA 3NYOA 3TNQB 1Q3WA 1NXKA 3UG2A 4OBQA 4DH7A 1AD5A 3LMHA 3G51A 3EN6A 5AM6A 5ANKA 5JGBA 3QKKA 2F9GA 3R8VA 3ZC5A 3GOPA 1MRYA 4BFMA 2IVSA 4EQMA 3UP7A 4AFEA 4L9IA 3CQWA 4YP8A 4CFNA 5AADA 4OT6A 4FKGA 2FSOX 3GI3A 3MBLA 2SRCA 2E9NA 4L46A 4E4MA 4KNBA 5HHWA 2ACXA 2C4GA 3D5UA 2UW5A 4USEA 3D7TB 5AV1A 3TL8A 2VTAA 1Q8TA 3MB6A 3UO5A 1JSVA 4MXYA 3F3UA 3AXWA 3DZQA 1IRKA 3COIA 5TR6A 2I6LA 3OFMA 2BILB 1P2AA 3Q9ZA 1OGUA 4DEBA 5EW9A 3V3VA 2YISA 4C4GA 4FT5A 3KEXA 3DKOA 3DNDA 4S2ZA 4BY9E 5CQWA 5AA8A 4ASEA 5IH6A 5M08A 4ITHA 5GJGA 2OIQA 4AA0A 5FLFA 4JG7A 2W96B 3PXZA 4O2ZA 5DRDA 3GU8A 5FG8A 4A4XA 2IN6A 4BI2A 5IU2A 5J7HA 4L42A 1ZMWA 2VAGA 2JITA 3CP9A 3DDQA 4DA5A 3MY0A 2YJRA 3QCSA 3DB8A 4RFMA 1T46A 4YJPA 5L8LA 4BCKA 3C4EA 2VTRA 1ND4A 4QMYA 2JGZA 4R8QA 4DGNA 2WO6A 3FC2A 4W8EA 1ZOGA 3LW0A 5M06A 3PIYA 2PVFA 4TN6A 4MCVA 4NH1A 4YZCA 2BHHA 5FUTA 2BZKB 5TKDA 1UVRA 2VTQA 4I92A 3QU0A 4M66A 2QNJA 3PPZA 1URCA 2KTYA 3DTCA 5CY3A 5AUYA 3ZM4A 3LJ1A 3HDNA 3QUPA 2WTCA 4FUXA 4FSUA 3NIZA 5L2SA 1TQIA 4DLIA 4GRBA 1OIUA 4I1ZA 4MVFA 3CGFA 3RALA 4TXCA 4D58A 4RFYA 4TYEA 1PKGA 3MA3A 4BDAA 4E1ZA 2GNIA 2Y4IB 4HYHA 5HU9A 3F88A 1YI6A 3AC5A 5JGAA 5BVEA 5CEQA 3JXWA 2ZMDA 3QTQA 3MIAA 3ZSIA 1L8TA 4HYUA 4KKHA 4QTBA 4XP3A 4YJVA 4UMTA 3NUNA 3OY1A 2VV9A 2PVKA 2OXYA 4FA2A 1OUYA 1TQPA 2YWPA 4GK2A 2IW6A 4LV5A 3PIZA 2BZJA 4L00A 4GT3A 3HRFA 3MJ1A 4K33A 4XOZA 1Z57A 1IASA 3AC3A 4FTKA 4XG3A 2ITVA 3QX4A 4RVKA 1ZY4A 1R0EA 2Y4PA 3KMMA 4QYYA 4BL1A 2W4KA 3BU3A 4K0YA 2BDWA 3CKXA 1PXJA 4FT9A 2JIVA 3Q9XA 2UUEA 4G16A 3B2TA 3VS4A 5FGKA 4JG6A 1OPJA 4XCUA 4R7IA 3UTOA 3IW4A 2IG7A 1WVWA 3QL8A 5AP7A 3QTWA 5EDRA 3QYWA 3TNHA 3LCKA 4C34A 5M57A 2J90A 3DBFA 3EN5A 3NNXA 2VWXA 3FSFA 3W2SA 2WMAA 1NT2A 3DFCB 3BQCA 3R1NA 4CFMA 1SZMA 2YIQA 4AW1A 3FMLA 2VTHA 5DE2A 4UMRA 4O6EA 2YFXA 4F08A 5IH4A 3N4TA 1OL2A 2B1PA 4FEXA 4D2VA 3GQLA 2CN5A 2H34A 4U5JA 5EHYA 5K9IA 4EJ7A 3MH1A 3PY1A 2C0OA 5CF8A 2JKQA 5IA1A 2PE0A 3R7VA 2OIBA 4EL9A 2UW4A 2VX1A 3VUIA 2YDKA 3PDTA 3OWLA 3HV3A 4O7VA 3QQLA 3QZIA 3HVCA 2XKDA 3POOA 4JX7A 5I9XA 1A9UA 1K2PA 4RLLA 3F2RA 1IR3A 3P0MA 1JKSA 3RBWA 1JKTA 4OTDA 3KMWA 4D5KA 5C4KA 5AM7A 4L52A 3LJ2A 4QP6A 5KBRA 2BMCA 2Y6MA 3ORXA 4CNHA 2ITUA 4YHFA 5HGIA 3Q4CA 2YZAA 5HO6A 1H4LA 3OY3A 3IW6A 5DR2A 3CY3A 2YEXA 5JMSA 2IVUA 4KKEA 3U8WA 3RPOA 4PF4A 4E20A 4EI4A 2JFMA 2J0IA 1R0PA 3C0HA 4OTGA 2CGUA 5D11A 1ZXEA 3R7OA 4JQ8A 4NKSA 5I4NA 1FMKA 2V0DA 3JS2A
chains in the Genus database with same CATH superfamily
4A4OA 1UV5A 4AN2A 4ZLZA 4PMMA 3IO7A 4QMVA 4Z3VA 1NW1A 3F2AA 3ENHA 3HRBA 3DBEA 2AEGA 4IAFA 3F5XA 5CT0A 3ROYA 3UDBA 4DGOA 5FWKK 2G15A 2O63A 3ORMA 3ZO3A 2G01A 4V0GA 3E7OA 3R8LA 5A14A 4MQ2A 4C61A 5I9UA 3HYHA 2RG5A 2A0CX 3CSVA 4M69B 2XYNA 4LOQA 3HUBA 4I6HA 4MTAA 4U9AA 3D94A 4B4LA 5CU0A 4ENYA 2PMOX 5EK7A 1QMZA 3UBDA 3WZJA 4FKLA 3ZYAA 2Z02A 4DFLA 4QMXA 4QD6A 1JWHA 3KL8A 1KSWA 2GHLA 3PVGA 5C8MA 2BAQA 3MPTA 3FUPA 3PPJA 2XKCA 1QPCA 4HNFA 4I4FA 4R5SA 1Q99A 3R7IA 3HUCA 1HCKA 2XNEA 3E93A 3KF4A 3EN9A 2QO2A 3PFQA 4L3JA 4M15A 4HYIA 4K2RA 3AC1A 1J1BA 2W5AA 4I94A 4C7TA 5HE0A 1VEBA 1XWSA 3OBJA 3DK7A 5FTQA 4M3QA 4UB7A 4CG8A 3C4FA 4TTHB 1W83A 5DFPA 4G6LA 4YBJA 4G5PA 4O0SA 3BKBA 5GNKA 3RINA 3W0SA 2ZB0A 3LMGA 4FKUA 4ENXA 1PRYA 4IWQA 5HBJA 3OCTA 4AE6A 4L8MA 2VTMA 1OUKA 1REJA 4L43A 3SXRA 4D2TA 3VONA 3ORKA 4JBPA 5J87A 4DH8A 2G2IA 3JYAA 4RT7A 3R7GA 4IAYA 3I5NA 3A4PA 2R3GA 2XK7A 3UNZA 2PUUA 2HY81 3CQEA 3PVBA 3N9XA 3TKIA 4EK3A 3G15A 4LUEA 2VWYA 3DTWA 3D0EA 3F5PA 4YLKA 2ZM3A 2WELA 5DPVA 2ZDUA 1XH9A 2ITZA 4CV9A 1CKPA 5KMIA 3FZPA 4GH2A 3UDSA 4YJOA 2QHMA 3LFNA 3DBCA 5FXQA 2RF9A 3KVXA 4LV7A 5IQIA 3VHEA 3GC9A 3EQPA 3WOWA 2C6TA 3BZ3A 4DITA 1PJKA 4DCAA 4O82A 4Y85A 4DGGA 5EOBA 5HEZA 4ANQA 3JR1A 2CGWA 4JDHA 5C9CA 4FTRA 4W4WA 3E63A 5DR9A 3OD6X 3WF8A 4F6WA 2J0JA 3C5UA 1ST0A 4C59A 4FZFB 4XYFA 5DLSA 4R5YA 5I5ZA 3ACJA 1UNLA 3F9NA 4IZ7A 4BVUA 1H1WA 4FV7A 4YO4A 2CGXA 4FIGA 1TVOA 1KWPA 2XMYA 2JEDA 4AA5A 3UPXA 2WTKB 2G9XA 3EZRA 4TWPA 4FGBA 4ZJJA 3FMNA 4FG9A 4FKTA 4CCUA 2Z7SA 3GU7A 2HXLA 1UKHA 3L8VA 3F7ZA 3R2YA 4FTNA 3FI4A 4O0YA 3TXOA 4BZOA 4YTIA 3AD4A 2BKKA 3QD4A 2REIA 4YJQA 3A8WA 4LFIA 5CI6A 5DA3A 1F5QA 5J5SA 5A3XA 5TF9A 2OW3A 2W9ZB 5EYMA 3FPQA 4AFJA 3RHKA 3W2CA 1SYKA 2ITOA 4C62A 5IA2A 2CKOA 1J3HA 3VS6A 5KKRB 4IWPA 3T3VA 2WU6A 4Z9LA 2OJIA 3GC7A 4FG7A 4NJ3A 4RIXA 3ROCA 4E5BA 1YWNA 1WMKA 1YDRE 2JD5A 3EYHA 3TNIA 5JSMA 3MESA 3UZRA 5IQEA 5CS6A 2PZRA 4JBOA 4ASDA 4QDEA 2VO0A 5IQAA 2CSNA 3CIKA 3AT3A 3VBWA 1UNHA 5CLPA 2CKQA 5KMNA 2GS6A 4IIRA 1GZ8A 3VRZA 2XJ1A 5CZIA 3NMUF 5JGDA 2GQRA 1L3RE 2W9FB 2RFDA 4QP1A 4DEAA 5DN3A 4G9RA 4CMTA 2WNTA 4BTFA 3NS9A 4G2FA 1PXOA 4C4JA 3DGKA 3GB2A 3JPVA 4F7LA 4PL4A 4XHKB 5AMNA 3TZ7A 5KBQA 5HG7A 5CALA 2R7IA 2ETKA 3FBVA 3FMJA 3C50A 3N4VA 4O4FA 4NZWB 4EK4A 3MFTA 3NUSA 3V01A 3ZO4A 4U80A 1IAHA 4FTQA 3NVMB 5BMMA 1Z9XA 1E9HA 5G6VA 3I5ZA 3V5LA 4E7WA 4M67A 1ZYDA 4HGTA 2WMVA 2BHEA 3WF6A 1AGWA 3QUDA 3DOGA 4ANSA 4O27B 5B2MA 5FDPA 5H2UA 4KUJA 3QTSA 3BYUA 3COKA 3AKKA 2ERZE 1H26A 2ZOQA 3WILA 5M4FA 3NWWA 4DFZE 4FE2A 2R5TA 3FZ1A 4J99A 3R7YA 5L4QA 1G5SA 4ZSGA 3K5VA 2X0QA 2C0TA 1ZOHA 3DNEA 4O38A 4ZZOA 2W1CA 4IB1A 2IW8A 3KXXA 2H9VA 3UO4A 4N4SA 2BRMA 4EYMA 1VLRA 2X6DA 4F78A 2W1EA 2Y4IC 3NNUA 4CRSA 4BCQA 4S32A 2GNLA 4H05A 2QR8A 5EKOA 3JVSA 2CNVA 5FQDC 1DS5A 4QT1A 4OW8A 5DBXA 4QEBA 5M53A 3RPSA 4PY1A 4GCJA 3QQKA 2ONLC 5L2TA 5DOSA 3HMOA 4H1JA 4HVGA 4I4EA 2V7AA 4DHZA 4TWOA 5ANOA 3R8PA 3TG1A 3BU5A 4R7BA 2R3FA 4W9XA 3NAYA 3EZVA 5F95A 4ZSEA 4MD7E 2JDSA 4CRLA 2NRYA 3BYMA 5T6KA 3ZLXA 4A9SA 4RJ7A 2BZHB 1OIQA 2H96A 4KSQA 2OFUA 2QO7A 1HOWA 3KXMA 3OTVA 1WBWA 2B0QA 4II5A 3VUGA 1P14A 2XS0A 3CPCA 3OEFX 3FQHA 4G9CA 3VHKA 5LXMA 2Y9QA 3IGOA 4RIWA 4K11A 3ORIA 1ZLTA 2OU7A 3L8PA 2FYSA 1TZDA 3W18A 2XARA 4N6YA 2YLFA 3UODA 3O96A 2XIYA 3R71A 4I6QA 2X1NA 2XIXA 3PXFA 2G2FA 3LZBA 4FTOA 4O0UA 5KHWA 4QPMA 4DC2A 3I7CA 3EQBA 2NNWB 1OIRA 1ZMVA 2XNBA 3RVGA 3ZO1A 4ZTRA 1U5QA 1LP4A 4RJ5A 5ANJA 2X2KA 4K18A 3F5UA 4N0SA 4ANMA 4YPDA 1OL5A 4FV0A 4JT3A 4CQGA 4PWNA 4RA5A 3TN8A 4BDEA 4QMTA 1O9UA 3PXYA 2JC6A 5L2IA 3WZKA 3FV8A 4GKIA 2G1TA 1GAGA 2R3OA 3NW7A 4G31A 3Q2JA 3OUKA 2C30A 4L7FA 1JAMA 4M13A 2VUWA 3FE3A 4KIQA 1WBTA 1M7QA 3GCQA 1OGYA 2XNOA 3ATSA 5CSHA 4NEUA 5AJQA 3C4WA 3V8TA 3ZRMA 2PHKA 1FQ1B 2QONA 5AV3A 5KMLA 4XLVA 4HVHA 1Q5KA 2VX0A 2BFYA 2WTWA 2B9FA 4CVAA 2YCQA 3A99A 4ANLA 2YIXA 4WSQA 3RHXA 1QPDA 2R2PA 4QQJA 4IAKA 4Y5HA 2QCSA 3D4QA 1H08A 2BRNA 2R3IA 4WD5A 4QP9A 2WTJA 2C3IB 4YUQA 2PY3A 5JT2A 4L3PA 3DS6A 1CKIA 3HECA 3TIZA 5CSWA 4L6QA 3A2CA 3EKNA 5GIOE 3LAUA 2HELA 2J7TA 5JK3A 3BHUA 5EI6A 3I0OA 3KFAA 4C35A 5FM2A 3L9MA 3PJ3A 4C4HA 3KRRA 3QTRA 4S34A 4R7HA 3OT3A 4CZTA 2YACA 4KIOA 2HYYA 5ACKA 3WYYA 5EQYA 1DI9A 1WZYA 5H8BA 2OJFE 3DK3A 2VWUA 3G2FA 2AQXA 4IDVA 5JFVA 3OF0A 5HBEA 4QRCA 3VRYA 4LMNA 3WF5A 4LRKA 4MAOA 2EXEA 4AU8A 2J5EA 3VBVA 3P23A 3O0GA 3KRXA 5BYZA 4BCPA 4AGWA 5D7VA 4AXDA 3MTFA 3Q60A 3P7BA 1U5RA 4CKJA 4JOAA 4L68A 2WU7A 3QCQA 5AAGA 2UVZA 3MVLA 4EOIA 3KB7A 5HVKA 4EOMA 2JDTA 4EKKA 4ZAUA 2XK4A 2Y0AA 5AP3A 3ZLSA 4B99A 1VZOA 4F9WA 2UW6A 1Q97A 2OJJA 3MFRA 5DYJA 4FSTA 2IZUA 4FT0A 4ZTQA 4RWJA 5EYKA 3DKCA 2YCSA 2BZIB 4FTAA 3LPBA 5M09A 1GJOA 1ZOEA 3RPVA 2O5KA 3VIDA 5I3OA 4ANBA 3SGCA 3HA6A 3TV6A 2P55A 4KRDA 4CG9A 3CCNA 5A4QA 3AMYA 3POZA 4IZ5A 4F6SA 5AP6A 4GIHA 3TYKA 4O6LA 4RJ4A 3S1HA 3D5XA 2WIHA 3BBWA 3FKLA 3SX9A 5L6OA 4GG7A 2HIWA 3ML1A 4PP7A 5EI2A 1U46A 2UZNA 2AC3A 3V8SA 3ZFYA 3I6UA 3NRMA 4KSPA 4MWHA 4NM5A 5K5NA 4EZ7A 4FV9A 3OUNB 3VC4A 1GZKA 3RAWA 4BKZA 4FKRA 4CKIA 3JY0A 4F9BA 4DG3E 5LMBA 2VTNA 2BALA 4BI0A 1RJBA 3KGAA 3EQGA 4XMOA 4ZLOA 3LLTA 4AACA 3QLFA 2XKFA 3DAJA 3U9CA 4M8TA 4O0WA 3LVPA 3G33A 2WMTA 4AZWA 1V0PA 5CANA 5LVPA 3AC8A 4L01A 4FVRA 1Q8WA 4EYJA 2HY0A 3E3PA 3QCYA 4YLJA 3VAPA 5AV2A 1XBAA 3G9NA 3VQHA 4QPSA 4D0XA 1YVJA 1UWJA 3DXNA 3SQQA 2VTJA 4CT2A 4W4XA 2GS7A 2YJSA 3D15A 5DG5A 3QTXA 5BVWA 3ZH8A 2YITA 3VBTA 3BQRA 2WTKC 3LFAA 4DGLC 1YXVA 4YJUA 3BLAA 2PMNX 3BRBA 4TY1A 5EOLA 5IKWA 3WF9A 5IQGA 3QGWA 2BTSA 5EM8A 5BV3A 1YXUA 4EH5A 3RP9A 2XANA 4IADA 2C5VA 3FWQA 4QTAA 3OWJA 2BDFA 4MXXA 4IWOA 4AP7A 3BGQA 2WMBA 4TWCA 2C6IA 5CVGA 2EB3A 3R30A 3BU6A 3SW7A 1YHSA 3NIEA 4O0RA 4YHTA 2J50A 5M55A 5A4TA 5KKRC 2IO6A 3PLSA 2OWBA 3DLSA 4FMQA 3T3UA 4X6QC 2XCKA 3E3BX 5KO1A 3RNIA 2WQNA 3E87A 3D7ZA 4BCGA 4I22A 4FSMA 5AR2A 3MSSA 3IGGA 4XG8A 3NNVA 4HYSA 4E4NA 4M69A 4AA4A 5ANDA 5HCZA 4TT7A 2V62A 5AA9A 1LR4A 3MVMA 4M12A 4IE9A 5LJJA 2GTNA 4YZBA 3GCVA 4BBMA 4FZ7A 4GT5A 3IW8A 2FGIA 4U0IA 4BIBA 5E9EA 3S2PA 4BKJA 4XP0A 5A6NA 4A7CA 5T3QA 4CLJA 4GVJA 4KAOA 3HAMA 2IW9A 2C0IA 4U7ZA 3RAKA 2JDOA 2OXDA 3GU6A 1CM8A 2F7ZE 4KBCA 3UQGA 4DEHA 4BTMA 3TZ8A 5HNIX 4I21A 3MN3A 3GC8A 4G3FA 4D55A 3MI9A 3UVPA 4DG2E 4FOBA 3ZRLA 3NNWA 2FSMX 2XJ2A 2OFVA 4RRVA 4WNPA 5ANIA 1VYZA 4LDTA 4D4VA 3DAEA 1F3MC 1ZYCA 2C1BA 5LOHA 3E8NA 4ANOA 4O86A 3ODZX 5JZJA 2QG7A 4J95A 4PUZA 5H9BA 2CCHA 3F5GA 2Y7JA 3IKAA 4UMQA 2OF4A 1W98A 4USFA 3SD0A 2YLEA 5EFQA 4IX5A 1H24A 2J9MA 2GHGA 5H8EA 3SOAA 4JRVA 4BCFA 2X7GA 3KCKA 4KS8A 3DAKA 3MY1A 5HI2A 3R9DA 4BDJA 5CAOA 4ZOGA 3U6IA 1PXLA 4MNEB 1M2PA 1ZWSA 1WVYA 4GS6A 4IB3A 3PSDA 3KK9A 4HGLA 2X9EA 3KULB 1H8FA 2ZJWA 2YA9A 4CLIA 2WHBA 4BI1A 4XG7A 3VQUA 3AGLA 4KIKA 4FTLA 4EOJA 2OK1A 2XNMA 4F70A 4RJ8A 4MXOA 4PL3A 3Q32A 4RFZA 2W1FA 2C1AA 3HV4A 3KY2A 5F1ZA 2ETMA 2BAKA 4DTAA 3GCPA 4MF1A 2VWVA 3RM6A 4DH3A 3PP1A 1FVTA 3P78A 1FVVA 4XJ0A 2AYPA 4ZTSA 4XV1A 3ZS5A 3HMNA 5KMKA 4FNZA 4FEWA 1O6LA 4FGRA 3AT2A 3TNPC 3EIDA 4ASZA 4WUAA 3NCZA 3ULZA 3LM0A 4EHGA 2YCRA 3MW1A 1ZYLA 5HNBA 4KBAA 4XG9A 3KC3A 1H1SA 2PVRA 4ERWA 2IF8A 4YJTA 3MFUA 4D9TA 3TUDA 5HORA 4E6QA 5HU3A 4JX3A 3QRJA 4YLLA 4IZYA 2J0KA 1GIJA 3ALNA 4D28A 4F0FA 3FXXA 5AV4A 2PZPA 5LMKC 1UU3A 3GUBA 3KN5A 3R0TA 5A54A 4FKQA 5HLWA 1JOWB 4L45A 4UYAA 4JMQA 2I40A 5CVHA 4RWLA 2PL0A 2F57A 3OZ6A 4A06A 3BBTB 4LOPA 5F9EA 5JFSA 3MA6A 2PUPA 1CTPE 4FT7A 4F9AA 4D5HA 3E5AA 4FIEA 3H9OA 3LLAA 3GOKA 4ZMFA 1ATPE 2YAAA 3TDWA 3UMXA 4OTQA 5GZ9A 4FSNA 4A9RA 5CTPA 3BHTA 4EOKA 3LHJA 5AAFA 5BQ0A 1I44A 2BIYA 4YTCA 5IQHA 3R22A 5CU4A 4AAYA 4U97A 4U6RA 3LCOA 4AN9A 5LCKA 5G1XA 2WXVA 4IFGA 3GBZA 1BL6A 4IW0A 4M7IA 4PX6A 5E8SA 3F82A 5HE1A 3MH0A 4NCTA 5DVRA 5KCVA 5IA0A 3VS3A 3BE9A 3MFSA 4G3CA 1YXXA 4I24A 4BDGA 4E5WA 2C68A 3CC6A 4JIKA 4D2WA 4QP8A 2UW8A 5AR8A 3ITZA 4I0RA 5I0BA 4NK9A 5M4CA 3AC4A 4E6CA 4IAAA 4O4BB 4X3JA 4QYGA 4ZTHA 3BX5A 4EH9A 2X2LA 3G6GA 4EH7A 2XCHA 4J7BA 5IEXA 3BHHA 3KF7A 5BYLA 2O2UA 2DS1A 2OZAB 4JJRA 3UC3A 5K4JA 3E62A 3RI1A 5DEWA 2QU5A 3VBXA 5TO8A 1GNGA 3RM7A 5JH6A 5IZFA 3HV7A 4MEDA 4C4EA 3TWJA 5AP5A 3DBDA 4KA3A 4A9UA 3W2RA 3NX8A 3ORLA 3QRUA 4RIOA 4X7QA 4ZMEA 2GMXA 4E3CA 1J7UA 3W2QA 3DFAA 3BEGA 3BLRA 3NYNA 2CGVA 3WZEA 3MPMA 4CFUA 3CKWA 4O7YA 4PNKA 4QP7A 4QOXA 2QLUA 2NRUA 4D2SA 1KUTA 4ACGA 5D9HA 2PVYA 3JY9A 4O1PA 1XH7A 1BMKA 2XP2A 4GVAA 2C5YA 3QZFA 5FD2A 4ALWA 4ALUA 4UMPA 5AUUA 2VWBA 4BDHA 3HNGA 2FSTX 4IX6A 3QQGA 3AGMA 1CMKE 3EFJA 3OG7A 5CWZA 5FP5A 3AG9A 3ATTA 4GKHA 2JFLA 2C6EA 4NM3A 2OZOA 2R3HA 4FTUA 2XUUA 5C26A 4DE4A 3NUYA 4FIHA 2PZIA 4DFNA 3TJDA 3R1QA 4DAWA 5HE3A 2DWBA 3O23A 4IC8A 1UA2A 2XKEA 2GFSA 3GP0A 3HDMA 4ANNA 2ZM4A 4HVDA 4PL5A 3LMIA 4FZDB 1UU7A 3P79A 1UKIA 4AXCA 2GQSA 2WIPA 4IB0A 4RGJA 4FYOA 4WO5A 4MX9A 4IM2A 4X2JA 5IUIA 3R9NA 2IEWA 5DMZA 4M14A 2WMXA 3OHTA 5CNNA 3KIOC 3SKCA 3T9TA 3V5PA 3ZBXA 3BHYA 2A19B 2ZV7A 4EOLA 3L8XA 4F9CA 3QQHA 4U79A 2CKPA 4YC8A 3VUHA 3UVRA 5CF5A 4FKIA 3B2WA 3IS5A 4IAIA 4CT1A 4D2RA 4MD9E 3TUBA 3NUXA 2ITTA 3EQDA 4KB8A 5AIKA 3BI6A 4FSZA 3UPZA 1TKIA 3EFKA 2WKMA 4KKGA 5HO8A 5L2QA 4ORKA 1O6KA 2YIWA 1RE8A 4XOYA 3V5WA 2Z2WA 1IAJA 1PF8A 3DKFA 3LFFA 4APPA 4BJJA 2BROA 4FODA 3OCBA 4PP9A 2EU9A 4FNWA 2P0CA 2XYUA 3TV7A 4NM0A 4FUYA 3UMWA 1BKXA 2O8YA 4NUSA 1LUFA 4KS7A 4RZVA 4CFWA 3BWJA 3NDMA 1Q8UA 3ZBFA 4AW2A 3OS3A 3CTHA 3FQSA 3QAME 2I0EA 4ID7A 3S3IA 3GFEA 5HTIA 3PTGA 3TMOA 1W2DA 3F3VA 1P4FA 3FLYA 4OBPA 2PE1A 2Z7LA 4P90A 2HZIA 3OT8A 4IX3A 4RJ3A 4EORA 5EKNA 4C02A 3MWUA 1SNXA 4FX3A 3ZUUA 4BGHA 3PYYA 1S9JA 4AOTA 4TWNA 3ZSGA 3CXWA 4AOIA 4NIFA 2WMUA 1FVRA 2VD5A 1KOAA 4P2KA 2IVVA 5ANEA 4AN3A 4JNWA 5C01A 2BUJA 3GCUA 4IVCA 4EH3A 1H27A 5DWRA 5JEBA 3NUUA 4EWQA 5CXZA 1Q8YA 2E9VA 3D9VA 3ORTA 4O7WA 2C6KA 3K3JA 5E7RA 2IVTA 3UGCA 4AT3A 2A4LA 4YNEA 1SMHA 1K9AA 5CF4A 1JSTA 2HZ4A 3KRLA 4NU1A 4RWIA 4XG4A 3TI1A 4F1TA 2E9UA 3FHRA 3M2WA 5KX8A 3IOPA 4XP2A 2VO6A 3HL7A 4PDSA 5M4UA 3QXOA 4XG6A 3PA5A 2RFEA 3M42A 3C5IA 5KMMA 1NVSA 1ZARA 4ACDA 2PVHA 4AZEA 4F1MA 2XH5A 3LXPA 3VW6A 2QQ7A 4JS8A 4XV2A 3L9LA 5A4LA 4XX9A 3CR0A 4TRLA 3P1AA 3GENA 3FY0A 2CLXA 2GSFA 3FLQA 4J8NA 3FXWA 2OH4A 4UXLA 3H9RA 4Q2AA 5AP0A 3ZDUA 4EEVA 2V7OA 4G34A 3AMBA 4J96A 4YC3A 4C3FA 2XM9A 3QWKA 5JN2A 3NFGB 4IJ9A 4QYHA 3VW8A 3FEGA 3F66A 1S9IA 2RG6A 3EQFA 3HV5A 2XIZA 4O21A 2Q0NA 3H0ZA 2HXQA 3NYXA 4Y72A 3LFEA 2Y8OA 3TIYA 2W5BA 5A6OA 2UZWE 4ZZMA 3FLZA 4KINA 4QMUA 2Z60A 3DK6A 4CQEA 5AP1A 4F64A 2W1DA 3CGOA 3RZBA 4BCJA 4HPTE 5HZNA 3Q6WA 4PRJA 5CAQA 5CEMA 2HK5A 3GU4A 1OZ1A 1QPJA 3IECA 3ENMA 4LYNA 2KULA 4R77A 1R78A 2XIKA 3ODYX 3RCJA 2JKMA 3AKJA 2FSLX 3OW3A 4FNXA 4UWYA 1UU9A 3LQ3A 3CTJA 2YM3A 4RC2A 3ZZWA 2AUHA 4YZ9A 3NSZA 3E64A 3NFFB 1CDKA 4RPVA 2R3PA 3PY3A 2GNHA 1OMWA 5C8NA 2PSQA 2VTLA 5KHXA 3SA0A 3W0RA 1IA8A 3KCFA 4FG8A 1YWRA 1JPAA 5ETAA 3OTUA 1E1XA 1WBPA 5AUXA 2EUFB 3VNTA 3P9JA 4G6OA 4LGDA 1B6CB 4PMPA 2IZRA 4Q9ZA 1OBDA 4GU6A 1R39A 2UZBA 4GFOA 1Q24A 3Q5ZA 4IC7A 4MBJA 3CLYA 4FTJA 1H00A 4WBBB 4DT8A 3PZEA 4TL0A 2UVXA 2VWZA 4I5HA 5E8YA 2PMIA 4U81A 3W55A 5GHVA 1OPLA 1NA7A 4QO9A 2WFYA 3COHA 4X6RA 4MF0A 4WG5A 2BIKB 2WEVA 1GIHA 5FRIA 4CZYB 4IACA 2E9OA 1KE7A 4I20A 5EHOA 4UXQA 5EH0A 2HENA 3NR9A 2FVDA 4FI1A 5EM7A 4GSBA 3F2NA 3OCGA 4UEUA 4EQUA 5HIDA 3GU5A 4WHZA 4WIHA 5DH3A 4UMUA 3W0MA 1SVGA 2XF0A 3V5QA 2CJMA 3A61A 2W1ZA 2A2AA 4E5AX 3GXLA 5AAEA 1PXIA 3NGAA 4ZXTA 2X8EA 3O8UA 4J71A 4LMUA 3TZ9A 3T8OA 3U87A 5L6PA 4X2GA 2NP8A 2E9PA 4O81A 4U43A 3ZTXA 4EH2A 4DYMA 3R21A 1X8BA 3NW6A 1OKYA 1PXNA 2EB2A 2B9JA 3Q4ZA 3RAHA 5K5XA 5M4IA 4YTHA 3DXPA 5FP6A 4BN1A 3K5UA 2C6OA 4DEDA 2P4IA 4KRCA 2YM7A 4OTWA 2GPHA 3VF9A 3UIXA 4BGGA 3PXRA 3QD2B 4A9TA 3O8PA 5KNJA 2OLCA 3P08A 4HW7A 3EQIA 2BPMA 3MJ2A 4FVQA 2J6MA 5EYDA 4Y8DA 1I09A 4RC4A 4IEBA 1MUOA 4O4CA 4Q5HA 5HTCA 4BCIA 4G17A 5J1WA 5DHJA 3R2BA 4Q5EA 4BYIA 3ALOA 1XKKA 1GY3A 4I23A 1DAYA 1LEWA 1OI9A 2Z7RA 1WAKA 2CN8A 3RK5A 5LVMA 1G8SA 4DEIA 4FV2A 3E8EA 4ITJA 2WB8A 5DEYA 2X7OA 2XBJA 4FTCA 5E92A 2DUVA 4PDPA 1DI8A 3MIYA 5HCXA 4MWIA 1WBOA 4CEGA 5FTGA 4DT9A 4QP3A 3BGZA 4OBOA 2W4OA 5IMEA 3I60A 3TTIA 5HIEA 4IFCA 2FH9A 4ZSAA 5BUJA 2QG5A 4UWBA 5I9WA 2ITNA 2XJ0A 4JRNA 4U8ZA 4BWXA 3WE4A 4EOOA 5D12A 2X7FA 3UJGA 3FQEA 4NTSA 2CCIA 3D7TA 4DEEA 4YJSA 1JKLA 3IDCA 2VTSA 4K8AA 2QOOA 3P7CA 3S0OA 3OEZA 2B7AA 3IW5A 5BYYA 2PE2A 1JQHA 1KOBA 3PZHA 1KE8A 5E8VA 2WMQA 1Y6BA 2W7XA 3LE6A 2W1GA 3CQUA 4EH8A 5E1SA 4G1WA 4F99A 5IEYA 3PJCA 4HNIA 1DAWA 3HAVA 4ZSJA 4FT3A 1AQ1A 3Q04A 2UZDA 4QMZA 1RQQA 1M7NA 4BHZA 3DCVA 4IM3A 4E26A 2CMWA 2J2IB 2C69A 5EQEA 3HKOA 5HLPA 2GTMA 3UNKA 4O2PA 5L8KA 4HJOA 4RX8A 1Y8YA 4G6NA 5GJFA 3R8ZA 4PDOA 1QL6A 3NUPA 4MK0A 2B55A 2RFNA 4FSQA 4R78A 1ZAOA 4C33A 4F0GA 1YDSE 2PK9A 3RJCA 1LEZA 2YCFA 5HX8A 1XHAA 5DR6A 4ASXA 4EC8A 4DFUA 4X2NA 5E8XA 5M56A 1PHKA 4F7JA 1W0XC 4XEYA 2R3MA 4RZWA 4U44A 3UIMA 2UZEA 4YC6A 4JLCA 4B6LA 3OROA 4IVBA 1JSUA 1GIIA 3DT1A 4FTTA 1JKKA 2V5QA 5JFXA 2YIYA 4DDGA 2ERKA 2ZVAA 5KZ0A 3EYGA 3F3WA 1PXKA 2PUIA 3DLZA 5HBHA 3BGPA 4CMOA 4FC0A 4A9YA 4ARKA 1OM1A 4BR3A 2C47A 3ACKA 2VTTA 3LQ8A 4YSMA 2X8IA 4PV0A 4JR7A 5CU2A 4FZ6A 3MDYA 5CT7A 3HMMA 2WGJA 2UZLA 3Q6UA 3D5VA 3QQUA 4FV8A 2DQ7X 5CEPA 5CU3A 4L44A 2ONLA 3HZTA 4UBAA 3PSBA 3LXNA 1G8KA 2PVNA 3L9PA 4TW9A 3TV4A 3WBLA 4YNOA 1XQZA 5JQ8A 4N57A 3HP5A 5AR4A 3FKNA 1YI3A 5E8ZA 1YXTA 3Q2MA 3WIKA 4JR3A 2R3KA 3BLQA 4IBMA 3ZHPC 4DDIA 2J5FA 2JBOA 3IOKA 3DA6A 3HEGA 3I6WA 4FK3A 3F7WA 2OZAA 1J7IA 2JBPA 3LIJA 2I1MA 3PWYA 5J1VA 1V1KA 3SRVB 2WOUA 4Y46A 4RLKA 2ZMCA 2ZV2A 3GQIA 3OP5A 3Q9WA 4LM5A 5CX9A 5BMSA 4DHJA 5FBNC 5CSPA 5IPJA 1IG1A 4J53A 3PRFA 1LPUA 2CDZA 4BDDA 1H0WA 1OL6A 2W06A 4FL1A 4FKVA 3R7UA 2X81A 3VF8A 4LUDA 3VUKA 4AX8A 2RFSA 3R8MA 3V8WA 1WCCA 1PKDA 2PYWA 4AUAA 4MQ1A 1UNGA 4BRXA 4ZS4A 3MS9A 1Z5MA 1BI7A 4AG8A 2XNPA 1XMMA 4EK8A 4I3ZA 4A07A 4RIXB 1FBNA 3C51A 4BC6A 2I0HA 3ID6C 3A7JA 5J79A 1V0BA 1WFCA 1YKRA 2GDOA 1XBBA