3NUSA

Phosphoinositide-dependent kinase-1 (pdk1) with fragment8
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
286
structure length
276
Chain Sequence
QPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords phosphoinositide-dependent kinase-1
publication title Aminoindazole PDK1 Inhibitors: A Case Study in Fragment-Based Drug Discovery.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 276
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nusA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nusA01
2W5AA 2J2IB 3COHA 2X81A 4GUEA 4AWIA 3QYWA 2XNGA 3NSZA 3NLBA 4EH4A 4IWQA 3EQFA 3LPBA 2B53A 1PKDA 2X7GA 3FLYA 4R6VA 2UZEA 4RX7A 1OBDA 2B9IA 5HE3A 4YGAA 3TV4A 2I1MA 4UMTA 2WQBA 5J7HA 3FMKA 4RIYB 1KV2A 4JX3A 5A4QA 1UKHA 5C4LA 1Q62A 2C6TA 3EFKA 2VX1A 5LMKC 5FDXA 4AW5A 2H6DA 2GNLA 2PVNA 3QCQA 2GHLA 3CBLA 4II5A 2WEIA 4OTQA 5FEQA 2ZDUA 3EQGA 3MY1A 4I6FA 4EOPA 5L2SA 4D1SA 4KRCA 5GJFA 4O96A 3TJCA 3RCDA 3FYKX 1CDKA 4L3LA 3PXYA 1DAWA 3BYMA 3G33A 4QD6A 3O17A 2BKKA 4O0TA 4QMVA 3VJNA 2HOGA 1Q3WA 2BCJA 1WBWA 4IIRA 3R71A 3SV0A 4L42A 1MQBA 4H36A 3HGKA 2O0UA 4IXPA 1JAMA 4CLIA 1KE8A 5KBQA 3UVRA 1W7HA 2CGXA 2BKZA 2JLDA 4AFEA 5LWNA 2HZ4A 4AW0A 4CFUA 4B8LA 1ND4A 2OFUA 4U45A 3H4JA 4B0GA 4BIBA 5B7VA 5BVFA 3UZTA 3VS2A 2GPHA 3NCGA 4C4FA 4QMWA 2W9FB 3G90X 5M4UA 5JFVA 3FSKA 4Y5QA 1NA7A 5BMMA 4ID7A 3IONA 1ZYCA 4JDHA 2XRUA 3OC1A 4LUEA 4B9DA 4BI0A 4RWKA 3TEIA 5CSWA 2WB8A 2RFSA 2XEYA 2QLQA 4KA3A 4LFIA 3LFAA 4I5HA 4RIWB 5J87A 2WOTA 3G51A 3HV3A 5LVOA 5E8SA 2XNMA 3UO5A 3RBWA 4IZAA 2C6LA 4DT8A 5BYYA 5L2QA 5LARA 2G2HA 4XMOA 4DYMA 4JS8A 2PPQA 5KMOA 2ONLA 3HX4A 3SX9A 4M69B 2BDJA 4FEUA 2CKOA 1QPJA 1ZOEA 4RRVA 1APME 4F4PA 3P5KA 1YW2A 1QCFA 3Q6UA 4MQ1A 5KMLA 3Q6WA 3LMIA 2Y6MA 3OFMA 4FV4A 3UDBA 4GEOA 4J98A 3D4QA 4M7IA 4KBKA 1HCKA 4EONA 4BDDA 3FMMA 2VTLA 3FKLA 3LMGA 4HCUA 4OTRA 3G6HA 4LMNA 4EQUA 4D9UA 3PWDA 5DI1A 3OBJA 3EFWA 4BHNA 3I0QA 3PG1A 3RPSA 5FDPA 4RZWA 1CTPE 4MXCA 3W8QA 3U8WA 3BE2A 3QKKA 4HNIA 5GJGA 2ZDTA 4EH6A 3EQHA 3MB7A 1V1KA 2QO9A 4ZY6A 5KHXA 4E3CA 2DUVA 3UO6A 3F2AA 4HVHA 5HLNA 2BIKB 3CD3A 2YIQA 1GZNA 3ALOA 1PXIA 4FV5A 3KEXA 4X2FA 5A4CA 4X7QA 5C4KA 3SXFA 4X2GA 4D0WA 3G0EA 3WYXA 3IGGA 3FXXA 4YPSA 4I5PA 3UP2A 4BCPA 3R02A 2IVVA 4LM5A 2OW3A 5A3XA 1PXPA 3NUYA 5E8YA 2I6LA 4Y95A 4XYFA 1XH8A 4YSJA 1PJKA 1SM2A 3OCGA 4X3JA 4G2FA 4M14A 5KMJA 1XBBA 4K77A 4I20A 1IRKA 2HZNA 4LRKA 5CT0A 4DEGA 4L67A 3Q9XA 4ZEGA 2BRGA 2OJGA 2PZIA 4J97A 2X4FA 4ZY4A 3TM0A 1PHKA 4RWJA 4YSMA 4GK2A 4JAJA 2YDJA 3SRVA 3ULIA 5ITAA 2OGVA 5BUJA 4K11A 5BNJA 5E90A 3Q5IA 1YWNA 1XO2B 2WQEA 4KABA 5AV2A 3DXPA 1SNUA 5BYLA 5HG7A 4LL5A 4EQMA 2GHGA 3LFDA 3R1NA 3DDPA 5IEXA 4CZTA 4RC2A 4GMYA 2R4BA 1OIUA 4P5ZA 4NL0A 3V6RA 3KN6A 4FTCA 4UX9A 2Z8CA 3UYSA 3EN4A 2X9FA 3R8MA 1YXVA 4U44A 1IR3A 3QZFA 5AP4A 4ZJJA 4FSYA 4AN9A 3QAME 3I5ZA 4LV5A 3SXRA 3FZRA 3LXPA 3LJ1A 3D5UA 3EKNA 4EH7A 1UV5A 2QHNA 4O7YA 2W1IA 3B8QA 4FG9A 4E4MA 5EM5A 5K5NA 3DA6A 3R8UA 2VUWA 4ZSGA 5AV1A 1H07A 5D12A 3NYNA 4AA4A 5LVNA 2XA4A 4WSQA 4D9TA 4DBNA 2OIDA 4PQNA 5JZNA 3V8TA 5EI8A 3I7CA 1OMWA 2O2UA 2WMBA 1U59A 4HYHA 4G3EA 4KIKA 3A8XA 3AMBA 3LQ5A 3TI1A 5I3OA 3KY2A 3PA3A 2E9OA 1T45A 2LGCA 4R7IA 4BTJA 2G2IA 2GMXA 1BI8A 2JDTA 3E8DA 5E1EA 4BKYA 4FIGA 1IG1A 4RSSA 5IQIA 4MNEB 4WOVA 3WOWA 3D0EA 4U3YA 5B2KA 1Z5MA 1URWA 1FMOE 3PJ3A 2RFDA 5HZNA 4QYFA 2BMCA 3KFAA 4TN6A 3COIA 4APPA 4W4YA 1H28A 3ACKA 5CEPA 4GU9A 4PDPA 1WBTA 2F2UA 3PUPA 5L2WA 1UU3A 5TOZA 3ELJA 4ZY5A 4GJ2A 3NR9A 4K9YA 4OGRA 1VYZA 4CT1A 2ZAZA 2UUEA 3THBA 4N0SA 2X1NA 4UWBA 4HYIA 5DT3A 2X2KA 3E3BX 3DJ6A 3REPA 4Q9SA 3LFNA 5IH6A 4QMZA 4RVKA 4TT7A 3TIZA 3U4UA 3KVWA 3VUKA 3QTQA 1YRPA 3CEKA 4FKWA 4NUSA 3WBLA 1J91A 2BZHB 3S00A 3NWWA 4CFXA 3R2BA 3E5AA 2IZSA 3UOLA 4HGEA 4JG8A 4F64A 4FKSA 4FV8A 1SVEA 4YZCA 2F49A 4L3PA 4IAFA 4TXCA 1S9JA 4FT3A 2WELA 2OK1A 1RW8A 3PIYA 3H30A 2YA9A 1B39A 3DAKA 3O50A 4BBMA 4ASXA 4EK8A 5CU0A 4AGCA 4Y46A 5J79A 2Y8OA 4YTHA 5CALA 3F5GA 3DLSA 5GZAA 4U0IA 3R73A 4X2JA 5DOSA 1K2PA 3RKBA 4W4WA 2JIIA 4JQEA 3R1SA 3O51A 4U79A 2ITXA 5ETFA 2GTMA 4EK5A 4AZWA 3A99A 4AE6A 4DFLA 2C6KA 4ORKA 3R28A 3QX4A 5KUPA 2QG7A 4D2TA 3MFSA 3QUDA 4EOQA 2H34A 3V5LA 3KRRA 1KSWA 4W9WA 3Q4TA 5FM3A 2R3RA 4OTPA 4GRBA 4M15A 4OTHA 2J0MB 3QGWA 4FKVA 3OVVA 3Q52A 3VUDA 2BRMA 4BCHA 2DS1A 3DFAA 3TCPA 2BHEA 3HZTA 4QQCA 2CDZA 4BWXA 1GOLA 1E1XA 1YVJA 4NK9A 4AOIA 5B2MA 2BFYA 2GSFA 4BYJA 2WIHA 2JGZA 3DOGA 2W7XA 3QU0A 4FKJA 2ESMA 3IW4A 5DH3A 2XNEA 4HGSA 3K5UA 5BX0A 5FG8A 3LXNA 4QP9A 4UZDA 5CWZA 5AR2A 5HE1A 3P7BA 3B2TA 3C4EA 4NIFB 5EFQA 2OSCA 2VTIA 4L6QA 3LFSA 4DGMA 3CKWA 2BAKA 2IW6A 1YDTE 4IX6A 4OTWA 4BN1A 4IDVA 5C8MA 1EH4A 2AC5A 2OH0E 3KN5A 4O91A 3NUPA 4EJNA 4S33A 3BIZA 3TNPC 1OKYA 1RE8A 2WQMA 2XCKA 3C4ZA 3NVKI 4ZTRA 3UTOA 2YZAA 5IMEA 4RIXA 5JK3A 3OT3A 2PUPA 4PMTA 2UW6A 3IW6A 4WNOA 4ZOGA 3GEQA 4ZJIA 5ICPA 3L8VA 4YBKA 3TL8A 2GS7A 2VO6A 2XYUA 5L3AA 1JNKA 4BTMA 5KKRC 3G5DA 4TZRA 1PYXA 5CI6A 4G6OA 4MD9E 4C61A 4HVIA 3ZHPC 4MVFA 2XEZA 3W2RA 1ZMVA 3CD8A 3QF9A 4PDSA 3UQCA 3KULB 3SD0A 4I92A 3QCYA 5EOLA 4DHFA 4V0GB 4IX3A 3E64A 4DH8A 1M2PA 3E7VA 1OL1A 2RFNA 2YEXA 2IZRA 3RK5A 2HY0A 3QA0A 5CANA 5EDRA 4ARKA 1Y8GA 5EM7A 4QYHA 4BGHA 3GENA 4QP7A 4YJTA 5FD2A 5C9CA 3ZUTA 3K3JA 1OL2A 3NW7A 3ULZA 1E9HA 5CQWA 2WOUA 2HENA 2J0KA 2UZVA 5D7AA 4BCJA 3S1HA 1JBPE 5G6VA 3IW8A 3LW0A 3EOCA 2VTPA 1OIYA 3NW5A 5IU2A 4FOBA 1DAYA 3BZ3A 3P7AA 4TYHA 5EI6A 5HCYA 3C13A 3RWQA 4CCUA 4EH3A 3CJGA 4F63A 1FOTA 2XVDA 1BMKA 2B9JA 3DY7A 4RX9A 3V5JA 5GIPE 3HA8A 3QCXA 4IFGA 3NUUA 4GCJA 5I4NA 5EW8A 4ZMEA 4D5KA 3TWJA 4GJ3A 4C02A 3GFEA 4D4VA 2XMYA 4GK3A 5KBRA 3CQUA 4YUQA 3GC0A 4ANLA 4AF3A 2PTKA 5J8IA 4KSQA 5CNNA 4KS7A 2BAJA 2J7TA 1WZYA 2GQSA 3FE3A 1ZRZA 3E63A 5D9HA 4FV1A 5GJDA 5JMSA 4IEBA 4D5HA 2R2PA 1JVPP 5AJQA 4CT2A 5HIBA 1MP8A 2QKWB 2WPAA 4H3PA 5FTGA 5CEOA 1U54A 4DT9A 3BU3A 2VWIA 4U7ZA 4GL9A 2XB7A 3D7TB 3UIBA 2C5NA 5BVDA 3IDCA 5IH4A 2QD9A 4MF1A 4A9UA 3ZBFA 4JG7A 1KOAA 5E9EA 2R9SA 3MY5A 4NH1A 5J95A 3VF8A 5K4JA 3R9RA 5CXHA 4QRCA 3QXOA 5DE2A 2YCQA 3BHUA 3FL5A 3QFVA 4NKSA 3VW8A 3C5UA 2EXCX 3QRIA 4OUCA 2VZ6A 5C8NA 5FXRA 3SXSA 3EN7A 3ZC6A 3Q96A 4J95A 4JR7A 5FXSA 2QVSE 4JQ8A 4S31A 3A7IA 2IWIA 3VS7A 4DTAA 4ZMFA 3NYOA 3K2LA 3UQFA 4AGWA 4UXLA 3DFCB 4K2RA 3CLYA 5LJJA 3PY3A 2GTNA 4D2PA 5BUIA 1F0QA 4XLVA 3QTUA 5GINE 4YJNA 5EH0A 4EUUA 3R00A 5DR6A 3EKKA 4FX3A 4NJDA 5IUHA 4E5BA 3O7LB 2W5HA 5DPVA 2ITTA 5DLSA 2Y0AA 3EZRA 4WD5A 5CF5A 3ZXTA 5JQ5A 4FV2A 2C3KA 2UZBA 2BVAA 2VX3A 3A4OX 4BDIA 3L1SA 2QURA 4DGLC 3BHTA 4PWNA 5TE0A 1WBVA 2P3GX 4ZJVA 4FTNA 1OPJA 4BCOA 2YJSA 1W0XC 2EVAA 3KK8A 2VTAA 5A54A 4O7SA 3V5QA 3TNIA 3M42A 4O22A 3NNVA 1S9IA 3TACA 2ONLC 3MPMA 4UXQA 4I24A 2B52A 4Q5EA 4BB4A 5K3YA 2PHKA 4O0YA 3TNQB 3F5XA 3QYZA 3VS5A 1XHAA 1VJYA 2PVJA 2VTRA 3IKAA 4HGTA 1YI6A 4LOQA 4XV3A 2PVHA 4CLJA 2FA2A 2ITOA 3ORLA 2QHMA 3LVPA 3OTUA 3QQHA 3UNZA 3TUDA 1O6YA 2J5FA 3FUPA 3BHVA 5K5XA 3FMNA 2QQ7A 5H8GA 2UW5A 3BV2A 2UW4A 3VBQA 1PMEA 3WE4A 4OTGA 1YKRA 3DS6A 4UB7A 4LGHA 3OOMA 3LLTA 4KIQA 4OTFA 4YLLA 4M0YA 4BKZA 4BDHA 4BTKA 3ZLSA 4IVBA 3QLGA 3OMVA 5AP7A 4FIHA 2WKMA 4RLLA 4FG7A 3ROYA 3RVGA 2VTJA 4A4LA 1ZZ2A 3IK3A 2V7OA 2J0IA 4MNFA 5AM7A 3ERKA 3IGOA 4J99A 3TNWA 3BI6A 4W8DA 4KNBA 5DEWA 3RNIA 3PXKA 5HOAA 1J7UA 4BRXA 3C0GA 2OJ9A 3PWYA 2R3IA 4ANQA 3RJCA 4MEDA 3ATTA 1YHWA 3FSFA 3PFQA 4O7NA 3NMUF 1BYGA 5AP5A 3TUCA 3D5VA 3I60A 3LFFA 5HO7A 4DEIA 1REJA 4CQGA 4D4RA 4HJOA 4XBRA 3AC8A 2H8HA 2X6DA 4IVCA 1VR2A 4FSWA 3PJCA 4WUNA 5JGBA 2GNHA 5E8ZA 1L8TA 1VZOA 3FEGA 4X21A 4P90A 3VRYA 4A9YA 4C4JA 3C4CA 1OITA 2FGIA 4UEUA 4O84A 3BWJA 1GZ8A 4M97A 2PE1A 3HAMA 5AUXA 1OECA 3G9LX 4BF2A 4E7WA 3LCTA 4I0TA 3MSSA 3HUCA 3Q9YA 3FMJA 4BCGA 4DITA 1PXLA 3DKGA 3PSDA 4PX6A 4IADA 2RIOA 4G1WA 4R3RA 4XNEA 2YIXA 3ZRKA 4I94A 5L8LA 4N6ZA 4RVTA 3KXNA 4C59A 4HVSA 3ZLWA 3ZUVA 5J7BA 3F5UA 4FL2A 3EN9A 1NVSA 2HXQA 3DTCA 5AX3A 3VULA 1GZKA 1KE6A 1FMKA 3EQPA 2YJRA 3O7LD 3QHWA 2C69A 4L44A 1U4DA 4BBFA 1RJBA 4EOSA 3HV5A 2LAVA 3JVSA 3Q9ZA 1M52A 5I5ZA 4QTEA 2GFSA 3BQRA 2GDOA 3NCZA 1OKVA 5FGKA 4DEBA 3GC8A 1OVEA 3A7HA 4F09A 3UPXA 4FTTA 4U8ZA 4Z3VA 4CKRA 3QA8A 3QKLA 2G15A 4DH7A 4IM0A 4O6EA 2WTWA 4RC3A 2VWWA 5KX8A 4AS0A 4AUAA 5I9YA 4PDOA 2WQNA 4NT4A 3BEGA 4RFMA 4YPDA 5CEMA 2B7AA 4F70A 1ZYDA 4TPTA 3EB0A 4RJ7A 2YM5A 4EH5A 2RKUA 5IA1A 5L6PA 1MRYA 4AX8A 3ZONA 3SG9A 3FZOA 4H1JA 3IDBA 3ORPA 5AV3A 4CMOA 3NDMA 3Q2MA 3ZZEA 4WA9A 4RFZA 3GCSA 3GFWA 3Q53A 3FKNA 4MHAA 3N9XA 3UVPA 3M2WA 1P14A 1G8AA 4FNXA 3CE3A 1YWVA 1P5EA 3HP5A 3F7ZA 4WG3A 2X7OA 3AT4A 1Q97A 4NTTA 4FUXA 1XH5A 3HMPA 3Q5ZA 4GIIA 3Q9WA 2R3JA 3GBZA 4F1TA 5M08A 2WMTA 3GU7A 4DGNA 2C1BA 2Q0NA 3NNXA 1Q8UA 2CLQA 4M12A 4H05A 2XNOA 4UYAA 2VTNA 1TQMA 2ZVAA 4RIYA 2FUMA 2GU8A 2UVYA 2V5QA 3VO3A 4HVGA 3TJDA 1V0PA 1A06A 5I9ZA 2VTOA 4QYYA 4IH8A 5CYIA 3WI6A 4JRVA 3DB8A 3TV6A 4PV0A 3WYYA 3OXZA 2CCIA 3OWLA 3OBGA 4M66A 2IVTA 3ET7A 3GUBA 2XM8A 3FLWA 3WF6A 3PIZA 2BHHA 4QP4A 1I09A 3RAWA 3WE8A 3NUAA 3ZM9A 3PVWA 5CF4A 5ACKA 1OPKA 4OAVB 4ZAUA 2UVXA 2C6EA 3MVLA 2X4ZA 3L9LA 2UZNA 4BVUA 4BWPA 4XS2A 4TW9A 3MH3A 4IANA 1YDSE 2ITZA 1URCA 4CNHA 2CCHA 2C0IA 2HWPA 4YURA 5H3QA 4FKUA 5CEKA 3ORZA 2KULA 4MKCA 5M57A 2PL0A 4FV9A 4ZSLA 5F1ZA 3RHKA 3OTVA 4I1ZA 4W4XA 3GU8A 3OWJA 4V05A 5JT2A 3VUIA 1JWHA 4C3PA 4XG9A 4MXZA 3TIYA 3OEZA 4P4CA 4RX5A 3ETAA 2CNUA 5FP6A 4YJUA 4GVJA 4JOAA 5F95A 3E7OA 3SDJA 4RLKA 4C57A 4IB0A 2PVRA 2BROA 3OS3A 4I5CA 1XH6A 4RIWA 4USEA 2OJJA 4JIKA 3LCSA 3KRLA 3OEFX 1UWHA 2JDOA 2YERA 4TYIA 3VQUA 1JSVA 4F99A 4CGAA 4FTLA 3UOJA 1LPUA 3FYJX 4Y5HA 3BBWA 3JPVA 5HNIX 3PVBA 3MV5A 4BIEA 3CC6A 3PY1A 4M69A 4CFFA 1YHSA 5HBJA 4F9AA 3FV8A 4FKOA 3EQBA 4YP8A 3QD3A 5IA2A 3OCBA 3GU4A 3QRKA 4KBAA 5AR5A 2E9VA 2WTDA 4O0SA 1OGUA 4X3FB 3R04A 1UKIA 2XK4A 2RG6A 4L52A 5CT7A 1Q4LA 4D2SA 5CXZA 4FR4A 3KMMA 4J8NA 4J8MA 3QTZA 3F5PA 4FKTA 1H4LA 3P79A 4I4FA 4M8TA 4U3ZA 1JKSA 4NCTA 4AAAA 2I7QA 3F66A 2UZUE 3DAEA 3S2PA 4FKLA 2QOKA 2OZAB 3CY3A 3R7YA 3M11A 3RAKA 4CV9A 2BIYA 4XP3A 4HVDA 4YO4A 4IB3A 3HMIA 5DRDA 3TKHA 2UW9A 4ANBA 5ETIA 5FM2A 5CF6A 2WD1A 4L68A 4MXOA 5I9VA 5BYZA 2F7EE 4TL0A 3QUEA 3F69A 2B0QA 4YU2A 4ZIMA 4MBLA 1NXKA 4O0VA 4LQMA 4B4LA 3RK7A 4EWQA 3GCUA 2QOOA 2WMUA 2A1AB 2Q0BA 2Y9QA 2WU7A 5IF1A 3SOAA 3LFQA 4C62A 4NWMA 2W4KA 3FY2A 3PZEA 1UNLA 2BAQA 4YR8A 3ENMA 2PU8A 2CGUA 3POOA 2OO8X 4DH1A 4YZ9A 3HDNA 3GVUA 2QU5A 3QD2B 3NUSA 3S3IA 4A9TA 4CKIA 2VU3A 3FL4A 4JBQA 4DGGA 4BZNA 3S95A 3E8NA 1JLUE 3I6UA 5IZFA 2VX0A 2W17A 3VVHA 2JDRA 4XCUA 1A9UA 4IZ5A 1SNXA 4FIFA 2R3LA 3SW7A 4O1PA 5CZHA 3ZCLA 3DV3A 2BRHA 3QQUA 4FF8A 4DC2A 3JYAA 4FTKA 2A0CX 1FINA 1U5QA 5CAVA 3LQ8A 3MN3A 3TTJA 2PMLX 3Q04A 3FDNA 4HGLA 4O21A 3SG8A 2Y4IC 2P55A 5CSXA 4MWIA 4FIIA 3KMWA 5DYJA 5CQUA 4W8EA 5JEBA 5HBEA 1LR4A 2XK9A 1BL7A 4GW8A 4XRJA 1DM2A 5FRIA 5CAPA 2Q83A 3L9NA 3NVMB 4G5JA 4Z7HA 2R5TA 2YCRA 2FO0A 3AD5A 3O8UA 3VBWA 3WZDA 1YXSA 3SAYA 4UMPA 4C8BA 3RWPA 2BFXA 4AT3A 4ENXA 5HX6A 4WNKA 1UU8A 4QMXA 3RAHA 3QX2A 4TWCA 3NIZA 3O0GA 2EB2A 2QI8A 5EDQA 5ANGA 3UO4A 4D28A 4IBMA 4E6CA 4ANSA 3GT8A 1ZYJA 1BUHA 2JD5A 3IO7A 4QQ5A 5H9BA 4IAKA 3SGCA 2HZIA 5FXQA 4CFWA 4EI4A 4QMNA 3FC2A 4EOMA 5IMXA 4QPAA 3UBDA 1PMUA 1H08A 3FMDA 3PPKA 5EG3A 2BZIB 3QQFA 3MYGA 2PVLA 2VRXA 4KSPA 4OTDA 2QOHA 3UNJA 4CFMA 1UNHA 3CY2A 4K0YA 4FIEA 3VS0A 2JAVA 2B9HA 3QQJA 4A07A 3A7GA 5FWKK 2ITWA 5AUTA 3PSCA 4JXFA 3HLLA 4GFOA 2VTMA 2B9FA 3W55A 5K0KA 3A4PA 3CGOA 2YIWA 2R3KA 4DG2E 2VTHA 4JQ7A 5E8VA 1JSUA 2XIXA 1XJDA 4K18A 1GIIA 3MPTA 3EQIA 3KXGA 2PSQA 2QOFA 4MNEA 5EKOA 5M4CA 4RQVA 4CD0A 4E5AX 3LCOA 2XRWA 2QONA 4MD7E 1MRVA 2EXMA 4L7SA 5HE0A 3UC3A 4DFYA 4DG3E 3BX5A 4O7TA 5F4NA 1ZYLA 4TYEA 4EQCA 4F9WA 1DS5A 3P78A 3RNYA 4QTAA 4IB1A 1JOWB 1K3AA 4P2KA 4KWPA 3TXOA 5IG1A 4IACA 3ACJA 4FEWA 3GB2A 4RWIA 1KE7A 1WFCA 3QTSA 2W1ZA 2C3IB 2XJ0A 5TT7A 3V8SA 2QLUA 4I5MA 4F9BA 4FEVA 4XLIA 5ETCA 2OWBA 3UGCA 4AG8A 2R64A 4AA5A 5KMKA 4EYJA 3QQGA 2R3HA 4CZUA 3F6XA 4JVGA 4YJQA 4DFBA 2F7ZE 4DEEA 2W4JA 3MVHA 4PPBA 3TZMA 5KHWA 3QZHA 4JT3A 5FTOA 5DWRA 4I0SA 3MBLA 3TZ9A 3ODYX 2W1GA 1YI3A 4AOJA 5CSVA 3EN5A 3ORXA 4FSTA 4L3JA 2CKEA 5EHOA 3RGFA 3RCJA 4IJPA 1MUOA 1QPEA 2ITQA 3GCQA 4QPMA 4AACA 1PYEA 2UZTA 3DBDA 4MBIA 5FBOA 5DA3A 3BQCA 2R3MA 4H3BA 4MBJA 5E8XA 3HA6A 4IVAA 4AA0A 5AR7A 2YITA 4RFYA 4L53A 4WSYA 4C4IA 1P4FA 5I0BA 3QWKA 5AFVA 2XIRA 4LMUA 4GFGA 4ANNA 2XK3A 4B7TA 3MIAA 3SKCA 5IPJA 2VAGA 4FTIA 1IEPA 4QYGA 3UOHA 3BBTB 4F0IA 3NGAA 3LFEA 4NYEA 2IW8A 4L9IA 1BI7A 3WARA 4UMRA 2YAAA 3ZUUA 5AP1A 5GIOE 3HMOA 1ZZLA 3HRCA 4S2ZA 2C6MA 3W16A 5EKNA 4BBEA 3EQCA 3KK9A 4A4XA 3DKOA 4CYJA 3ZXZA 1PMVA 3UODA 2ACXA 5E4HA 3N51A 2PZPA 5GZ9A 2PVYA 1VEBA 3P1AA 4R8QA 3PP1A 4PL5A 5HQ0A 2J0LA 2RL5A 3R7EA 4PPAA 4CV8A 3SHEA 4L8MA 2XIZA 3VHEA 1G5SA 3BKBA 2FSMX 4GT4A 1WBNA 5F20A 4X6QC 4OTIA 1IA8A 2YCSA 3JVRA 2ZV7A 2GS2A 3DTWA 5D1JA 3GU5A 4I6HA 5L2TA 2B4SB 3LIJA 4RA4A 3RPVA 1H01A 3PIXA 3PYYA 2ERKA 4BC6A 3GQIA 4G3FA 4J1RA 5AUVA 5H8EA 4ZTSA 4G34A 3OOGA 2XK7A 4OAUC 3L8PA 3C9WA 4U43A 3AC2A 4X6RA 3FXZA 3V6SA 4QTBA 3ZSHA 4ACHA 5JKGA 4C7TA 3DK6A 3NYVA 5J9LA 2OXXA 4FV6A 2C68A 3E88A 2WTKC 4IAIA 3W2CA 5LVPA 5KZ0A 4FTJA 4NIFA 4XEYA 2BPMA 4HZSA 3BCEA 5KMMA 4O82A 1WVWA 4B8MA 1H00A 4FL3A 3EZVA 4BKJA 4EZ7A 1PXMA 3FI2A 1TKIA 3LM0A 3JXWA 3PA4A 2C5YA 3WF9A 4BDCA 3VC4A 3LCDA 2JEDA 1VYWA 4CVAA 1RDQE 3MJ1A 4X0MA 5LMKA 4XX9A 3OT8A 2R7BA 3R8ZA 4F7SA 3SOCA 2E2BA 3POZA 3RAIA 3FBVA 2W1DA 3ENHA 3SC1A 4D4SA 2XIKA 3CTHA 3HV7A 1QPCA 5AWMA 3C0IA 4PUZA 4WRSA 2PUNA 3KQ7A 1J7LA 4UALA 1W8CA 5DG5A 5LCKA 4OBOA 3GI3A 2CN5A 2X8IA 5FQDC 3KULA 4ALVA 3C7QA 2W96B 3FPMA 5BVOA 5HU3A 4G16A 4V0GA 4C3RA 1FVVA 2VWYA 5AUZA 4DH5A 2O8YA 2PMNX 5CLPA 3KF7A 1BKXA 3TTIA 5CI7A 4U40A 4R3CA 2Z7QA 4IC7A 3E87A 3VS4A 3W10A 4EEVA 4EHVA 4N70A 4FEQA 5JQ8A 4BHZA 4LL0A 4A9SA 4YJVA 1H1QA 2Z02A 3LLAA 1HCLA 2VO3A 5HD4A 2CPKE 3FQHA 3DZQA 4G5PA 4DBXA 4YC6A 5LWMA 3R9NA 5IQCA 2SRCA 2PULA 3KB7A 3WIGA 1QMZA 2YLFA 3FLSA 5AAGA 3MJ2A 4JAIA 3OY1A 2C6OA 5JFXA 1K9AA 2NRYA 4L45A 2XIYA 1R0EA 3D83A 3QUPA 4ZP5A 4NM5A 1YXUA 2WMVA 3DNEA 4Y83A 3E92A 4WIHA 3ZYAA 3OF0A 1XBCA 4CSVA 3FZTA 2WTJA 4H1MA 4LGDA 2HIWA 2CKPA 4LOOA 2BTSA 1YOJA 3CPBA 5A9UA 4ITJA 3BU6A 2JBOA 4F7NA 5L2IA 2WQOA 2J90A 1OKWA 1A48A 2CNVA 2XF0A 4RPVA 4MXYA 3KXHA 3DBFA 2QOIA 5LVLA 4O81A 2QOLA 5DHJA 5IKWA 2C47A 3CCNA 2VWUA 4CXAA 3DB6A 4FMQA 3L8XA 5IQDA 4C33A 3W32A 3D7TA 4KBCA 1SVHA 5DFPA 4M0ZA 4W9XA 2GQGA 4H39A 4FUYA 4I4EA 5C01A 4NM0A 2UZLA 2ZOQA 3A8WA 4Y73A 3PSBA 3DPKA 4UWCA 5D10A 4O0XA 5IUIA 5L6WL 5HTBA 5M56A 4HOKA 4FSUA 4C36A 3G15A 4FIJA 5IDPA 4EC8A 2REIA 5HG8A 5HO6A 3MA3A 5BVKA 4ZTHA 1JQHA 2C4GA 1MQ4A 4FODA 3T3VA 5IH5A 1YXTA 4KUJA 2C5VA 2ERZE 4PL4A 3CQWA 4G3CA 2PZRA 3FMEA 4TWPA 4H58A 5EW3A 3IS5A 2HW6A 4PF4A 1H1WA 2PY3A 4PTGA 4C38A 2OJIA 4FL1A 2QU6A 2Y6OA 4BDKA 4BZOA 4W4VA 1R78A 3C0HA 2W5BA 4B6LA 1OL7A 2V7AA 4NW6A 4XG4A 5T6KA 5M51A 5T3QA 4UMUA 2C5XA 4Q2AA 4YZMA 4FTAA 5FEEA 4FGRA 2UW3A 2YM4A 4JBPA 2ITNA 3MY0A 4EORA 2WZJA 3VBTA 4BY9E 3T3UA 3E93A 3GCPA 1H27A 4YHFA 4DTKA 4YNEA 1M17A 5K9IA 4QMYA 3IOKA 4XH6A 4NW5A 2Y4IB 3W33A 2BR1A 4I93A 4IW0A 5DMZA 4NSTA 5E7RA 5GHVA 4ANMA 4WHZA 3F3UA 4ZXTA 3UMWA 2IJMA 3QTXA 5CF8A 2FVDA 4O7RA 2BZKB 3UYTA 4O0UA 3EYGA 5CTPA 3HDMA 4DFXE 1Y57A 4TRLA 4YZDA 4AZTA 2OKRA 4EYMA 3RHXA 3FQSA 5KMNA 2QG5A 3HMNA 4XG3A 4OT6A 4JR3A 5DN3A 1I44A 3OROA 4DEAA 4BICA 4E4LA 5HGIA 4E73A 4EH9A 3E62A 4NEUA 3VHKA 3VW6A 2YCFA 3D2IA 1L3RE 5F9EA 2BRNA 4OT5A 4FVRA 1IAHA 4FE2A 4C34A 3ZU7A 3GNIB 5I3RA 2BILB 2WTIA 3P86A 3QTIA 2GFCA 4ONAA 4U6RA 5HLPA 3AQVA 4BDFA 4GT5A 1CMKE 4QMOA 4QMPA 4XRLA 4BL1A 4FI1A 4AU8A 4E6AA 2I0VA 3U9CA 4C58A 4LRJA 4JDKA 1Q99A 2ZM1A 3I79A 2UZWE 3QRJA 4F6SA 4J96A 2BZJA 4RQKA 4E93A 1IA9A 4R7BA 3FQEA 5EM8A 1XH4A 3WF7A 2P33A 4L00A 3PDTA 3N4TA 2QOBA 5L8KA 2ZV2A 3QKMA 3VS1A 3IW5A 4Y85A 4GIHA 1YI4A 4GSBA 3O71A 1OL6A 3ORTA 3EQRA 2PVFA 3W2SA 3WZKA 4ZSEA 4ASEA 2VO7A 4IHPA 2JBPA 4HPUE 4L46A 5TR6A 5JGDA 4I41A 1FVRA 3ZSGA 3OG7A 3RZFA 3DCVA 4MD8E 4G3DA 3L8SA 1J3HA 4LRMA 4RVMA 4G31A 3RALA 3QC4A 4DH3A 3BPRA 1R39A 4ENYA 5M09A 3MB6A 3QZIA 3EMGA 3FPQA 2GNJA 4WG4A 5HG9A 4F7JA 3L9MA 4WUAA 4IM3A 3CR0A 4LI5A 2BUJA 4WT6A 3GQLA 5C27A 2W06A 4D4YA 3PE1A 5AP3A 4GU6A 5M4FA 4AZSA 4UYNA 4Z16A 1J1CA 2ZV9A 4P7EA 3OUKA 4IAZA 2G01A 4I3ZA 4LYNA 4YTFA 4AE9A 4A06A 2YDKA 2WO6A 4CRSA 3LMHA 4KIPA 3NIEA 4FOCA 5AUYA 2HZ0A 4IZ7A 3F9NA 4IE9A 5EYKA 4R1YA 1W83A 4FVPA 5M53A 3HNGA 4BR3A 5IQEA 5JZJA 3RZBA 3IW7A 3AC1A 4XP2A 3R8LA 5EI2A 2CKQA 4ZTLA 4CMTA 2IVUA 3IG7A 3R9HA 1F3MC 3ORIA 3D15A 1X8BA 1WVXA 4PMPA 1WVYA 4FZ7A 3NUNA 2WTCA 5HVYA 3H9OA 3R8PA 2PYWA 4UMQA 2ETRA 4EH8A 3NZ0A 3PP0A 2GNFA 2ITUA 2X2MA 4WKQA 2WAJA 4U80A 4IJ9A 5CASA 4FV0A 2A27A 3NPCA 2JITA 5HORA 4P5QA 2F7XE 5A6OA 2W9ZB 3RTPA 4ACMA 2CNQA 4ERWA 3HAVA 3V51A 4R78A 4WNMA 1M7QA 2OJFE 3D5XA 3HVCA 2V22A 1OPLA 4F08A 4MCVA 4USDA 5LMAA 4CTCA 3IOPA 3LFBA 3MGYA 4XP0A 4NJ3A 5AR8A 5AA8A 2VNWA 3F2NA 4CG9A 3P23A 3VS6A 3F2RA 3FWQA 3JY0A 4C2VA 3PVGA 4G17A 4QP1A 1JKTA 3WZEA 2XH5A 4KKGA 5EW9A 5HKMA 3NEWA 3TKIA 3TNHA 1PY5A 2W05A 5E8TA 5A46A 3ZS5A 5EHLA 2WHBA 2R3NA 3P4KA 2RG5A 4LGGA 2XKDA 1OL5A 4GKHA 4FSZA 3QXPA 4AFJA 2W1EA 1YXXA 3LXKA 2GNIA 2G1TA 3E8EA 3ORNA 2OLCA 1TQPA 3MTFA 3AMYA 3O23A 4MX9A 2QO2A 4RC4A 3SQQA 3G6GA 3KRWA 4FNWA 4R7HA 4BCFA 3BHHA 5IISA 4CYIA 3DBQA 3RMFA 3LM5A 5BVEA 4U81A 3H0YA 3DK7A 3D2KA 3PZHA 5JRQA 5AM6A 3NX8A 4EBWA 2H96A 3VUTA 2VTTA 4DINA 3UNKA 4AZEA 1ERKA 5HNGA 3V04A 2XNBA 5E8WA 5FLFA 4D55A 1M2QA 1Q5KA 3BGQA 3DJ5A 3KRJA 3QC9A 3PXRA 4O6LA 2JIUA 2XKFA 4MXAA 3WIKA 4CFVA 2R3PA 4F7LA 5IEYA 4KD1A 3IDPA 1CKIA 2UW7A 4O86A 3PXQA 4DLIA 4BCIA 3I6WA 1LP4A 4CCBA 2WXVA 2XUUA 4IAAA 4WBBB 5CAUA 1ZY5A 4ZSJA 4QQJA 3VBXA 4JI9A 2F57A 2C1AA 4S30A 1UNGA 4CFNA 3CP9A 3RK9A 2UZDA 1GIHA 3HL7A 3HUBA 5HHWA 4DF3A 2Y7JA 4KINA 3CTQA 5M06A 2R3GA 1DI9A 4IB5A 5IA0A 3OP5A 4M84A 2YZLA 1M7NA 4E4NA 3QBNA 4Q9ZA 4ZZOA 2I0EA 1OI9A 3B8RA 4PY1A 5HVJA 5DT4A 3P7CA 3QCSA 4IFCA 2QNJA 4U97A 2JAMA 4G6LA 3ZEWA 2IN6A 4KRDA 5IQGA 4J71A 2DQ7X 3Q2JA 4LV8A 2CMWA 1GNGA 3PG3A 3R22A 3AXWA 2ZV8A 4R3PA 1QL6A 4O7WA 3PRFA 4DAWA 2CJMA 4M3QA 4YMJA 3EFJA 2ZMDA 5L4QA 2NO3A 3MWUA 2UV2A 5G1XA 3MDYA 1KE9A 1W84A 1XQZA 4D1XA 3D5WA 2I0YA 2JKMA 3FI3A 3GC7A 3W2QA 4XHKB 4TWNA 1NT2A 3BWFA 3AT2A 3ZOSA 3HKOA 4X3FA 2Z7RA 3K54A 5CVFA 4AP7A 4CQEA 4AZVA 2OF2A 2VGOA 2O64A 2PMIA 1T46A 3VWAA 2YHVA 3EN6A 5IEVA 4QT1A 3GP0A 2BDFA 4LG4A 2WFYA 4UN0C 5CU6A 4WRGA 2C0OA 1ZMWA 2BRBA 3KC3A 2OZAA 3FZSA 2CSNA 4ZTNA 4E5WA 1CM8A 3MA6A 2J0JA 3PXFA 4R5SA 2ITPA 3O2MA 3KVXA 3PVUA 4K1BA 4UY9A 1FBNA 4IDTA 4S34A 5EK7A 4DCEA 4FZ6A 3BLQA 2OIBA 1ZMUA 4APCA 3V5PA 2PZYA 2Z7SA 4DEHA 1AD5A 1CKPA 5HEZA 2AC3A 3KA0A 4CTBA 2J9MA 3R9OA 3AD4A 3HECA 4XG7A 3COMA 4L7FA 4YC8A 3JUHA 3QLFA 4FT5A 4ZLYA 1WBPA 3BU5A 3ITZA 1WBOA 3HP2A 1H25A 1Q8ZA 4EWHA 3U4WA 4FSMA 3VUHA 2UZOA 3C4XA 1PRYA 2QCSA 2QODA 5T68A 3D9VA 2EU9A 2YACA 2C0TA 5J9YA 3QRUA 1OIQA 3A2CA 5JRSA 3JY9A 4GYGA 4MYGA 3HYHA 2P2IA 3VUMA 2XKEA 3CQEA 4QMMA 4Y8DA 5ANIA 4EK3A 2JC6A 1M14A 3CIKA 4EL9A 1UWJA 1P2AA 1PKGA 3ORMA 4IWPA 3ANRA 3BYSA 4TKSA 4UBAA 3W8LA 2WNTA 1SVGA 2R7IA 4D58A 3B2WA 1OM1A 2ZJWA 3QTWA 4OLIA 4PMMA 4QTDA 5AP6A 5EYDA 4CMUA 4JG6A 4HYUA 4GUBA 4I6QA 4IQ6A 3UJGA 2WMSA 4BFMA 2E9PA 4KKHA 1BL6A 1PXNA 4WO5A 5B0XA 3HRFA 3TN8A 4YTCA 3HEGA 4AGUA 4ZZMA 3FI8A 3BLHA 4X2NA 2VGPA 4XUFA 3TZ8A 1U46A 1M2RA 4QMUA 4AN2A 4PMSA 3PTGA 3ZBXA 2AUHA 3NS9A 1OB3A 3ZTXA 3KL8A 3Q4ZA 2ETKA 4DGOA 1Y6AA 5AIKA 4RBLA 4EC9A 4BZDA 5AAFA 3Q60A 1PXKA 4CG8A 3OUNB 4J52A 2E9NA 3KF4A 4NTSA 4NKAA 4RJ4A 5BVWA 4WG5A 1ZYSA 4FKGA 3AC5A 1IASA 3F61A 4O2PA 5EYMA 3FLZA 2FSTX 5DR2A 2YN8A 2B55A 2V55A 2WMXA 4CKJA 4FV7A 1Y8YA 2VTSA 1H0VA 2KTYA 2XM9A 3FMLA 3I4BA 2W1FA 3EFLA 2VV9A 4RJ6A 3DU8A 2YM7A 2NPQA 5CEIA 5KO1A 3LOKA 2BALA 2J4ZA 4DFUA 4I21A 5KMIA 4GT3A 4O27B 3ANQA 2O3PA 3DDQA 2A2AA 1ZY4A 3C5IA 4KIOA 2YAKA 5HLWA 4CZYB 3VQHA 4FKRA 5FEDA 3DZOA 3RPOA 4RT7A 2YDIA 5CAQA 3TV7A 3D7ZA 1WCCA 5ANDA 3V01A 3AGLA 3FAAA 3UG1A 4FT9A 4ANOA 4FSNA 2AYPA 5HD7A 3OCTA 4FZDB 2W1HA 1LUFA 3BEAA 4TNDA 2ITVA 2X8EA 2B1PA 5TKDA 5A6NA 4BDAA 1ZAOA 5HVKA 4TY1A 4D0XA 4IVDA 1UVRA 3I5NA 3BYVA 5LXMA 3BELA 1Q41A 3IECA 3H3CA 3AOXA 4QO9A 2E9UA 2YWVA 2RSVA 3GC9A 4QMLA 3H10A 3ZO4A 2J6MA 4GYIA 5I9XA 1SMHA 3IQ7A 4QOXA 2OFVA 3DBEA 3ZRLA 4ZSAA 2QR8A 3UVQA 4J53A 5KKRB 3QGYA 5EYCA 4IWDA 1DI8A 4C3FA 2BDWA 5JFWA 2XK6A 5DEYA 5C8KA 2FSOX 4GK4A 5HIDA 4QYEA 4E1ZA 4O7LA 1REKA 3A7JA 4HYSA 4JL9A 5EQEA 2R3OA 3R7VA 3NNUA 2A19B 5CAOA 3ZLYA 4BI1A 2C6IA 1XR1A 3HV4A 4K6ZA 4XG6A 3PPZA 5CEQA 4BCNA 4FTOA 4AXAA 4RG0A 2Y4PA 3U6JA 3R7IA 1UU7A 4FKIA 4FT0A 4RJ5A 5DVRA 5A4EA 3PJ2A 3U55A 4U42A 3SA0A 1SYKA 4JDIA 4E4XA 2W0JA 2HELA 1R3CA 3FHRA 3P0MA 4U9AA 4YLJA 4QMSA 3M1SA 4XBUA 4FNZA 4QP3A 3GOKA 4Y72A 4YJOA 4JRNA 3DLZA 3QWJA 3ZC5A 2YM3A 2Z60A 3Q3BA 4YC3A 1B38A 3FMHA 3SRVB 5HU9A 2JFLA 3QL8A 4TYJA 5HX8A 4F1OA 3AC4A 2XKCA 2J51A 1GAGA 1V0OA 4N4SA 3FXWA 5IQBA 2VWVA 1OBGA 3A60A 2DWBA 2W99B 4H3QA 2XS0A 2GHMA 3W1FA 3BHYA 4TWOA 2B54A 4AT4A 4EOIA 3F82A 3LE6A 1QPDA 4F9YA 1PW2A 2JKQA 4EJ7A 2FYSA 3EYHA 1KOBA 2GNGA 2XYNA 3DKCA 3LZBA 3QALE 4QQTA 4ZZNA 5E92A 4USFA 2OG8A 2OXDA 4ACGA 4F6WA 3D14A 5CX9A 3VBVA 1KV1A 2QC6A 3KXXA 3R0TA 4AQCA 4F0FA 1AQ1A 4QPSA 3TG1A 5IQAA 3EJ1A 3VS3A 4JNWA 3UE4A 5HNBA 4O0WA 3UIXA 1Q8TA 1Q8WA 1SZMA 2PK9A 2O63A 4GV1A 2C6DA 3ZFXA 4ALUA 4IWOA 2C30A 1JPAA 4AZFA 1FGKA 4BCMA 2NNWB 3ZSIA 4PDYA 4FTMA 4FEXA 4DE4A 3KCFA 5CVGA 1TQIA 4XG8A 3MFRA 3ZFMA 5J5SA 4AGDA 1WAKA 3DKFA 4JX7A 4YO6A 3FKOA 3A7FA 3CPCA 3WILA 4NFMA 4KIKB 1NW1A 2HCKA 2YFXA 4HZRA 1OIRA 5IA5A 4FV3A 3HRBA 3VF9A 4HW7A 1Y6BA 4ACCA 5IA3A 3I1AA 5BVNA 5LOHA 4E6DA 3QRTA 1XWSA 3EH9A 5KE0A 4RVLA 2NP8A 3OW3A 2EXEA 4FTUA 5AUWA 4AW2A 3GOPA 4MQ2A 4EKKA 3OHTA 3S0OA 1OKZA 4XV9A 2QOCA 5KCVA 4YJPA 4BCQA 4MAOA 5JGAA 3C4WA 1OUYA 5D7VA 2YABA 3ATSA 2XBJA 3R63A 4UV0A 3VAPA 3C50A 2ZYBA 3DK3A 2UW0A 2PVKA 2Z7LA 3UMXA 2PE2A 2F4JA 1OZ1A 2W4OA 4F65A 1W98A 5AAEA 3KREA 3WF8A 3W2PA 3OXTA 1O6LA 3OY3A 3FY0A 3ZZWA 4EZ3A 3WZUA 3DXNA 3W18A 4GH2A 2VD5A 4DTBA 2NRUA 2RGPA 5AP2A 5CSHA 2ZM4A 3KXZA 3PY0A 3RINA 3AGMA 3HV6A 3VN9A 5LQFA 2G9XA 4XV2A 1YQJA 3CXWA 4BIDA 4DG0E 1KUTA 3ALNA 4BGGA 4QTCA 2C3JA 3NNWA 4I0RA 4EBVA 4I6BA 4XV1A 4RIOA 5IDNA 2JFMA 4PTCA 3FLQA 3UIUA 1H1RA 1WBSA 3WZJA 4EHGA 1LEWA 2WMRA 3JR1A 2DYLA 5M07A 3R7GA 2VTQA 3A61A 5JN2A 3AMAA 5I9UA 3GU6A 4FSQA 3VJOA 3U87A 2ZB0A 3AC3A 3R83A 2O65A 2EUFB 1KE5A 2WIPA 4QNYA 4CEGA 2IW9A 4U41A 1ATPE 4C4EA 5AR4A 1O6KA 2JDVA 4BYIA 4GS6A 2X7FA 5ANJA 4EKLA 4EOKA 5BQ0A 3R1QA 1FGIA 3F3WA 4K33A 3K3IA 3PJ1A 3OCSA 2QKRA 4AOTA 3R7OA 3R01A 1ZARA 3EIDA 5GNKA 2EB3A 4PP7A 1J1BA 4EOJA 1YOMA 3I81A 3RM7A 2XNNA 3D94A 2HAKA 4GFMA 4C0TA 5HO8A 3KRXA 1CSNA 4FYNA 3TZ7A 3P08A 5H8BA 5HTCA 3MW1A 4C4HA 1H0WA 5FUTA 5LVMA 3DQWA 4RGJA 3LFCA 2BTRA 3TUBA 1H1PA 2JKOA 1B6CB 5TF9A 3MPAA 1H8FA 3ZDIA 2XK8A 3C4FA 2R3QA 3KMUA 4YZBA 5CVHA 2OH4A 5D11A 4MH7A 4EOOA 1O9UA 3CS9A 3ZEPA 2JDSA 3LJ2A 3IPHA 1ZXEA 3EQDA 4DLJA 4IMYA 3ODZX 4NU1A 4HPTE 2P0CA 1Z57A 3F7WA 4IX4A 2HYYA 3MTLA 3LCKA 1RQQA 1JKLA 3FZPA 5AADA 5J9ZA 4N57A 5ACBC 2X9EA 3DNDA 4ITHA 5E8UA 4ZS4A 3H9RA 5ANKA 4JLCA 4FTRA 1XKKA 4V04A 4FGBA 2QOQA 4LUDA 3G0FA 3DXQA 2VNYA 4JDJA 3P9JA 4XOZA 3V3VA 4A9RA 3RI1A 3CJFA 3VUGA 3ORKA 2OZOA 4O2ZA 1ZWSA 3PE2A 1UA2A 4WBOA 3OWKA 3ZH8A 3MI9A 5K0XA 3O96A 3GGFA 4GG5A 5ANOA 4EK6A 3U9NA 3O8TA 4R77A 5J1WA 4UZHA 3GCVA 3O8PA 2GS6A 3QQLA 2H9VA 3OWPA 4PRJA 1WMKA 4A4OA 2ETMA 4FICA 4QNAA 4RIXB 3N4UA 1H26A 3ZFYA 2PWLA 4ERKA 4L01A 5AV0A 5BUEA 3MVJA 4LOPA 3S4QA 3ZLXA 2ZMCA 3F3TA 3KU2A 4FZFB 5HBHA 4OW8A 3QD4A 3NW6A 4HNFA 4BWKA 4TTHB 1Y91A 1PMNA 4E20A 4QMQA 4E8AA 4S32A 4ZK5A 1BLXA 4PNKA 3SW4A 2ZM3A 4FK3A 5EHYA 3RM6A 4X3FC 3MFUA 1FPUA 4YJRA 3ZDUA 4ZLOA 3ID6C 5IQFA 5DGZA 3TDWA 3F88A 3MS9A 3II5A 3QHRA 4FVQA 4ZS0A 2YM8A 3E8CA 3I0OA 4ZLZA 3EWHA 3K5VA 1GIJA 4WNPA 1ZOGA 3MH2A 5AA9A 1FQ1B 1R1WA 2W1CA 2O5KA 2HK5A 4FSRA 4BDEA 2WMAA 1V0BA 3CGFA 3ZMMA 4R1VA 3LQ3A 3JS2A 2Z2WA 5ANEA 2XJ2A 4U5JA 4E26A 1STCE 2UVZA 4AT5A 4TYHB 5J1VA 1W82A 2VO0A 4RWLA 2FSLX 4O7ZA 2CGWA 4ASDA 4AW1A 5I9WA 4JBVA 3DBCA 3V5TA 5C1QB 4EHZA 4ASZA 1HOWA 5CS6A 3E3PA 3G2FA 3KCKA 4OBQA 3PJ8A 2GCDA 2HW7A 3UPZA 4EH2A 4V01A 3WF5A 2IZTA 4ZTQA 2VWZA 1MRUA 3ZM4A 4NCTC 5EQPA 2JKKA 3ZRMA 1UU9A 4R5YA 3BYUA 5DRBA 2YIYA 2C5OA 5DR9A 3NRMA 2X0GA 1PF8A 3KXMA 3NUXA 4MK0A 2J50A 4MWHA 1JSTA 4QMTA 5HI2A 3UZRA 5M55A 1Q24A 5BPYA 4J7BA 3RPYA 1OUKA 1KWPA 3QD0A 3UZPA 5ETAA 3EL8A 2IZUA 4RJ3A 4D2WA 1R0PA 2IVSA 3ZO1A 4EHEA 1U54B 4F0GA 5L6OA 2PUIA 4CRLA 2CN8A 4O1OA 3R6XA 4PNIA 5JSMA 3VRZA 1IAJA 1H24A 2XCHA 3DGKA 3PRIA 5M4IA 4KS8A 3C51A 4FTQA 4G3GA 3UC4A 5FTQA 5DT0A 5A14A 4FYOA 3CTJA 3MH1A 3FJQE 3MVMA 2A4LA 4M13A 5EQYA 4IZYA 4G9CA 5M44A 3PPJA 2HXLA 3MIYA 3R7UA 3R30A 1P4OA 4YLKA 4C35A 4YBJA 5AEPA 1ZLTA 4YHJA 5HCXA 4NZWB 5KNJA 2R0IA 2WMQA 3H0ZA 3TKUA 4HCTA 2FB8A 2XBAA 5EM6A 2CLXA 4C37A 1YDRE 2RFEA 4NFNA 3AD6A 1Q61A 5CNOA 3BGZA 3RPRA 4ALWA 3RP9A 3V8WA 4YJSA 3ZO3A 4XJ0A 3MFTA 2P2HA 4TNBA 3U51A 1NVRA 2OF4A 4O38A 2CGVA 1XBAA 2XP2A 3BRBA 5AR3A 2WU6A 2X6EA 4MXXA 4DFZE 5IA4A 1AGWA 1CKJA 3AG9A 1YOLA 4TYGA 5GZ8A 5BMSA 4BI2A 4C4GA 1ZOHA 3BV3A 5HIEA 2IG7A 1XH7A 3TT0A 4FK6A 2X2LA 4DA5A 3PLSA 3I7BA 3OXIA 3UP7A 2I40A 4KKEA 5E91A 4OR5A 4M67A 5EOBA 5HESA 4AN3A 5CU4A 2R3FA 2F9GA 5AX9A 5CSPA 3FI4A 2OU7A 1LEZA 4IC8A 3QQKA 4EUTA 4Z55A 3FC1X 4BCKA 5A4TA 3U54A 3COKA 3NYXA 4I23A 1H1SA 4F9CA 4GVAA 4NM7A 3UG2A 2YM6A 4HCVA 4IX5A 5DNRA 2FH9A 3R21A 3R1YA 3PA5A 3AT3A 2XZSA 3DAJA 4FC0A 1J7IA 4FNYA 4RZVA 2J5EA 3Q4UA 4ZTMA 4JIAA 3VNTA 2QO7A 3OZ6A 4BDBA 4D2RA 1JKKA 1YWRA 2WTVA 3U6HA 2QR7A 4F6UA 2WMWA 2YISA 4BGQA 4YHTA 3GXLA 3HMMA 4FKPA 3QZGA 3OW4A 2YIRA 4JJRA 4D2VA 2OICA 4RJ8A 2GQRA 4EZ5A 4Q5HA 3BGPA 2EWAA 4FG8A 2PVMA 4G9RA 5H2UA 3F3VA 3T9TA 3U6IA 1YHVA 4C2WA 5AIRA 5AV4A 2OIQA 4BTFA 4RMZA 3G9NA 3R8VA 2PE0A 4EOLA 3UOKA 3F3ZA 4XOYA 3MESA 1BX6A 1TVOA 4KAOA 3BYOA 3QTRA 2HWOA 5HCZA 4BDGA 1G3NA 1GZOA 4DN5A 3CSVA 3PLAE 1PXOA 3KKVA 4FKQA 5JH6A 2OI4X 3Q32A 5KZIA 2RF9A 3C1XA 4FZAB 5HTIA 2WTKB 4GG7A 5FP5A 5CY3A 2CHLA 2IO6A 5D41A 5CZIA 2YWPA 3BE9A 3V5WA 3LAUA 4PL3A 3T9IA 4O7VA 5J5TA 2V0DA 2UW8A 1NY3A 2I0HA 5C03A 5TO8A 4FA2A 2PMOX 1E1VA 2X8DA 2XJ1A 3KGAA 3LJ0A 2R0UA 5LMBA 5A4LA 4L43A 4GKIA 1GY3A 3DJ7A 2C3LA 3FHIA 4PTEA 4G6NA 5DIAA 3NAXA 4PP9A 4OBPA 2OBJA 1PXJA 5AUUA 5C26A 3UQGA 4MF0A 2VWBA 4BDJA 2HY81 2VN9A 5HE2A 2WEVA 5EDPA 1U5RA 1FVTA 1NVQA 4A7CA 5E1SA 4EK4A 4IAYA 5LCJA 2YLEA 3NAYA 5K4IA 5HICA 1F5QA 2PZ5A 3N4VA 2F2CB 3FLNC 4FBXA 4X2KA 2PUUA 3DQXA 4QP2A 2V62A 4D1ZA 1Z9XA 4NM3A 4DFNA 5AMNA 4YTIA 4IM2A 4N6YA 3UIMA 3TDVA 3PXZA 4XG2A 3EL7A 5AP0A 5FBNC 3W2OA 4QP6A 3L9PA 5HG5A 3SVVA 2ITYA 5IQHA 4YZNA 3ROCA 3LHJA 4M68A 3CKXA 2OXYA 3VBYA 3FZ1A 3Q4CA 3SLSA 2VWXA 3VIDA 4DEDA 5CU2A 4JBOA 3LXLA 4K8AA 4RX8A 4FT7A 5DBXA 4DCAA 3A62A 3MH0A 5CU3A 3ZO2A 4E6QA 4MTAA 2P4IA 3BLRA 4ACDA 5CENA 2XNPA 1Q8YA 3R9DA 5IUGA 3EHAA 3LKMA 4UWYA 2WGJA 4YNOA 4KB8A 3R2YA 4I22A 4F1MA 1G8SA 3H9FA 2ZB1A 4ITIA 1Q3DA 5JFSA 5L8JA 2JIVA 4Z7GA 1XH9A 4QP8A 3DT1A 4O0RA 3OD6X 1GJOA 4B99A 4Z9LA 5B2LA 4RA5A 4O83A 5F94A 3T8OA 2X39A 4PPCA 2G2FA 2IPXA
chains in the Genus database with same CATH superfamily
2W5AA 2J2IB 3COHA 2X81A 4GUEA 4AWIA 3QYWA 2XNGA 3NSZA 3NLBA 4EH4A 4IWQA 3EQFA 3LPBA 2B53A 1PKDA 2X7GA 3FLYA 4R6VA 2UZEA 4RX7A 1OBDA 2B9IA 5HE3A 4YGAA 3TV4A 2I1MA 4UMTA 2WQBA 5J7HA 3FMKA 4RIYB 1KV2A 4JX3A 5A4QA 1UKHA 5C4LA 1Q62A 2C6TA 3EFKA 2VX1A 5LMKC 5FDXA 4AW5A 2H6DA 2GNLA 2PVNA 3QCQA 2GHLA 3CBLA 4II5A 2WEIA 4OTQA 5FEQA 2ZDUA 3EQGA 3MY1A 4I6FA 4EOPA 5L2SA 4D1SA 4KRCA 5GJFA 4O96A 3TJCA 3RCDA 3FYKX 1CDKA 4L3LA 3PXYA 1DAWA 3BYMA 3G33A 4QD6A 3O17A 2BKKA 4O0TA 4QMVA 3VJNA 2AEGA 2HOGA 1Q3WA 2BCJA 1WBWA 4IIRA 3R71A 3SV0A 4L42A 1MQBA 4H36A 3HGKA 2O0UA 4IXPA 1JAMA 4CLIA 1KE8A 5KBQA 3UVRA 1W7HA 2CGXA 2BKZA 2JLDA 4AFEA 5LWNA 2HZ4A 4AW0A 4CFUA 4B8LA 1ND4A 2OFUA 4U45A 3H4JA 4B0GA 4BIBA 5B7VA 5BVFA 3UZTA 3VS2A 2GPHA 3NCGA 4C4FA 4QMWA 2W9FB 3G90X 5M4UA 5JFVA 3FSKA 4Y5QA 1NA7A 5BMMA 4ID7A 3IONA 1ZYCA 4JDHA 2XRUA 3OC1A 4LUEA 4B9DA 4BI0A 4RWKA 3TEIA 5CSWA 2WB8A 2RFSA 2XEYA 2QLQA 4KA3A 4LFIA 3W0OA 3LFAA 4I5HA 4RIWB 5J87A 2WOTA 3G51A 3HV3A 5LVOA 5E8SA 2XNMA 3UO5A 3RBWA 4IZAA 2C6LA 4DT8A 5BYYA 5L2QA 5LARA 2G2HA 4XMOA 4DYMA 4JS8A 2PPQA 5KMOA 2ONLA 3HX4A 3SX9A 4M69B 2BDJA 4FEUA 2CKOA 1QPJA 1ZOEA 4RRVA 1APME 4F4PA 3P5KA 1YW2A 1QCFA 3Q6UA 4MQ1A 5KMLA 3Q6WA 3LMIA 5BV3A 2Y6MA 3OFMA 4FV4A 3UDBA 4GEOA 4J98A 3D4QA 4M7IA 4KBKA 1HCKA 4EONA 4BDDA 3FMMA 2VTLA 3FKLA 3LMGA 4HCUA 4OTRA 3G6HA 4LMNA 4EQUA 4D9UA 3PWDA 5DI1A 3OBJA 3EFWA 4BHNA 3I0QA 3PG1A 3RPSA 5FDPA 4RZWA 1CTPE 4MXCA 3W8QA 3U8WA 3BE2A 3QKKA 4HNIA 5GJGA 2ZDTA 4EH6A 3EQHA 4I6LA 3MB7A 1V1KA 2QO9A 4ZY6A 5KHXA 4E3CA 2DUVA 3UO6A 3F2AA 4HVHA 5HLNA 2BIKB 3CD3A 2YIQA 1GZNA 3ALOA 1PXIA 4FV5A 3KEXA 4X2FA 5A4CA 4X7QA 5C4KA 3SXFA 4X2GA 4D0WA 3G0EA 3WYXA 3IGGA 3FXXA 4YPSA 4I5PA 3UP2A 4BCPA 3R02A 2IVVA 4LM5A 2OW3A 5A3XA 1PXPA 3NUYA 5E8YA 2I6LA 4Y95A 4XYFA 1XH8A 4YSJA 1PJKA 1SM2A 3OCGA 4X3JA 4G2FA 4M14A 5KMJA 1XBBA 4K77A 4I20A 1IRKA 2HZNA 4LRKA 5CT0A 4DEGA 4L67A 3Q9XA 4ZEGA 2BRGA 2OJGA 2PZIA 4J97A 2X4FA 4ZY4A 3TM0A 1PHKA 4RWJA 4YSMA 4GK2A 4JAJA 2YDJA 3SRVA 3ULIA 5ITAA 2OGVA 5BUJA 4K11A 5BNJA 5E90A 3Q5IA 1YWNA 1XO2B 2WQEA 4KABA 5AV2A 3DXPA 1SNUA 5BYLA 5HG7A 4LL5A 4EQMA 2GHGA 3LFDA 3R1NA 3DDPA 5IEXA 4CZTA 3AKKA 4RC2A 4GMYA 2R4BA 1OIUA 4P5ZA 4NL0A 3V6RA 3KN6A 4FTCA 4UX9A 2Z8CA 3UYSA 3EN4A 2X9FA 3R8MA 1YXVA 4U44A 1IR3A 3QZFA 5AP4A 4ZJJA 4FSYA 4AN9A 3QAME 3I5ZA 4LV5A 3SXRA 3FZRA 3LXPA 3LJ1A 3D5UA 3EKNA 4EH7A 1UV5A 2QHNA 4O7YA 2W1IA 3B8QA 4FG9A 4E4MA 5EM5A 5K5NA 3DA6A 3R8UA 2VUWA 4ZSGA 5AV1A 1H07A 5D12A 3NYNA 4AA4A 5LVNA 2XA4A 4WSQA 4D9TA 4DBNA 2OIDA 4PQNA 5JZNA 3V8TA 5EI8A 3I7CA 1OMWA 2O2UA 2WMBA 1U59A 4HYHA 4G3EA 4KIKA 3A8XA 3AMBA 3LQ5A 3TI1A 5I3OA 3KY2A 3PA3A 2E9OA 1T45A 2LGCA 4R7IA 4BTJA 2G2IA 2GMXA 1BI8A 2JDTA 3E8DA 5E1EA 4BKYA 4FIGA 1IG1A 4RSSA 5IQIA 4MNEB 4WOVA 3WOWA 3D0EA 1XMMA 4U3YA 5B2KA 1Z5MA 1URWA 1FMOE 3PJ3A 2RFDA 5HZNA 4O4EA 4QYFA 2BMCA 3KFAA 4TN6A 3COIA 4APPA 4W4YA 1H28A 3ACKA 2IEWA 5CEPA 4GU9A 4PDPA 1WBTA 2F2UA 3PUPA 5L2WA 1UU3A 5TOZA 3ELJA 4ZY5A 4GJ2A 3NR9A 4K9YA 4OGRA 1VYZA 4CT1A 2ZAZA 2UUEA 3THBA 4N0SA 2X1NA 4UWBA 4HYIA 5DT3A 2X2KA 3BL9A 3E3BX 3DJ6A 3REPA 4Q9SA 3LFNA 5IH6A 4QMZA 4RVKA 4TT7A 3TIZA 3U4UA 3KVWA 3VUKA 3QTQA 1YRPA 3CEKA 4FKWA 4NUSA 3WBLA 1J91A 2BZHB 3S00A 3NWWA 4CFXA 3R2BA 3E5AA 2IZSA 3UOLA 4HGEA 4JG8A 4F64A 3NFGB 4FKSA 4FV8A 1SVEA 4YZCA 2F49A 4L3PA 4IAFA 4TXCA 1S9JA 4FT3A 2WELA 2OK1A 1RW8A 3PIYA 3H30A 2YA9A 1B39A 3DAKA 3O50A 4BBMA 4ASXA 4EK8A 5CU0A 4AGCA 4Y46A 5J79A 2Y8OA 4YTHA 5CALA 3F5GA 3DLSA 5GZAA 4U0IA 3R73A 4X2JA 5DOSA 1K2PA 3RKBA 4W4WA 2JIIA 1ST0A 4JQEA 3R1SA 3O51A 4U79A 2ITXA 5ETFA 2GTMA 4EK5A 4AZWA 4F78A 3A99A 4AE6A 4DFLA 2C6KA 4ORKA 3R28A 3QX4A 5KUPA 2QG7A 4D2TA 3MFSA 3QUDA 4EOQA 2H34A 3V5LA 3KRRA 1KSWA 4W9WA 3Q4TA 5FM3A 2R3RA 4OTPA 4GRBA 4M15A 4OTHA 2J0MB 3QGWA 4FKVA 3OVVA 3Q52A 3VUDA 2BRMA 4BCHA 2DS1A 3DFAA 3TCPA 3BL7A 2BHEA 3HZTA 4QQCA 2CDZA 4BWXA 1GOLA 1E1XA 1YVJA 4NK9A 4AOIA 5B2MA 2BFYA 2GSFA 4BYJA 2WIHA 2JGZA 3DOGA 2W7XA 3QU0A 4FKJA 2ESMA 3IW4A 5DH3A 2XNEA 4HGSA 3K5UA 5BX0A 5FG8A 3LXNA 4QP9A 4UZDA 5CWZA 5AR2A 5HE1A 3P7BA 3B2TA 3C4EA 4NIFB 5EFQA 2OSCA 2VTIA 4L6QA 3LFSA 4DGMA 3CKWA 2BAKA 2IW6A 1YDTE 4IX6A 4OTWA 4BN1A 4IDVA 5C8MA 1EH4A 2AC5A 2OH0E 3KN5A 4O91A 3NUPA 4EJNA 4S33A 3W0PA 3BIZA 3TNPC 1OKYA 1RE8A 2WQMA 2XCKA 3C4ZA 3NVKI 4ZTRA 3UTOA 2YZAA 5IMEA 4RIXA 5JK3A 3OT3A 2PUPA 4PMTA 2UW6A 3IW6A 4WNOA 4ZOGA 3GEQA 4ZJIA 5ICPA 3L8VA 4YBKA 3TL8A 2GS7A 2VO6A 2XYUA 5L3AA 1JNKA 4BTMA 5KKRC 3G5DA 4TZRA 1PYXA 5CI6A 4G6OA 4MD9E 4C61A 4HVIA 3ZHPC 4MVFA 2XEZA 3W2RA 1ZMVA 3CD8A 3QF9A 4PDSA 3UQCA 3KULB 3SD0A 4I92A 3QCYA 5EOLA 4DHFA 4V0GB 4IX3A 3E64A 4DH8A 1M2PA 3E7VA 1OL1A 2RFNA 2YEXA 2IZRA 3RK5A 1W2DA 2HY0A 3QA0A 5CANA 5EDRA 4ARKA 1Y8GA 5EM7A 4QYHA 4BGHA 3GENA 4QP7A 4YJTA 5FD2A 5C9CA 3ZUTA 3K3JA 1OL2A 3NW7A 3ULZA 1E9HA 5CQWA 2WOUA 2HENA 2J0KA 2UZVA 5D7AA 4BCJA 3ML1A 3S1HA 1JBPE 5G6VA 3IW8A 3LW0A 3EOCA 2VTPA 1OIYA 3NW5A 5IU2A 4FOBA 1DAYA 3BZ3A 3P7AA 4TYHA 5EI6A 5HCYA 3C13A 3RWQA 4CCUA 4EH3A 3CJGA 4F63A 1FOTA 2XVDA 1BMKA 2B9JA 3DY7A 4RX9A 3V5JA 5GIPE 3HA8A 3QCXA 4IFGA 3NUUA 4GCJA 5I4NA 5EW8A 4ZMEA 4D5KA 3TWJA 4GJ3A 4C02A 3GFEA 4D4VA 2XMYA 4GK3A 5KBRA 3CQUA 4YUQA 3GC0A 4ANLA 4AF3A 2PTKA 5J8IA 4KSQA 5CNNA 4KS7A 2BAJA 2J7TA 1WZYA 2GQSA 3FE3A 1ZRZA 3E63A 2X0OA 5D9HA 4FV1A 5GJDA 5JMSA 4IEBA 4D5HA 2R2PA 1JVPP 5AJQA 4CT2A 5HIBA 1MP8A 2QKWB 2WPAA 4H3PA 5FTGA 5CEOA 1U54A 4DT9A 3BU3A 2VWIA 4U7ZA 4GL9A 2XB7A 3D7TB 3UIBA 2C5NA 5BVDA 3IDCA 5IH4A 2QD9A 4MF1A 4A9UA 3ZBFA 4JG7A 1KOAA 5E9EA 2R9SA 3MY5A 4NH1A 5J95A 3VF8A 5K4JA 3R9RA 5CXHA 4QRCA 3QXOA 5DE2A 2YCQA 3BHUA 3FL5A 3QFVA 4NKSA 3VW8A 3C5UA 2EXCX 3QRIA 4OUCA 2VZ6A 5C8NA 5FXRA 3SXSA 3EN7A 3ZC6A 3Q96A 4J95A 4JR7A 5FXSA 2QVSE 4JQ8A 4S31A 3A7IA 2IWIA 3VS7A 4DTAA 4ZMFA 3NYOA 3K2LA 3UQFA 4AGWA 4UXLA 3DFCB 4K2RA 3CLYA 5LJJA 3PY3A 2GTNA 4D2PA 5BUIA 1F0QA 4XLVA 3QTUA 5GINE 4YJNA 5EH0A 4EUUA 3R00A 5DR6A 3EKKA 4FX3A 4NJDA 5IUHA 4E5BA 3O7LB 2W5HA 5DPVA 2ITTA 4QDEA 5DLSA 2Y0AA 3EZRA 4WD5A 5CF5A 3ZXTA 4QEBA 5JQ5A 4FV2A 2C3KA 2UZBA 2BVAA 2VX3A 3A4OX 4BDIA 3L1SA 2QURA 4DGLC 3BHTA 4PWNA 5TE0A 1WBVA 2P3GX 4ZJVA 4FTNA 1OPJA 4BCOA 4AQKA 2YJSA 1W0XC 2EVAA 3KK8A 2VTAA 5A54A 4O7SA 3V5QA 3TNIA 3M42A 4O22A 3NNVA 1S9IA 3TACA 2ONLC 3MPMA 4UXQA 4I24A 2B52A 4Q5EA 4BB4A 5K3YA 2PHKA 3W0RA 4O0YA 3TNQB 3F5XA 2X0QA 3QYZA 3VS5A 1XHAA 1VJYA 2PVJA 2VTRA 3IKAA 4HGTA 1YI6A 4LOQA 4XV3A 2PVHA 4CLJA 2FA2A 2ITOA 3ORLA 2QHMA 3LVPA 3BLAA 3OTUA 3QQHA 3UNZA 3TUDA 1O6YA 2J5FA 3FUPA 3BHVA 5K5XA 3W0SA 3FMNA 2QQ7A 5H8GA 2UW5A 3BV2A 2UW4A 3P5JC 3VBQA 1PMEA 3WE4A 4OTGA 1YKRA 3DS6A 4UB7A 4LGHA 3OOMA 3LLTA 4KIQA 4OTFA 4YLLA 4M0YA 4BKZA 4BDHA 4BTKA 3ZLSA 4IVBA 3QLGA 3OMVA 5AP7A 4FIHA 2WKMA 4RLLA 4FG7A 3ROYA 3RVGA 2VTJA 4A4LA 1ZZ2A 3IK3A 2V7OA 2J0IA 4MNFA 5AM7A 3ERKA 3IGOA 4J99A 3TNWA 3BI6A 4W8DA 4KNBA 5DEWA 3RNIA 3PXKA 5HOAA 1J7UA 4BRXA 3C0GA 2OJ9A 3PWYA 2R3IA 4ANQA 3RJCA 4MEDA 3ATTA 1YHWA 3FSFA 3PFQA 4O7NA 3NMUF 1BYGA 5AP5A 3TUCA 3D5VA 3I60A 3LFFA 5HO7A 4DEIA 1REJA 4CQGA 4D4RA 4HJOA 4XBRA 3AC8A 2H8HA 2X6DA 4IVCA 1VR2A 4FSWA 3PJCA 4WUNA 5JGBA 2GNHA 5E8ZA 1L8TA 1VZOA 3FEGA 4X21A 4P90A 3VRYA 4A9YA 4C4JA 3C4CA 1OITA 2FGIA 4UEUA 4O84A 3BWJA 1GZ8A 4M97A 1XMLA 2PE1A 3HAMA 5AUXA 1OECA 3G9LX 4BF2A 4E7WA 3LCTA 4I0TA 3MSSA 3HUCA 3Q9YA 3FMJA 4BCGA 4DITA 1PXLA 3DKGA 3PSDA 4PX6A 4IADA 2RIOA 4G1WA 4R3RA 4XNEA 2YIXA 3AKJA 3ZRKA 4I94A 5L8LA 4N6ZA 4RVTA 3KXNA 4C59A 4HVSA 3ZLWA 3ZUVA 5J7BA 3F5UA 4FL2A 3EN9A 1NVSA 2HXQA 3DTCA 5AX3A 3VULA 1GZKA 1KE6A 1FMKA 3EQPA 2YJRA 3O7LD 3QHWA 2C69A 4L44A 1U4DA 4BBFA 1RJBA 4EOSA 3HV5A 2LAVA 3JVSA 3Q9ZA 1M52A 5I5ZA 4QTEA 2GFSA 3BQRA 2GDOA 3NCZA 1OKVA 5FGKA 4DEBA 3GC8A 1OVEA 3A7HA 4F09A 3UPXA 4FTTA 4U8ZA 4Z3VA 4CKRA 3QA8A 3QKLA 2G15A 4DH7A 4IM0A 4O6EA 2WTWA 4RC3A 2VWWA 5KX8A 4AXCA 4AS0A 4AUAA 5I9YA 4PDOA 2WQNA 4NT4A 3BEGA 4RFMA 4YPDA 5CEMA 2B7AA 4F70A 1ZYDA 4TPTA 3EB0A 4RJ7A 2YM5A 4EH5A 2RKUA 5IA1A 5L6PA 1MRYA 4AX8A 3ZONA 3SG9A 3FZOA 4H1JA 3IDBA 3ORPA 5AV3A 4CMOA 3NDMA 3Q2MA 3ZZEA 4WA9A 4RFZA 1VLRA 3GCSA 3GFWA 3Q53A 3FKNA 4MHAA 3N9XA 3UVPA 3M2WA 1P14A 1G8AA 4FNXA 3CE3A 1YWVA 1P5EA 3HP5A 3F7ZA 4WG3A 1W2CA 2X7OA 3AT4A 1Q97A 4NTTA 4FUXA 1XH5A 3HMPA 3Q5ZA 4GIIA 3Q9WA 2R3JA 3GBZA 4F1TA 5M08A 2WMTA 3GU7A 4DGNA 2C1BA 2Q0NA 3NNXA 1Q8UA 2CLQA 4M12A 4H05A 2XNOA 4UYAA 2VTNA 1TQMA 2ZVAA 4RIYA 2FUMA 2GU8A 2UVYA 2V5QA 3VO3A 4HVGA 3TJDA 1V0PA 1A06A 5I9ZA 1TZDA 2VTOA 4O4FA 4QYYA 4IH8A 5CYIA 3WI6A 4JRVA 3DB8A 3TV6A 4PV0A 3WYYA 3OXZA 2CCIA 3OWLA 3OBGA 4M66A 2IVTA 3ET7A 3GUBA 2XM8A 3FLWA 3WF6A 3PIZA 2BHHA 4QP4A 1I09A 3RAWA 3WE8A 3NUAA 3ZM9A 3PVWA 5CF4A 5ACKA 1OPKA 4OAVB 4ZAUA 2UVXA 2C6EA 3MVLA 2X4ZA 3L9LA 2UZNA 4BVUA 4BWPA 4XS2A 4TW9A 3MH3A 4IANA 1YDSE 2ITZA 1URCA 4CNHA 2CCHA 2C0IA 2HWPA 4YURA 5H3QA 4FKUA 5CEKA 3ORZA 2KULA 4MKCA 5M57A 2PL0A 4FV9A 4ZSLA 5F1ZA 3RHKA 3OTVA 4I1ZA 4W4XA 3GU8A 3OWJA 4V05A 5JT2A 3VUIA 1JWHA 4C3PA 4XG9A 4MXZA 3TIYA 3OEZA 4P4CA 4RX5A 3ETAA 2CNUA 5FP6A 4YJUA 4GVJA 4JOAA 5F95A 3E7OA 3SDJA 4RLKA 4C57A 4IB0A 2PVRA 2BROA 3OS3A 4I5CA 1XH6A 4RIWA 4USEA 2OJJA 4JIKA 3LCSA 3KRLA 3OEFX 1UWHA 2JDOA 2YERA 4TYIA 3VQUA 1JSVA 4F99A 4CGAA 4FTLA 3UOJA 1LPUA 3FYJX 4Y5HA 3BBWA 3JPVA 5HNIX 3PVBA 3MV5A 4BIEA 3CC6A 3PY1A 4M69A 4CFFA 1YHSA 5HBJA 4F9AA 3FV8A 4FKOA 3EQBA 4YP8A 3QD3A 5IA2A 3OCBA 3GU4A 3QRKA 4KBAA 5AR5A 2E9VA 2WTDA 4O0SA 1OGUA 4X3FB 3R04A 1UKIA 2XK4A 2RG6A 4L52A 5CT7A 1Q4LA 4D2SA 5CXZA 4FR4A 4DDGA 3KMMA 4J8NA 4J8MA 2NYAA 3QTZA 3F5PA 4FKTA 1H4LA 3P79A 4I4FA 4M8TA 4U3ZA 1JKSA 4NCTA 4AAAA 2I7QA 3F66A 2UZUE 3DAEA 3S2PA 4FKLA 2QOKA 2OZAB 3CY3A 3R7YA 3M11A 3RAKA 2ZFYA 4CV9A 2BIYA 4XP3A 4HVDA 4YO4A 4IB3A 3HMIA 5DRDA 3TKHA 2UW9A 2XANA 4ANBA 5ETIA 5FM2A 5CF6A 2WD1A 4L68A 4MXOA 5I9VA 5BYZA 2F7EE 4TL0A 3QUEA 3F69A 2B0QA 4YU2A 4ZIMA 4MBLA 1NXKA 4O0VA 4LQMA 4B4LA 3RK7A 4EWQA 3GCUA 2QOOA 2WMUA 2A1AB 2Q0BA 2Y9QA 2WU7A 5IF1A 3SOAA 3LFQA 4C62A 4NWMA 2W4KA 3FY2A 3PZEA 1UNLA 2BAQA 4YR8A 3ENMA 2PU8A 2CGUA 3POOA 2OO8X 4DH1A 4YZ9A 3HDNA 3GVUA 2QU5A 3QD2B 3NUSA 3S3IA 4A9TA 4CKIA 2VU3A 3FL4A 4JBQA 4DGGA 4BZNA 3S95A 3E8NA 1JLUE 3I6UA 5IZFA 2VX0A 2W17A 3VVHA 2JDRA 4XCUA 1A9UA 4IZ5A 1SNXA 4FIFA 2R3LA 3SW7A 4O1PA 5CZHA 3ZCLA 3DV3A 2BRHA 3QQUA 4FF8A 4DC2A 3JYAA 4FTKA 2A0CX 1FINA 1U5QA 5CAVA 3LQ8A 3MN3A 3TTJA 2PMLX 3Q04A 3FDNA 4HGLA 4O21A 4AXEA 3SG8A 2Y4IC 2P55A 5CSXA 4MWIA 4FIIA 3KMWA 5DYJA 5CQUA 4W8EA 5JEBA 5HBEA 1LR4A 2XK9A 1BL7A 4GW8A 4XRJA 1DM2A 5FRIA 5CAPA 2Q83A 3L9NA 3NVMB 4G5JA 4Z7HA 2R5TA 2YCRA 2FO0A 3AD5A 3O8UA 3VBWA 3WZDA 1YXSA 3SAYA 4UMPA 4C8BA 3RWPA 2BFXA 4AT3A 4ENXA 5HX6A 4WNKA 1UU8A 4QMXA 3RAHA 3QX2A 4TWCA 3NIZA 3O0GA 2EB2A 2QI8A 5EDQA 5ANGA 3UO4A 4D28A 4IBMA 4E6CA 4ANSA 3GT8A 1ZYJA 1BUHA 2JD5A 3IO7A 4QQ5A 5H9BA 4IAKA 3SGCA 2HZIA 5FXQA 4CFWA 4EI4A 4QMNA 3FC2A 4EOMA 5IMXA 4QPAA 3UBDA 1PMUA 1H08A 3FMDA 3PPKA 5EG3A 2BZIB 3QQFA 3MYGA 2PVLA 2VRXA 4KSPA 4OTDA 2QOHA 3UNJA 4CFMA 1UNHA 3CY2A 4K0YA 4FIEA 3VS0A 2JAVA 2B9HA 3QQJA 4A07A 3A7GA 5FWKK 2ITWA 5AUTA 3PSCA 4JXFA 3HLLA 4GFOA 2VTMA 2B9FA 3W55A 5K0KA 3A4PA 3CGOA 2YIWA 2R3KA 4DG2E 2VTHA 3W0NA 4JQ7A 5E8VA 1JSUA 2XIXA 1XJDA 4K18A 1GIIA 3MPTA 3EQIA 3KXGA 2XARA 2PSQA 2QOFA 4MNEA 5EKOA 5M4CA 4RQVA 4CD0A 4E5AX 3LCOA 2XRWA 2QONA 4MD7E 1MRVA 2EXMA 4L7SA 5HE0A 3UC3A 4DFYA 4DG3E 3BX5A 4O7TA 5F4NA 1ZYLA 4TYEA 4EQCA 4F9WA 1DS5A 3P78A 3RNYA 4QTAA 4IB1A 1JOWB 1K3AA 4P2KA 4KWPA 3TXOA 5IG1A 4IACA 3ACJA 4FEWA 3GB2A 4RWIA 1KE7A 1WFCA 3QTSA 2W1ZA 2C3IB 2XJ0A 5TT7A 3V8SA 2QLUA 4I5MA 4F9BA 4FEVA 4XLIA 5ETCA 2OWBA 3UGCA 4AG8A 2R64A 4AA5A 5KMKA 3KIOC 4EYJA 3QQGA 2R3HA 4CZUA 3F6XA 4JVGA 4YJQA 4DFBA 2F7ZE 4DEEA 2W4JA 3MVHA 4PPBA 3TZMA 5KHWA 3QZHA 4JT3A 5FTOA 5DWRA 4I0SA 3MBLA 3TZ9A 3ODYX 2W1GA 1YI3A 4AOJA 5CSVA 3EN5A 3ORXA 4FSTA 4L3JA 2CKEA 5EHOA 3RGFA 3RCJA 4IJPA 1MUOA 1QPEA 2ITQA 3GCQA 4QPMA 4AACA 1PYEA 2UZTA 3DBDA 4MBIA 5FBOA 5DA3A 3BQCA 2R3MA 4H3BA 4MBJA 5E8XA 3HA6A 4IVAA 4AA0A 5AR7A 2YITA 4RFYA 4L53A 4WSYA 4C4IA 1P4FA 5I0BA 3QWKA 5AFVA 2XIRA 4LMUA 4GFGA 4ANNA 2XK3A 4B7TA 3MIAA 3SKCA 5IPJA 2VAGA 4FTIA 1IEPA 4QYGA 3UOHA 3BBTB 4F0IA 3NGAA 3LFEA 4NYEA 2IW8A 4L9IA 1BI7A 3WARA 4UMRA 2YAAA 3ZUUA 5AP1A 5GIOE 3HMOA 1ZZLA 3HRCA 4S2ZA 2C6MA 3W16A 5EKNA 4BBEA 3EQCA 3KK9A 4A4XA 3DKOA 4CYJA 3ZXZA 1PMVA 3UODA 2ACXA 5E4HA 3N51A 2PZPA 5GZ9A 2PVYA 1VEBA 3P1AA 4R8QA 3PP1A 4PL5A 5HQ0A 2J0LA 2RL5A 3R7EA 4PPAA 4CV8A 3SHEA 4L8MA 2XIZA 3VHEA 1G5SA 3BKBA 2FSMX 4GT4A 1WBNA 5F20A 4X6QC 4OTIA 1IA8A 2YCSA 3JVRA 2ZV7A 2GS2A 3DTWA 5D1JA 3GU5A 4I6HA 5L2TA 2B4SB 3LIJA 4RA4A 3RPVA 1H01A 3PIXA 3PYYA 2ERKA 4BC6A 3GQIA 4G3FA 4J1RA 5AUVA 5H8EA 4ZTSA 4G34A 3OOGA 2XK7A 4OAUC 3L8PA 3C9WA 4U43A 3AC2A 4X6RA 3FXZA 3V6SA 4QTBA 3ZSHA 4ACHA 5JKGA 4C7TA 3DK6A 3NYVA 5J9LA 2OXXA 4FV6A 2C68A 3E88A 2WTKC 4IAIA 3W2CA 5LVPA 5KZ0A 4FTJA 4NIFA 4XEYA 2BPMA 4HZSA 3BCEA 5KMMA 4O82A 1WVWA 4B8MA 1H00A 4FL3A 3EZVA 4BKJA 4EZ7A 1PXMA 3FI2A 1TKIA 3LM0A 3JXWA 3PA4A 2C5YA 3WF9A 4BDCA 3VC4A 1G8KA 3LCDA 2JEDA 1VYWA 4CVAA 1RDQE 3MJ1A 4X0MA 5LMKA 4XX9A 3OT8A 2R7BA 3R8ZA 4F7SA 3SOCA 2E2BA 3POZA 3RAIA 3FBVA 2W1DA 3ENHA 3SC1A 4D4SA 2XIKA 3CTHA 3HV7A 1QPCA 5AWMA 3C0IA 4PUZA 4WRSA 2PUNA 3KQ7A 1J7LA 4UALA 1W8CA 5DG5A 5LCKA 4OBOA 3GI3A 4O4DA 2CN5A 2X8IA 5FQDC 3KULA 4ALVA 3C7QA 2W96B 3FPMA 5BVOA 5HU3A 4G16A 4V0GA 4C3RA 1FVVA 2VWYA 5AUZA 4DH5A 2O8YA 2PMNX 5CLPA 4FJVA 3KF7A 1BKXA 3TTIA 5CI7A 4U40A 4R3CA 2Z7QA 4IC7A 3E87A 3VS4A 3W10A 4EEVA 4EHVA 4N70A 4FEQA 5JQ8A 4BHZA 2XAOA 4LL0A 4A9SA 4YJVA 1H1QA 2Z02A 3LLAA 1HCLA 2VO3A 5HD4A 4JMQA 2CPKE 3FQHA 3DZQA 4G5PA 4DBXA 4YC6A 5LWMA 3R9NA 5IQCA 2SRCA 2PULA 3KB7A 3WIGA 1QMZA 2YLFA 3FLSA 5AAGA 3MJ2A 4JAIA 3OY1A 2C6OA 5JFXA 1K9AA 2NRYA 4L45A 2XIYA 1R0EA 3D83A 3QUPA 4ZP5A 4NM5A 1YXUA 2WMVA 3DNEA 4Y83A 3E92A 4WIHA