3VO3A

Crystal structure of the kinase domain of human vegfr2 with imidazo[1,2-b]pyridazine derivative
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
307
structure length
303
Chain Sequence
PLDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Vascular endothelial growth factor receptor 2
publication title Discovery of N-[5-({2-[(cyclopropylcarbonyl)amino]imidazo[1,2-b]pyridazin-6-yl}oxy)-2-methylphenyl]-1,3-dimethyl-1H-pyrazole-5-carboxamide (TAK-593), a highly potent VEGFR2 kinase inhibitor
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 303
sequence length 307
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3vo3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3vo3A01
1PMUA 1AQ1A 2R3HA 2CJMA 2B9FA 3NMUF 3HV4A 5HBHA 2XYUA 4KNBA 3R2YA 3A7FA 3G15A 3AD5A 4F08A 3OT3A 2IVUA 3QKKA 4FNXA 4F09A 3UQFA 3BLHA 3BHTA 1YWNA 3GOKA 3NZ0A 4D2RA 2YM8A 3D2IA 3G6HA 4BHZA 1JBPE 2XH5A 3HMIA 3QRUA 4U3YA 2UW0A 5CS6A 4JRVA 3A61A 3PYYA 2W4KA 4JQ8A 2ZYBA 4CTBA 3QGYA 4DG2E 3DT1A 2YIXA 3E8NA 3DV3A 3DQXA 3HMNA 4GYGA 1OL7A 1XBBA 3QQJA 4XJ0A 3UO5A 4H05A 1J91A 4NH1A 3P5KA 3FMDA 3FZPA 2IZUA 4G5JA 5B7VA 3UVQA 3TV4A 4QMZA 5EYMA 3EN7A 1URCA 3A99A 3DKGA 3R63A 4E4LA 4EQUA 4Z55A 1K2PA 4G31A 4ANNA 4NK9A 4U43A 2O3PA 4R1VA 5AR4A 2JDVA 3ENMA 2HZNA 5DEYA 4DG0E 4P5QA 3QLFA 3ZLXA 4V0GA 4HGTA 2PZRA 2QO7A 3CC6A 2C3IB 2VWZA 1IG1A 3MI9A 4FBXA 4I1ZA 4OTGA 3WF9A 4D4YA 4QMQA 3LKMA 4O7TA 4AXAA 4FVPA 2OJIA 5LJJA 1KWPA 1GZ8A 4TY1A 3C9WA 1OM1A 3CGOA 4M69A 1I44A 2VX1A 5T3QA 4LGGA 4NWMA 4F0IA 4FYOA 4FX3A 2C6MA 2EB3A 5CVFA 5D1JA 5M08A 3DTCA 3NAXA 4J71A 3QCQA 3U87A 2J51A 1BKXA 1ZYJA 3F5UA 2ZV2A 3FMNA 4CMUA 4IDTA 4Y46A 1XKKA 3Q2MA 4XV9A 3TUDA 3OCBA 3VAPA 1P4FA 4BI2A 4R3CA 2J50A 4BF2A 3NUSA 2O0UA 2ZM3A 3TDVA 2XK6A 4JDHA 3ORLA 1DAYA 3LFDA 3DKFA 4GK4A 3UYSA 1DS5A 1ZY4A 1RW8A 3PVWA 4HJOA 4YU2A 2B52A 5AEPA 4ID7A 4W8EA 2HZ4A 3RNIA 4C3RA 4A9YA 4JI9A 1JLUE 1WBNA 4ZIMA 2OZAA 4KS7A 2RFSA 3Q6UA 4JAIA 4D4VA 4JLCA 2VTJA 2W1HA 4XLIA 1GZOA 3FLSA 4WNOA 2R7BA 3VQHA 4FSUA 3H9RA 4EH7A 3GC8A 2QLUA 5GZAA 2IZSA 3HV5A 3R9NA 4MBIA 3R9RA 3QA0A 1LPUA 5E8SA 5DMZA 2XF0A 3FLYA 4FIFA 4UMUA 3FZOA 2VTAA 4Y85A 4UMQA 4USEA 3CP9A 4HGLA 3LFFA 5AX9A 2ZB1A 1S9JA 3H30A 5JH6A 4MQ1A 4BCIA 4CRLA 5HVKA 4XLVA 5A4EA 2W7XA 4YJPA 3TIYA 4A9UA 2IO6A 2OW3A 1PRYA 2Q83A 4CD0A 3D14A 5IG1A 2YDKA 3HVCA 3EQBA 3GQIA 3R01A 3VULA 5AAGA 5CWZA 3TCPA 4U44A 2XBAA 3LVPA 5AJQA 3W8QA 3KEXA 4M66A 1Q4LA 2WMTA 3CQUA 4CT2A 5KNJA 4QYHA 5HU3A 4DA5A 3ZCLA 4BI0A 2CCIA 4M12A 1YXSA 5M07A 4JT3A 4J8NA 3BBWA 4LUDA 4D55A 3ZONA 3G9LX 1P5EA 2XKFA 1I09A 4X2GA 2QOOA 4OGRA 2W5AA 2DYLA 2ZMCA 4KINA 4RA4A 4DTBA 3FAAA 4ZMFA 2VTRA 5EDRA 3KA0A 4EC9A 4YPSA 3MFTA 1OL6A 3OWKA 5ANEA 1L3RE 2XNNA 1SVHA 5CY3A 4FKIA 3R7YA 2JAVA 3FMJA 3KXMA 4MX9A 1SMHA 4D1XA 4FV7A 3MESA 4QMYA 5JRQA 4DLIA 5I9ZA 1NVSA 3DXNA 3E7OA 3U4WA 2HOGA 2YLFA 3D0EA 1U5QA 3FQEA 4I5HA 4F63A 2PMLX 5DYJA 3O50A 3GQLA 2QOKA 3RCDA 4O91A 2RL5A 4XNEA 4RGJA 2WTJA 3H4JA 5JK3A 4BDEA 3I5NA 4B8MA 5FDPA 4Z3VA 2QG5A 2PTKA 2VTNA 4GFMA 1U5RA 3FKNA 3HX4A 4OUCA 3OXTA 4C2VA 1KOBA 5E8ZA 1UNGA 2W1EA 1WVYA 1W98A 4JXFA 3QTWA 5JEBA 1MQ4A 2HZ0A 2OZAB 2XNPA 3ERKA 4KSPA 3VS3A 4R8QA 4LMNA 5HI2A 1OL2A 3R8ZA 3QRIA 4NJDA 4RZVA 5EKOA 5FUTA 4U41A 4O84A 2WEVA 4MHAA 4PWNA 3TIZA 3D9VA 1A48A 2W06A 1H0WA 3QGWA 4ITHA 4QD6A 2F4JA 3NUAA 3CS9A 3FXXA 2R0UA 3WE4A 4KBKA 4O6LA 4JJRA 4UALA 4XX9A 2X2MA 1JKTA 5EDPA 3O7LD 2XKCA 3QWJA 3SOCA 4EHVA 1Z5MA 5HE2A 4EZ7A 4L01A 3V6RA 2ONLC 2Y4PA 3G90X 4UXQA 5M55A 5JZJA 2X6DA 4C4IA 1KSWA 4FV8A 4FZFB 4IADA 5JZNA 2QOIA 1YI6A 4CYIA 4UN0C 2GS6A 3TKHA 3RK5A 2QVSE 3SD0A 4L7SA 4QO9A 5K0KA 1PXJA 3IW5A 5D7AA 4ASDA 3OCGA 3NUNA 4AA0A 4BZDA 4CYJA 3HEGA 3QL8A 4APPA 1KV1A 5IA0A 3BZ3A 3E87A 3LHJA 4I21A 3Q9WA 2XIZA 1V0BA 4WOVA 3F3ZA 3LIJA 2HK5A 3AT4A 4MEDA 3MGYA 4U0IA 5TT7A 5FM3A 1SVEA 3LXLA 1IRKA 1H1QA 4PTCA 3PPZA 2B0QA 1M7QA 5TKDA 1KE8A 3FJQE 5A4LA 1MUOA 2CNUA 5FTGA 5FLFA 4X2FA 3OS3A 3CQEA 3QYZA 3CIKA 3T9IA 4QP7A 3QTQA 4DITA 5EYKA 4L68A 1QPEA 2X1NA 3O2MA 1YHWA 4QNAA 3UPXA 3BU5A 3QC4A 1W82A 4TL0A 4GVAA 1FGKA 5ACBC 3N4TA 3LCKA 3BELA 3FI8A 3P79A 3RM6A 4PRJA 3QRTA 2RG5A 2H6DA 3CPCA 3KY2A 4RX9A 3QWKA 4W9WA 4YJUA 2YFXA 4F99A 4TYGA 2C6TA 1CKPA 3CY2A 4KBAA 5CU3A 4YURA 4CGAA 3WZUA 2Z7RA 4MF0A 4BKJA 1L8TA 3F3WA 4PTEA 2NPQA 2PE1A 1JSTA 4IM2A 4NM3A 5ICPA 1DAWA 4FV2A 5HIBA 2ITYA 5LWMA 2C0IA 2FSTX 3NYNA 4HVDA 3CD3A 2G2FA 2OZOA 2PVRA 5IQCA 4DTAA 3HA8A 4FZ6A 3R30A 5KMKA 3D83A 1UU9A 4IX4A 5DH3A 2C1AA 3ZM4A 4EI4A 1MP8A 1O6LA 2XIRA 4E26A 3UIXA 2GFSA 4RJ6A 5CZHA 1PJKA 5G6VA 4K33A 2W1CA 1Q3WA 2GNGA 3TJDA 4FEUA 4ZZNA 2YHVA 5JKGA 5JFVA 5CI6A 4PP9A 3O8UA 3PA5A 3TL8A 4YHTA 3ZZEA 1HCLA 3ENHA 2QURA 4OLIA 1OPKA 2C3JA 4RX7A 2OLCA 3LMHA 4XV3A 3NUPA 2O65A 2ZDTA 2R3QA 3FI4A 1H1WA 2QHMA 3Q04A 2VAGA 2W05A 4IZ7A 4LRJA 3QLGA 4ZS0A 5AR7A 4DN5A 4V01A 1YDTE 4AN2A 3JPVA 3DBCA 2ZV9A 5CAPA 3S0OA 5KBQA 2QU5A 1G3NA 3LCOA 5KX8A 3QX2A 3EN9A 4NJ3A 4KRDA 3SW4A 4AG8A 4ZOGA 1R0PA 4IAAA 1QMZA 5DFPA 2XIYA 1J1CA 1KE5A 1VYWA 3QZGA 4JL9A 5DR2A 5AR5A 3BWFA 4QMVA 5L6OA 3OXZA 1PXOA 3FWQA 4QPMA 3RTPA 4RFZA 3UYTA 4E20A 4YC6A 3FQHA 3W2SA 3KRRA 4D1ZA 2X4FA 1OPLA 4DCEA 4GK3A 2VTSA 4QPSA 1YW2A 2VWBA 4ZJVA 4S33A 2Z8CA 2PVKA 3KVXA 3LQ5A 4F9AA 4C3FA 4FTNA 3LJ2A 1ZLTA 5ANIA 3QUPA 2DS1A 4ITJA 2BIYA 3GB2A 1JQHA 5HCXA 4QMNA 3OCTA 4I3ZA 3QQHA 4YLKA 4YMJA 2QD9A 2AC5A 1OL1A 3W2QA 1ZYCA 4FICA 2P55A 4D2VA 4YTCA 4O0YA 4USFA 1PY5A 4ZJJA 4O0RA 4EH2A 2C1BA 4R1YA 3DS6A 1V0PA 3MA3A 4CV8A 4EL9A 2IZTA 4ACGA 4WA9A 3G2FA 4FZ7A 2QU6A 2R4BA 3LFAA 4DFLA 1OL5A 2ESMA 4FVQA 4XG6A 1IA9A 2PUNA 5FG8A 2H8HA 2VTMA 5DBXA 3FSFA 3FL4A 5HO7A 4MTAA 2X4ZA 5T68A 4F6SA 4EWHA 3RALA 3D5VA 3MY5A 1PXNA 3OW3A 4QMOA 3OCSA 4W4WA 4FIHA 4ZLYA 2ZV8A 3HAVA 5CXHA 2PVFA 2A0CX 2WQEA 4W4YA 3FMEA 3UP7A 3A62A 3KXHA 3W2PA 5I9YA 4GH2A 3K5VA 4H1JA 2ZDUA 2CNVA 2UW3A 5EYDA 3FC1X 3MJ2A 3QZIA 2ITZA 2X39A 1ZZ2A 4USDA 2YZAA 3W33A 2XS0A 3OXIA 4FV0A 3DZOA 5HG9A 4I92A 4CZUA 3RPSA 2LGCA 3IQ7A 3ORNA 3U8WA 4ZAUA 4FKLA 5JQ8A 1H00A 4CV9A 2PL0A 5IH4A 2PE2A 3MPMA 5I0BA 3CLYA 4NIFB 1ZOGA 4BGHA 3LMIA 1XH9A 1ZYSA 3AC5A 3PPKA 3L9LA 1Z9XA 3AC4A 2VN9A 3AT3A 1KE9A 1GJOA 3ZOSA 4E4MA 1ZRZA 5AMNA 2J4ZA 3V8WA 4GK2A 2R3PA 3GNIB 2PZ5A 2O5KA 4H58A 4QMLA 4E73A 4YHFA 3U55A 4FKSA 3PJCA 4JR7A 2VNWA 3VJNA 4BKYA 5LARA 4BTMA 4I94A 2C0TA 1Q61A 3D5WA 4X2NA 5HKMA 2WO6A 4ARKA 3ZEWA 1U46A 2ITXA 3I5ZA 4DGOA 3GU4A 4DBNA 2Y4IB 4NT4A 4PDSA 2PPQA 3RK9A 4BB4A 4BHNA 5EG3A 1CM8A 4JDJA 3ZDIA 3ZU7A 4ZZOA 3ET7A 3ZBXA 4DEDA 2XP2A 1HCKA 4FG9A 5DN3A 3TZMA 3MTLA 2JAMA 4FODA 4I41A 4JX3A 4RVTA 1GIIA 4YZMA 5CAUA 1R0EA 5CQWA 2UZBA 3UBDA 1XWSA 3NDMA 2VO3A 4RSSA 2CKQA 2R7IA 4D9TA 3KF7A 4KS8A 4YJQA 3HMPA 1VJYA 5EQEA 2GNJA 4QYEA 4IB0A 4FE2A 2VWUA 2FB8A 3GC7A 3L8PA 4QMPA 4W4VA 4OTFA 5CEOA 3DBQA 5BYYA 5KMMA 1PHKA 4OTDA 3RM7A 1JVPP 4I20A 4Z9LA 2W1ZA 3VC4A 5CU0A 1GIHA 3BU3A 3CEKA 4TTHB 3BU6A 3NNVA 2VWIA 5LVOA 3OG7A 2OIBA 1FINA 1Z57A 4AN9A 4APCA 4AW2A 4DG3E 4RWKA 3T9TA 4EH6A 3QTZA 2PZYA 4C36A 2VTQA 4Q9SA 4FSWA 2R3OA 1M2QA 3S1HA 4NL0A 4FZAB 3ZMMA 3ZUVA 3FXZA 4IWDA 1AGWA 5IISA 4EK8A 1OI9A 2GNHA 2BAQA 2A19B 3TTJA 4FSTA 3D5XA 3QCSA 2J2IB 5J95A 3VJOA 2QR8A 2GNFA 4IJPA 4AOIA 5IMXA 3UZTA 4RC2A 1IEPA 1J1BA 2B53A 2P2IA 4ZY5A 1BI8A 4YZDA 3PZEA 3RCJA 4C4HA 1YWRA 5CSHA 5HG7A 4C2WA 3R28A 4BDAA 2PVMA 3QCXA 3ROYA 4LG4A 3DOGA 3DAKA 3MDYA 5ETFA 5HD7A 4J96A 5BPYA 2HZIA 2E9PA 4KIPA 4FT3A 4ZSJA 5CEIA 3FI2A 5L2WA 4XRJA 5BQ0A 3EIDA 5E9EA 4FSYA 3U6HA 3ATTA 3QD4A 3HL7A 3G51A 4GW8A 3UP2A 4EH5A 2HIWA 4O7LA 4EUUA 4HPUE 2OJ9A 4U6RA 1B38A 5C4KA 3SRVB 4UX9A 1ZZLA 3LFQA 3DJ7A 4CCBA 2XRWA 3V04A 2P0CA 2R3FA 5ANDA 2EUFB 1NA7A 1PXLA 5J9ZA 3PIYA 5B0XA 4OTIA 5IQAA 5EH0A 2J0KA 2YABA 1YHVA 5GHVA 4LQMA 4E1ZA 3A8XA 4C4GA 3BGQA 4NUSA 2WQMA 4I6QA 2R64A 1CKIA 4WBBB 4NM5A 5JFXA 4O1PA 2VO6A 4RT7A 2JIUA 3QXOA 1BL6A 1W8CA 3REPA 2JITA 2Z7QA 3UIMA 1P2AA 3A8WA 4YZBA 5EK7A 5FXSA 1YXVA 5B2KA 1VEBA 3W16A 3HNGA 2JFLA 5HX6A 1Q97A 4J8MA 3E93A 5F1ZA 5FQDC 4DCAA 2O8YA 2XJ2A 4JBPA 4EC8A 2C68A 2PMOX 4O86A 2PY3A 4BIEA 4O1OA 4MCVA 1H25A 4D2PA 4PNKA 2V5QA 4KSQA 3D15A 4HGSA 4YTFA 2CPKE 3ACKA 4IBMA 4S34A 4ZXTA 3ETAA 1H01A 4XG4A 3L1SA 2E2BA 4O7NA 4M3QA 2YWVA 3VQUA 5L2SA 4FZDB 4KA3A 3BHYA 4L53A 5AP3A 5L8KA 3WF8A 2W17A 4QT1A 4J52A 4QP4A 3GP0A 3UC3A 5D11A 3IECA 4ERWA 5C03A 4LL0A 2Y4IC 3QXPA 2B9IA 3BX5A 5HX8A 3EFLA 4JIAA 3PVGA 2HW6A 3NCZA 1W0XC 3BLRA 3NW5A 2YITA 4UWYA 4XV1A 4AE6A 4ASXA 5AP6A 2BKKA 4EOPA 2F7XE 3UOLA 4CFMA 1PMVA 3F5XA 2CMWA 4QQJA 3MB6A 3VUGA 4C33A 3N4UA 5HNGA 5EQYA 3EN4A 3I6WA 4E5WA 4E4NA 5BVFA 3HV3A 3U6IA 4X2JA 3R04A 5IUIA 2WPAA 3WIKA 2P2HA 4D4SA 5C27A 5CSPA 3F3UA 2QCSA 1UNHA 1RE8A 4DFUA 5AA8A 4JBVA 4I0RA 5HQ0A 3LCDA 4MXOA 4K8AA 1OUKA 3ORTA 4YP8A 4KIKB 4B9DA 4CT1A 4DFYA 2XCKA 4QP3A 2PVYA 2WMXA 5IUGA 5ANJA 1JOWB 4KAOA 4ALWA 1H1RA 2BR1A 2QOBA 3KXZA 2OO8X 2R3IA 4IQ6A 4LRKA 4BDFA 4TZRA 3O17A 1OMWA 3Q4UA 4FNZA 4WKQA 5AIRA 1Q3DA 5KUPA 4BIBA 1DI8A 2B7AA 2X7FA 4AP7A 3SHEA 3I60A 4BCHA 3O8TA 5AM7A 5CENA 2OG8A 3QTIA 3FLNC 4IX3A 2FO0A 5J7BA 4GKHA 4FTOA 4ZZMA 3RZBA 4O7ZA 3ITZA 2J6MA 3U6JA 4EHZA 2I1MA 3R71A 3A7JA 3W1FA 5H8GA 2H96A 4FKQA 3QD2B 4I4EA 1OITA 1XH6A 2FGIA 5KMIA 3SXFA 4A4XA 3PLAE 2BAJA 3UO6A 4C38A 2UZDA 3FMLA 3FYJX 2FYSA 5H8EA 5IDPA 4AZVA 3W32A 4ASZA 4QQCA 3LPBA 3O8PA 1YKRA 3N51A 4F65A 4QMXA 5M4IA 1JPAA 4NTSA 3EQRA 3IKAA 3P0MA 4Y73A 4PPAA 4EOIA 1YRPA 3NUUA 2J0IA 3Q6WA 4L3JA 1YOMA 4C4EA 4YBJA 4AGCA 4I5PA 4QP1A 5AR2A 3V5LA 2WTCA 4U81A 3VUDA 4DEIA 1UA2A 3GC0A 4FGRA 2V0DA 3C1XA 4X3JA 5FXQA 4CFXA 3OROA 3AGLA 3OTUA 5J1WA 3DNEA 4IANA 4F4PA 4F1MA 2X8IA 3PY1A 4ZY6A 3O7LB 1OIRA 2PUUA 4DT8A 4FSQA 1ZMWA 3PLSA 4MK0A 1MRVA 3W10A 4AZTA 4NYEA 3PFQA 4F7NA 4CKRA 3EKNA 3OZ6A 2GQGA 5CF8A 4YUQA 2IW9A 5HNIX 2ETMA 4IACA 1WBPA 2JEDA 2C4GA 3ULZA 3EOCA 2IPXA 5ITAA 5CASA 3KL8A 4CLJA 3NYXA 1OUYA 2X0GA 5EDQA 5BVNA 2W9FB 3OF0A 4FT0A 1Q62A 2F57A 3RAHA 3UC4A 4H3PA 4F0FA 4KKGA 2OJFE 1ZXEA 3ANRA 3DPKA 5BUJA 5A4QA 3GFEA 3A7HA 1WVWA 4ZK5A 1W84A 3PVUA 1Q24A 5HG8A 3DLSA 2J0MB 2OGVA 5T6KA 3CKXA 4DGGA 4PP7A 1ZARA 2UZVA 3C51A 3D7TB 3FY0A 3GBZA 4DH3A 3FEGA 2O64A 4MH7A 3DNDA 3KB7A 3EQIA 5C8MA 5HTIA 3UQCA 2WMWA 5K0XA 1QPDA 4UZDA 4B4LA 2XEYA 3FHIA 2E9VA 3VS5A 4L7FA 5KKRB 2IZRA 5FWKK 1STCE 4DYMA 5HLNA 1REKA 2ITTA 3FDNA 4IZ5A 2YAKA 3Q9XA 3RZFA 4EYJA 4K11A 4RZWA 3VO3A 4CKIA 1M14A 4GG5A 2Z7SA 5K5NA 3FPMA 4FG8A 4WNPA 5AA9A 5IPJA 4O83A 1PW2A 2VNYA 2Y6OA 5DVRA 2Y7JA 4RFMA 2YM3A 4C8BA 3UDBA 5CX9A 3AT2A 3WF7A 4L3PA 4YLJA 3COKA 2BALA 4GYIA 3WARA 1WBWA 1PMNA 2CN8A 2WQBA 2X7GA 3AMBA 5DI1A 3Q5IA 3ZSGA 3SG8A 4JR3A 3NGAA 3BLQA 2ITPA 4WD5A 5J9LA 4AOJA 4TWCA 3ID6C 3KULB 4PUZA 4DE4A 5HD4A 1ATPE 3E7VA 5HO6A 2EWAA 2GHLA 4QMTA 2YAAA 3LFBA 1VYZA 3F7ZA 4U40A 4BL1A 2J5EA 3F3VA 5BMSA 4P90A 4B0GA 3MIYA 4TN6A 3IW7A 3VBQA 3FI3A 2XK7A 5CZIA 5A4CA 3KK8A 3P78A 4LRMA 3P23A 3TV7A 5KZ0A 5LMAA 2W1FA 3IOKA 1Y8GA 3F82A 3AMAA 3R1YA 2W4JA 3EJ1A 1YOJA 3I1AA 4GT3A 4F6UA 4AW1A 1H24A 4I0TA 4IVBA 4TKSA 4XG3A 4MBJA 3KXXA 5L2TA 3LOKA 3SXSA 3KQ7A 5L3AA 2XKEA 4RWJA 3AC8A 3DGKA 3HYHA 4ZTHA 3MSSA 5I3RA 2WMQA 3FZTA 4AGWA 3GCUA 2ZB0A 1WZYA 3D2KA 4MXCA 4ZTNA 3MA6A 5A14A 2B4SB 3UZRA 3WILA 2PVJA 2C3LA 3DBFA 4NM7A 3A4PA 3EQPA 4YJOA 2YISA 3MV5A 5DRDA 3EQCA 3U9CA 3UOKA 4IVAA 2VWYA 3AMYA 2VWWA 5K9IA 2YM5A 2FSOX 4U9AA 4C37A 4AAAA 5L8JA 5E4HA 1FMOE 2YLEA 1H08A 4G6OA 4H39A 1ND4A 2WXVA 2IVSA 2XKDA 5E8YA 3SXRA 2UZOA 2QOQA 2ITUA 3I7BA 3OBGA 1B39A 3QBNA 3VHKA 3SLSA 4CEGA 4FTAA 4M67A 1PXMA 1SYKA 4KUJA 4ZEGA 1WBOA 4IDVA 4LGHA 1OGUA 4PV0A 4V0GB 4N6ZA 4QYFA 1YVJA 1Q8WA 3PE1A 5I9VA 3RPRA 1UVRA 5JN2A 4IAZA 4K2RA 3CY3A 5K4IA 4MD7E 4A7CA 5CF4A 2P3GX 5JT2A 2UZTA 3NPCA 5EQPA 3MIAA 4AN3A 1YOLA 2J7TA 4NU1A 3ZFYA 4M69B 2ITWA 4O82A 4RJ7A 3GU6A 2OBJA 2WU7A 4MXAA 4FEQA 4OT6A 2HCKA 4BWKA 4CFUA 2CNQA 3PG1A 4PPBA 4JBOA 4UBAA 3HECA 4D2TA 2XNGA 3TXOA 3G0EA 3F2RA 3DA6A 4HZSA 4F1TA 4IIRA 5ANOA 3T3VA 5LCJA 5LWNA 3R7VA 4FEVA 3OTVA 4FV1A 3ZXTA 4KRCA 1WMKA 5EHYA 5D10A 4UYNA 3HKOA 3FPQA 4CZTA 4Q9ZA 3G5DA 4FT7A 4XEYA 2JFMA 3I79A 4TYHA 5AAFA 5E8WA 3QZHA 1R39A 3BGZA 3HRCA 1PMEA 2FUMA 3ZUTA 3OHTA 2QR7A 3FV8A 2PUIA 4FUYA 3W8LA 4C0TA 4JVGA 4FIIA 3S2PA 4FTTA 5DT3A 1GZNA 3VNTA 3H10A 2WMVA 5ANGA 2YN8A 4R6VA 5HEZA 4IWQA 3DBDA 3GCPA 5KKRC 3PPJA 2EVAA 3ZS5A 2JKQA 2O2UA 4TT7A 3BYMA 3V6SA 3NCGA 4X0MA 4L9IA 4ASEA 3FUPA 1JSVA 5DHJA 2R3MA 4XRLA 3I4BA 4YZ9A 2I6LA 2QO9A 2RFEA 3PA4A 4R5YA 3V8TA 5IA2A 3UGCA 2Z02A 1OVEA 1QPCA 3MFRA 3JXWA 3VN9A 5JFSA 3C4XA 4GSBA 3WE8A 4AUAA 3CJFA 1G8SA 1Y57A 3KCKA 3E88A 3ZSIA 1KOAA 4E8AA 3TNQB 2JGZA 3UTOA 3UODA 3GU8A 3DZQA 4PF4A 3HA6A 4J98A 2GHMA 2GQRA 3FY2A 3ACJA 3FXWA 3VF8A 4ANQA 4FKUA 5JGDA 4JDIA 2VTTA 4DF3A 4EK3A 2EXEA 4RWLA 5FXRA 3ZRLA 4GJ3A 1U4DA 2HENA 3R73A 3SV0A 2RIOA 4RLLA 4R77A 3JYAA 5CF6A 5LXMA 4DLJA 3W55A 5AFVA 4I4FA 3IONA 3K3IA 3RHXA 1TQPA 3MW1A 5LVPA 2VO0A 4F1OA 5JMSA 4IZAA 1TQIA 4M0YA 4O0WA 2I7QA 2C0OA 1GOLA 2HY0A 3K54A 3ZRMA 4JQEA 5DR6A 3RAWA 1V1KA 3I6UA 3NWWA 4HOKA 5AWMA 3Q4ZA 5BNJA 3C5UA 5ANKA 3BQCA 3ZTXA 2FSLX 3FLWA 3VBYA 3FMMA 5I9XA 4TYEA 2ITQA 4FEXA 4N57A 2ZAZA 2C30A 2I40A 4IW0A 4O7WA 2X9FA 4LM5A 2JDTA 1NVRA 4JAJA 3EMGA 4AU8A 4R7IA 3NX8A 4TYHB 4F7JA 1JKKA 5F9EA 4HGEA 4E6QA 4J7BA 4CQEA 3FMKA 4FKRA 5DOSA 5TE0A 5IKWA 4CLIA 2R3RA 1WBSA 2GNLA 4LGDA 1CKJA 5LQFA 1J7UA 3O71A 3UOJA 4TNDA 1XH8A 2RF9A 5FM2A 2Z7LA 1APME 3TKUA 2PVHA 2X7OA 4A4OA 3SW7A 3NRMA 2VGOA 2XNBA 4ZLOA 4ZP5A 3KMUA 4GV1A 4FOCA 2A2AA 1ZMUA 4QQ5A 1Y6AA 2C6DA 2QNJA 1KV2A 2PWLA 4JBQA 4O0TA 5CU6A 5AUTA 2XB7A 3ZH8A 4Y8DA 3TZ7A 1YXTA 2PSQA 2JD5A 4IAIA 4M84A 4AW0A 4DEGA 3FYKX 3F61A 3S4QA 5B2LA 3MB7A 2QI8A 4PTGA 1GY3A 4HPTE 4RRVA 4YJRA 1NVQA 2UVZA 2JKKA 3LAUA 3FHRA 4QMMA 3E8EA 4DEBA 1PXIA 4HNFA 2OWBA 3ZUUA 3WIGA 3PXZA 1WAKA 4MD9E 5EOLA 3HP5A 1SNUA 4C59A 4DFZE 4EBWA 2WD1A 2PE0A 1WBVA 1T46A 3Q3BA 3SDJA 2CKPA 4D58A 4TNBA 4I24A 4BTKA 2HXQA 5CEKA 4IWPA 4O6EA 3Q52A 4AS0A 3IW8A 4FMQA 4L67A 4TWPA 3FKLA 2REIA 3FMHA 2BILB 2GCDA 3PVBA 5EYCA 1ZOEA 5E8TA 2GNIA 2OXXA 2VTIA 4Y72A 4R78A 4XMOA 3U4UA 3LXNA 2GFCA 3RMFA 2R3NA 1IASA 1P4OA 1ZMVA 3UNZA 3VRZA 3ZHPC 3CXWA 3RPVA 3LE6A 4FTUA 2HAKA 3Q2JA 3QCYA 5M57A 1YQJA 4BDKA 4NKSA 2HXLA 1IAHA 2JLDA 3HMOA 4R7HA 1OPJA 5AR3A 4FK6A 4Z16A 4EOJA 2JDOA 3JR1A 2BUJA 3C0HA 3DJ5A 1H28A 4L43A 4FTKA 2F2UA 3QUDA 4K0YA 2BRMA 5CNNA 4AGUA 3UPZA 2BFXA 3BCEA 3EYHA 4DEEA 3C4ZA 2G15A 4DEAA 4WG4A 3BQRA 5AP1A 1WFCA 1CDKA 2JIIA 3PSCA 1NXKA 4F9YA 4FV6A 2CHLA 4DH5A 3BBTB 3GU5A 5AUYA 5TO8A 2VRXA 2G2HA 5H2UA 4YO4A 5IA4A 1Y8YA 2X2KA 4IWOA 4BYIA 3DK6A 4W4XA 5FP5A 4L3LA 4KIQA 4YZNA 5HESA 4BCMA 3IW6A 4BCJA 3LM5A 4ZJIA 5JGBA 2R3LA 3ORIA 5DWRA 3R9HA 3EQHA 3P7BA 5DNRA 3AGMA 5DIAA 3ZDUA 4FV9A 1WCCA 3HRFA 2VTLA 4WT6A 2GHGA 3M2WA 5EW3A 3TNPC 3TKIA 4I5MA 4NFMA 4QMSA 3II5A 3RAKA 4C62A 4NSTA 4FNWA 4E7WA 5DG5A 1ZYDA 2BRGA 5AAEA 4DGNA 1OKZA 1J3HA 4H3QA 1Q8ZA 1XH7A 3L8SA 5M51A 2SRCA 2CLQA 3COMA 4EHEA 3IPHA 3QTRA 3CCNA 3NIZA 2YA9A 2YACA 4E6DA 1LP4A 1TKIA 1Y6BA 1FMKA 2HELA 2PVLA 3HV6A 4WNKA 3JY9A 4B99A 1GZKA 4FKOA 4HCUA 1BUHA 3P08A 1PKGA 5CQUA 3ZO4A 5GZ8A 4C58A 4GG7A 2E9OA 4PMPA 5HU9A 2Y0AA 4O7RA 4RLKA 4ANLA 4C4FA 4JOAA 5GNKA 3GCSA 4KIOA 4DH1A 2YIRA 3PJ2A 3NVMB 3PXRA 5CT7A 4EUTA 2C69A 2B1PA 2UZLA 3IDCA 5CYIA 1XJDA 4YJSA 2AC3A 5E1EA 3OMVA 4EYMA 4Z7GA 1OB3A 3KCFA 3QX4A 3P86A 5KHXA 3R21A 5GINE 4H1MA 3KRLA 1IR3A 3LFCA 4IC8A 1O6KA 4Q2AA 1MRYA 5KO1A 4NZWB 3CPBA 1RJBA 4RIOA 4D4RA 2R9SA 4XUFA 3QC9A 3VW8A 2OH0E 2RKUA 4P7EA 4CMOA 4BDDA 4DFNA 2DWBA 1OECA 2OK1A 4NM0A 4J99A 4A9TA 4MAOA 5L2QA 4MNEA 3GXLA 2QG7A 3R2BA 3CTQA 5AV0A 3FLQA 4RJ3A 4TRLA 1XBAA 4OBOA 4H3BA 3BYVA 3MFSA 5AUWA 3I7CA 3QUEA 4CMTA 4O38A 4RJ4A 5ETCA 4IVCA 3W2RA 4EKKA 1KE7A 5DE2A 4RX8A 3E63A 2ACXA 4G3CA 4ITIA 3LXPA 3G0FA 3QD3A 5EW8A 2VTHA 3CBLA 3MH1A 5FBNC 5M4FA 3B2WA 4FIEA 3MYGA 5HGIA 5AV4A 1GIJA 3ZLYA 2ETRA 4ACHA 4QTAA 2ITVA 1ZOHA 2ZM4A 4AW5A 1Y91A 2J9MA 3KKVA 2RFDA 3MBLA 3KGAA 4HYSA 1Q8TA 4FV4A 4IE9A 3NYVA 3NYOA 4O7VA 4GT4A 1QL6A 3FSKA 1OIUA 3DBEA 4KKHA 2BCJA 5HOAA 3PSDA 1M52A 4YGAA 2WAJA 4I6BA 3U9NA 2YIYA 1UNLA 5HBEA 4DBXA 5L8LA 1LUFA 5DA3A 1H8FA 4YR8A 3VUIA 3RPOA 3TTIA 3TUBA 3PSBA 5GJGA 3VW6A 4X21A 1WBTA 3DU8A 2B55A 5M56A 4MWIA 1YXXA 2WB8A 1YDSE 4FKWA 4C61A 4N4SA 4BCQA 1Q8UA 1XH5A 2BTSA 1QCFA 3VHEA 5IQFA 1YI3A 2RFNA 3OFMA 1JKLA 1TQMA 1ZWSA 2UW4A 2BRHA 3QYWA 4FYNA 3GT8A 4D2SA 3PXQA 2AYPA 3ODZX 3KMMA 4N6YA 5CEMA 4MXXA 2OF4A 1PXKA 1SZMA 1NW1A 4IB3A 3BV2A 3NVKI 4YZCA 3QTXA 4D5KA 3V5TA 4LFIA 2E9NA 5AP0A 4CZYB 2XNEA 3HAMA 3KXNA 4DGMA 2HW7A 2OF2A 3CR0A 3ORKA 2C5VA 2XUUA 3F7WA 3RGFA 4YSMA 4LI5A 5J8IA 4FSNA 4N70A 4DINA 4AFJA 5M06A 3KC3A 5AV3A 4I22A 4Y95A 2R0IA 4I5CA 1E1VA 4MVFA 4FVRA 5IZFA 3VBTA 1R3CA 4NFNA 4O0UA 3CGFA 5CAVA 4MNEB 4BCNA 2WOUA 3UZPA 3POZA 4K9YA 3AXWA 3JVRA 4YLLA 1UWJA 4ORKA 4R3RA 5AP2A 3UQGA 3VUKA 2VU3A 3C0IA 4G3EA 2QODA 3C13A 4X2KA 4EORA 4EH4A 3AQVA 3LJ0A 3C0GA 5LCKA 4UMPA 5J7HA 4I93A 2CCHA 2XK8A 4IHPA 4UY9A 3GENA 4LOPA 4ALUA 4G1WA 3PUPA 2PZIA 3ZBFA 4G5PA 4F6WA 4QMUA 3EKKA 4O0XA 4U79A 4X7QA 4QRCA 3FZRA 3V5JA 2BDJA 3RPYA 2GS2A 3QD0A 3H9FA 1UKHA 2YIQA 4D9UA 5C9CA 1H27A 4RC3A 5IEVA 3UMXA 3E92A 3PJ1A 3E8DA 3O96A 4FTRA 4R3PA 4WUAA 3PWYA 4G2FA 3ZRKA 5BUIA 2PK9A 4BGGA 5AIKA 4M13A 4JG8A 3VUTA 3OY3A 5M4CA 5F95A 4NCTA 5BVKA 3LM0A 3BYUA 2B9HA 3LZBA 3R1NA 4WSQA 1KE6A 3MH0A 4GCJA 3C7QA 3FKOA 5A3XA 4L00A 3TI1A 3ZLSA 4GRBA 3JUHA 1AD5A 4HNIA 3T8OA 2PMNX 4PMSA 3RP9A 4C7TA 5J79A 2A4LA 4XG7A 4ZTMA 2NRYA 3PJ8A 1VZOA 3HP2A 4S2ZA 4IC7A 5KMOA 5CNOA 4ANSA 2W5BA 3EN6A 3DB8A 5L6PA 4KD1A 4FTQA 5IQIA 2XIXA 1LEWA 3R9OA 4II5A 4AT5A 5AADA 2X81A 1YWVA 4FNYA 2JKOA 4GEOA 4BC6A 5AX3A 3OWJA 4PL4A 5IQBA 3BKBA 3VS6A 5EW9A 4MXYA 5CEPA 3HZTA 4GIHA 3VVHA 3V51A 3SC1A 3KF4A 3DKCA 4HCVA 4JG6A 4PDOA 1R78A 1MRUA 2GTMA 4GFOA 2WMAA 4B6LA 3Q9YA 5JQ5A 1IAJA 3PTGA 1Q5KA 1FOTA 3CD8A 4BDCA 3BGPA 2WKMA 5HG5A 4OBQA 3LLTA 4J97A 3MTFA 5F94A 2UZEA 4OT5A 3F9NA 4G6LA 2F7ZE 3BYSA 3VS2A 5IH5A 1FVRA 3DTWA 3FE3A 4C3PA 3ORPA 2QQ7A 2XK3A 3JS2A 5AV2A 3RWPA 5FDXA 4XP3A 1URWA 2YM6A 5L4QA 3OEFX 4EOKA 4FUXA 3GI3A 4YBKA 4BBFA 3PIZA 4L52A 1CTPE 2BVAA 3G9NA 1UKIA 2UW5A 3D94A 3I0QA 3OWPA 4ACDA 1OKVA 1NY3A 4I0SA 4FEWA 2H34A 1NT2A 4EKLA 1H07A 2ZV7A 4P5ZA 5FTOA 2V62A 3LCTA 5IEXA 5FRIA 2F7EE 3QQLA 3ALNA 1JKSA 3DKOA 3CKWA 3EB0A 3LFSA 2X6EA 3QALE 3MFUA 5D12A 5LVLA 3R7UA 3VBVA 2WMRA 3NW7A 5C8NA 4LV8A 2YZLA 3L9MA 4FKGA 3NNUA 1E1XA 2PHKA 4HVSA 5CF5A 4IX6A 5CXZA 5M44A 4UMTA 2HY81 3H9OA 4WHZA 2PYWA 4N0SA 4M0ZA 2GQSA 2JC6A 3E64A 1OBDA 2ERKA 4C35A 2IVTA 3IGOA 4ZS4A 4CVAA 4LUEA 2NNWB 1IA8A 2XEZA 4TPTA 3S95A 2XNOA 2YM4A 3NUYA 4BWPA 5A9UA 1LR4A 3G33A 3PXFA 2G2IA 3VWAA 4WSYA 3K2LA 4BCKA 5K4JA 3D5UA 3R8LA 5IQEA 4AA4A 2RG6A 2UVYA 4IAFA 3OVVA 3MWUA 3IOPA 3NAYA 2CGUA 2DQ7X 3UOHA 4EH9A 3VS1A 4QP6A 4I6FA 2A1AB 3EN5A 2WTDA 3Q32A 3S3IA 2UW7A 4HYHA 3O0GA 5AP4A 3BE9A 2C6LA 5KCVA 4RQVA 5I3OA 2B54A 4UV0A 4A06A 1MQBA 2GDOA 4EZ3A 3GC9A 3E62A 3DFAA 3P4KA 5KZIA 3PWDA 5HZNA 5I9WA 2C5YA 3PZHA 4LOOA 3GFWA 3VS7A 4F0GA 4ZTSA 4MBLA 4B7TA 4JS8A 5K3YA 2GPHA 2BMCA 2FH9A 3DAEA 2OJJA 3E3BX 2GSFA 3EL7A 3FLZA 3KK9A 3KRWA 3PY0A 2F49A 2W1IA 3QQUA 4FL3A 2W4OA 4GS6A 3AOXA 3SA0A 1UV5A 4O81A 3R7GA 1M2RA 3EL8A 3UVRA 1DI9A 4BVUA 1S9IA 5CU4A 2JDRA 3MPTA 5AP5A 2P33A 4YHJA 3FZ1A 1F0QA 3F2NA 2ERZE 1T45A 2QONA 4O22A 4DT9A 4ERKA 4QP2A 4F9WA 4RVKA 4H36A 4IFCA 3UVPA 1PKDA 1G5SA 4GJ2A 4PMMA 2IJMA 1XHAA 2PULA 4IH8A 4E5AX 2XZSA 1UWHA 1FGIA 5EOBA 2QOHA 4BRXA 3PG3A 4S30A 4B8LA 3HDNA 4ACMA 4CSVA 2Z60A 4MQ2A 5IQGA 4O7SA 3SOAA 2XM9A 3BHVA 3C4EA 3NUXA 2UZUE 5EI6A 3ZC6A 3BEGA 4WRGA 3VS0A 2UZNA 4RC4A 4FT5A 1PYXA 1W7HA 2RSVA 3DB6A 3BE2A 2JIVA 2WFYA 4BDBA 2EXMA 4FGBA 5KHWA 3IS5A 4BWXA 2E9UA 2WQOA 3DDQA 1J7IA 4LYNA 4U80A 2ETKA 3KMWA 4JRNA 4D28A 3Q4TA 4M97A 5M53A 5LMKA 3ROCA 3LJ1A 4HVIA 5H8BA 2CGVA 4G9RA 4UZHA 4X6QC 1XO2B 2VUWA 4FG7A 3TUCA 2UW6A 5CVHA 4GT5A 2QHNA 3RNYA 3VBWA 4IM0A 3U51A 1Q41A 3MS9A 4E93A 1H1SA 2XVDA 3RVGA 3IDBA 5LVMA 1G8AA 2J0JA 4RX5A 3OD6X 4RG0A 2YEXA 4WG5A 4BZOA 2R5TA 3L8XA 5LVNA 4Q5EA 4FKPA 3DK3A 2XCHA 3L8VA 2YJRA 3OT8A 3MJ1A 4OTWA 5FEEA 4IFGA 5IDNA 3VRYA 4RBLA 4PX6A 4AZSA 3PXKA 3UIUA 3OEZA 4NCTC 3P9JA 4BCFA 4OTPA 4C4JA 5E90A 4MWHA 4PL5A 3F69A 3PP0A 1FQ1B 3PY3A 5HTCA 5LOHA 4FC0A 4EOOA 2XRUA 5E8UA 4FV3A 3DJ6A 4V05A 4E5BA 2F2CB 4YPDA 5HCYA 3F6XA 1WVXA 3NNXA 3GCVA 3GUBA 5CSWA 3JY0A 3NLBA 3H3CA 4QP9A 3RHKA 3UNKA 4IAKA 4AFEA 2VO7A 4FL2A 4TWOA 5BVDA 4Z7HA 5IU2A 2AUHA 5DLSA 2UVXA 3OY1A 4CTCA 2ZM1A 4YJNA 3R7IA 3QQKA 1KUTA 4IX5A 3EHAA 2OKRA 3HUBA 3RINA 4E6AA 1JNKA 4F7LA 2BPMA 4EH8A 5C26A 1YXUA 4EOSA 5HTBA 4FT9A 2OFVA 3MN3A 2C5OA 2W9ZB 4QYGA 2BAKA 4ZMEA 1H4LA 2QC6A 3MPAA 5ETIA 4YC8A 5GZ9A 4AX8A 3R83A 5A4TA 3R7OA 4IB5A 4ZTLA 3TNIA 2BHEA 4NTTA 2WMUA 2ZOQA 5IF1A 4FIGA 3TEIA 4G3FA 4EWQA 3MVMA 3R0TA 4WIHA 3WBLA 5KMLA 5GIPE 4XYFA 4FTMA 2C6KA 2GS7A 3AC2A 3DDPA 4XS2A 4XP2A 4EQCA 4M68A 3D4QA 3KRJA 2X9EA 4QYYA 2KULA 2YIWA 3CJGA 3EFJA 3I81A 4CFVA 4EK6A 2GTNA 4RMZA 4YSJA 5IUHA 4EH3A 4EHGA 2PUPA 2R3JA 5CAQA 4MD8E 4O96A 1RDQE 2VV9A 3R8UA 5ACKA 3U54A 3R02A 3V5PA 3ZO2A 5BYLA 2BDWA 3SGCA 2CKOA 3F3TA 3JVSA 5I9UA 4F9CA 1ZAOA 2BHHA 2F9GA 3G6GA 4GVJA 2J0LA 4RIWA 4PPCA 3ATSA 3TM0A 5M09A 2JBPA 4HCTA 4ZLZA 1BI7A 5BVOA 2XNMA 4JX7A 3TNHA 2CKEA 3NS9A 2WIPA 4EJNA 1SVGA 2YCRA 3M1SA 5CT0A 2YJSA 5BYZA 2WQNA 4OBPA 4ENXA 3N9XA 3ALOA 3IGGA 1PYEA 2A27A 5IQDA 2C6OA 3P1AA 5CLPA 4CXAA 2WMBA 3MVLA 3R00A 4MF1A 2BFYA 3QHWA 5CTPA 3TG1A 2HWPA 2WGJA 3TJCA 5ETAA 4ANBA 4CQGA 4AWIA 2P4IA 1ZYLA 3IDPA 4ACCA 4BTJA 4LV5A 3V8SA 1V0OA 4EEVA 4L8MA 4X6RA 1QPJA 4IVDA 3CQWA 5HE3A 3BWJA 4YJTA 2BZKB 1BL7A 3UJGA 5JRSA 4OAVB 4D0WA 1Q99A 2CGXA 4IAYA 5HO8A 1HOWA 2QOLA 2XBJA 4CKJA 4YO6A 2XK4A 5FP6A 4C02A 3A7GA 3NNWA 2WHBA 2C3KA 1LEZA 4XG9A 5E91A 2I0EA 3IK3A 4I6HA 5DR9A 1RQQA 2XJ0A 3ULIA 3PE2A 3QF9A 3F2AA 3K5UA 2I0YA 5IH6A 4RJ8A 2OH4A 3ZFXA 3EQFA 3ZO3A 1U54A 1FVTA 5HVYA 4K18A 3OUKA 5IQHA 2OFUA 4JIKA 4BN1A 1M17A 4OTHA 4BDHA 1OZ1A 3BHHA 4NKAA 1YI4A 4O2ZA 2XMYA 3ORZA 5K5XA 2C5XA 3KFAA 4BZNA 4M7IA 2YDJA 3BV3A 3IW4A 4IEBA 4AOTA 4Y5QA 1ZY5A 2UW9A 3IO7A 5J87A 4FOBA 2WELA 5HNBA 4OAUC 3F88A 5BMMA 5M4UA 3QU0A 3QKMA 3CSVA 2EU9A 2X2LA 2PZPA 3DK7A 3V5WA 4BIDA 1XBCA 4O0VA 5CALA 2CN5A 4XH6A 1A06A 2VZ6A 4NIFA 3H0ZA 4EONA 3THBA 3K3JA 4Q5HA 4EBVA 3B2TA 3C4WA 4L45A 3QHRA 3OOGA 3HGKA 4C57A 1P14A 1F3MC 4UB7A 3A60A 3L9NA 4G3DA 3VBXA 4RIWB 3OBJA 3QTUA 4FI1A 5FGKA 3B8RA 4U3ZA 4AACA 4EK4A 5I4NA 4TW9A 4QTCA 3EYGA 2ZJWA 3AC3A 3HMMA 5HLWA 4EJ7A 3BPRA 3EFWA 4DEHA 5J1VA 3R8MA 3RBWA 4R7BA 4RVMA 1VR2A 2QOCA 4P2KA 5EI8A 2BTRA 3PRFA 5HLPA 4DGLC 3HUCA 4Y5HA 2BZJA 5H9BA 4MYGA 3QFVA 5TR6A 3TV6A 3V01A 5HIEA 5JFWA 5FBOA 5BVWA 5B2MA 4JQ7A 4BDGA 5E8XA 3TT0A 4BCGA 3KU2A 5KMJA 1J7LA 4U7ZA 3SKCA 3TWJA 2X8EA 5DT0A 3TDWA 3ZEPA 4EOLA 4A9SA 3F5GA 4RJ5A 5LMKC 4KABA 3QQGA 5DGZA 1B6CB 3ZYAA 2GMXA 4CFFA 5J9YA 1X8BA 2XK9A 3ORXA 4DHFA 4ZSAA 2I0HA 4XBRA 4QTBA 5KMNA 4V04A 2WZJA 4Y83A 5AUUA 3BRBA 2J90A 2W96B 4GMYA 2OXDA 3FBVA 4O21A 4XG2A 4IMYA 4IXPA 4XBUA 1BMKA 3KVWA 3DXQA 3A2CA 2FA2A 5A6OA 4IZYA 4ZSGA 4ONAA 2OI4X 5CU2A 1BLXA 1REJA 1O6YA 5F4NA 3SG9A 4E4XA 4MNFA 2JDSA 1M2PA 3DAJA 4BYJA 1XH4A 3KXGA 4X3FA 3PA3A 4P4CA 4AT4A 1OBGA 5C8KA 1U54B 3ODYX 2QKRA 5DT4A 4XHKB 4FTLA 4M14A 3I0OA 4XP0A 2IG7A 3OUNB 4UEUA 4FF8A 4WBOA 3EQGA 2FVDA 4NEUA 4O7YA 2Y6MA 5HICA 3MVHA 2C47A 2OIQA 4EZ5A 4FTCA 2R3KA 4YTHA 5E7RA 3AD4A 4E3CA 4IJ9A 4K77A 5E1SA 5AUXA 5E92A 3BIZA 5HE1A 2V22A 4DC2A 2IN6A 5CAOA 1A9UA 4DAWA 4UXLA 3ZSHA 2YWPA 4OR5A 4YC3A 4BGQA 4EOMA 5J5SA 2OJGA 2WTVA 5AV1A 5HCZA 4U97A 3ZXZA 3HV7A 3V3VA 4DH8A 2CDZA 3M11A 5TF9A 2WMSA 3LXKA 5C01A 1OIYA 4QNYA 3LW0A 4GL9A 4TYIA 5H3QA 4PQNA 1CSNA 3BHUA 4FKVA 2IW8A 2OICA 5A54A 3NEWA 1PF8A 4TXCA 3A7IA 3PIXA 4HYUA 4FV5A 5BX0A 3SRVA 1K3AA 2UW8A 4D5HA 4FKJA 5FEQA 5IA1A 3R1SA 4F9BA 3AC1A 3F5PA 2EB2A 3QAME 4UWBA 3EH9A 5FEDA 4W8DA 4BFMA 4PNIA 3OOMA 2R3GA 3NR9A 4D0XA 4LOQA 3ORMA 5GIOE 4WG3A 4YJVA 3ZM9A 4L44A 4LMUA 4CRSA 4G9CA 2QOFA 4WUNA 3RWQA 4OW8A 3SVVA 3ANQA 4CFNA 3BYOA 5EM8A 4FSZA 4G34A 3MY1A 5D9HA 4AZFA 3WYXA 3WI6A 4CG8A 4YNOA 4U42A 4L42A 3UMWA 5JSMA 2O63A 3T3UA 2VWXA 4JNWA 4UMRA 5CSXA 4NW6A 4L46A 4WNMA 5CI7A 4PDYA 2VX0A 2WTIA 1OKYA 1Q8YA 2YM7A 3GU7A 5BVEA 1R1WA 4G3GA 1EH4A 3TACA 5EM5A 2V7OA 2WEIA 2VGPA 5EM6A 3ZO1A 5IMEA 3UG2A 4UYAA 4O0SA 2OXYA 3EWHA 4IM3A 4X3FB 4BI1A 3O51A 4GKIA 5D41A 2W0JA 2UZWE 3L9PA 4FK3A 3W2OA 2BZIB 2R2PA 4ZTQA 3AG9A 4RIXA 2Z2WA 4ANOA 4E6CA 4QPAA 4CFWA 3PDTA 2VX3A 1M7NA 3NIEA 3R7EA 4ALVA 1UU3A 4HZRA 4MXZA 3FC2A 3PP1A 4HVHA 5FTQA 1TVOA 3C4CA 1PXPA 2XYNA 3KRXA 3HRBA 4YNEA 4A9RA 4HW7A 5IA3A 4O27B 5CSVA 2C5NA 4BBMA 3Q96A 5HE0A 4QOXA 2ZVAA 3O23A 3GGFA 1UU8A 2W5HA 1FVVA 5GJDA 2ITNA 3Q4CA 4RA5A 1BX6A 3E8CA 3ZZWA 2BROA 2YCQA 2Q0NA 2DUVA 3R6XA 4U5JA 1JSUA 4K1BA 4BTFA 3DCVA 3E3PA 3TN8A 3UIBA 3LLAA 2V55A 2J5FA 3V5QA 4DTKA 4QQTA 2GU8A 3C5IA 3FL5A 4DFBA 4U45A 5DRBA 4FKTA 5EHLA 2C6IA 4KKEA 2WTKB 2IW6A 4QMWA 4UWCA 3PXYA 3MH2A 4KIKA 2B9JA 4U8ZA 3ZLWA 4AZWA 4CNHA 4F70A 4CG9A 3QTSA 3Q9ZA 5BUEA 4AGDA 3CTHA 2YERA 3DQWA 3LQ3A 3GOPA 2HYYA 3R8PA 4G6NA 4GU9A 5FD2A 2QKWB 1H1PA 4GU6A 2BKZA 2QLQA 4KBCA 1H26A 1GAGA 4WRSA 3FZSA 3Q60A 4S31A 3UG1A 4C34A 3BEAA 2X8DA 4S32A 5HIDA 3RK7A 5A46A 2BZHB 2VWVA 4KB8A 2C6EA 4RVLA 4XOYA 4XV2A 3SX9A 2YCSA 4QTEA 5JGAA 2XIKA 3RI1A 4ANMA 4BBEA 5IEYA 2FSMX 3NSZA 1O9UA 5EFQA 4GUEA 5EM7A 1E9HA 3A4OX 4F7SA 3QRJA 4ENYA 3QRKA 4BDIA 3DFCB 1OKWA 4BICA 3RAIA 3VUMA 5EKNA 2KTYA 3B8QA 3ZFMA 4I23A 5L6WL 2YCFA 1XR1A 4D2WA 2CGWA 2QO2A 3MVJA 3P7AA 4D1SA 4FA2A 4ZSEA 5AR8A 3W18A 2EXCX 4GUBA 4J1RA 4EK5A 3RJCA 3F66A 5AUZA 2H9VA 4FTJA 4RIXB 4M8TA 3OW4A 3UNJA 2ITOA 4CCUA 2BIKB 4KWPA 4RIYA 1JWHA 2RGPA 3EQDA 4A4LA 2XM8A 2NO3A 4JDKA 3LFEA 3C50A 3QQFA 4G17A 4AQCA 1FBNA 4J53A 4AT3A 4PDPA 3EZVA 2G1TA 2VD5A 3TNWA 2YDIA 3WZDA 3SQQA 4BDJA 4BCOA 2W1DA 4AE9A 3S00A 2HWOA 3R9DA 4A07A 4BCPA 2OSCA 2Y9QA 3HLLA 3LMGA 4RPVA 1YDRE 2WIHA 3DY7A 4MKCA 4W9XA 5GJFA 3WYYA 4EOQA 4HVGA 4FSRA 5HBJA 4O2PA 2IVVA 2W99B 5CEQA 3CTJA 1YHSA 3Q5ZA 3NW6A 4WO5A 2PU8A 5CVGA 3E5AA 1FPUA 4OTQA 3P7CA 4RWIA 3QZFA 3SAYA 4PL3A 4L6QA 2G01A 4ZTRA 5L2IA 5AM6A 3UE4A 3WF5A 5IA5A 4OTRA 3ELJA 2WU6A 2XA4A 5TOZA 3GCQA 5KE0A 3VF9A 3LFNA 4AF3A 3POOA 4QTDA 2PVNA 4FSMA 2W1GA 5AP7A 1W83A 3R22A 4FIJA 4QP8A 3CE3A 5D7VA 1DM2A 4LL5A 3C4FA 3WOWA 2IWIA 3R8VA 3WF6A 4X3FC 2CLXA 3VS4A 5HHWA 3DLZA 4TWNA 5CANA 4EQMA 3KREA 3WZJA 1JAMA 4DH7A 1CMKE 4PMTA 2JBOA 4RFYA 1H0VA 3LQ8A 4FTIA 3MH3A 4TYJA 5AUVA 2V7AA 2I0VA 4FR4A 3MY0A 3OC1A 2UUEA 3EZRA 4M15A 2UV2A 4YTIA 5J5TA 4PY1A 3IG7A 2JKMA 3D7TA 2Q0BA 5C4LA 3WZEA 2PMIA 3KN5A 2NP8A 3RKBA 3PJ3A 1GNGA 2OIDA 3OP5A 3GVUA 5G1XA 5LMBA 5F20A 5KBRA 2BDFA 5EHOA 5HVJA 2BRNA 5HORA 3BI6A 3PRIA 3COHA 4G16A 4AZEA 4R5SA 3VIDA 1K9AA 3Q53A 4DFXE 2XJ1A 3KN6A 4GIIA 3VUHA 3N4VA 4BKZA 3LCSA 3WZKA 3R1QA 4K6ZA 2BRBA 3DXPA 4ZSLA 4BY9E 3OWLA 3QKLA 5A6NA 2ONLA 2Y8OA 3GEQA 5I5ZA 3AD6A 2OU7A 3W2CA 5C1QB 1U59A 2ZMDA 2VTPA 2WTKC 1F5QA 4AA5A 4F64A 2WOTA 4ZY4A 2CSNA 1SNXA 1ERKA 4FL1A 4HYIA 4RIYB 5DEWA 3QA8A 3COIA 4BR3A 3EFKA 3TZ8A 3UO4A 2NRUA 3D7ZA 1UU7A 5E8VA 4XOZA 3KULA 4JG7A 4NW5A 3M42A 4GFGA 4IB1A 1SM2A 3TZ9A 4XG8A 4RQKA 1XQZA 3FQSA 4J95A 4XCUA 5EI2A 2VTOA 1BYGA 2G9XA 2WNTA 3H0YA 1OIQA 2WTWA 2LAVA 5DPVA 3ZC5A 3HDMA
chains in the Genus database with same CATH superfamily
1PMUA 1AQ1A 2R3HA 2CJMA 2B9FA 3NMUF 3HV4A 5HBHA 2XYUA 4KNBA 3R2YA 3A7FA 3G15A 3AD5A 4F08A 3OT3A 2IVUA 3QKKA 4FNXA 4F09A 3UQFA 3BLHA 3BHTA 1YWNA 3GOKA 3NZ0A 4D2RA 2YM8A 3D2IA 3G6HA 4BHZA 1JBPE 2XH5A 3HMIA 3QRUA 4U3YA 2UW0A 5CS6A 4JRVA 3A61A 3PYYA 2W4KA 4JQ8A 2ZYBA 4CTBA 3QGYA 4DG2E 3DT1A 2YIXA 3E8NA 3DV3A 3DQXA 3HMNA 4GYGA 1OL7A 1XBBA 3QQJA 4XJ0A 3UO5A 4H05A 1J91A 4NH1A 3P5KA 3FMDA 3FZPA 2IZUA 4G5JA 5B7VA 3UVQA 3TV4A 4QMZA 5EYMA 3EN7A 1URCA 3A99A 3DKGA 3R63A 4E4LA 4EQUA 4Z55A 1K2PA 4G31A 4ANNA 4NK9A 4U43A 2O3PA 4R1VA 5AR4A 2JDVA 3ENMA 2HZNA 5DEYA 4DG0E 4P5QA 3QLFA 3ZLXA 4V0GA 4HGTA 2PZRA 2QO7A 3CC6A 2C3IB 2VWZA 1IG1A 3MI9A 4FBXA 4I1ZA 4OTGA 3WF9A 4D4YA 4QMQA 3LKMA 4O7TA 4AXAA 4FVPA 2OJIA 5LJJA 1KWPA 1GZ8A 4TY1A 3C9WA 1OM1A 3CGOA 4M69A 1I44A 2VX1A 5T3QA 4LGGA 4NWMA 4F0IA 4FYOA 4FX3A 2C6MA 2EB3A 5CVFA 5D1JA 5M08A 3DTCA 3NAXA 4J71A 3QCQA 3U87A 2J51A 1BKXA 1ZYJA 3F5UA 2ZV2A 3FMNA 4CMUA 4IDTA 4Y46A 1XKKA 3Q2MA 4XV9A 3TUDA 3OCBA 3VAPA 1P4FA 4BI2A 4R3CA 2J50A 4BF2A 3NUSA 2O0UA 2ZM3A 3TDVA 2XK6A 4JDHA 3ORLA 1DAYA 3LFDA 3DKFA 4GK4A 3UYSA 1DS5A 1ZY4A 1RW8A 3PVWA 4HJOA 4YU2A 2B52A 5AEPA 4ID7A 4W8EA 2HZ4A 3RNIA 4C3RA 4A9YA 4JI9A 1JLUE 1WBNA 4ZIMA 2OZAA 4KS7A 2RFSA 3Q6UA 4JAIA 4D4VA 4JLCA 2VTJA 2W1HA 4XLIA 1GZOA 3FLSA 4WNOA 2R7BA 3VQHA 4LDTA 4FSUA 3H9RA 4EH7A 3GC8A 2QLUA 5GZAA 2IZSA 3HV5A 3R9NA 4MBIA 3R9RA 3QA0A 1LPUA 5E8SA 5DMZA 2XF0A 3FLYA 4FIFA 4UMUA 3FZOA 2VTAA 4Y85A 4UMQA 4USEA 3CP9A 4HGLA 3LFFA 5AX9A 2ZB1A 1S9JA 3H30A 5JH6A 4MQ1A 4BCIA 4CRLA 5HVKA 4XLVA 5A4EA 2W7XA 4YJPA 3TIYA 4A9UA 2IO6A 2OW3A 1PRYA 2Q83A 4CD0A 3D14A 5IG1A 2YDKA 3HVCA 3EQBA 3GQIA 3R01A 3VULA 5AAGA 5CWZA 3TCPA 4U44A 2XBAA 3LVPA 5AJQA 3W8QA 3KEXA 4M66A 1Q4LA 2WMTA 3CQUA 4CT2A 5KNJA 4QYHA 5HU3A 4DA5A 3ZCLA 4BI0A 2CCIA 4M12A 1YXSA 5M07A 4JT3A 4J8NA 3BBWA 4LUDA 4D55A 3ZONA 3W0RA 3G9LX 1P5EA 2XKFA 1I09A 4X2GA 2QOOA 4OGRA 2W5AA 2DYLA 2ZMCA 4KINA 4RA4A 4DTBA 3FAAA 4ZMFA 2VTRA 5EDRA 3KA0A 4EC9A 4YPSA 3MFTA 1OL6A 3OWKA 5ANEA 1L3RE 2XNNA 1SVHA 5CY3A 4FKIA 3R7YA 2JAVA 3PUFC 3FMJA 3KXMA 4MX9A 1SMHA 4D1XA 4FV7A 3MESA 4QMYA 5JRQA 4DLIA 5I9ZA 1NVSA 3DXNA 3E7OA 3U4WA 2HOGA 2YLFA 3D0EA 1U5QA 3FQEA 1ST0A 4I5HA 4F63A 2PMLX 5DYJA 3O50A 3GQLA 2QOKA 3RCDA 4O91A 2RL5A 4XNEA 4RGJA 2WTJA 3H4JA 5JK3A 4BDEA 3I5NA 4B8MA 5FDPA 4Z3VA 2QG5A 2PTKA 2VTNA 4GFMA 1U5RA 3FKNA 3HX4A 4OUCA 3OXTA 4C2VA 1KOBA 5E8ZA 1UNGA 2W1EA 1WVYA 1W98A 4JXFA 3QTWA 5JEBA 1MQ4A 2HZ0A 2OZAB 2XNPA 3ERKA 4KSPA 3VS3A 4R8QA 4LMNA 5HI2A 1OL2A 3R8ZA 3QRIA 4NJDA 4RZVA 5EKOA 5FUTA 4U41A 4O84A 2WEVA 4MHAA 4PWNA 3TIZA 3D9VA 1A48A 2W06A 1H0WA 3QGWA 4ITHA 4QD6A 2F4JA 3NUAA 3CS9A 3FXXA 2R0UA 3WE4A 4KBKA 4O6LA 4JJRA 4UALA 4XX9A 2X2MA 1JKTA 2X0QA 3O7LD 2XKCA 3QWJA 5EDPA 3SOCA 1Z5MA 5HE2A 4EHVA 4EZ7A 4L01A 3V6RA 2ONLC 2Y4PA 3G90X 4UXQA 5M55A 5JZJA 2X6DA 4C4IA 1KSWA 4FV8A 4FZFB 4IADA 5JZNA 2QOIA 1YI6A 4CYIA 4UN0C 2GS6A 3TKHA 3RK5A 2QVSE 3SD0A 4L7SA 4QO9A 4LV7A 3TYKA 5K0KA 1PXJA 3IW5A 5D7AA 4ASDA 3OCGA 3NUNA 4AA0A 4BZDA 4CYJA 3HEGA 3QL8A 4APPA 1KV1A 5IA0A 3BZ3A 3E87A 3LHJA 4I21A 3Q9WA 2XIZA 1V0BA 4WOVA 3F3ZA 3LIJA 2HK5A 3AT4A 4MEDA 3MGYA 4U0IA 5TT7A 5FM3A 1SVEA 3LXLA 1IRKA 1H1QA 4PTCA 3PPZA 2B0QA 1M7QA 5TKDA 1KE8A 3FJQE 5A4LA 1MUOA 2CNUA 5FTGA 5FLFA 4X2FA 3OS3A 3CQEA 3QYZA 3CIKA 3T9IA 4QP7A 3QTQA 4DITA 5EYKA 4L68A 1QPEA 2X1NA 3O2MA 2ZFYA 1YHWA 4QNAA 3UPXA 3BU5A 3QC4A 1W82A 4TL0A 4GVAA 1FGKA 3O5AA 5ACBC 3N4TA 3LCKA 3BELA 3FI8A 3P79A 3RM6A 4PRJA 3QRTA 2RG5A 2H6DA 3CPCA 3KY2A 4RX9A 3QWKA 3NFGB 4W9WA 4YJUA 2YFXA 4F99A 4TYGA 2C6TA 1CKPA 3CY2A 4KBAA 5CU3A 4YURA 4CGAA 3WZUA 2Z7RA 4MF0A 4BKJA 1L8TA 3F3WA 4PTEA 2NPQA 2PE1A 1JSTA 4IM2A 4NM3A 5ICPA 1DAWA 4FV2A 5HIBA 2ITYA 5LWMA 2C0IA 2FSTX 3NYNA 4HVDA 3CD3A 2G2FA 2OZOA 2PVRA 5IQCA 4DTAA 3HA8A 4FZ6A 3R30A 5KMKA 3D83A 1UU9A 4IX4A 5DH3A 2C1AA 3ZM4A 4EI4A 1MP8A 1O6LA 2XIRA 4E26A 3UIXA 2GFSA 4RJ6A 5CZHA 1PJKA 5G6VA 4K33A 2W1CA 1Q3WA 2GNGA 3TJDA 4FEUA 4ZZNA 2YHVA 5JKGA 5JFVA 5CI6A 4PP9A 3O8UA 3PA5A 3TL8A 4YHTA 3ZZEA 1HCLA 3ENHA 2QURA 4OLIA 1OPKA 2C3JA 4RX7A 2OLCA 3LMHA 4XV3A 3NUPA 2O65A 2ZDTA 2R3QA 3FI4A 1H1WA 2QHMA 3Q04A 2VAGA 2W05A 4IZ7A 4LRJA 3QLGA 4ZS0A 5AR7A 4DN5A 4V01A 1YDTE 4AN2A 3JPVA 3DBCA 2ZV9A 5CAPA 3S0OA 3W0OA 5KBQA 2QU5A 1G3NA 3LCOA 5KX8A 3QX2A 3EN9A 4NJ3A 4KRDA 3SW4A 4AG8A 4ZOGA 1R0PA 4IAAA 1QMZA 5DFPA 2XIYA 1J1CA 1KE5A 1VYWA 3QZGA 4JL9A 5DR2A 5AR5A 3BWFA 4QMVA 5L6OA 3OXZA 1PXOA 3FWQA 4QPMA 3RTPA 4RFZA 3UYTA 4E20A 4YC6A 3FQHA 3W2SA 3KRRA 4D1ZA 2X4FA 1OPLA 4DCEA 4GK3A 2VTSA 4QPSA 1YW2A 2VWBA 4ZJVA 4S33A 2Z8CA 2PVKA 3KVXA 3LQ5A 4F9AA 4C3FA 4FTNA 5BV3A 3LJ2A 1ZLTA 5ANIA 3QUPA 2DS1A 4ITJA 2BIYA 3GB2A 1JQHA 5HCXA 4QMNA 3OCTA 4I3ZA 3QQHA 4YLKA 4YMJA 2QD9A 2AC5A 1OL1A 3W2QA 1ZYCA 4FICA 2P55A 4D2VA 4YTCA 4O0YA 4USFA 1PY5A 4ZJJA 4O0RA 4EH2A 2C1BA 4R1YA 3DS6A 1V0PA 3MA3A 4CV8A 4EL9A 2IZTA 4ACGA 4WA9A 3G2FA 4FZ7A 2QU6A 2R4BA 3LFAA 4DFLA 1OL5A 2ESMA 4FVQA 4XG6A 1IA9A 2PUNA 5FG8A 2H8HA 2VTMA 5DBXA 3FSFA 3FL4A 5HO7A 4MTAA 2X4ZA 5T68A 4F6SA 4EWHA 3RALA 3D5VA 3MY5A 1PXNA 3OW3A 4QMOA 3OCSA 4W4WA 4FIHA 4ZLYA 2ZV8A 3HAVA 5CXHA 2PVFA 2A0CX 2WQEA 4W4YA 3FMEA 3UP7A 3A62A 3KXHA 3W2PA 5I9YA 4GH2A 3K5VA 4H1JA 2ZDUA 2CNVA 2UW3A 5EYDA 3FC1X 3MJ2A 3QZIA 2ITZA 2X39A 1ZZ2A 4USDA 2YZAA 3W33A 2XS0A 3OXIA 4FV0A 3DZOA 5HG9A 4I92A 4CZUA 3RPSA 2LGCA 3IQ7A 3ORNA 3U8WA 4ZAUA 4FKLA 5JQ8A 1H00A 4CV9A 2PL0A 5IH4A 2PE2A 3MPMA 5I0BA 3CLYA 4NIFB 1ZOGA 4BGHA 3LMIA 1XH9A 1ZYSA 3AC5A 3PPKA 3L9LA 1Z9XA 3AC4A 2VN9A 3AT3A 1KE9A 1GJOA 3ZOSA 4E4MA 1ZRZA 5AMNA 2J4ZA 3V8WA 4GK2A 2R3PA 3GNIB 2PZ5A 2O5KA 4H58A 4QMLA 4E73A 4YHFA 3U55A 4FKSA 3TMOA 3PJCA 4JR7A 2VNWA 3VJNA 4BKYA 5LARA 4BTMA 4I94A 2C0TA 1Q61A 3D5WA 4X2NA 5HKMA 2WO6A 4ARKA 3ZEWA 1U46A 2ITXA 3I5ZA 4DGOA 3GU4A 4DBNA 2Y4IB 4NT4A 4PDSA 2PPQA 3RK9A 4BB4A 4BHNA 5EG3A 1CM8A 4JDJA 3ZDIA 3ZU7A 4ZZOA 3ET7A 3ZBXA 4DEDA 2XP2A 1HCKA 4FG9A 5DN3A 3TZMA 3MTLA 2JAMA 4FODA 4I41A 4JX3A 4RVTA 1GIIA 4YZMA 5CAUA 1R0EA 5CQWA 2UZBA 3UBDA 1XWSA 3NDMA 3BLAA 2VO3A 4RSSA 2CKQA 2R7IA 4D9TA 3KF7A 4KS8A 4YJQA 3HMPA 1VJYA 5EQEA 2GNJA 4QYEA 4IB0A 4FE2A 2VWUA 2FB8A 3GC7A 3L8PA 4QMPA 4W4VA 4OTFA 5CEOA 3DBQA 5BYYA 5KMMA 1PHKA 4OTDA 3RM7A 1JVPP 4I20A 4Z9LA 2W1ZA 3VC4A 5CU0A 1GIHA 3BU3A 3CEKA 4TTHB 3BU6A 3NNVA 2VWIA 5LVOA 3OG7A 2OIBA 1FINA 1Z57A 4AN9A 4APCA 4AW2A 4DG3E 4RWKA 3T9TA 4EH6A 3QTZA 2PZYA 4C36A 2VTQA 4Q9SA 4FSWA 2R3OA 1M2QA 3S1HA 4NL0A 4FZAB 3ZMMA 3ZUVA 3FXZA 4IWDA 1AGWA 5IISA 4EK8A 1OI9A 2GNHA 2BAQA 2A19B 3TTJA 4FSTA 3D5XA 3QCSA 2J2IB 5J95A 3VJOA 2QR8A 2GNFA 4IJPA 4AOIA 5IMXA 3UZTA 4RC2A 1IEPA 1J1BA 2B53A 2P2IA 4ZY5A 1BI8A 4YZDA 3PZEA 3RCJA 4C4HA 1YWRA 5CSHA 5HG7A 4C2WA 3R28A 4BDAA 2PVMA 3QCXA 3ROYA 4LG4A 3DOGA 3DAKA 3MDYA 5ETFA 5HD7A 4J96A 5BPYA 2HZIA 2E9PA 4KIPA 4FT3A 4ZSJA 5CEIA 3FI2A 5L2WA 4XRJA 5BQ0A 3EIDA 5E9EA 4FSYA 3U6HA 3ATTA 3QD4A 3HL7A 3G51A 4GW8A 3UP2A 4EH5A 2HIWA 4O7LA 4EUUA 4HPUE 2OJ9A 4U6RA 1B38A 5C4KA 3SRVB 4UX9A 1ZZLA 3LFQA 3DJ7A 4CCBA 4DHIB 2XRWA 3V04A 2P0CA 2R3FA 5ANDA 2EUFB 1NA7A 1PXLA 5J9ZA 3PIYA 5B0XA 4OTIA 5IQAA 5EH0A 2J0KA 2YABA 1YHVA 5GHVA 4LQMA 4E1ZA 3A8XA 4C4GA 3BGQA 4NUSA 2WQMA 4I6QA 2R64A 1CKIA 4WBBB 4NM5A 5JFXA 4O1PA 2VO6A 4RT7A 2JIUA 3QXOA 1BL6A 1W8CA 3REPA 2JITA 2Z7QA 3UIMA 1P2AA 3A8WA 4YZBA 5EK7A 5FXSA 1YXVA 5B2KA 1VEBA 3W16A 3HNGA 2JFLA 5HX6A 1Q97A 4J8MA 3E93A 5F1ZA 5FQDC 4MUQA 4DCAA 2O8YA 2XJ2A 4JBPA 4EC8A 2C68A 2PMOX 4O86A 2PY3A 4BIEA 4O1OA 4MCVA 1H25A 4D2PA 4PNKA 2V5QA 4KSQA 3D15A 4HGSA 4YTFA 2CPKE 3ACKA 4IBMA 4S34A 4ZXTA 3ETAA 1H01A 4XG4A 4FJVA 3L1SA 2E2BA 4O7NA 4M3QA 2YWVA 3VQUA 5L2SA 4FZDB 4KA3A 3BHYA 4L53A 5AP3A 5L8KA 3WF8A 2W17A 4QT1A 4J52A 4QP4A 3GP0A 3UC3A 5D11A 3IECA 4ERWA 5C03A 4LL0A 2Y4IC 3QXPA 2B9IA 3BX5A 5HX8A 3EFLA 4JIAA 3PVGA 2HW6A 3NCZA 1W0XC 3BLRA 3NW5A 2YITA 4UWYA 4XV1A 4AE6A 4ASXA 5AP6A 2BKKA 4EOPA 2F7XE 3UOLA 4CFMA 1PMVA 3F5XA 2CMWA 4QQJA 3MB6A 3VUGA 4C33A 3N4UA 5HNGA 5EQYA 3EN4A 3I6WA 4E5WA 4E4NA 5BVFA 3HV3A 3U6IA 4X2JA 1TZDA 3R04A 5IUIA 2WPAA 3WIKA 2P2HA 4D4SA 5C27A 5CSPA 3F3UA 2QCSA 1UNHA 1RE8A 3VONA 4DFUA 5AA8A 4JBVA 4JMQA 4I0RA 5HQ0A 3LCDA 4QEBA 4MXOA 4K8AA 1OUKA 3ORTA 4YP8A 4KIKB 4B9DA 4CT1A 4DFYA 2XCKA 4QP3A 2PVYA 2WMXA 5IUGA 5ANJA 1JOWB 4KAOA 4ALWA 1H1RA 2BR1A 2QOBA 3KXZA 2OO8X 2R3IA 4IQ6A 4LRKA 4BDFA 4TZRA 3O17A 1OMWA 3Q4UA 4FNZA 4WKQA 5AIRA 1Q3DA 5KUPA 4BIBA 1DI8A 2B7AA 2X7FA 4AP7A 3SHEA 3I60A 4BCHA 3O8TA 5AM7A 5CENA 2OG8A 3QTIA 3FLNC 4IX3A 2FO0A 5J7BA 4GKHA 4FTOA 4ZZMA 3RZBA 4O7ZA 3ITZA 2J6MA 3U6JA 4EHZA 2I1MA 3R71A 3A7JA 3W1FA 5H8GA 2H96A 4FKQA 3QD2B 4I4EA 1OITA 1XH6A 2FGIA 5KMIA 3SXFA 4A4XA 3PLAE 2BAJA 3UO6A 4C38A 2UZDA 3FMLA 3FYJX 2FYSA 5H8EA 5IDPA 4AZVA 3W32A 4ASZA 4QQCA 3LPBA 3O8PA 1YKRA 3N51A 4F65A 4QMXA 5M4IA 1JPAA 4NTSA 3EQRA 3IKAA 3P0MA 4Y73A 4PPAA 4EOIA 1YRPA 3NUUA 2J0IA 3Q6WA 4L3JA 1YOMA 4C4EA 4YBJA 4AGCA 4I5PA 4QP1A 5AR2A 3V5LA 2WTCA 4U81A 3VUDA 4DEIA 1UA2A 3GC0A 4FGRA 2V0DA 3C1XA 4X3JA 5FXQA 4CFXA 3OROA 3AGLA 3OTUA 5J1WA 3DNEA 4IANA 4F4PA 4F1MA 2X8IA 4O4DA 3PY1A 4ZY6A 3O7LB 1OIRA 2PUUA 4DT8A 4FSQA 1ZMWA 3PLSA 4MK0A 1MRVA 3W10A 4AZTA 4NYEA 3PFQA 4F7NA 4CKRA 3EKNA 3OZ6A 2GQGA 5CF8A 4YUQA 2IW9A 5HNIX 2ETMA 4IACA 1WBPA 2JEDA 2C4GA 3ULZA 3EOCA 2IPXA 5ITAA 5CASA 3KL8A 4CLJA 3NYXA 2IF8A 1OUYA 2X0GA 5EDQA 5BVNA 2W9FB 3OF0A 4FT0A 1Q62A 2F57A 3RAHA 3UC4A 4H3PA 4F0FA 4KKGA 2OJFE 1ZXEA 3ANRA 3DPKA 5BUJA 5A4QA 3GFEA 3A7HA 1WVWA 4ZK5A 1W84A 3PVUA 1Q24A 5HG8A 3DLSA 2J0MB 2OGVA 5T6KA 3CKXA 4DGGA 4PP7A 1ZARA 2UZVA 3C51A 3D7TB 3FY0A 3GBZA 4DH3A 3FEGA 2O64A 4MH7A 3DNDA 3KB7A 3EQIA 5C8MA 5HTIA 3UQCA 2WMWA 5K0XA 1QPDA 4UZDA 4B4LA 2XEYA 3FHIA 2E9VA 3VS5A 4L7FA 5KKRB 2IZRA 5FWKK 1STCE 4DYMA 5HLNA 1REKA 2ITTA 3FDNA 4IZ5A 2YAKA 3Q9XA 3RZFA 4EYJA 4K11A 4RZWA 3VO3A 4CKIA 1M14A 4GG5A 2Z7SA 5K5NA 3FPMA 4FG8A 4WNPA 5AA9A 5IPJA 4O83A 1PW2A 2VNYA 2Y6OA 5DVRA 2Y7JA 4RFMA 2YM3A 4C8BA 3UDBA 5CX9A 3AT2A 3WF7A 4L3PA 4YLJA 3COKA 2BALA 4GYIA 3WARA 1WBWA 1PMNA 2CN8A 2WQBA 2X7GA 3AMBA 5DI1A 3Q5IA 3ZSGA 3SG8A 4JR3A 3NGAA 3BLQA 2ITPA 4WD5A 5J9LA 4AOJA 4TWCA 3ID6C 3KULB 4PUZA 4DE4A 5HD4A 1ATPE 3E7VA 5HO6A 2EWAA 2GHLA 4QMTA 2YAAA 3LFBA 1VYZA 3F7ZA 4U40A 4BL1A 2J5EA 3F3VA 5BMSA 4P90A 4B0GA 3MIYA 4TN6A 3IW7A 3VBQA 3FI3A 2XK7A 5CZIA 5A4CA 3KK8A 3P78A 4LRMA 3P23A 1XMMA 3TV7A 5KZ0A 5LMAA 2W1FA 3IOKA 1Y8GA 3F82A 3AMAA 3R1YA 2W4JA 3EJ1A 1YOJA 3I1AA 4GT3A 4F6UA 4AW1A 1H24A 4I0TA 3KIOC 4IVBA 4TKSA 4XG3A 4MBJA 3KXXA 5L2TA 3LOKA 3SXSA 3KQ7A 5L3AA 2XKEA 4RWJA 3AC8A 3DGKA 3HYHA 4ZTHA 3MSSA 5I3RA 2WMQA 3FZTA 4AGWA 3GCUA 2ZB0A 1WZYA 3D2KA 4MXCA 4ZTNA 3MA6A 5A14A 2B4SB 3UZRA 3WILA 2PVJA 2C3LA 3DBFA 4NM7A 3A4PA 3EQPA 4YJOA 2YISA 3MV5A 5DRDA 3EQCA 3U9CA 3UOKA 4IVAA 2VWYA 3AMYA 2VWWA 5K9IA 2YM5A 2FSOX 4U9AA 4C37A 4AAAA 5L8JA 5E4HA 1FMOE 2YLEA 1H08A 4G6OA 4H39A 1ND4A 2WXVA 2IVSA 2XKDA 5E8YA 3SXRA 2UZOA 2QOQA 2ITUA 3I7BA 3OBGA 1B39A 3QBNA 3VHKA 3SLSA 4CEGA 4FTAA 4M67A 1PXMA 1SYKA 4KUJA 4ZEGA 1WBOA 4IDVA 4LGHA 1OGUA 4PV0A 4V0GB 4N6ZA 4QYFA 1YVJA 1Q8WA 3PE1A 5I9VA 3RPRA 1UVRA 5JN2A 4IAZA 4K2RA 3CY3A 5K4IA 4MD7E 4A7CA 5CF4A 2P3GX 5JT2A 2UZTA 3NPCA 5EQPA 3MIAA 4AN3A 1YOLA 2J7TA 4NU1A 3ZFYA 4M69B 2ITWA 4O82A 4RJ7A 3GU6A 2OBJA 2WU7A 4MXAA 4FEQA 4OT6A 2HCKA 4BWKA 4CFUA 2CNQA 3PG1A 4I6LA 4PPBA 4JBOA 4UBAA 3HECA 4D2TA 2XNGA 3TXOA 3G0EA 3F2RA 3DA6A 4HZSA 4F1TA 4IIRA 5ANOA 3T3VA 5LCJA 5LWNA 3R7VA 4FEVA 3OTVA 4FV1A 3ZXTA 4KRCA 1WMKA 5EHYA 5D10A 4UYNA 3HKOA 3FPQA 4CZTA 4Q9ZA 3G5DA 4FT7A 4XEYA 2JFMA 3I79A 4TYHA 5AAFA 5E8WA 3QZHA 1R39A 3BGZA 3HRCA 1PMEA 2FUMA 3ZUTA 3OHTA 2QR7A 3FV8A 2PUIA 4FUYA 3W8LA 4C0TA 4JVGA 4FIIA 3S2PA 4FTTA 5DT3A 1GZNA 3VNTA 3H10A 2WMVA 5ANGA 2YN8A 4R6VA 5HEZA 4IWQA 3DBDA 3GCPA 5KKRC 3PPJA 2EVAA 3ZS5A 2JKQA 2O2UA 4TT7A 3BYMA 3V6SA 3NCGA 4X0MA 4L9IA 4ASEA 3FUPA 1JSVA 5DHJA 2R3MA 4XRLA 3I4BA 4YZ9A 2I6LA 2QO9A 2RFEA 3PA4A 4R5YA 3V8TA 5IA2A 3UGCA 2Z02A 1OVEA 1QPCA 3MFRA 3JXWA 3VN9A 5JFSA 3C4XA 4GSBA 3WE8A 4AUAA 3CJFA 1G8SA 1Y57A 3KCKA 3E88A 3ZSIA 1KOAA 4E8AA 3TNQB 2JGZA 3UTOA 3UODA 3GU8A 3DZQA 4PF4A 3HA6A 4J98A 2GHMA 2GQRA 3FY2A 3ACJA 1W2CA 3FXWA 3VF8A 4FKUA 4ANQA 4JDIA 2VTTA 5JGDA 4DF3A 4EK3A 2EXEA 4RWLA 3UDZA 5FXRA 3ZRLA 4GJ3A 1U4DA 2HENA 3R73A 3SV0A 2RIOA 4RLLA 4R77A 3JYAA 5CF6A 5LXMA 4DLJA 3W55A 5AFVA 4I4FA 3IONA 3K3IA 3RHXA 1TQPA 3MW1A 5LVPA 2VO0A 4F1OA 5JMSA 4IZAA 1TQIA 4M0YA 4O0WA 2I7QA 2C0OA 1GOLA 2HY0A 3K54A 3ZRMA 4JQEA 5DR6A 3RAWA 1V1KA 3I6UA 3NWWA 4HOKA 5AWMA 3Q4ZA 5BNJA 3C5UA 5ANKA 3BQCA 3ZTXA 2FSLX 4O4EA 3FLWA 3VBYA 3FMMA 5I9XA 4TYEA 2ITQA 4FEXA 4N57A 2ZAZA 2C30A 2I40A 4IW0A 4O7WA 2X9FA 4LM5A 2JDTA 1NVRA 4JAJA 3EMGA 4AU8A 4R7IA 3NX8A 4AQKA 4TYHB 4F7JA 1JKKA 1G8JA 5F9EA 4HGEA 4E6QA 4J7BA 4CQEA 3FMKA 4FKRA 5DOSA 5TE0A 5IKWA 4CLIA 2R3RA 1WBSA 2GNLA 4LGDA 1CKJA 5LQFA 1J7UA 3O71A 3UOJA 4TNDA 1XH8A 2RF9A 5FM2A 2Z7LA 1APME 3TKUA 2PVHA 2X7OA 4A4OA 3SW7A 3NRMA 2VGOA 2XNBA 4ZLOA 1TFFA 4ZP5A 3KMUA 4GV1A 4FOCA 2A2AA 1ZMUA 4QQ5A 1Y6AA 2C6DA 2QNJA 1KV2A 2PWLA 4JBQA 4O0TA 5CU6A 5AUTA 2XB7A 3ZH8A 4Y8DA 3TZ7A 1YXTA 2PSQA 2JD5A 4IAIA 4M84A 4AW0A 4DEGA 3FYKX 3F61A 3S4QA 5B2LA 3MB7A 2QI8A 4PTGA 1GY3A 4HPTE 4RRVA 4YJRA 1NVQA 2UVZA 2JKKA 3LAUA 3FHRA 4QMMA 3E8EA 4DEBA 1PXIA 4HNFA 2OWBA 3ZUUA 3WIGA 3PXZA 1WAKA 4MD9E 5EOLA 3HP5A 1SNUA 4C59A 4DFZE 4EBWA 2WD1A 2PE0A 1WBVA 1T46A 3Q3BA 3SDJA 2CKPA 4D58A 4TNBA 4I24A 4BTKA 2HXQA 5CEKA 4IWPA 4O6EA 3Q52A 4AS0A 3IW8A 4FMQA 4L67A 4TWPA 3FKLA 2REIA 3FMHA 2BILB 2GCDA 3PVBA 5EYCA 1ZOEA 4AXFA 5E8TA 2GNIA 2OXXA 2VTIA 4Y72A 4R78A 4XMOA 3U4UA 3LXNA 2GFCA 3RMFA 2R3NA 1IASA 1P4OA 1ZMVA 3UNZA 3VRZA 3ZHPC 3CXWA 4O4BB 3RPVA 3LE6A 4FTUA 2HAKA 3Q2JA 3QCYA 5M57A 1YQJA 4BDKA 4NKSA 2HXLA 1IAHA 2JLDA 3HMOA 4R7HA 1OPJA 5AR3A 4FK6A 4Z16A 4EOJA 2JDOA 3JR1A 2BUJA 3C0HA 3DJ5A 1H28A 4L43A 4FTKA 2F2UA 3QUDA 4K0YA 2BRMA 5CNNA 4AGUA 3UPZA 2BFXA 3BCEA