4DN5A

Crystal structure of nf-kb-inducing kinase (nik)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
344
structure length
331
Chain Sequence
SVEEYLVHALQGSVSSGQAHSLTSLAKTWAARGSRSREPSPKTEDNEGVLLTEKLKPVDYEYREEVHWATHQLRLGRGSFGEVHRMEDKQTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLVKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVCLQIPGTETHMAPEVVLGRSCDAKVDVWSSCCMMLHMLNGCHPWTQFFRGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPIHRVSAAELGGKVNRALQQVGGLKSPWRGEYKEPRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mitogen-activated protein kinase kinase kinase 14
publication title Structure of Nuclear Factor Kappa B-inducing kinase domain reveals a constitutively active conformation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 106
structure length 331
sequence length 344
chains with identical sequence B
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dn5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dn5A01
1FVRA 2XK8A 4NM7A 3MYGA 5CZIA 4ZTRA 3I6UA 5M09A 4EORA 2VO7A 3N4UA 2QONA 5AV4A 1Q8ZA 4HGLA 5A6NA 3QYZA 5BVFA 3N4VA 4EBWA 4DINA 2FH9A 3FSFA 4H36A 3UG2A 4UMTA 4ANLA 1F3MC 3KRJA 4L45A 5IQDA 4V0GB 3EN9A 4O1OA 3W55A 4TW9A 3EFKA 5HKMA 2QKWB 3C13A 4HPUE 3RVGA 2R3LA 5LVOA 2ONLC 3I0OA 5CU2A 4QYGA 4D1ZA 4OBPA 3ZZEA 1GZKA 2P55A 5HHWA 2OH4A 3CJGA 5G6VA 4FNXA 5H2UA 4J53A 3WILA 4CCUA 1WVWA 4BBFA 4BIBA 2XZSA 5FQDC 2OXXA 2W0JA 4ZZMA 3R9OA 3RM6A 4QTEA 3ORZA 2J5FA 3R7OA 1UKIA 4C2VA 1XJDA 2WMTA 2WD1A 4ZJJA 2C4GA 3QBNA 3D15A 3LJ2A 4IJ9A 3HRCA 3OTUA 2ITWA 4CZYB 4YTFA 4F0IA 2Y4IB 4AGWA 4GIHA 4W8EA 2ZM4A 4ZZNA 2HW7A 3QTZA 4NZWB 2I1MA 2Q0BA 2WMAA 1H4LA 5EYKA 4I6QA 1WBPA 2XUUA 5HGIA 3ORIA 5M44A 1OL5A 3TI1A 2ITYA 4U0IA 4RQVA 3ORXA 4F9CA 3W16A 5LQFA 5FXQA 5BVNA 2XS0A 2BMCA 3QA0A 1ZMVA 2CJMA 3SRVA 2JITA 4NJ3A 3OCBA 2VTHA 5ETIA 4I5HA 4I3ZA 2C1AA 3RPVA 3P4KA 2IVVA 4KSQA 3QHRA 3VS0A 4BDKA 4KINA 4KRDA 4HGTA 4KIPA 5A4LA 1CKIA 4CFXA 4O7NA 1Z5MA 3PPZA 3SC1A 2C3JA 2X7OA 3G51A 4YJOA 4ORKA 4FZ7A 4U43A 4JX3A 1YKRA 1GZNA 3TL8A 1PXIA 4L9IA 3EL7A 4OTDA 2QOOA 3GC0A 2Y6MA 3LXLA 4RT7A 4XCUA 4EL9A 3PDTA 4D0XA 3RALA 4CQEA 4BCQA 1LP4A 2R3IA 4TL0A 5LXMA 5CWZA 2P33A 2RG6A 3P7AA 3K3JA 4FTJA 4OUCA 4FKOA 3FMHA 3ZDIA 4EHZA 4FKJA 2QOCA 4BTKA 3BYMA 4D55A 3KRWA 4HYUA 4J71A 4O2PA 4QYYA 5AP1A 4EOLA 3DDQA 4I21A 4APPA 3DTCA 5C4KA 5H3QA 2YABA 4I92A 5BQ0A 3GU8A 2BKKA 1WCCA 2VO6A 2C0IA 4YTIA 5CENA 2HY0A 5AP6A 1YWVA 3LJ0A 2YCSA 3BYVA 3W33A 2QLUA 3ZYAA 3EQGA 4FV4A 5D9HA 3RZFA 4PDPA 4QYFA 5AR2A 2GQGA 3NLBA 3V01A 3O51A 1U4DA 3V5PA 2PE2A 3LFDA 2UVYA 4Y5QA 2YACA 4D2WA 3DKCA 5A4TA 5LVNA 2WTKB 3FEGA 3JPVA 4DC2A 4RVMA 3VBVA 4OT6A 4X3FA 5IQIA 2J0IA 3PJCA 3PA5A 1OKVA 5EOBA 4QQ5A 3VQUA 4ONAA 3BLHA 1WVXA 3TUDA 4CT1A 3KFAA 4IZ7A 4QP1A 4DCAA 5EI8A 2IZRA 3ANRA 3D5UA 3DBFA 4I22A 4PL4A 3FKNA 2JKQA 2PMOX 2WTIA 4B0GA 4BBEA 4NCTA 4AN3A 4NKAA 4FVRA 4O0YA 3P5KA 4O7WA 4I41A 2VGOA 3E3PA 3DV3A 4Q5EA 4F65A 2P0CA 5AA8A 4FT5A 5GJFA 4XV1A 3PRIA 4Y72A 4Y73A 4EH3A 4O0TA 5IG1A 3IGOA 2PVRA 4IVDA 4ZTSA 3W8QA 3TUCA 4GT5A 3LXNA 4L43A 2XKFA 3EL8A 3OD6X 4ZMFA 2NP8A 5H9BA 3R22A 4FTOA 4O7LA 2F2UA 4M69B 3RHXA 2YM3A 1UU7A 4AE9A 4R78A 2VU3A 5CF5A 5T3QA 4AN9A 3ZZWA 4I5PA 2WZJA 3EQBA 5ITAA 4GW8A 3RK7A 2BCJA 2JKMA 4DFNA 4A9SA 3R8LA 3WZDA 3VJOA 4PF4A 4TYHA 1YXXA 2QODA 2W17A 3NYXA 2BDJA 4I6BA 3G0FA 2JAVA 3C5UA 3E88A 5EM7A 2CGUA 3TNPC 4EK5A 3F3TA 4FV9A 3R9NA 4KB8A 3DBCA 1ZYSA 2F7EE 2Z60A 3WE8A 3ZUVA 3H0YA 4NKSA 5DRBA 2YLFA 4AS0A 2UZLA 1NA7A 2XKEA 4M66A 3HV4A 4X21A 4E20A 4BKYA 5I5ZA 5KNJA 5ACKA 2HIWA 2F7XE 2J9MA 5J7HA 2VD5A 4TKSA 3DNDA 3VUIA 3RPOA 4TPTA 2E2BA 2JKKA 4FUYA 4C2WA 3V8TA 2X6EA 1MUOA 2EXEA 2QR8A 3BBTB 2YM4A 4GT4A 5GIOE 3QRUA 4QMNA 2R7BA 3LPBA 5AR8A 2DUVA 3KCKA 4AFJA 4DT9A 2WFYA 2OJJA 4UYNA 2X2MA 2WU6A 4UB7A 3AT2A 2O3PA 1SVEA 2WHBA 3KRRA 4F99A 5E92A 4EQMA 4FSTA 4QPSA 5E8XA 4GKIA 3MVLA 4V05A 5DR9A 5CAUA 4BZOA 2YM7A 3V51A 5A46A 3NVKI 4KRCA 4LV5A 3D5WA 4WNKA 2JIIA 4C4EA 5IQHA 1UVRA 1SM2A 2O5KA 4FV1A 4RSSA 4U40A 4V0GA 2DS1A 4AA0A 5J1WA 2F4JA 3ZMMA 3BV2A 5IA1A 1PYXA 4PRJA 4L01A 1E1VA 4TYIA 5E7RA 5CS6A 4ITHA 4A7CA 3GUBA 3A7JA 2J2IB 2QR7A 3BHHA 3VBWA 3BZ3A 1BKXA 2AC5A 3E8CA 1YXVA 4QMMA 1IASA 4JDHA 2C6DA 2WAJA 4H3PA 4LFIA 3D94A 1JSTA 1QPDA 2PY3A 3QZHA 4UWBA 3V3VA 2QO9A 4TWCA 5HU3A 1QPCA 2YWVA 4ZY4A 3NAYA 3LQ5A 4FIGA 4R3RA 1YRPA 3A62A 3QLGA 4IAYA 2EB2A 3U54A 1L3RE 4BZDA 5TOZA 5JFWA 2HZ0A 4JX7A 2QOIA 3D5XA 5EHYA 2X8IA 2VZ6A 4USFA 4IAZA 2VWBA 3RNIA 4FYOA 3VS7A 4IDVA 5BYZA 4DFBA 1LUFA 4FG7A 5E8YA 1KE6A 3QTUA 4XBUA 1CMKE 3SXRA 3W2OA 1YW2A 3QA8A 3VIDA 3FZRA 3ZSIA 3IPHA 3JXWA 4GUEA 2BROA 2GHLA 4FTKA 2WTVA 4R7IA 2I7QA 4U5JA 1YDRE 4QP9A 4QMWA 3HX4A 2NNWB 3QQKA 3BKBA 3TZ8A 2CKPA 2JBPA 3PJ3A 5HOAA 2C5VA 3IG7A 3UOLA 4QMUA 3VBXA 1WFCA 5AP4A 3F88A 3VO3A 3PA4A 4A9UA 5HCXA 1OMWA 4PMSA 5FLFA 3KVXA 4GJ2A 4DTBA 3UJGA 4TTHB 1H26A 2LAVA 1KE9A 4BFMA 4QP3A 1Q62A 4OTWA 2PVMA 3L8PA 3OW4A 3W2SA 4D1XA 3AMAA 5L2TA 3NW6A 4E4MA 4FV5A 4KKGA 3I4BA 1OI9A 3ACKA 5HQ0A 5CVHA 3EJ1A 3VQHA 4RBLA 2W9ZB 4EZ5A 3LFCA 3KXZA 4L7SA 4F1TA 3UNJA 4FT3A 1MQ4A 4JAJA 4WUAA 1KWPA 1DI9A 5FDXA 3UO6A 4R77A 1OPKA 4DAWA 4X2JA 4ZP5A 4E26A 4EKLA 5A4EA 1WZYA 2IVSA 1OBDA 3E8DA 3VUTA 2WMXA 4AN2A 2ITPA 5B2MA 3ZU7A 4FIEA 1IAJA 4EH7A 4J95A 3G2FA 4YMJA 1GZ8A 2JDTA 4AT5A 4DN5A 2BRNA 4J97A 3UNKA 5CLPA 3D2IA 1Q8YA 3NPCA 5JZNA 4FKVA 5HG9A 4EH9A 1OM1A 2CNVA 3NWWA 3I1AA 2Q83A 3A4PA 3ANQA 4YZMA 3H9FA 5C8KA 4RFYA 1Q8TA 3FWQA 4NJDA 4AFEA 5J7BA 4ZTQA 3H9OA 2XBAA 2J4ZA 3MY0A 3GGFA 3FKOA 5E8UA 2WMQA 5I9XA 5JSMA 4FTQA 1WBOA 4JR3A 5ANOA 4AF3A 3S2PA 4MHAA 4NSTA 5IDPA 3D4QA 5KKRB 5HZNA 2UVXA 3DFCB 3F2AA 3OCGA 4TN6A 2OXYA 5TKDA 4CMUA 4O7SA 3W8LA 1LPUA 5A54A 3P79A 3R8VA 3G90X 4RWJA 3Q60A 4CTCA 3KB7A 4RMZA 4BHNA 4BGQA 4MF1A 4AUAA 4YLJA 4IVBA 2IVTA 3GXLA 1L8TA 3OFMA 4IM3A 3RK9A 3SX9A 4Z7GA 4JQEA 4GS6A 2ITNA 3WIKA 5EHLA 1RW8A 3C9WA 4ZS0A 4A07A 3DK6A 4H58A 4O7RA 3ENHA 4ZTLA 4EZ7A 5DIAA 4QYEA 3DNEA 3PJ1A 4O7VA 2BIYA 4ANSA 4BN1A 3RM7A 1I09A 5JGBA 3TG1A 4NFNA 2VTIA 2Y6OA 5AP2A 3W2PA 4AA5A 2QURA 4HCVA 3HV3A 3I5ZA 4OTFA 1IA8A 3OC1A 4FG9A 3LQ8A 2VTQA 5IQEA 4M69A 1IAHA 4EOPA 1VYWA 4RX7A 2JDOA 1TQMA 2X1NA 5E1EA 2PUNA 1O6LA 3CEKA 2ETRA 4FKGA 2QKRA 3CQEA 3KKVA 4FL1A 4FVQA 5EK7A 4E73A 2YAAA 3Q9WA 2DYLA 3KXXA 4FT9A 3AT3A 4CMTA 4EBVA 2ZV2A 4MBIA 3NZ0A 3W10A 1G8SA 4IAFA 4RGJA 1G8AA 3DDPA 5EDRA 2W96B 3IW8A 4O38A 2ZM1A 2W5BA 3ROCA 3UVPA 4ACDA 3SDJA 4U42A 2PVLA 2VTRA 3C51A 3G33A 4PP7A 3PY1A 2VTJA 4UMPA 4HCTA 1LEZA 3MH0A 4MTAA 3VC4A 2XP2A 1VEBA 2J6MA 4WNOA 2OI4X 5CY3A 3NVMB 2GTMA 2C6OA 3DB6A 3RWPA 3UQCA 1Q3DA 3RAWA 1PXKA 4FC0A 2JBOA 2PTKA 4G2FA 2QLQA 4IZYA 4LYNA 3LMGA 2VTLA 5I4NA 3GCQA 3GVUA 5TE0A 1PKGA 1Q97A 3TKIA 2XJ0A 4D58A 2OG8A 3OCTA 4FBXA 4MD8E 2IN6A 3ZONA 1I44A 3E62A 5IMEA 5JMSA 3HAVA 4BI2A 5DRDA 2W1HA 2X8EA 5C27A 4Z3VA 5CASA 2GNJA 1OIQA 3DKFA 4EJNA 1W98A 3QD2B 2B9IA 3TTIA 4GG5A 5A4QA 1NT2A 5HVJA 4AZTA 3EZVA 4YZCA 5KBRA 2QHMA 4OTPA 4BCIA 1REJA 3OOMA 1Y91A 1U5RA 4OT5A 2A27A 3DLZA 2B4SB 2VX1A 3UZTA 1ATPE 4CZTA 3OZ6A 3VVHA 4D1SA 4FZ6A 3PSCA 3NNUA 5C9CA 4P7EA 5CEPA 2PPQA 3ZLSA 5M08A 3ODZX 4FSUA 4O21A 4ITJA 2VWWA 4YO4A 2E9VA 3K5VA 2ITUA 5JZJA 2X81A 4IM2A 3UTOA 4DGLC 4BDBA 5DYJA 2F9GA 3EQDA 1R3CA 4E6AA 2C0TA 5K0XA 2H34A 4XP0A 5F94A 4D2PA 4HVIA 3C0HA 2FO0A 3T9IA 2J51A 4KIQA 2B53A 4CQGA 5CSXA 4KNBA 2QOKA 3GFWA 3PSBA 4JQ7A 3WOWA 4ANOA 4M84A 1JKLA 2JDVA 2X9EA 4ITIA 3EKNA 4ARKA 4XS2A 3R00A 4QMYA 5AR4A 1PXPA 4QD6A 4GIIA 3PXZA 5CNNA 5CSPA 3LZBA 3PPJA 3TCPA 4V04A 4WD5A 5AV3A 3V8WA 2UW6A 4G17A 1GIIA 4GVAA 4ZSGA 3RPRA 2R0IA 3GOPA 1Q4LA 2VAGA 2BRMA 4JT3A 5E1SA 2IVUA 4FK6A 3WE4A 4HNFA 4F9YA 2ZOQA 1YOLA 5LVLA 4DG2E 5KO1A 4MNEB 4H1JA 3GENA 3UMWA 3EMGA 2XEYA 4Q2AA 4M0ZA 5CI6A 3E64A 1OIYA 4FSQA 4RJ6A 2HZIA 4C3PA 5HU9A 3I6WA 1AD5A 3MB7A 3LCDA 4FVPA 4NYEA 4CMOA 5FEQA 5AV0A 3BHTA 4FL2A 3I7CA 2XJ1A 2RL5A 2VTMA 4M67A 4ENYA 2WQOA 5HVYA 4ZSAA 3NUPA 3DJ6A 4ZJVA 1CKJA 4USEA 4ZMEA 1K3AA 3M1SA 5AR3A 2E9UA 3Q53A 4F9BA 4ZY5A 2F2CB 5JQ8A 4D4VA 4HYHA 4NT4A 4WG3A 4CYIA 4RX8A 4FE2A 2ITZA 2EU9A 2W7XA 3L9PA 4BWKA 2I0YA 3MPAA 3VUKA 4E6CA 4L00A 1OUYA 3QZIA 4MBJA 4QMXA 4JDJA 5LMKA 4BKJA 1ZMWA 3HV5A 4C59A 3QL8A 2RKUA 2HY81 2CDZA 3PUPA 5BMMA 2AUHA 5CX9A 2OIDA 3ALNA 3Q4UA 4TY1A 3MFRA 3R71A 3UVQA 3K5UA 3PZEA 4LMUA 4KSPA 3LQ3A 4FKSA 5CALA 3KREA 3QXOA 1OZ1A 3G9LX 4YSMA 3RK5A 2G2FA 4XH6A 4R8QA 2XRUA 3CPBA 4YJTA 1KSWA 4WO5A 5LCKA 4UN0C 4GSBA 5IQGA 2G2IA 4WBOA 4XBRA 1Y8YA 2R3QA 2RFEA 2RIOA 3UOJA 5CYIA 1CTPE 3ZUUA 2RGPA 4MXOA 3QC4A 4EOKA 4BKZA 3ERKA 5AV2A 2V55A 4EOSA 5TT7A 5HE2A 4RJ8A 3DQXA 4D2TA 1IEPA 3LFBA 1JSUA 5HTBA 3VN9A 4DE4A 3LM5A 5CU0A 4ZK5A 2PHKA 3EB0A 4HVDA 3VUMA 2PVHA 3ZM4A 5CXHA 1EH4A 3E7VA 3G6GA 5KE0A 4C37A 5IEVA 2PE0A 4QMZA 3SW7A 4JAIA 2DWBA 2X4ZA 3EQHA 3FYJX 4FZDB 1MP8A 4DCEA 4MXAA 3TNQB 4K33A 4BYJA 2QQ7A 3DU8A 3ORMA 4XRJA 3E3BX 1Y6BA 3HGKA 3IW4A 4BF2A 1UA2A 4YTHA 4DH7A 4YTCA 1A48A 4C7TA 1KV1A 1Q8WA 3P7CA 4F7SA 3DOGA 4RZVA 4QYHA 4ENXA 2O64A 3HMOA 4G6OA 4DLIA 1NVRA 1IRKA 3D0EA 3WBLA 3CD8A 4V01A 4XLIA 2C0OA 4IH8A 3RI1A 4CD0A 3CKXA 4K11A 5J5SA 2REIA 3SG8A 4CSVA 3BU6A 3R8UA 3IW7A 3R1SA 3FXXA 1FGKA 4E6DA 4RVTA 1H01A 4U3ZA 3FLWA 2YZAA 5D11A 5AM6A 3PWYA 4D9TA 2WTJA 1H07A 4ERWA 4K0YA 3Q4ZA 4R7BA 5H8BA 3MPTA 4LUEA 3DJ5A 3DK7A 4FTRA 3LXKA 3QCYA 2YFXA 2F57A 3EQFA 2ZYBA 1JPAA 4RC2A 3W18A 5A3XA 1VR2A 2VWUA 3QGYA 3P0MA 4DHFA 3PVGA 3I5NA 4HVGA 4BCHA 3DPKA 4FSYA 1Z9XA 5I9ZA 2IZTA 3DB8A 4DGGA 4F09A 2NPQA 3KC3A 2XIKA 1H25A 2QNJA 2BAQA 2XNOA 3CTQA 4DGNA 5K4JA 4NL0A 3HLLA 1ZYJA 5ICPA 5KHXA 5LVMA 3A7GA 4U79A 3RBWA 4GT3A 3FPMA 4A9RA 5IA4A 3UQGA 2KTYA 4PDOA 5CI7A 3E8NA 4JI9A 2VRXA 2W4JA 2OIQA 3TN8A 1URWA 3NUUA 2R3RA 2WPAA 4F6WA 3N4TA 4UALA 3I79A 4JBQA 4HJOA 1GY3A 1PJKA 1R0EA 3PVUA 3UP7A 3IS5A 5JT2A 2WMWA 3ZS5A 1JLUE 4IACA 4F0GA 5HX8A 3U6JA 2NRYA 2OFVA 5AUWA 2J0JA 3IO7A 4NH1A 4ALUA 5GNKA 4D0WA 5EQPA 3NAXA 3ZO1A 3QQGA 4BWPA 3MVHA 2IW9A 2YJSA 3M11A 4EH2A 4F70A 5M4CA 4BCKA 1J3HA 4ASZA 2CGXA 4N70A 1TQPA 4BTFA 3KXMA 3KMMA 4J8MA 4QQTA 5JKGA 4UMQA 3KRXA 5TR6A 3LXPA 4KBKA 5HIDA 3UIMA 3SGCA 4FV3A 4L52A 3R02A 5HESA 4FT7A 4GK4A 2GNGA 3JVRA 1XO2B 4A9YA 2BIKB 4K6ZA 3Q52A 3DXPA 2VO0A 2XNNA 3BELA 2WTWA 1CKPA 1H1RA 4DEEA 3E7OA 3R7VA 3SOCA 4GJ3A 3MTLA 2C5XA 3ZLYA 3BE9A 5EQEA 1WBNA 2GFSA 2W1ZA 4RC3A 5IA2A 4DITA 1YI3A 5ACBC 4M13A 1URCA 5AMNA 4A06A 3EYGA 1A06A 2HCKA 2VO3A 3UE4A 4NEUA 3V5QA 5GHVA 3CQWA 5L6PA 4ZLYA 3AGMA 3TDWA 3FI3A 4I94A 1ZARA 4FTIA 3ULIA 4J7BA 3FI4A 4YNEA 3ODYX 4RLLA 3R9HA 3QX2A 1OIUA 4E93A 2ZV7A 3B2WA 4AOJA 4D2RA 4E5WA 1YXSA 4QRCA 1UKHA 4FIJA 4O0VA 4QP8A 4BDHA 5IQBA 3UBDA 5CU4A 5AA9A 4O0RA 3AGLA 4EUTA 3TWJA 4XRLA 3EZRA 3B2TA 5HNIX 2R0UA 3DXNA 3LMHA 1XH7A 5J9ZA 1R0PA 4YR8A 1UNHA 3ORPA 4PTCA 3RCDA 5FP5A 5A9UA 2XIYA 5C1QB 2XKCA 5IZFA 3BEAA 3BBWA 3CC6A 5JRQA 4ASXA 4MNEA 5IQCA 3F7ZA 4IWDA 3U8WA 4ACHA 3TJDA 3MH2A 4G16A 3S4QA 4PPCA 4GU9A 5FRIA 4TWOA 4UMUA 3H30A 4BCNA 4KBCA 1KOAA 1JWHA 1ZRZA 5J8IA 2J0MB 2X7FA 4B7TA 4YZNA 4MAOA 5ANEA 4B9DA 5EYDA 5L6OA 2PVYA 4F4PA 5AIKA 5J9YA 5D7VA 4WRGA 3NX8A 2C3KA 5LVPA 3IOPA 4K1BA 3UO5A 3EQRA 4UMRA 5KMNA 4BCPA 4KKEA 4DGOA 4ASEA 2VWZA 2W05A 1CDKA 3OT8A 4YSJA 2ESMA 3LVPA 3NYOA 2Z8CA 3KA0A 3VULA 4QMOA 1XQZA 2YAKA 1Q61A 3FMNA 1T46A 4FR4A 3UP2A 5IF1A 5LJJA 4DH1A 2B9HA 1NXKA 2A2AA 3BGQA 3HMIA 3DT1A 4GH2A 3D14A 3DKOA 4QP2A 1ZZ2A 2YDIA 4J99A 3FL5A 3JS2A 2G01A 2F7ZE 1H1PA 2BHHA 4TWPA 3QQUA 3FMJA 3DA6A 1UNLA 3R1NA 3MTFA 1VZOA 1PMVA 2CKOA 4UZDA 2R3GA 4HGEA 3OEZA 4IM0A 5E9EA 2IZUA 3FXWA 5JRSA 4YZ9A 2XK6A 3MY5A 4ALVA 5AAGA 5F4NA 4GKHA 4DTKA 4G9RA 2ERKA 2CGWA 5C8MA 4O84A 2P2HA 4F64A 4ZZOA 2X0GA 4O86A 2XMYA 5DG5A 3QLFA 3HL7A 2KULA 3D2KA 3H4JA 1KE5A 5FTGA 4UXLA 3V5JA 3FZSA 3WF7A 2C6EA 4Z16A 4FNWA 4BDDA 4RJ5A 3RMFA 4A9TA 1DM2A 4WG4A 3VUHA 1GAGA 3RCJA 3BQRA 2I0EA 5FP6A 3VW6A 4DEAA 4X6RA 1FMOE 4H05A 2QC6A 4BTJA 5EG3A 2XYUA 4IB1A 2V7AA 1ZMUA 2ONLA 4FEQA 2X9FA 2GMXA 4B8MA 5T6KA 5D41A 5HBEA 2PVJA 4FKQA 4PPAA 4RPVA 3GB2A 4Y95A 5FM2A 3BGPA 5HNGA 2JDRA 2X2KA 4EOIA 4XG4A 3KULB 2PL0A 3ENMA 5CAVA 3D9VA 3UIUA 4EOQA 5L2SA 3BGZA 5AAFA 4EH5A 3WF6A 2XCKA 3HMMA 1STCE 2I6LA 2PUUA 4CT2A 4G5JA 4JDIA 3UOKA 5LOHA 3ZFMA 2ACXA 3U9CA 4R5SA 5KX8A 2CNQA 4E1ZA 5BX0A 5L6WL 3TT0A 2ZV8A 3NEWA 1B39A 1XH6A 3NRMA 4JDKA 1F0QA 4UWYA 5HBHA 3S1HA 1M17A 5L2QA 2FSLX 4A4XA 3UZPA 3PG1A 4DH3A 3Q9YA 4CFFA 4O22A 3EH9A 3R21A 4ZSJA 2JEDA 3BQCA 3GOKA 4YHTA 4JBVA 5FDPA 2R3MA 2UW4A 3MBLA 2CLXA 1QMZA 3LW0A 4LG4A 3O50A 3AD4A 2X39A 4EYMA 5CAOA 3IOKA 4E4NA 3W1FA 2LGCA 3MVMA 3R6XA 4NU1A 3MVJA 3CD3A 4O6LA 5HLWA 4YJSA 5FG8A 2VV9A 3V6RA 3W2QA 4DA5A 4MYGA 5T68A 3PP0A 4QMPA 3A8WA 4K8AA 2FYSA 1U59A 4DGMA 4L68A 4AZSA 2YIYA 4E6QA 3FUPA 2WNTA 2XJ2A 3VS5A 1U5QA 2UZNA 3E5AA 2BUJA 1IA9A 4UYAA 3SOAA 3ROYA 3FYKX 2BRBA 4NM3A 5B2LA 4MQ1A 1OITA 2CHLA 2JKOA 5DEYA 5IA5A 5F9EA 2WOTA 2Z02A 5IA0A 3F5GA 1OL1A 4O6EA 3KQ7A 5HG7A 3OUNB 3T3UA 5FEDA 5FTQA 3UC4A 3FV8A 4AW5A 5C4LA 1WMKA 2W1FA 2PVFA 5I9YA 1IR3A 1Q99A 2QU6A 3LLAA 5IQAA 3WZEA 3QU0A 4J98A 3UDBA 5IDNA 3AMYA 2GHGA 4H1MA 2UZVA 4BDIA 1PRYA 4GYGA 2JIVA 2CMWA 3FLQA 3NCZA 5J9LA 1W0XC 1S9IA 2VTNA 4JQ8A 3HDNA 4U8ZA 3MI9A 3UMXA 3RPYA 3ZEWA 3AD6A 2OXDA 4CFUA 2V7OA 2JD5A 4IW0A 2SRCA 1ZAOA 4XP2A 5CQWA 2GDOA 2YIQA 3P9JA 3UG1A 4BCMA 1Q3WA 5K4IA 3TIYA 3F5XA 3JY9A 3ZRLA 3TUBA 5GZAA 4RA5A 3SXSA 2O8YA 5IH5A 4ZAUA 4LOOA 2QG5A 2YEXA 2BZHB 2OZAB 1RQQA 3ZHPC 4A4OA 1PW2A 3AG9A 3CBLA 1WBTA 4JS8A 3GC8A 4AW2A 5I9WA 2W4KA 1QPJA 3DBDA 3L9NA 5M07A 1H1SA 2RFSA 4BY9E 4O7TA 3ZXZA 2PWLA 2O63A 1UNGA 4M7IA 4WT6A 5CZHA 1R1WA 2B52A 1J91A 4RJ3A 3VJNA 5DR2A 4F08A 3QX4A 3FMDA 3PIYA 3MB6A 4FSMA 5EW8A 4EK3A 2QI8A 2W4OA 3KXHA 2NRUA 2PE1A 3R73A 4CKRA 3R7GA 3FMLA 4IDTA 1E1XA 3DLSA 4XMOA 3U87A 5EM5A 3KMWA 3KN6A 5L2IA 4UXQA 4D4RA 4DFXE 3F2RA 2C3IB 3F3ZA 3NIEA 3O8UA 4TZRA 5EDQA 3TZ9A 3UGCA 3UIBA 2ZM3A 5AP5A 1WBWA 1OUKA 3N9XA 2BALA 3IECA 2R9SA 3L1SA 3QUEA 4BCJA 1CM8A 4K18A 3HP5A 2IWIA 3LHJA 4QO9A 4XG7A 1JBPE 4LL0A 5M56A 3CS9A 3LFSA 2VGPA 1M52A 2O65A 3MJ2A 5G1XA 3AQVA 3SLSA 3O17A 1BYGA 2HZNA 2WELA 4IVCA 4QTBA 4ZJIA 2E9PA 3FMMA 3QZGA 3CQUA 4YNOA 4GVJA 3MDYA 3HECA 3NUSA 3Q9XA 2FVDA 2XCHA 5HORA 1M7NA 2R4BA 2W1EA 3PP1A 2OIBA 1YXUA 3F3UA 4BYIA 1ND4A 4D2VA 4BGHA 3IKAA 3C50A 2XNGA 4PNIA 2PUIA 2OJ9A 4MXZA 2YIWA 3BHVA 3EN7A 2VWIA 4AZEA 4RX5A 4OTHA 4MWIA 1KV2A 3L9LA 3LCOA 4RWIA 3P23A 3C4EA 3QCQA 4MD9E 4ERKA 3NYVA 1DI8A 4QMQA 5EHOA 5IA3A 1ZXEA 3GT8A 4PPBA 3FMEA 1YHSA 2O2UA 4AGCA 4FF8A 3CP9A 3PTGA 4DH5A 2E9OA 3GU5A 4NK9A 4QP6A 3R9DA 4AQCA 2WQMA 5CVGA 5DGZA 4I4FA 3O23A 5HE3A 5BUJA 4BCOA 1J1CA 3O7LD 3I81A 3ZBFA 5IEYA 2XM9A 3VRYA 4R7HA 4KIOA 5DVRA 4XEYA 5ETCA 4XLVA 3SAYA 2DQ7X 2X8DA 4AZWA 4G1WA 3Q4CA 5M55A 2X4FA 3FLNC 2JAMA 1GOLA 2YIRA 4RIYB 5HG5A 3ZM9A 3GI3A 5IUGA 2YM5A 4IX5A 2FUMA 2EUFB 3ACJA 4MKCA 5CF4A 5JQ5A 2QO2A 3QKMA 3FJQE 5HCYA 2BHEA 3AC1A 3CLYA 3R7EA 1JVPP 3AC3A 2OSCA 2PZRA 4O91A 1DS5A 2YLEA 3R30A 3QQJA 3DCVA 3ZSGA 2BTSA 3Q32A 4CFNA 3H10A 5M4FA 1KUTA 3CKWA 3QKLA 1MRYA 3KULA 1Z57A 2W06A 3H0ZA 2OLCA 3GU7A 4C35A 5KMLA 5JH6A 4FKRA 2VWXA 2XA4A 4IANA 4LGHA 4C0TA 5D10A 3HZTA 3FPQA 5L2WA 4C3RA 4YHJA 3IW6A 2R3HA 3OUKA 4LQMA 4RC4A 1JNKA 1SZMA 4I0RA 4WUNA 5J95A 3TTJA 4EOJA 2QG7A 1UU8A 3K3IA 2H96A 4QMVA 4TYJA 1O6YA 2UZWE 2PMLX 4G5PA 3UVRA 4JXFA 3G5DA 4XJ0A 5AFVA 4JIAA 2GNIA 3F5UA 4FEXA 3P78A 4D2SA 3KY2A 4ANQA 4LUDA 2C5OA 3GU6A 3C4CA 4C4GA 4MXCA 4FTMA 4XOZA 1M7QA 3MV5A 5IH4A 3BIZA 3ATSA 1QCFA 1FOTA 4FSZA 4OW8A 1YOJA 2RFNA 4FK3A 3V8SA 4C3FA 3EN6A 2XNMA 3E92A 1JSVA 3E87A 3I7BA 2YHVA 3BWJA 1RDQE 4S33A 3IQ7A 4FGBA 4TYEA 3DXQA 2VTAA 1A9UA 3BYUA 2GFCA 4EKKA 2UW9A 3RZBA 2G9XA 3DQWA 3TNWA 3BU5A 4K2RA 3C4WA 3ZRKA 3NW7A 5DH3A 2QOBA 5TO8A 1S9JA 4AGDA 4E3CA 4FGRA 4K77A 5FEEA 4BDAA 4F9AA 2PK9A 3Q96A 3TM0A 2C68A 3LM0A 4L42A 5EFQA 2J90A 3OWKA 4FZFB 4DYMA 5DR6A 3AC5A 3R83A 5FUTA 4OGRA 3UYTA 3SKCA 3JYAA 4HPTE 4I0SA 2BZKB 1HCLA 4HYIA 2WMVA 2R3NA 4OAUC 3SQQA 3O0GA 5BNJA 1KE7A 3VWAA 5AUXA 4W4WA 4NW6A 2WQBA 2Z7LA 4W9WA 4JG6A 2CGVA 4QMLA 2VN9A 1PXMA 2AC3A 3VW8A 1O6KA 4F0FA 5HEZA 2CN5A 4TXCA 2HZ4A 3BEGA 4AA4A 2J0LA 2OF2A 3U51A 2BR1A 5GJDA 4AX8A 4RVLA 2R2PA 4FKIA 2OGVA 1X8BA 3A7HA 3GQIA 1FGIA 4R3CA 3TJCA 3SG9A 3OOGA 3QYWA 1GIHA 4FOBA 4KWPA 3BWFA 5JEBA 4YLKA 5EOLA 3ZXTA 4HNIA 4CKIA 5M4UA 4U7ZA 3HNGA 4CXAA 3OP5A 3ATTA 3KF4A 4M12A 2A4LA 3NNXA 2BDFA 4DBXA 4RX9A 1H0WA 3POOA 2VNYA 4IAKA 4E4XA 2OZAA 4L7FA 5M4IA 1YWNA 3LMIA 5JFVA 1MRUA 3PJ2A 3OY3A 5AP0A 2V22A 2IW6A 2G2HA 3W32A 3F69A 1CSNA 4BDJA 2R3PA 3E63A 4F6SA 3DS6A 5AX9A 5CEMA 3NGAA 3RAKA 4CLIA 4XV3A 3RWQA 4FTLA 4E8AA 4DLJA 5C8NA 3CY2A 2EWAA 4AWIA 3EQPA 3PYYA 2J7TA 4RWLA 2BFXA 3BU3A 3ITZA 4I4EA 4P5QA 1FVVA 2GCDA 2I40A 2W5HA 2EVAA 3AC4A 4FKWA 4PMMA 1JKSA 4WIHA 2H8HA 3K54A 1PF8A 5EI6A 4AW1A 3RKBA 4B6LA 4EWHA 3TIZA 5HX6A 5IMXA 2ZDTA 4KD1A 4L44A 4IB3A 4DFYA 4P2KA 1Y57A 4C4JA 4HVSA 5E4HA 4KA3A 4QQCA 4DEIA 2ZB1A 1H08A 3UPZA 5HIEA 4IAAA 5E8WA 1Q5KA 3ORNA 1YVJA 1APME 1JKKA 4X7QA 5L8JA 2W9FB 2YJRA 5GZ8A 5EM8A 3L9MA 1M2PA 3OWLA 4BZNA 1MQBA 4R5YA 3F5PA 4ZTNA 1SVGA 4F6UA 1ZOEA 3PIZA 1Q41A 4IZAA 4GFMA 5DEWA 4AG8A 4MF0A 1PMNA 3PPKA 3TDVA 2GNFA 2R3JA 4XHKB 5KCVA 2X6DA 5K3YA 4FTNA 1P14A 2ERZE 4USDA 2C6LA 3LOKA 3DBQA 2WIHA 5KMIA 5HLPA 4IHPA 2OJFE 5JFXA 1PHKA 5FD2A 3ORTA 4FIHA 3Q4TA 1Q8UA 4F9WA 3D7TB 2QU5A 5KZ0A 5AJQA 4ACMA 4YUQA 2FA2A 5BVWA 2OF4A 4XNEA 3WYYA 3KXNA 4CFVA 4OTQA 1IG1A 1H24A 2IJMA 5GINE 1YDTE 4Y85A 1JQHA 3A8XA 5KBQA 4I93A 3LFQA 4HZSA 4CRSA 4FKLA 1B6CB 3E8EA 3EKKA 2ZMDA 4YP8A 1OVEA 4DEBA 4LGGA 4D4YA 3R63A 4PX6A 2WO6A 3AMBA 3NDMA 4RIYA 4X2GA 2OBJA 4PTEA 3VS6A 4M97A 5JGDA 3BHUA 4IIRA 1V0PA 3NW5A 5FM3A 2RF9A 4UZHA 4FYNA 2BILB 4EH8A 2UW5A 1UWJA 2G1TA 2V5QA 2JGZA 4H39A 2BAKA 3AD5A 4LL5A 4IJPA 5CU3A 4BRXA 3PXFA 5HCZA 1ZWSA 5ETFA 3QD4A 4E5AX 3FLSA 2UW3A 3QRIA 4IEBA 4U97A 4ZLZA 2CCIA 2GPHA 4IAIA 4DG3E 4O81A 3KK9A 3QRJA 4U3YA 4BI0A 4Y46A 2Q0NA 1H1QA 1P2AA 4I6HA 3AC2A 5DN3A 4FIFA 4X0MA 3GFEA 3Q9ZA 2YZLA 3FI2A 4PUZA 2WMSA 4D4SA 5AV1A 4FV2A 4NIFB 3PE2A 1KE8A 4JRVA 3HRBA 2P3GX 3H9RA 1XH9A 2CCHA 3U55A 3ETAA 1ZOGA 4YPSA 4KAOA 1W83A 4C36A 5J87A 3UODA 3U4WA 2W5AA 1SVHA 4B4LA 1U54B 4KUJA 4FKTA 2PMNX 3LFNA 2BAJA 3UC3A 4BVUA 4FTTA 3FLZA 3QXPA 3FDNA 3LCTA 3NCGA 4XG6A 1BL6A 3F9NA 4BICA 5IU2A 2A1AB 5GZ9A 2OU7A 5DT3A 3UOHA 5L8LA 3QALE 3BPRA 3R9RA 5KHWA 3SW4A 5FXSA 4JBOA 4WA9A 1OKZA 4BWXA 5LCJA 3JY0A 4X3FC 5AX3A 4DFUA 1H1WA 3OWJA 3QWKA 1B38A 3WF9A 1WVYA 3MH1A 4ACCA 1G3NA 5KMOA 3R28A 2QHNA 2HK5A 2X7GA 3FQEA 4X2KA 3L8XA 3TNHA 4CVAA 2UV2A 5H8EA 3F66A 5IISA 4FOCA 4MXXA 2R7IA 2XF0A 2YWPA 3JVSA 4UY9A 5AADA 4NCTC 2XRWA 4F7LA 4AT4A 4JG8A 2C3LA 3M2WA 4NTTA 4BB4A 3OEFX 3R1QA 3GBZA 4ASDA 2HENA 4IB0A 2GS6A 4KIKB 5D1JA 2GNLA 3QTSA 4IWOA 4RZWA 3ZC6A 4CTBA 3D7ZA 4X2FA 5DOSA 3G15A 4RIXB 5LWNA 2WGJA 1FVTA 3NSZA 2WOUA 3IW5A 4Z55A 5IUHA 1H28A 2V62A 3VS3A 3CE3A 4U45A 5FWKK 4O82A 3FQHA 3F3WA 1YXTA 3DAJA 3EQIA 2XK9A 3GNIB 3MN3A 3BYSA 4G9CA 4U44A 3RP9A 4KKHA 1W84A 3TZ7A 4EUUA 5AUUA 2PYWA 1H00A 2QOFA 4AOTA 3WZJA 1BL7A 3FI8A 3DK3A 4CKJA 5CT0A 5E90A 3A4OX 3A99A 4MXYA 3OG7A 4IE9A 2XK4A 4FI1A 3UPXA 4ZXTA 4DG0E 3OHTA 3NUXA 4L53A 2PVNA 3PA3A 4FV7A 5DHJA 4RIWB 4RIOA 4JOAA 4FMQA 4G6NA 3LFEA 1YWRA 2Y0AA 5EQYA 5GJGA 3AT4A 4TWNA 4UBAA 3EFJA 3KGAA 4N6ZA 4YZBA 2I0VA 3ZFXA 4JL9A 4DBNA 3VHKA 5HTIA 3VHEA 2QOQA 3TZMA 4QT1A 2FSOX 4I20A 4QP7A 4JIKA 4OR5A 3RAIA 4YC6A 2BZJA 2GS7A 3S95A 2ZVAA 2WEIA 3R7IA 3TKUA 4FUXA 2VUWA 4LI5A 2UZBA 4C58A 4ZLOA 3PLAE 2IG7A 5CXZA 5A6OA 3T9TA 5EKNA 4I5CA 2YCFA 3Q04A 5AUZA 2XBJA 5HD4A 4O0WA 3FZ1A 1OKYA 3WYXA 4QPMA 3A7IA 2UW7A 4BDEA 4YO6A 2RG5A 3QD3A 4FTUA 4I5MA 5HG8A 3RNYA 4FEWA 4J1RA 3PJ8A 3R8ZA 5KUPA 4CV8A 4A4LA 1OECA 3FZPA 3VRZA 2CN8A 4MNFA 2ETMA 5CT7A 2B54A 3NUYA 3KF7A 5L4QA 4QTCA 4WNMA 2EXMA 2ZDUA 5KMJA 3CXWA 3UNZA 2PZPA 3OXIA 3V5LA 4CG8A 5HBJA 4EH6A 4HGSA 3F2NA 4CZUA 4OTGA 3EWHA 5HE0A 4DF3A 2BVAA 1H0VA 1AQ1A 3ORLA 4RFMA 3MGYA 4PV0A 3ZEPA 2HXLA 1OPLA 4X6QC 5AEPA 1SNXA 4EHVA 4DFLA 4O7YA 3ZCLA 5LARA 5HNBA 1V1KA 2BRHA 4FNZA 4EEVA 4CFWA 3A61A 2GU8A 4TT7A 3HA6A 4YJVA 2H9VA 3NUAA 1R78A 4F1MA 5C26A 3GCSA 3EYHA 2BFYA 3KEXA 4XG9A 5BUEA 4GCJA 5L8KA 3U6HA 5CEOA 1NVQA 2RSVA 5EH0A 3TXOA 3V04A 3ZO2A 3P1AA 3GCUA 3LKMA 2CKEA 2VX0A 3GP0A 4IWQA 3MS9A 4QOXA 5EDPA 2CSNA 4YBKA 3BE2A 2Y8OA 4RWKA 1FINA 1OKWA 4G3FA 2WEVA 2GNHA 5DLSA 3SV0A 4O0XA 4IQ6A 2Y4IC 3F82A 4W4VA 4FSRA 5DFPA 3RJCA 1BX6A 1ZLTA 4EJ7A 2IZSA 2VNWA 4S31A 1OL6A 4II5A 3WZKA 2WTCA 5HIBA 3R8PA 3UQFA 2CKQA 4WSQA 4G31A 3VNTA 3NMUF 1XH5A 3D7TA 3MESA 5DBXA 5AP3A 3THBA 3OWPA 2ITXA 3D83A 1RE8A 3WI6A 5IEXA 5AUYA 3OBJA 3T3VA 1UU3A 3EOCA 1JOWB 5AP7A 4L3JA 3KXGA 4YLLA 4FSNA 4D28A 4MEDA 3DTWA 5CEKA 1OIRA 3REPA 4LV8A 3CTHA 2C6IA 3PFQA 3CJFA 3QCXA 4NWMA 2XNPA 1MRVA 1J7UA 2FSTX 3OW3A 5GIPE 1LEWA 2O0UA 1R39A 4WOVA 5D12A 5HVKA 1M2QA 5HI2A 4EK4A 5FGKA 4GL9A 3O96A 4O96A 4PDSA 3VAPA 4YU2A 3Q5ZA 3BI6A 3ZBXA 4XG3A 3GEQA 4KS8A 4AE6A 3OMVA 3PIXA 3HP2A 4FKPA 4H3QA 3MFTA 3SVVA 2IPXA 4JJRA 4BDGA 4LRJA 5J5TA 4IBMA 4EOOA 1SYKA 2Y7JA 2ZAZA 3GC9A 3S0OA 2WTDA 3PXYA 3QCSA 2IO6A 4EYJA 1XH8A 4ACGA 2GQRA 3IDPA 3AC8A 2GSFA 5H8GA 3ZDUA 2PUPA 1REKA 3PVWA 3JUHA 4NIFA 1RJBA 2P4IA 3HVCA 3ELJA 4XG2A 3ZUTA 2ITQA 3K2LA 5AR7A 3I0QA 3FE3A 1FBNA 2VX3A 1XWSA 4G3GA 2P2IA 4M14A 4X3JA 1V0BA 1XBBA 3F3VA 3NR9A 3T8OA 1NVSA 4FL3A 2UVZA 1U54A 5C03A 1JKTA 4ZIMA 3MWUA 1TVOA 4RJ4A 2I0HA 3S3IA 3HMPA 4NW5A 4PDYA 3PVBA 4GK3A 3V6SA 2WTKC 2A19B 5DI1A 4FV8A 3VS4A 4FODA 3ZO4A 1HOWA 4AZFA 2NO3A 2ITOA 4ZSEA 4IVAA 5K9IA 2B0QA 4TYGA 1QL6A 2R5TA 1ZYDA 2XK3A 3FLYA 3O8TA 4QTDA 5CF8A 2VWVA 4EI4A 3HRFA 3QF9A 1OL7A 3OY1A 4ALWA 5IPJA 2ZB0A 3QRTA 4PY1A 3N51A 3RPSA 2Z7QA 4G3CA 3IDCA 3BCEA 2GTNA 3QQFA 3O8PA 2Z7RA 1ZZLA 4PL3A 2QOLA 3COKA 5CQUA 2B1PA 3ZSHA 5FXRA 4B8LA 4MQ2A 3QQLA 4P4CA 4EZ3A 4LOQA 2UZTA 4ZTMA 2WQNA 4KIKA 4CFMA 4GG7A 2BZIB 2OWBA 3I60A 4D5KA 3D5VA 4RIXA 3JR1A 4BDCA 2OW3A 5DE2A 3ET7A 5DT4A 4L6QA 3FZTA 4GMYA 5AIRA 4N6YA 5EYMA 3TEIA 4IX3A 3NNVA 3TV7A 4C4IA 1BMKA 4JBPA 1YQJA 5EKOA 4W8DA 4ZOGA 2C47A 1DAWA 4OBQA 2OK1A 2VTSA 3R01A 1WAKA 3DY7A 4FV0A 4O7ZA 1UU9A 3EFLA 2ITTA 4CRLA 5IKWA 4C02A 3KN5A 3VF8A 4RIWA 4IXPA 4E7WA 1ZOHA 4BDFA 4FTCA 3FZOA 3COHA 4LRMA 2HOGA 3ZO3A 3LE6A 3L8SA 3ZH8A 3MA6A 4BIEA 2YN8A 3ULZA 5KMMA 5AWMA 3DJ7A 1OB3A 2UW8A 5F20A 4O1PA 3UZRA 4FKUA 3OT3A 4QMTA 5EYCA 4W4YA 4EHEA 3VUGA 3B8QA 3H3CA 5CEQA 3L8VA 5M57A 1YHWA 3ZFYA 1ZY5A 3SXFA 3HEGA 4EONA 3OTVA 1W8CA 5FBNC 4WKQA 5AR5A 3PLSA 1TQIA 4RJ7A 4UEUA 1GZOA 3SD0A 3MFUA 4FICA 3M42A 5F95A 3EN4A 2HAKA 3ORKA 2UZDA 4RG0A 3VBQA 4F1OA 1E9HA 4N57A 2C69A 4JNWA 1U46A 1ZY4A 3EHAA 4BI1A 4FT0A 2IW8A 3UO4A 3PXQA 2XM8A 5EW9A 2OICA 2PU8A 3QWJA 3V5TA 3QGWA 5BMSA 2YDKA 5IUIA 2PSQA 4PMTA 2YISA 3VS1A 4CEGA 4G3EA 5JK3A 2WB8A 1P5EA 3HAMA 1YOMA 4G6LA 5EI2A 5BYLA 4MK0A 4YJRA 5KZIA 1OL2A 2ITVA 3W2CA 4PNKA 4BHZA 5A4CA 1PKDA 1XBCA 5BVOA 2WMUA 3QHWA 2CPKE 3OF0A 3OS3A 3QTWA 2J5EA 2ZV9A 2HELA 3DFAA 3R7UA 4AZVA 2B9JA 4D5HA 5HO7A 4DFZE 4P5ZA 3OROA 4M15A 2R3FA 3FSKA 4BTMA 4C4FA 2GQSA 4BC6A 1PXNA 4CNHA 5HTCA 2WKMA 2XK7A 3BX5A 5JFSA 3F61A 4ANBA 3FY0A 3WF8A 4FG8A 2YA9A 5DMZA 3BRBA 4FX3A 4JR7A 1XHAA 4G3DA 1AGWA 3Q3BA 4TNBA 5K5NA 4XUFA 3QTXA 2C1BA 4R3PA 4AU8A 4D9UA 4DT8A 5AM7A 3FL4A 3QTRA 3MIYA 4QP4A 2C30A 5CSVA 4EQCA 2R64A 4IC7A 4QQJA 3EQCA 4EOMA 4FTAA 4IX6A 4FSWA 4O2ZA 4OTIA 3NNWA 5HE1A 3SA0A 2F49A 1P4OA 4S30A 5M51A 2PZYA 3G6HA 2Z7SA 3O71A 5ANJA 1NW1A 3R2YA 1J7LA 4RRVA 2YM8A 3R04A 3FMKA 4CCBA 4DTAA 2JFLA 1W7HA 5I9VA 4X2NA 5I3RA 2XNBA 2FSMX 4EC9A 4U80A 2XB7A 4GV1A 3R2BA 5F1ZA 3R1YA 4FV6A 5CSHA 4B99A 3RAHA 4MBLA 2B55A 3OBGA 2ZMCA 3R7YA 5DA3A 5BVDA 1ZYLA 3NUNA 2VTPA 5DPVA 4CYJA 4HZRA 4ANNA 4IMYA 5AUTA 3LIJA 3P86A 5KMKA 5LMAA 5FTOA 1XBAA 3MFSA 4LM5A 2WIPA 5CAPA 4GU6A 1KOBA 5J1VA 4EK8A 1F5QA 4J52A 4PWNA 4XOYA 5CTPA 4KS7A 2HWPA 1XH4A 3G9NA 3EN5A 3POZA 5CVFA 4IFCA 2OJIA 4HYSA 4TNDA 3ZOSA 5K5XA 2OZOA 4WHZA 4NM5A 2OO8X 4BR3A 3VUDA 1VJYA 3FC1X 4YGAA 2YERA 4MWHA 3Q2JA 3W2RA 5CF6A 3P08A 3LLTA 1YI6A 3TNIA 2XVDA 1WBSA 2YITA 5HO8A 2YM6A 1PXOA 3OXTA 4YHFA 3DZOA 3PY0A 1O9UA 5LMKC 4QNAA 4M8TA 4L3LA 4YZDA 3B8RA 2Z2WA 4K9YA 5I0BA 4AAAA 3NIZA 2VTOA 2XH5A 1XR1A 1WBVA 2WMBA 4ZEGA 3HYHA 2E9NA 3QTQA 3CTJA 4HOKA 3MJ1A 3HUBA 4W4XA 4XG8A 4J8NA 4IX4A 4YJPA 2Y4PA 4YJUA 3U4UA 3A7FA 3CIKA 4FZAB 4NUSA 5DT0A 4ZY6A 2QVSE 3FAAA 4M0YA 4OTRA 3FHIA 4I1ZA 4ZSLA 2FB8A 5FBOA 3PZHA 4YC3A 3BLQA 4F63A 3Q6WA 4FIIA 3IK3A 5KKRC 3AXWA 4APCA 2A0CX 5E91A 1W82A 5J79A 5HD7A 5E8ZA 3BV3A 1OGUA 4FEUA 4EWQA 3PSDA 4S34A 4W9XA 4O0UA 4PTGA 3LFFA 4WNPA 4Y5HA 1PXJA 1QPEA 5JN2A 4C4HA 4C62A 4IZ5A 3MW1A 4AT3A 5AUVA 1PMEA 1VYZA 2HWOA 5LMBA 3C4FA 2XNEA 4GFOA 4UV0A 2XIZA 5ANKA 3QQHA 3HV6A 4MCVA 4MD7E 4WSYA 2Y9QA 1K9AA 5DNRA 2ETKA 2OKRA 1Y6AA 2RFDA 4WBBB 3VBYA 4MH7A 1BLXA 4ZTHA 4FNYA 4R6VA 4QNYA 4L3PA 5JGAA 3PRFA 4I0TA 4RLKA 4XP3A 3ID6C 3UYSA 2EXCX 4PL5A 3HDMA 3GCVA 4HW7A 4WRSA 4BCFA 2VTTA 3A60A 5IQFA 3MIAA 3DAEA 2QD9A 5M06A 4BIDA 3WZUA 3DZQA 3RHKA 5CANA 4C33A 1T45A 1TKIA 5LWMA 3II5A 3LFAA 3FBVA 4QPAA 4PMPA 2UUEA 5ETAA 3WIGA 1FQ1B 2AYPA 2H6DA 2XKDA 4AW0A 4CV9A 5BUIA 3EFWA 2FGIA 3NYNA 1SMHA 1H8FA 4U9AA 4RQKA 5M53A 3DKGA 3QUDA 3PXKA 4Y8DA 3SRVB 4C38A 2W1IA 3MY1A 5IH6A 5I9UA 3SHEA 5C01A 4PQNA 2BDWA 2GS2A 2QOHA 4YBJA 2QO7A 4LMNA 2XEZA 4QMSA 3CCNA 4YPDA 3OXZA 4R1VA 1BI7A 2JFMA 2VWYA 3C7QA 3GCPA 3Q2MA 3RGFA 3WF5A 2YCRA 4I24A 4TRLA 3KMUA 2XIRA 1GIJA 3F6XA 3IONA 3PWDA 2YIXA 4IADA 3KCFA 1YDSE 5CEIA 2PMIA 4YURA 3WARA 2XYNA 4GYIA 3QKKA 3GQLA 4O0SA 4L8MA 4O83A 4JG7A 1JAMA 4F7JA 2UZOA 4XV9A 5CNOA 3DBEA 4FEVA 3FKLA 4IB5A 4Q9SA 4Z7HA 4OAVB 1M14A 4PP9A 3R0TA 2W1DA 3QTIA 4KABA 4YJQA 5CU6A 4GUBA 4DH8A 3CGFA 1P4FA 1Q24A 4E5BA 5AAEA 5DWRA 5CSWA 2QCSA 4AACA 3BLRA 2PZ5A 3CY3A 4M68A 3UIXA 3GU4A 3C4XA 3CR0A 4BL1A 4CLJA 3DAKA 5HO6A 3S00A 2OFUA 4R1YA 4Y83A 2WXVA 3ZLWA 4O27B 3C0IA 2JC6A 3NS9A 5E8SA 4U81A 1BUHA 4DEGA 3HMNA 1BI8A 3COMA 3QC9A 5E8TA 2V0DA 3OVVA 4GK2A 2UW0A 5ANDA 4U6RA 5A14A 4GRBA 4WG5A 2ZJWA 4UX9A 2C6TA 3FQSA 3MH3A 2PULA 3QRKA 4EC8A 1GNGA 4P90A 4C57A 5BYYA 1YHVA 4Q5HA 5HICA 5L3AA 3HV7A 4IWPA 4DEHA 4E4LA 1M2RA 2BPMA 3A2CA 4Q9ZA 4IC8A 4MX9A 3R8MA 4EHGA 2R3KA 2W99B 4OBOA 2B7AA 4XX9A 2BKZA 4LOPA 4F7NA 2WU7A 3C0GA 3HA8A 4X3FB 3QZFA 4AOIA 3QFVA 4CGAA 4NM0A 3U9NA 4L67A 3QUPA 5BVEA 3P7BA 5ANGA 5B2KA 3C5IA 3CSVA 4RA4A 4NTSA 4N0SA 4MVFA 3Q5IA 4OLIA 4BCGA 4FA2A 3FY2A 2WQEA 1J1BA 1XKKA 2X2LA 4XYFA 2XIXA 4AGUA 3IGGA 2PVKA 3G0EA 5TF9A 3VS2A 4UWCA 1J7IA 2R3OA 3PY3A 3ALOA 3C1XA 3FHRA 4I23A 5EW3A 3LJ1A 2C5YA 2WMRA 3COIA 4YJNA 3RTPA 1ZYCA 2EB3A 1LR4A 1UWHA 4IFGA 3QAME 3BYOA 4ID7A 3V5WA 3PE1A 5EM6A 2YDJA 2CNUA 1NY3A 3AOXA 2YCQA 4GFGA 3TV4A 4Z9LA 3MSSA 1ERKA 3RINA 4H3BA 4ANMA 3C4ZA 3BHYA 4DEDA 1OBGA 3KRLA 5E8VA 3DGKA 3OCSA 4AXAA 1K2PA 2HXQA 3F7WA 4JVGA 4NFMA 4S32A 5K0KA 3LCKA 4S2ZA 1V0OA 2C6KA 3KK8A 3TV6A 3VF9A 3EIDA 4EH4A 4BGGA 1Y8GA 1FPUA 3TKHA 3ZTXA 2HW6A 3CPCA 4TYHB 3KU2A 4L46A 2CLQA 4YC8A 4CG9A 2B9FA 3E93A 3KL8A 3O7LB 5BVKA 3IDBA 1H27A 3ZC5A 4AP7A 1DAYA 3FC2A 5BPYA 1OPJA 5CAQA 2JIUA 2BRGA 4EQUA 4QTAA 3ZRMA 3PXRA 3GC7A 1YI4A 3U6IA 4RFZA 4JLCA 2JDSA 2OH0E 3O2MA 4LGDA 4KBAA 1FMKA 5D7AA 3LCSA 5B0XA 4U41A 4C61A 4C34A 2C6MA 2OJGA 3MPMA 4HVHA 3LAUA 4RVKA 5HLNA 2GHMA 1UV5A 4G34A 5B7VA 3HUCA 2UZEA 4LRKA 2G15A 1G5SA 3ZLXA 2JLDA 2PZIA 4I6FA 5I3OA 3Q6UA 4EK6A 1SNUA 4GEOA 3VBTA 4N4SA 1HCKA 4HCUA 4XV2A 1PY5A 4BBMA 2C5NA 4M3QA 5ANIA 2J50A 2UZUE 2W1GA 3KVWA 3TACA 1PXLA 3HKOA 1PMUA 3PG3A 3MA3A 4ZS4A 2BTRA 4J96A 4C8BA 2W1CA 2J0KA 2HYYA 4JRNA 3FXZA 3QD0A 3CGOA 1GJOA 1PYEA
chains in the Genus database with same CATH superfamily
1FVRA 2XK8A 4NM7A 3MYGA 5CZIA 4ZTRA 3I6UA 5M09A 4EORA 2VO7A 3N4UA 2QONA 5AV4A 1Q8ZA 4HGLA 5A6NA 3QYZA 5BVFA 3N4VA 4EBWA 4DINA 2A98A 2FH9A 3FSFA 4H36A 3UG2A 4UMTA 4ANLA 1F3MC 3KRJA 4L45A 5IQDA 4V0GB 3EN9A 4O1OA 3W55A 4TW9A 3EFKA 5HKMA 2QKWB 3C13A 4HPUE 3RVGA 2R3LA 5LVOA 2ONLC 3I0OA 5CU2A 4QYGA 4D1ZA 4OBPA 3ZZEA 1GZKA 2P55A 5HHWA 2OH4A 3CJGA 5G6VA 4FNXA 5H2UA 4J53A 3WILA 4CCUA 1WVWA 4BBFA 4BIBA 2XZSA 5FQDC 2OXXA 2W0JA 4ZZMA 3R9OA 3RM6A 4QTEA 3ORZA 2J5FA 3R7OA 1UKIA 4C2VA 1XJDA 2WMTA 2WD1A 4ZJJA 2C4GA 3QBNA 3D15A 3LJ2A 4IJ9A 3HRCA 3OTUA 2ITWA 4CZYB 4YTFA 4F0IA 2Y4IB 4AGWA 4GIHA 4W8EA 2ZM4A 4ZZNA 2HW7A 3QTZA 4NZWB 2I1MA 2Q0BA 2WMAA 1H4LA 5EYKA 4I6QA 1WBPA 2XUUA 5HGIA 2XARA 3ORIA 5M44A 1OL5A 3TI1A 2ITYA 4U0IA 4RQVA 3ORXA 4F9CA 3W16A 5LQFA 5FXQA 5BVNA 2XS0A 2BMCA 3QA0A 1ZMVA 2CJMA 3SRVA 2JITA 4NJ3A 3OCBA 2VTHA 5ETIA 4I5HA 4I3ZA 2C1AA 3RPVA 3P4KA 2IVVA 4KSQA 3QHRA 3VS0A 4BDKA 4KINA 4KRDA 4HGTA 4KIPA 5A4LA 1CKIA 4CFXA 4O7NA 1Z5MA 3PPZA 3SC1A 2C3JA 2X7OA 3G51A 4YJOA 4ORKA 4FZ7A 4U43A 4JX3A 1YKRA 1GZNA 3TL8A 1PXIA 4L9IA 3EL7A 4OTDA 2QOOA 3GC0A 2Y6MA 3LXLA 4RT7A 4XCUA 4EL9A 3PDTA 4D0XA 3RALA 4CQEA 4BCQA 1LP4A 2R3IA 4TL0A 5LXMA 5CWZA 2P33A 2RG6A 3P7AA 3K3JA 4FTJA 4OUCA 4FKOA 3FMHA 3ZDIA 4EHZA 4FKJA 2QOCA 4BTKA 3BYMA 4D55A 3KRWA 4HYUA 4J71A 4O2PA 4QYYA 5AP1A 4EOLA 3DDQA 4I21A 4APPA 3DTCA 5C4KA 5H3QA 2YABA 4I92A 5BQ0A 3GU8A 2BKKA 1WCCA 2VO6A 2C0IA 4YTIA 5CENA 2HY0A 4AQKA 5AP6A 1YWVA 3LJ0A 2YCSA 3BYVA 3W33A 2QLUA 3ZYAA 3EQGA 4FV4A 5D9HA 3RZFA 4PDPA 4QYFA 5AR2A 2GQGA 3NLBA 3V01A 3O51A 1U4DA 3V5PA 2PE2A 3LFDA 2UVYA 4Y5QA 2YACA 4D2WA 3DKCA 5A4TA 5LVNA 2WTKB 3FEGA 3JPVA 4DC2A 4RVMA 3VBVA 4OT6A 4X3FA 5IQIA 2J0IA 3PJCA 3PA5A 1OKVA 5EOBA 4QQ5A 3VQUA 4ONAA 3BLHA 1WVXA 3TUDA 4CT1A 3KFAA 4IZ7A 4QP1A 4DCAA 5EI8A 2IZRA 3ANRA 3D5UA 3DBFA 4I22A 4PL4A 3FKNA 2JKQA 2PMOX 2WTIA 4B0GA 4BBEA 4NCTA 4AN3A 4NKAA 4FVRA 4O0YA 3P5KA 4O7WA 4I41A 2VGOA 3E3PA 3DV3A 4Q5EA 4F65A 2P0CA 5AA8A 4FT5A 5GJFA 4XV1A 3PRIA 4Y72A 4Y73A 4EH3A 4O0TA 5IG1A 3IGOA 2PVRA 4IVDA 4ZTSA 3W8QA 3TUCA 4GT5A 3LXNA 4L43A 2XKFA 3EL8A 3OD6X 4ZMFA 2NP8A 5H9BA 3R22A 4FTOA 4O7LA 2F2UA 4M69B 3RHXA 2YM3A 1UU7A 4AE9A 4R78A 2VU3A 5CF5A 5T3QA 4AN9A 3O5AA 3ZZWA 4I5PA 2WZJA 3EQBA 5ITAA 4GW8A 3RK7A 2BCJA 2JKMA 4DFNA 4A9SA 3R8LA 3WZDA 3VJOA 4PF4A 4TYHA 1YXXA 2QODA 2W17A 3NYXA 2BDJA 4I6BA 3G0FA 2JAVA 3C5UA 3E88A 5EM7A 2CGUA 3TNPC 4EK5A 3F3TA 4FV9A 3R9NA 4KB8A 3DBCA 1ZYSA 2F7EE 2Z60A 3WE8A 3ZUVA 3UDZA 3H0YA 4NKSA 5DRBA 2YLFA 4AS0A 2UZLA 1NA7A 2XKEA 4M66A 3HV4A 4X21A 4E20A 4BKYA 5I5ZA 5KNJA 5ACKA 2HIWA 2F7XE 2J9MA 5J7HA 2VD5A 4TKSA 3DNDA 3VUIA 3RPOA 4TPTA 2E2BA 2JKKA 4FUYA 4C2WA 3V8TA 2X6EA 1MUOA 2EXEA 2QR8A 3BBTB 2YM4A 4GT4A 5GIOE 3QRUA 4QMNA 2R7BA 3KIOC 3LPBA 5AR8A 2DUVA 3KCKA 4AFJA 1XMLA 4DT9A 2WFYA 2OJJA 4UYNA 2X2MA 2WU6A 4UB7A 3AT2A 4DHZA 2O3PA 1SVEA 2WHBA 3KRRA 4F99A 5E92A 4EQMA 4FSTA 4QPSA 5E8XA 3W0MA 4GKIA 3MVLA 4V05A 5DR9A 5CAUA 4BZOA 2YM7A 3V51A 5A46A 3NVKI 4KRCA 4LV5A 3D5WA 4WNKA 2JIIA 4C4EA 5IQHA 1UVRA 1SM2A 2O5KA 4FV1A 4RSSA 4U40A 4V0GA 2DS1A 4AA0A 5J1WA 2F4JA 3ZMMA 3BV2A 5IA1A 1PYXA 4PRJA 4L01A 1E1VA 4TYIA 5E7RA 5CS6A 4ITHA 4A7CA 3GUBA 3A7JA 2J2IB 2QR7A 3BHHA 3VBWA 3BZ3A 1BKXA 2AC5A 3E8CA 1YXVA 4QMMA 1IASA 4JDHA 2C6DA 2WAJA 4H3PA 4LFIA 4FJVA 3D94A 1JSTA 1QPDA 2PY3A 3QZHA 4UWBA 3V3VA 2QO9A 4TWCA 4O4FA 5HU3A 1QPCA 4DDIA 2YWVA 4ZY4A 3NAYA 3LQ5A 4FIGA 4R3RA 1YRPA 3A62A 3QLGA 4IAYA 2EB2A 3U54A 1L3RE 4BZDA 5TOZA 5JFWA 2HZ0A 4JX7A 2QOIA 3D5XA 5EHYA 2X8IA 2VZ6A 4USFA 3UDSA 4IAZA 2VWBA 3RNIA 4FYOA 3VS7A 4IDVA 5BYZA 4DFBA 1LUFA 3W0QA 4FG7A 5E8YA 1KE6A 3QTUA 4XBUA 1CMKE 3SXRA 3W2OA 1YW2A 3QA8A 3VIDA 3FZRA 3ZSIA 3IPHA 3JXWA 4GUEA 2BROA 2GHLA 4FTKA 2WTVA 4R7IA 2I7QA 4U5JA 1YDRE 4QP9A 4QMWA 3HX4A 2NNWB 3QQKA 3BKBA 3TZ8A 2CKPA 3AKLA 2JBPA 3PJ3A 5HOAA 2C5VA 3IG7A 3UOLA 4QMUA 3VBXA 1WFCA 5AP4A 3F88A 3VO3A 3PA4A 4A9UA 5HCXA 1OMWA 4PMSA 5FLFA 3KVXA 4GJ2A 4DTBA 3UJGA 4TTHB 1H26A 2LAVA 1KE9A 4BFMA 4QP3A 1Q62A 4OTWA 2PVMA 3L8PA 3OW4A 3W2SA 4D1XA 3AMAA 5L2TA 3NW6A 4E4MA 4FV5A 4KKGA 3I4BA 1OI9A 3ACKA 5HQ0A 5CVHA 3EJ1A 3VQHA 4RBLA 2W9ZB 4EZ5A 3LFCA 3KXZA 4L7SA 4F1TA 3UNJA 4FT3A 1MQ4A 4JAJA 4WUAA 1KWPA 1DI9A 5FDXA 3UO6A 4R77A 1OPKA 4DAWA 4X2JA 4ZP5A 4E26A 4EKLA 5A4EA 1WZYA 2IVSA 1OBDA 3E8DA 3VUTA 2WMXA 4AN2A 2ITPA 3BL9A 5B2MA 3ZU7A 4FIEA 1IAJA 4EH7A 4J95A 3G2FA 4YMJA 1GZ8A 2JDTA 4AT5A 4DN5A 2BRNA 4J97A 3UNKA 5CLPA 3D2IA 1Q8YA 3NPCA 5JZNA 4FKVA 5HG9A 4EH9A 1OM1A 2CNVA 3NWWA 3I1AA 2Q83A 3A4PA 3ANQA 4YZMA 3H9FA 5C8KA 4RFYA 1Q8TA 3FWQA 4NJDA 4AFEA 5J7BA 4ZTQA 3H9OA 2XBAA 2J4ZA 3MY0A 3GGFA 3FKOA 5E8UA 2WMQA 5I9XA 5JSMA 4FTQA 1WBOA 4JR3A 5ANOA 4AF3A 3S2PA 4MHAA 4NSTA 5IDPA 3D4QA 5KKRB 5HZNA 2UVXA 3DFCB 3F2AA 3OCGA 4TN6A 2OXYA 5TKDA 4CMUA 4O7SA 3W8LA 1LPUA 5A54A 4F78A 3P79A 3R8VA 3G90X 4RWJA 3Q60A 4CTCA 3KB7A 4RMZA 4BHNA 4BGQA 4MF1A 4AUAA 4YLJA 4IVBA 2IVTA 3GXLA 1L8TA 3OFMA 4IM3A 3RK9A 3SX9A 4Z7GA 4JQEA 4GS6A 2ITNA 3WIKA 5EHLA 1RW8A 3C9WA 4ZS0A 4A07A 3DK6A 4H58A 4O7RA 3ENHA 4ZTLA 4EZ7A 5DIAA 4QYEA 3DNEA 3PJ1A 4O7VA 2BIYA 2X0OA 4BJJB 4ANSA 4BN1A 3RM7A 1I09A 5JGBA 3TG1A 4NFNA 2VTIA 2Y6OA 5AP2A 3W2PA 4AA5A 2QURA 4HCVA 3HV3A 3I5ZA 4OTFA 1IA8A 3OC1A 4FG9A 3LQ8A 2VTQA 5IQEA 4M69A 1IAHA 1G8JA 4EOPA 1VYWA 4RX7A 2JDOA 1TQMA 2X1NA 5E1EA 2PUNA 1O6LA 3CEKA 2ETRA 4FKGA 2QKRA 3CQEA 3KKVA 4FL1A 4FVQA 5EK7A 4E73A 4DHIB 2YAAA 3Q9WA 2DYLA 3KXXA 4FT9A 3AT3A 4CMTA 4EBVA 2ZV2A 4MBIA 3NZ0A 3W10A 1G8SA 4IAFA 4RGJA 1G8AA 3DDPA 5EDRA 2W96B 3IW8A 4O38A 2ZM1A 2W5BA 3ROCA 3UVPA 4ACDA 3SDJA 4U42A 2PVLA 2VTRA 3C51A 3G33A 4PP7A 3PY1A 2VTJA 4UMPA 4HCTA 1LEZA 3MH0A 4MTAA 3VC4A 2XP2A 1VEBA 2J6MA 4WNOA 2OI4X 5CY3A 3NVMB 2GTMA 2C6OA 3DB6A 3RWPA 3UQCA 1Q3DA 3RAWA 1PXKA 4FC0A 2JBOA 2PTKA 4G2FA 2QLQA 4IZYA 4LYNA 3LMGA 2VTLA 5I4NA 3GCQA 3GVUA 5TE0A 1PKGA 1Q97A 3TKIA 2XJ0A 4D58A 2OG8A 3OCTA 4FBXA 4MD8E 2IN6A 3ZONA 1I44A 3E62A 5IMEA 5JMSA 3HAVA 4BI2A 5DRDA 2W1HA 2X8EA 5C27A 4Z3VA 5CASA 2GNJA 1OIQA 3DKFA 4EJNA 1W98A 3QD2B 2B9IA 3TTIA 4GG5A 5A4QA 1NT2A 5HVJA 4AZTA 3EZVA 4YZCA 5KBRA 2QHMA 4OTPA 4BCIA 1REJA 3OOMA 1Y91A 1U5RA 4OT5A 2A27A 3DLZA 2B4SB 2VX1A 3UZTA 1ATPE 4CZTA 3OZ6A 3VVHA 4D1SA 4FZ6A 3PSCA 3NNUA 5C9CA 4P7EA 5CEPA 2PPQA 2NYAA 3ZLSA 5M08A 3ODZX 4FSUA 4O21A 4ITJA 2VWWA 4YO4A 2E9VA 3K5VA 2ITUA 5JZJA 2X81A 4IM2A 3UTOA 4DGLC 4BDBA 5DYJA 2F9GA 3EQDA 1R3CA 4E6AA 2C0TA 5K0XA 2H34A 4XP0A 5F94A 4D2PA 3TYKA 4HVIA 3C0HA 2FO0A 3T9IA 2J51A 4KIQA 2B53A 4CQGA 5CSXA 4KNBA 2QOKA 3GFWA 3PSBA 4JQ7A 3WOWA 4ANOA 4M84A 1JKLA 2JDVA 2X9EA 4ITIA 3EKNA 4ARKA 4XS2A 3R00A 4QMYA 5AR4A 1PXPA 4QD6A 4GIIA 3PXZA 5CNNA 5CSPA 3LZBA 3PPJA 3TCPA 4V04A 4WD5A 5AV3A 3V8WA 2UW6A 4G17A 1GIIA 4GVAA 4ZSGA 3RPRA 2R0IA 3GOPA 1Q4LA 2VAGA 2BRMA 4JT3A 5E1SA 2IVUA 4FK6A 3WE4A 4HNFA 4FRFA 4F9YA 2ZOQA 1YOLA 5LVLA 4DG2E 5KO1A 4MNEB 4H1JA 3GENA 3UMWA 3EMGA 2XEYA 4Q2AA 4M0ZA 5CI6A 3E64A 1OIYA 4FSQA 4RJ6A 2HZIA 4C3PA 5HU9A 3I6WA 1AD5A 3MB7A 3LCDA 4FVPA 4NYEA 4CMOA 5FEQA 5AV0A 3BHTA 4FL2A 3I7CA 2XJ1A 2RL5A 2VTMA 4M67A 4ENYA 2WQOA 5HVYA 4ZSAA 3NUPA 3DJ6A 4ZJVA 1CKJA 4USEA 4ZMEA 1K3AA 3M1SA 5AR3A 2E9UA 3Q53A 4F9BA 4ZY5A 2F2CB 5JQ8A 4D4VA 4HYHA 4NT4A 4WG3A 4CYIA 4RX8A 4FE2A 2ITZA 2EU9A 2W7XA 3L9PA 4BWKA 2I0YA 3MPAA 3VUKA 4E6CA 4L00A 2ZFYA 1OUYA 3QZIA 4MBJA 4QMXA 4JDJA 5LMKA 4BKJA 1ZMWA 3HV5A 4C59A 2X0PA 3QL8A 2RKUA 2HY81 2CDZA 3PUPA 5BMMA 2AUHA 5CX9A 2OIDA 3ALNA 3Q4UA 4TY1A 3MFRA 3R71A 3UVQA 2XAMA 3K5UA 3PZEA 4LMUA 4KSPA 3LQ3A 4FKSA 5CALA 3KREA 3QXOA 1OZ1A 3G9LX 4YSMA 3RK5A 2G2FA 4XH6A 4R8QA 2XRUA 3CPBA 4YJTA 1KSWA 1XMMA 4WO5A 5LCKA 4UN0C 4GSBA 2XALA 5IQGA 2G2IA 4WBOA 4XBRA 1Y8YA 2R3QA 2RFEA 2RIOA 3UOJA 5CYIA 1CTPE 3ZUUA 2RGPA 4MXOA 3QC4A 4EOKA 4BKZA 3ERKA 5AV2A 2V55A 4EOSA 5TT7A 5HE2A 4RJ8A 3DQXA 4D2TA 1IEPA 3LFBA 1JSUA 5HTBA 3VN9A 4DE4A 3LM5A 5CU0A 4ZK5A 2PHKA 3EB0A 4HVDA 3VUMA 2PVHA 3ZM4A 5CXHA 1EH4A 3E7VA 3G6GA 5KE0A 4C37A 5IEVA 2PE0A 4QMZA 3SW7A 4JAIA 2DWBA 2X4ZA 3EQHA 3FYJX 4FZDB 1MP8A 4DCEA 4MXAA 3TNQB 4K33A 4BYJA 3W0OA 2QQ7A 3DU8A 3ORMA 4XRJA 3E3BX 1Y6BA 3HGKA 3IW4A 4BF2A 1UA2A 4YTHA 4DH7A 4YTCA 1A48A 4C7TA 1KV1A 1Q8WA 3P7CA 4F7SA 3DOGA 4RZVA 4QYHA 4ENXA 2O64A 3HMOA 4G6OA 4DLIA 4BJJA 1NVRA 1IRKA 3D0EA 3WBLA 3CD8A 4V01A 4XLIA 2C0OA 4IH8A 3RI1A 4CD0A 3CKXA 4K11A 5J5SA 2REIA 3SG8A 4CSVA 3BU6A 3R8UA 3IW7A 3R1SA 3FXXA 1FGKA 4E6DA 4RVTA 1H01A 4U3ZA 3FLWA 2YZAA 5D11A 5AM6A 3PWYA 4D9TA 2WTJA 1H07A 4ERWA 4K0YA 3Q4ZA 4R7BA 5H8BA 3MPTA 4LUEA 3DJ5A 3P5JC 3DK7A 4FTRA 3LXKA 3QCYA 2YFXA 2F57A 3EQFA 2ZYBA 1JPAA 4RC2A 3W18A 5A3XA 1VR2A 2VWUA 3QGYA 3P0MA 4DHFA 3PVGA 3I5NA 4HVGA 4BCHA 3DPKA 4FSYA 1Z9XA 5I9ZA 2IZTA 3DB8A 4DGGA 4F09A 2NPQA 3KC3A 2XIKA 1H25A 2QNJA 2BAQA 2XNOA 3CTQA 4DGNA 5K4JA 4O4DA 3HLLA 4NL0A 1ZYJA 5ICPA 5KHXA 5LVMA 3A7GA 4U79A 3RBWA 4GT3A 3FPMA 4A9RA 5IA4A 3UQGA 2KTYA 4PDOA 5CI7A 3E8NA 4JI9A 2VRXA 2W4JA 2OIQA 3TN8A 1URWA 3NUUA 2R3RA 2WPAA 4F6WA 3N4TA 4UALA 3I79A 4JBQA 4HJOA 1GY3A 1PJKA 1R0EA 3PVUA 3UP7A 3IS5A 5JT2A 2WMWA 3ZS5A 1JLUE 4IACA 4F0GA 5HX8A 3U6JA 2NRYA 2OFVA 5AUWA 2J0JA 3IO7A 4NH1A 4ALUA 5GNKA 4D0WA 5EQPA 3NAXA 3ZO1A 3QQGA 4BWPA 3MVHA 2IW9A 2YJSA 3M11A 4EH2A 4F70A 5M4CA 4BCKA 1J3HA 4ASZA 2CGXA 4N70A 1TQPA 4BTFA 3KXMA 3KMMA 4J8MA 4QQTA 5JKGA 4UMQA 3KRXA 5TR6A 3LXPA 4KBKA 5HIDA 3UIMA 3SGCA 4FV3A 4L52A 3R02A 5HESA 4FT7A 4GK4A 2GNGA 3JVRA 1XO2B 4A9YA 2BIKB 4K6ZA 3Q52A 3DXPA 2VO0A 2XNNA 3BELA 2WTWA 1CKPA 1H1RA 4DEEA 3E7OA 3R7VA 3SOCA 4GJ3A 3MTLA 2C5XA 3ZLYA 3BE9A 5EQEA 1WBNA 2GFSA 2W1ZA 4RC3A 5IA2A 4DITA 1YI3A 5ACBC 4M13A 1URCA 5AMNA 4A06A 3EYGA 1A06A 2HCKA 2VO3A 3UE4A 1G8KA 4NEUA 3V5QA 5GHVA 3CQWA 5L6PA 4ZLYA 3AGMA 3TDWA 3FI3A 4I94A 1ZARA 4FTIA 3ULIA 4J7BA 3FI4A 4YNEA 3ODYX 4RLLA 3R9HA 3QX2A 1OIUA 4E93A 2ZV7A 3B2WA 4AOJA 4D2RA 4E5WA 1YXSA 4QRCA 1UKHA 4FIJA 4O0VA 4QP8A 4BDHA 5IQBA 3UBDA 5CU4A 5AA9A 4O0RA 3AGLA 4EUTA 3TWJA 4XRLA 3EZRA 3B2TA 5HNIX 2R0UA 3DXNA 3LMHA 1XH7A 5J9ZA 1R0PA 4YR8A 1UNHA 3ORPA 4PTCA 3RCDA 5FP5A 5A9UA 2XIYA 5C1QB 2XKCA 5IZFA 3BEAA 3BBWA 3CC6A 5JRQA 4ASXA 4MNEA 5IQCA 3W0NA 3F7ZA 4IWDA 3U8WA 4ACHA 3TJDA 3MH2A 4G16A 3S4QA 4PPCA 4GU9A 5FRIA 4TWOA 4UMUA 3H30A 4BCNA 4KBCA 1KOAA 1JWHA 1ZRZA 5J8IA 2J0MB 2X7FA 4B7TA 4YZNA 4MAOA 5ANEA 4B9DA 5EYDA 5L6OA 2PVYA 4F4PA 5AIKA 5J9YA 5D7VA 4WRGA 3NX8A 2C3KA 5LVPA 3IOPA 4K1BA 3UO5A 3EQRA 4UMRA 5KMNA 4BCPA 4KKEA 4DGOA 3W0PA 2XAOA 4ASEA 2VWZA 2W05A 1CDKA 3OT8A 4YSJA 2ESMA 3LVPA 3NYOA 2Z8CA 3KA0A 3VULA 4QMOA 1XQZA 2YAKA 1Q61A 3FMNA 1T46A 4FR4A 3UP2A 5IF1A 5LJJA 4DH1A 2B9HA 4JMQA 1NXKA 2A2AA 3BGQA 3HMIA 3DT1A 4GH2A 3D14A 3DKOA 4QP2A 1ZZ2A 2YDIA 4J99A 3FL5A 3JS2A 2G01A 2F7ZE 1H1PA 2BHHA 4TWPA 3QQUA 3FMJA 3DA6A 1UNLA 3R1NA 3MTFA 1VZOA 1PMVA 2CKOA 4UZDA 2R3GA 4HGEA 4O4EA 3OEZA 4IM0A 5E9EA 2IZUA 3FXWA 5JRSA 4YZ9A 2XK6A 3MY5A 4ALVA 5AAGA 5F4NA 4GKHA 4DTKA 4G9RA 2ERKA 2CGWA 5C8MA 4O84A 2P2HA 4F64A 4ZZOA 2X0GA 4O86A 2XMYA 5DG5A 3ML1A 3QLFA 3HL7A 2KULA 3D2KA 3H4JA 1KE5A 5FTGA 4UXLA 3V5JA 3FZSA 3WF7A 2C6EA 4Z16A 4FNWA 4BDDA 4RJ5A 3RMFA 4A9TA 1DM2A 4WG4A 3VUHA 1GAGA 3RCJA 3BQRA 2I0EA 5FP6A 3VW6A 4DEAA 4X6RA 1FMOE 4H05A 2QC6A 4BTJA 5EG3A 2XYUA 4IB1A 2V7AA 1ZMUA 2ONLA 4FEQA 2X9FA 2GMXA 4B8MA 5T6KA 5D41A 5HBEA 2PVJA 4FKQA 4PPAA 4RPVA 3GB2A 4Y95A 5FM2A 3BGPA 5HNGA 2JDRA 2X2KA 4EOIA 4XG4A 3KULB 2PL0A 3ENMA 5CAVA 3D9VA 3UIUA 4EOQA 5L2SA 3BGZA 5AAFA 4EH5A 3WF6A 2XCKA 3HMMA 1STCE 2I6LA 2PUUA 4CT2A 4G5JA 4JDIA 3UOKA 5LOHA 3ZFMA 2ACXA 3U9CA 4R5SA 5KX8A 2CNQA 4E1ZA 5BX0A 5L6WL 3TT0A 2ZV8A 3NEWA 1B39A 1XH6A 3NRMA 4JDKA 1F0QA 4UWYA 5HBHA 3S1HA 1M17A 5L2QA 2FSLX 4A4XA 3UZPA 3PG1A 4DH3A 3Q9YA 4CFFA 4O22A 3EH9A 3R21A 4ZSJA 2JEDA 3BQCA 3GOKA 4YHTA 4JBVA 5FDPA 2R3MA 2UW4A 3MBLA 2CLXA 1QMZA 3LW0A 4LG4A 3O50A 3AD4A 2X39A 4EYMA 5CAOA 3IOKA 4E4NA 3W1FA 2LGCA 3MVMA 3R6XA 4NU1A 3MVJA 3CD3A 4O6LA 5HLWA 4YJSA 5FG8A 2VV9A 3V6RA 3W2QA 4DA5A 4MYGA 5T68A 3PP0A 4QMPA 3A8WA 4K8AA 2FYSA 1U59A 4DGMA 4L68A 4AZSA 2YIYA 4E6QA 3FUPA 2WNTA 2XJ2A 3VS5A 1U5QA 2UZNA 3E5AA 2BUJA 1IA9A 4UYAA 3SOAA 3ROYA 3FYKX 2BRBA 4NM3A 5B2LA 4MQ1A 1OITA 2CHLA 2JKOA 5DEYA 4AXCA 5IA5A 5F9EA 2WOTA 2Z02A 5IA0A 3F5GA 1OL1A 4O6EA 3KQ7A 5HG7A 3OUNB 3T3UA 5FEDA 5FTQA 3UC4A 3FV8A 4AW5A 5C4LA 1WMKA 2W1FA 2PVFA 5I9YA 1IR3A 1Q99A 2QU6A 3LLAA 5IQAA 3WZEA 3QU0A 4J98A 3UDBA 5IDNA 3AMYA 2GHGA 4H1MA 2UZVA 4BDIA 1PRYA 4GYGA 2JIVA 2CMWA 3FLQA 3NCZA 5J9LA 1W0XC 1S9IA 2VTNA 4JQ8A 3HDNA 4U8ZA 3MI9A 3UMXA 3RPYA 3ZEWA 3AD6A 2OXDA 4CFUA 2V7OA 2JD5A 4IW0A 2SRCA 1ZAOA 4XP2A 5CQWA 2GDOA 2YIQA 3P9JA 3UG1A 4BCMA 1Q3WA 5K4IA 3TIYA 3F5XA 3JY9A 3ZRLA 3TUBA 5GZAA 1OGYA 4RA5A 3SXSA 2O8YA 5IH5A 4ZAUA 4LOOA 2QG5A 2YEXA 2BZHB 2OZAB 1RQQA 3ZHPC 4A4OA 1PW2A 3AG9A 3CBLA 1WBTA 4JS8A 3GC8A 4AW2A 5I9WA 2W4KA 1QPJA 3DBDA 3L9NA 5M07A 1H1SA 2RFSA 4BY9E 4O7TA 3ZXZA 2PWLA 2O63A 1UNGA 4M7IA 4WT6A 5CZHA 1R1WA 2B52A 1J91A 4RJ3A 3VJNA 5DR2A 4F08A 3NFGB 3QX4A 3FMDA 4O4CA 3PIYA 3MB6A 4FSMA 5EW8A 4EK3A 2QI8A 2W4OA 3KXHA 2NRUA 2PE1A 3R73A 4CKRA 3R7GA 3FMLA 4IDTA 1E1XA 3DLSA 4XMOA 3U87A 5EM5A 3KMWA 3KN6A 5L2IA 4UXQA 4D4RA 4DFXE 3F2RA 2C3IB 3F3ZA 3NIEA 3O8UA 4TZRA 5EDQA 3TZ9A 3UGCA 3UIBA 2ZM3A 5AP5A 1WBWA 1OUKA 3N9XA 2BALA 3IECA 2R9SA 3L1SA 3QUEA 4BCJA 1CM8A 4K18A 3HP5A 2IWIA 3LHJA 4QO9A 4XG7A 1JBPE 4LL0A 5M56A 3CS9A 3LFSA 2VGPA 1M52A 2O65A 3MJ2A 5G1XA 3AQVA 3SLSA 3O17A 1BYGA 2HZNA 2WELA 4IVCA 4QTBA 4ZJIA 2E9PA 3FMMA 3QZGA 3CQUA 4YNOA 4GVJA 3MDYA 3HECA 3NUSA 3Q9XA 2FVDA 2XCHA 5HORA 1M7NA 2R4BA 2W1EA 3PP1A 2OIBA 4I6LA 1YXUA 3F3UA 4BYIA 1ND4A 4D2VA 4BGHA 3IKAA 3C50A 2XNGA 4PNIA 2PUIA 2OJ9A 4MXZA 2YIWA 3BHVA 3EN7A 2VWIA 4AZEA 4RX5A 4OTHA 4MWIA 1KV2A 3L9LA 3LCOA 4RWIA 3P23A 3C4EA 3QCQA 4MD9E 4ERKA 3NYVA 1DI8A 4QMQA 5EHOA 5IA3A 1ZXEA 3GT8A 4PPBA 3FMEA 1YHSA 2O2UA 4AGCA 4FF8A 3CP9A 3PTGA 4DH5A 2E9OA 3GU5A 4NK9A 4QP6A 3R9DA 4AQCA 2IF8A 2WQMA