4DN5A

Crystal structure of nf-kb-inducing kinase (nik)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
344
structure length
331
Chain Sequence
b'SVEEYLVHALQGSVSSGQAHSLTSLAKTWAARGSRSREPSPKTEDNEGVLLTEKLKPVDYEYREEVHWATHQLRLGRGSFGEVHRMEDKQTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLVKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVCLQIPGTETHMAPEVVLGRSCDAKVDVWSSCCMMLHMLNGCHPWTQFFRGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPIHRVSAAELGGKVNRALQQVGGLKSPWRGEYKEPRHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mitogen-activated protein kinase kinase kinase 14
publication title Structure of Nuclear Factor Kappa B-inducing kinase domain reveals a constitutively active conformation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 106
structure length 331
sequence length 344
chains with identical sequence B
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dn5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dn5A01
4JRVA 4F09A 4WSYA 1RE8A 3LQ8A 4GEOA 2HZ0A 1I44A 4FT0A 4KS8A 4MK0A 3QTRA 3O96A 5AV1A 3TACA 4FKLA 3NW6A 3RI1A 3MVHA 3OEZA 4PNIA 5FXQA 3NVKI 2XK6A 4KNBA 3LXKA 5JGBA 4IFCA 1XR1A 1GY3A 3FE3A 1PXIA 2DYLA 3IECA 4JQ8A 5G1XA 4PMTA 5K0XA 2ITTA 5KMIA 4EQMA 4I21A 2C1BA 4O84A 5T3QA 3FMLA 1IAJA 1Y91A 1GZ8A 3DBQA 5BUEA 3FHRA 1XH6A 3LCKA 4OAVB 4QTDA 3TUDA 1BYGA 4ANNA 4DTBA 1OPJA 2E9UA 4QPSA 2XIRA 5TR6A 2PVLA 4BGHA 1QPEA 2RKUA 4KBKA 4FSUA 3SVVA 4X21A 1S9JA 4O6LA 3O8TA 3LMIA 2O0UA 4AZEA 2CNUA 4FTAA 3VVHA 2P0CA 3ZEPA 4HVGA 3EMGA 4FKGA 4D1SA 5J5SA 4CCBA 3VJOA 1BKXA 2WD1A 3IOKA 4WG4A 3IS5A 4MCVA 4RC4A 4ITJA 4GU6A 2WQBA 3G9LX 4Y83A 3D5VA 3ETAA 4BBEA 4RX5A 3TL8A 3PXQA 1H27A 5H8BA 4C2WA 3G90X 3BRBA 4DH1A 3FL4A 3O8PA 4ZMFA 1H28A 4LRKA 5ICPA 3FDNA 4YJNA 3DDPA 4AOTA 3T3UA 1U54B 2RG5A 4TW9A 2VNYA 4XX9A 2PU8A 1KUTA 3W2QA 1ZYLA 4I41A 1XBCA 5FG8A 5M4FA 3RK9A 1ZMUA 3FXWA 4IQ6A 4NZWB 4WKQA 3RPRA 1NXKA 3UDBA 2PTKA 1H00A 1PXKA 4BDFA 3CJFA 5JZJA 2J0IA 2OO8X 4RWKA 4CZUA 5L4QA 4CYIA 4I94A 5F9EA 3ZC6A 1PXNA 1Q8YA 3BBTB 4J8NA 5ETAA 4TWOA 3SKCA 5TOZA 4XS2A 5CI7A 4YGAA 4FE2A 3EFKA 4FK3A 3RZFA 2XM8A 3RM7A 5I0BA 3ZXZA 4O81A 2HENA 2YIXA 4AA5A 4I92A 4JBQA 4TXCA 3LXNA 3O8UA 4M97A 1MRYA 3P1AA 3WOWA 2YERA 3EFJA 5HHWA 2X2MA 5HIEA 1ZOGA 3I6WA 3PVUA 2OXDA 1ZAOA 2UZOA 3O71A 4QQJA 1PXOA 4X7QA 3UVQA 3W10A 4HYHA 3WE8A 5HTIA 2BR1A 4I4FA 2UV2A 2XM9A 3BGQA 2J4ZA 4A9SA 4FSYA 4HGSA 1OUYA 1FQ1B 3H4JA 4IVCA 4UB7A 3ZLYA 5HBJA 5HVKA 4K11A 2R5TA 4UY9A 3A7FA 4FK6A 2GTNA 5CANA 3CQEA 2IVVA 1OBDA 4WUAA 3GC7A 3NUNA 4F99A 3ODYX 4H1MA 5J87A 5J95A 5IEVA 4D9UA 1OL1A 5AV3A 4DLIA 4E5WA 4WNPA 2IPXA 3D9VA 5CZHA 4QQTA 2QOQA 5A3XA 4FGRA 5JFVA 5EHLA 5CEMA 3DLSA 1VYWA 4BRXA 4BTJA 4XBUA 5GINE 3BYVA 3C4WA 3CGFA 3VULA 4C35A 4NYEA 4ZS4A 3LCDA 5CAOA 4FVPA 3P7BA 4L01A 3VS2A 3S00A 3GOKA 2VWXA 4HVDA 3F2AA 2Y6OA 4XNEA 3ATTA 3G33A 3MH3A 3W2CA 5DIAA 4WG3A 3ZMMA 2X6EA 2QD9A 5FEDA 2UZDA 3U4UA 2Y4IB 4M84A 1TKIA 2ZB1A 3DXPA 4G3EA 1YWRA 4FI1A 3F7ZA 4FTNA 3TV4A 4E6CA 5C4LA 5AUYA 5FEEA 4MYGA 4FGBA 2YM5A 5IDPA 2IZRA 4NK9A 5FP6A 1UU7A 2OG8A 2WEVA 4YJVA 5IPJA 5HBEA 4OBOA 4W4YA 4DYMA 3C4FA 5DT0A 5DEYA 3TXOA 4PP7A 1JKSA 3BHHA 4IACA 3EB0A 2RL5A 4O0UA 4V04A 4HVSA 4D5KA 4UX9A 1IAHA 2C6KA 3N9XA 2ACXA 3HP5A 3MY0A 3Q9YA 3N4TA 2W17A 3NUUA 5FLFA 1GAGA 4IIRA 2VWIA 4F9CA 3U6HA 3HP2A 4AW1A 4F1MA 2WKMA 4BKYA 4EH2A 2I40A 1WBSA 4N4SA 1VZOA 4ZEGA 1TQIA 3FKOA 4RIYB 5I9UA 4O7NA 4PMSA 4GUBA 4UWYA 4ZSLA 4AOJA 4AQCA 3EN5A 3HL7A 4L3LA 2OJGA 5F4NA 4BB4A 5IQCA 2VWZA 4EKLA 3ZCLA 1KE6A 2JIVA 3KXNA 2R3KA 3C4CA 4C4GA 3OCBA 4WRGA 4R1YA 5CENA 1WMKA 1M2QA 1Q62A 1QPCA 2A0CX 2PVKA 3S4QA 4WRSA 5FBNC 3NYXA 2XYUA 1PKGA 5M44A 4F7JA 3RNIA 5IQDA 5D1JA 4RVTA 4U81A 1UU3A 4MBIA 5J7BA 3CJGA 2IZSA 2FSOX 4F1OA 2GSFA 1STCE 3FMMA 3Q53A 5DI1A 3QHRA 4I6BA 3EYGA 5AX3A 4IAKA 1PKDA 2IZUA 1ZARA 5GHVA 3MTFA 3Q6UA 3TT0A 5HLNA 5M4UA 2B7AA 2ZMDA 3BYUA 4M8TA 4RX9A 2YDJA 3F3ZA 5IF1A 4E4NA 3LFBA 1O6KA 3B2WA 5AWMA 2BAKA 3CE3A 1H01A 4EQCA 2R64A 3ZOSA 4QP8A 5AUXA 4FTLA 5HU9A 3TUBA 2XUUA 4DT9A 5E1SA 3FLYA 5E8UA 1E9HA 1YOJA 3ERKA 5DA3A 2I0EA 2OKRA 3BU6A 2WTVA 1WBPA 2W5BA 3R7VA 3CP9A 3NMUF 2VWWA 4CZYB 5GZAA 3RCJA 1Q61A 1YXXA 3C5IA 5IQHA 4H1JA 5L2TA 1K2PA 3LFQA 4QYHA 5CASA 5CYIA 2XKFA 4NKAA 4WG5A 2WAJA 2F2CB 5DVRA 4FNYA 2UZBA 3BV2A 4UMRA 4F6WA 3QQGA 5FDXA 2GNFA 3ZS5A 3GQLA 2GFCA 3R9DA 2UZWE 4AZSA 4NWMA 2XA4A 3WILA 1V0PA 1QPDA 4CTBA 3A7GA 2WTKC 3DQWA 5ANOA 4WUNA 4NCTA 3MN3A 3WZKA 2XIKA 2WMXA 4J71A 3PE2A 4MEDA 4KRDA 2YN8A 5CVHA 4IJPA 4JI9A 2PUPA 4IADA 2OLCA 5TKDA 2YHVA 3DKCA 1SVHA 3W2RA 4AUAA 5BVKA 3RPYA 4E93A 3MV5A 5ANIA 5JT2A 5HNIX 5AV0A 2B54A 4K2RA 3IKAA 3WF5A 3UG2A 3QL8A 4M0ZA 4GKHA 5HIBA 4JXFA 2CCHA 3Q04A 3M11A 4FIJA 2VX1A 3I7BA 4IX5A 4O0TA 4YC3A 5EG3A 4U97A 5FXRA 2FH9A 3FPMA 4CKIA 3FC2A 5EOLA 5HTBA 4FEQA 2JFMA 4TY1A 5H8GA 5HE0A 3RCDA 3DK3A 2FA2A 4KKEA 3L9PA 3RK7A 3F2RA 4YPSA 3VUIA 2VX0A 3HDNA 4W4VA 4A9TA 5K3YA 3C5UA 2XZSA 4I5CA 5JRSA 2GQRA 1KE7A 3KRWA 4C59A 3AOXA 4WOVA 4CT1A 4QTBA 3IDCA 4D4SA 4RJ3A 5I9XA 2G1TA 3U54A 3MWUA 2WQEA 3A61A 3GU7A 5E7RA 4CFXA 4W9WA 3FMEA 5AFVA 3LQ5A 4GG5A 4PUZA 3THBA 2QKWB 2Z7RA 3PIYA 2O65A 4IB5A 3CLYA 3R1SA 5FEQA 4EH7A 4BCIA 2UW0A 3PZEA 4YHJA 3W1FA 2QOLA 4DTKA 4UALA 2GHLA 4DGMA 5JEBA 1OKYA 2B52A 4EH8A 3S95A 4E20A 2WMVA 4QMYA 2Z7LA 3KVXA 4C3FA 2R3IA 2ZV8A 3QZHA 2JDVA 3R7OA 5IQGA 4C38A 3NYVA 4ZSEA 4BDEA 5L6OA 3ZDUA 4L52A 4DBNA 4G6LA 4TTHB 5CI6A 5IH4A 2VWUA 3GC8A 4EI4A 4DINA 2Z02A 4KBAA 4LRMA 3ZLSA 4BL1A 3DTWA 3EIDA 2R3MA 2AC5A 3OP5A 3EZVA 3OT3A 4PPCA 3P79A 4YPDA 3O17A 4GT3A 2PUIA 2JKQA 2WTWA 4HYIA 3V5WA 3HMOA 4OTFA 5D10A 3WZEA 2OF2A 4AAAA 1P4FA 2G2FA 3I5NA 5E91A 4CFMA 4FTJA 2OIBA 3QQFA 4XV2A 5F95A 2C0TA 3EN7A 3NPCA 2PMLX 4FEUA 4A06A 3P78A 3NUPA 4PPAA 1QCFA 5CU0A 2WIPA 3W16A 4DH8A 3L1SA 3OXIA 4JRNA 3HLLA 1W98A 4FOBA 4YU2A 2YWVA 5A6OA 1Y8YA 3HKOA 3NCGA 3PG3A 3Q5IA 2Y4IC 4LI5A 4FSRA 3SRVA 5KKRB 3TNHA 4APCA 2PVHA 2EUFB 2A27A 2W1FA 2X8DA 2ZOQA 4TRLA 2JAMA 3OW4A 4WBBB 4FIIA 3ORIA 2JDOA 4D2PA 3I0QA 4HYSA 4XJ0A 3V51A 4O0XA 3RNYA 5KMMA 4QYGA 3GCPA 4G3CA 5ACBC 4TYGA 3R30A 4KAOA 3BCEA 2ZDUA 4S30A 3V8TA 3L8XA 3VF9A 3O23A 4FEWA 4RMZA 3RAHA 3G5DA 1Q8ZA 2ZM1A 4EH6A 3LMGA 4XCUA 2XKCA 3IW7A 4FSMA 3PUPA 3LM0A 3SHEA 3DPKA 4N70A 5LVMA 4H3BA 3FEGA 1R78A 4JIAA 2BRMA 2IWIA 5KO1A 4LOQA 2WFYA 3FSKA 4R7IA 3AC3A 3CQUA 1HCKA 4AGUA 1FBNA 2C6IA 3WI6A 2OK1A 3ZU7A 5LMKA 3N51A 4FUXA 3GXLA 4LUDA 3V5QA 3UNKA 2B0QA 1OMWA 3QHWA 3F6XA 4BYJA 3E63A 4GIIA 2W7XA 5AP6A 3A2CA 5EHOA 5CXZA 3D5WA 1W83A 3V5JA 5JMSA 2QC6A 3G0FA 4EORA 3BI6A 4EK3A 5HESA 4HNIA 3DKGA 2XCHA 5BNJA 3NYNA 2W1EA 4UYAA 5JQ8A 5FUTA 5FXSA 3JUHA 4CEGA 1XH5A 5AIKA 3ZBFA 4IB1A 5A54A 2IO6A 1YKRA 1P14A 5HVYA 3UQGA 4RG0A 1YHVA 1AGWA 1URCA 2QKRA 3TKHA 2WU7A 4WNMA 2WZJA 4C37A 4R5YA 2X0GA 1ZRZA 3RM6A 3ID6C 4YZMA 2QNJA 2ETKA 2XNEA 4IWPA 1GZNA 4QMWA 4X6RA 5EK7A 3ZHPC 4BI1A 4NFNA 3SRVB 4GJ2A 2XNBA 2IG7A 4R1VA 4I23A 3LIJA 4NM0A 4D4RA 4F65A 3E93A 3HGKA 4IB3A 4K0YA 3VW8A 4Y8DA 3QQKA 4GCJA 3C9WA 1MRVA 4NUSA 3OVVA 4JNWA 3V04A 2G15A 1ZZLA 2ZVAA 4GYIA 2VX3A 1B6CB 3P7AA 1RJBA 4NU1A 4IZ7A 3DA6A 2LGCA 3FL5A 3RAIA 3CC6A 3NSZA 4AN3A 5BVEA 4QMUA 3BU3A 4G5PA 3COIA 4RWIA 3CIKA 3HEGA 4P5QA 4HW7A 2CMWA 3FSFA 1JWHA 4AW2A 1XH4A 3LQ3A 3GOPA 4IHPA 3G0EA 4HZSA 1IEPA 1V0OA 2H96A 1YW2A 5GJDA 3CSVA 3TNQB 2XIXA 1YHSA 3R7EA 4M12A 5FTOA 4D0WA 4OT5A 4PDOA 4GVAA 3UO4A 3NW7A 3SW7A 1BL6A 5DE2A 5D41A 1OBGA 1YDTE 2FUMA 2VTNA 3CBLA 2A4LA 4PMMA 2QOHA 3AGLA 4PWNA 4UYNA 4E6QA 5GNKA 2Q0BA 3S2PA 4RFZA 2WMTA 2F7XE 4N0SA 4K8AA 4G3GA 4ZY5A 2XNPA 4HZRA 1FPUA 5CEQA 4UV0A 4OBQA 5AV4A 4YSJA 5CF4A 5K5NA 1QL6A 4ONAA 4O82A 4JBOA 4R78A 4F64A 4E4LA 2C69A 3FLSA 3MJ1A 5DRDA 3R8PA 3VIDA 3KXGA 4Q9SA 4WBOA 5IG1A 4RJ6A 1YQJA 4I0SA 3ZRMA 4FIHA 4M7IA 4RIXB 3OUNB 1ZZ2A 3BYSA 4IAAA 4G3FA 2YZAA 3CEKA 2XBJA 5GIOE 3PZHA 2CGUA 4ASEA 4R3CA 3OBJA 2J0JA 2OIQA 3EQHA 2BCJA 4ZJJA 3VQUA 3FC1X 3L8PA 4ZLOA 2VTLA 5HOAA 3MH0A 3KULA 2W1IA 3MJ2A 4IC7A 3KXXA 5FQDC 3UYSA 5IEXA 1UWJA 3F69A 2ZV7A 3PLAE 4Y5QA 2PMNX 4RJ8A 2C1AA 3E7OA 1PMNA 1YVJA 3I7CA 3UZPA 4OTHA 4BZOA 3TZMA 3FXZA 4ZZNA 3KEXA 4DEHA 4DA5A 3PPJA 2VAGA 3VF8A 2ESMA 3MSSA 5EQPA 2RFNA 1V1KA 5BPYA 3M2WA 2REIA 4FZAB 3FY0A 4I3ZA 4A4LA 4BCQA 4FKPA 4DGOA 4DFUA 2WIHA 4QO9A 2BMCA 4N57A 1FVRA 3MFUA 4CT2A 2W0JA 3VBXA 3OY3A 2CKQA 3Q9WA 4OTPA 3DB6A 1L3RE 3ZFMA 3I60A 4UEUA 3LPBA 3DCVA 4O7VA 5CNNA 4BDHA 3QD2B 4XV9A 5AP7A 3D5XA 3GFEA 3LZBA 5B2KA 3VQHA 4GVJA 4F63A 3LXLA 5LVNA 2BKKA 3TDWA 1BI7A 3GCUA 4UZDA 3JPVA 1PXMA 2GS2A 3FAAA 2BHHA 1OPLA 3SQQA 4L00A 4YC8A 4ASXA 5EW3A 4S2ZA 2C5XA 4D58A 4DGLC 2X7GA 3SAYA 1Q8WA 3ALOA 3PY3A 2ZV9A 2VO0A 2BAQA 1NY3A 4XRLA 2X9FA 2VZ6A 2PVJA 4OLIA 5K0KA 3E8NA 3NRMA 3ULZA 4XUFA 3LVPA 3VS0A 2GNHA 2X6DA 3GU4A 5A4QA 1Q4LA 2WEIA 2W1ZA 3FQHA 3BGZA 5EH0A 1ZOEA 2BILB 3K3IA 3PPZA 4HCUA 5HCYA 3UOKA 2C4GA 4YTHA 4ZY4A 2ITYA 2PMOX 4IJ9A 4QMPA 5AX9A 3CR0A 4AW0A 3R1YA 4YLLA 5JFWA 5JSMA 5KBQA 3HV6A 4ITHA 4FG9A 4RFMA 4EOIA 1J7LA 2OH0E 4RT7A 3UBDA 2C6MA 4ALWA 1CKPA 4DITA 5E92A 3C0GA 3FZRA 2YCQA 2E9VA 3HMPA 3R71A 3L9LA 4LUEA 4J1RA 4RSSA 5EI8A 4IM3A 4MQ2A 3FJQE 5CZIA 5H9BA 3KULB 3W18A 4C33A 1URWA 2OZAA 2P4IA 1JLUE 4ZP5A 2EB2A 3WYYA 4D1XA 4F9WA 1ZXEA 3OWLA 3P9JA 1NT2A 1QPJA 4IAYA 2HWOA 3SC1A 3G15A 2V7AA 2EXEA 1JKKA 4FR4A 3E8EA 5A14A 4A7CA 1LUFA 4BDJA 1LPUA 2BFYA 3BHVA 3ORKA 3TDVA 2ITPA 4E5BA 4TWCA 4D4YA 2OI4X 5J9LA 5AUWA 3I5ZA 2VRXA 2AUHA 4TWNA 3SXRA 2VO6A 4KSPA 4X2GA 4ZLYA 1Q41A 3R7YA 3UO5A 4H05A 2I0VA 4DF3A 3UOLA 3PJ3A 5CEKA 1XH9A 3LW0A 4UBAA 5EDPA 4R6VA 4TYJA 4JAJA 4U0IA 5CALA 2X7OA 4YNEA 4H3PA 4ZZOA 2OW3A 3QD4A 5KHXA 3HA8A 4RGJA 5LOHA 4FV1A 3SA0A 4MBJA 3ENMA 1H1QA 5CLPA 4C4FA 4YHTA 2F2UA 4LRJA 4WSQA 4FNXA 4O1PA 3PJ2A 3R7IA 2XP2A 2J7TA 4Y85A 4M0YA 5HX6A 1O6YA 3W2PA 4ID7A 2PSQA 3GUBA 1ZOHA 1ZYSA 2JKMA 2PVFA 4FKWA 4A4XA 1UU9A 4XG3A 3QFVA 3JY9A 5C8NA 4JG7A 3FBVA 3W33A 3D0EA 2A1AB 3QKKA 1UNGA 4J7BA 5CSXA 4FZFB 2QR8A 4ZSGA 5IU2A 5DR6A 1AD5A 4LGGA 3PSCA 2DUVA 3QZFA 5L8JA 1YDSE 5E90A 5CSVA 3T8OA 1IG1A 2XEYA 3MIYA 4FSTA 4PTGA 4BCNA 3DTCA 4E6AA 5AAFA 3NUSA 2NP8A 3CQWA 3RHKA 5DFPA 4ORKA 3PIXA 3QRTA 3LJ1A 3QBNA 4YBKA 2OIDA 5AP0A 4O7ZA 5JKGA 1CKIA 4XLVA 3DBFA 4I20A 4C8BA 1H0VA 4I1ZA 3UZRA 2H34A 1DI8A 3TWJA 4U8ZA 5J79A 2HAKA 3ZC5A 4MXZA 4KIOA 3ZM4A 2OZAB 1I09A 3GQIA 3FI3A 2V55A 3PXZA 3R83A 4AP7A 3MIAA 4DHFA 5M53A 1T45A 4EJNA 2I6LA 3RPSA 3KF7A 4EKKA 4NIFA 4PP9A 2R4BA 3IGOA 4QMZA 4XRJA 5TT7A 2PYWA 3POOA 3NUXA 2KTYA 2P2HA 3ZSGA 5HCZA 5B7VA 4BI2A 3G2FA 4TPTA 1R1WA 2QHNA 1P5EA 3BX5A 4HGEA 4JLCA 3QRKA 3CXWA 5ETCA 2YITA 4GSBA 2XK3A 5HO7A 2VD5A 1WAKA 3AD4A 5HE1A 2GQSA 3Q3BA 4J97A 3VHEA 4QMLA 4DEEA 3TUCA 4FT3A 3PXRA 4XG8A 4Z7HA 4FUYA 4UXLA 3RBWA 3IW4A 1OM1A 4ERKA 5K5XA 5L6PA 2I7QA 4UMQA 2QODA 3IW8A 4YP8A 5AUZA 3RTPA 3FV8A 4EH4A 2YCSA 5C8KA 1CMKE 1O6LA 3FXXA 4IWDA 4MXAA 3JXWA 5DWRA 2AC3A 3DV3A 4KKGA 4DGNA 2IJMA 4YO6A 4X2FA 5CT0A 3HMMA 4DFXE 3OXTA 4AZWA 4DFLA 3A8WA 3IW5A 1PMEA 3PXKA 3S0OA 1Z5MA 2C6TA 3LCSA 3ZONA 3QU0A 3TN8A 2WNTA 4FTCA 3CD3A 2J5FA 2WPAA 4L7SA 2ZM3A 4LQMA 5FTQA 4E4MA 1GZOA 2R0UA 4U44A 2JIUA 4M69A 3N4UA 2WOUA 4QNAA 5FTGA 2UZNA 3QCXA 3F7WA 4AT4A 5E8XA 4QMXA 3Q9XA 4KIPA 3EQFA 4C4HA 1KV1A 2W96B 5BMSA 4DCAA 5J8IA 3RZBA 2ITZA 1CKJA 4RX7A 4BYIA 4DLJA 1OL7A 3DB8A 2QONA 3U87A 5AR3A 4B8LA 5EKNA 2VNWA 5DEWA 3L9MA 2X4FA 3H0YA 5HG7A 3HV7A 4Z55A 2QOCA 5GZ9A 5FM2A 5HO8A 3TV7A 4FV8A 3VHKA 3ZFYA 5EDRA 3H9RA 3VUDA 4YO4A 3OHTA 3TJDA 2QVSE 3SG8A 3ACKA 1YWVA 2BRBA 4GK2A 3QKLA 5HQ0A 4U41A 4JL9A 5HE3A 4BTMA 4NIFB 2ERZE 2J90A 3FPQA 4YTCA 3UPXA 4QP9A 3ENHA 3HUCA 2GPHA 2F57A 2NPQA 4O96A 4ANLA 4BC6A 4IX4A 3WZDA 3UE4A 4MXOA 4I0TA 4D9TA 2YAKA 3AMAA 3QQHA 4Y5HA 4V0GA 3QAME 3PRIA 3OTVA 4NW5A 3RVGA 2W05A 4P7EA 5LMBA 4G16A 4PL5A 5LARA 3B2TA 3QQUA 4LMNA 2XIZA 4KABA 3LHJA 5D7AA 5BQ0A 4GFMA 2OJJA 5AJQA 4PMPA 5BUJA 2HY81 3V5LA 4FVRA 4HVIA 3F5PA 3PJ1A 3OROA 4FTKA 5AR8A 3RK5A 3NUAA 1MRUA 3DNDA 3RPVA 4EONA 3D4QA 1PMUA 3BELA 4YUQA 2ETMA 4C61A 1MQ4A 2CGVA 3Q4ZA 4R3PA 1UU8A 4O22A 2ITQA 3UP7A 1BUHA 1SM2A 5M09A 3PRFA 1ZYCA 4C36A 5M08A 4TNBA 1H26A 3CS9A 2RFEA 2XF0A 2XK9A 2ZJWA 3HA6A 1SZMA 4CG9A 5HLWA 4MNEA 5IA4A 3ANQA 4FIFA 3SLSA 2R3PA 4ALVA 4PDPA 2IN6A 3ZYAA 2C30A 5E1EA 4M69B 4CCUA 5JQ5A 4BR3A 2W1DA 4J96A 4LL0A 3GCQA 4LM5A 4FKOA 1UKIA 3BHYA 3VBYA 3HAVA 4DG2E 4EOQA 4E3CA 3MA6A 5FDPA 5IQBA 4YMJA 5CNOA 3ULIA 4YTFA 4O0YA 1OL6A 1UWHA 2YLEA 4G5JA 3WF6A 2QI8A 2E9NA 3ODZX 5CU2A 2HCKA 4JDKA 2UW6A 3F5GA 3F3WA 4HYUA 4QOXA 4QYEA 3QQLA 2G2HA 4C7TA 5CT7A 3DS6A 4L42A 2CHLA 3LOKA 1M14A 4L53A 4C0TA 4JR3A 1NW1A 5IQEA 1ZMWA 5HGIA 4EUUA 1KOBA 4QMVA 4JDHA 5CAQA 3MB7A 5M57A 3BE2A 4QMTA 4FOCA 4D28A 1IA8A 4QTCA 2ZMCA 4OTIA 5EM6A 4II5A 2JBPA 1M17A 3QX2A 4H58A 4V0GB 3PFQA 4IM0A 2Y8OA 4EBVA 4CKRA 2G01A 4WIHA 1ZWSA 3KMWA 4DAWA 4IC8A 4RVLA 4GS6A 3IGGA 4O91A 4UWBA 3MS9A 1SNXA 1TQMA 2FSLX 4P5ZA 2PZRA 5ETIA 5EYCA 4BDCA 3IO7A 4BKZA 1OUKA 3RPOA 4ZSJA 4EC9A 3G6GA 3RKBA 4ZAUA 4S32A 4FBXA 2VO7A 3EQPA 5DT4A 4L46A 5JFXA 4BVUA 4RZWA 4K77A 4EK6A 3KY2A 4XOYA 3VW6A 4NM3A 3ET7A 3ZUVA 4D2VA 4MD7E 2XRWA 3HV3A 3KRXA 2YIQA 1H1WA 4DEIA 2P33A 1F3MC 1VYZA 4U79A 2WMAA 5IH6A 4ACGA 3KMUA 4MNEB 4QP6A 3U6JA 3R02A 3K2LA 1GOLA 4GIHA 4QD6A 4AN9A 5T68A 2XS0A 4GFGA 3AT3A 3ORMA 3O50A 5CEPA 2HXLA 3UGCA 4BZNA 3RAWA 1GIJA 4YJPA 1WBVA 3G51A 3TJCA 2CKPA 5HTCA 2BDWA 4JOAA 4XG7A 1Q3WA 3M1SA 4NW6A 4XHKB 3V5PA 1YI3A 4CTCA 3A4OX 3H9FA 4FKVA 5DLSA 4XG6A 1GIIA 5AP2A 4IM2A 2B1PA 4LYNA 3QTIA 3V01A 5A4EA 4G6NA 1EH4A 3DZQA 3QX4A 5E8YA 5JH6A 4K6ZA 1APME 2ERKA 4M66A 4FSWA 4C4IA 3R8VA 1G5SA 4ZTHA 2CSNA 3Q60A 2PHKA 3D83A 4QYYA 4H39A 4MHAA 3LXPA 4EC8A 3C50A 4YURA 3SXFA 3DY7A 1H4LA 3AC8A 4Q5HA 5C1QB 2BTRA 3UPZA 5AIRA 3MGYA 4RQKA 2PMIA 1PY5A 1NVQA 2RF9A 2UW8A 2B9HA 3NYOA 3R8UA 1A48A 3F88A 4FKUA 4AW5A 3I1AA 5IUIA 1U46A 1JKTA 4MWHA 4B99A 3PY0A 4TWPA 5E8VA 3KRRA 5FP5A 2GS7A 4CQGA 5CF5A 4R77A 2P3GX 3BZ3A 3R73A 4OBPA 2WMWA 4FL3A 5EFQA 3NIEA 2CJMA 3PSDA 4YC6A 5H8EA 1J1CA 4BIEA 3ACJA 4I0RA 1WCCA 3LCTA 4MTAA 3Q96A 3ZRKA 4ERWA 3MYGA 3HV4A 3IOPA 2GTMA 4FTOA 5AMNA 4DH5A 1IA9A 5EW9A 4B8MA 5AR5A 1YI6A 5K9IA 4YJSA 4RA5A 1PJKA 1FGIA 4G1WA 3VS7A 3EKKA 2A19B 4K33A 1Y6AA 2GNGA 3BU5A 3LJ0A 4FV4A 4QYFA 4Y46A 4NSTA 5ACKA 3UVRA 3O7LB 2O63A 4BN1A 4L9IA 4IVBA 3AQVA 4CFWA 5HU3A 4F6UA 5KX8A 3D7TA 4CMUA 3QQJA 2UZUE 3R21A 3NCZA 3Q52A 4FIGA 3WYXA 5CQWA 1WFCA 3FI4A 2R3QA 4MXXA 2XMYA 3DBCA 3IDBA 4FMQA 3RWQA 3NZ0A 2JDTA 3CGOA 3NGAA 3OWJA 1HCLA 3E8CA 1FVVA 3UIUA 3A4PA 3PP1A 4UZHA 4I4EA 2XJ0A 4LOPA 3DJ7A 3TKUA 1LR4A 3VS1A 2YLFA 1W7HA 3HDMA 2VWVA 4JX3A 1JKLA 4FL1A 2OWBA 4LMUA 2X1NA 5AR2A 3TZ9A 1O9UA 1TVOA 5EOBA 4F08A 4X2JA 3W2OA 2YZLA 1H0WA 2GFSA 2ZV2A 5L6WL 4CSVA 2PE1A 4RWJA 4W9XA 5GZ8A 3SDJA 2WTCA 3V6RA 4PNKA 3RINA 4DG3E 3TM0A 4D0XA 2WMRA 2BALA 2ZM4A 3OTUA 4GH2A 3VS3A 2JAVA 4B0GA 3K3JA 4YJOA 3QWJA 3GP0A 3FZ1A 5IA1A 2UVYA 5BVDA 3ANRA 2CDZA 5HI2A 3FMNA 2C47A 3BQRA 1WVYA 3KQ7A 3A60A 4PRJA 3MH2A 3AD5A 4ANQA 2A2AA 3GCVA 1TQPA 4GV1A 1YOLA 4XH6A 1M2RA 1UA2A 1U4DA 3HMNA 3R01A 1OIRA 4TYHA 2OSCA 3UIXA 3SX9A 5JGDA 1Q24A 2W1CA 3KC3A 2VV9A 3Q5ZA 4F6SA 1OGUA 4KBCA 2VWBA 4AU8A 3E3BX 1J91A 4M68A 4FV5A 3HNGA 4LFIA 4WA9A 3COMA 2ITNA 4I93A 4FICA 5KNJA 3PY1A 1ZLTA 3Q32A 3E62A 4W8EA 5HLPA 5AM6A 3BEGA 5HE2A 1GJOA 2QG5A 4DEGA 3VUMA 3NW5A 3R63A 2W06A 3W55A 3PYYA 4AACA 2XEZA 1WZYA 4JJRA 4EOMA 4QP3A 1R3CA 3PPKA 5IH5A 3TV6A 4Z7GA 4XP3A 4EBWA 1E1VA 3HYHA 5IUGA 3FMDA 4UN0C 3OCGA 4F9BA 1PW2A 4ZIMA 2O8YA 3VBTA 2R2PA 2XYNA 3OBGA 4MH7A 5CSPA 2ITWA 4KIQA 2HZIA 4G9CA 2HW7A 2W9FB 2OU7A 5AUTA 2XJ1A 3AT2A 3JVSA 4IXPA 4C57A 4YLKA 3W8QA 1FINA 4BDGA 2F7EE 5JFSA 3KN5A 4BI0A 3VBVA 4IAFA 3R9OA 3L8SA 3KVWA 2FYSA 5KZIA 4DFYA 3FY2A 2GNLA 3BQCA 4WT6A 5A6NA 2WTIA 2C3KA 5L2IA 4WHZA 2V7OA 2X2KA 4J98A 2QU6A 2HWPA 5E8SA 3R1NA 3OZ6A 2JBOA 4DCEA 2JKKA 3GCSA 4USDA 3DLZA 2WTDA 4GU9A 2GCDA 4X3FA 3T9IA 3ORLA 3SG9A 4C02A 3S1HA 5M56A 2PUNA 1FGKA 2FSMX 3LCOA 3TZ7A 4HCTA 2QOOA 3EQRA 2PUUA 3PSBA 3ELJA 4X0MA 3HRCA 3MPMA 4IZAA 4GG7A 5I9VA 5IQFA 3MPAA 4L6QA 5C4KA 4KB8A 2X8IA 2NNWB 2W4OA 5EKOA 1BI8A 1UV5A 2BPMA 3EYHA 4TYHB 3R2YA 4EZ7A 3P23A 4J99A 3VC4A 3VUGA 4ZTQA 4FTTA 4C62A 3GENA 5DRBA 2HYYA 4IW0A 2C3LA 2XH5A 4FKSA 4PDSA 3FZOA 4C58A 2BIYA 4CYJA 3AC1A 4FC0A 4DH3A 2V5QA 3GC0A 3MPTA 4EH5A 1P2AA 3PWYA 3AXWA 3BYMA 3PP0A 2BRNA 1JNKA 4W8DA 5L8LA 1FVTA 1QMZA 2QCSA 3LLAA 4FTRA 3PVWA 5IA3A 5G6VA 1KE5A 1DI9A 1KOAA 4RJ7A 4KKHA 1WBWA 2Y6MA 2Z7QA 3BLHA 3KK8A 2PULA 3ROYA 4DEDA 2C6LA 3GNIB 1XH7A 2VTSA 3DXNA 3KCKA 4P2KA 4KIKA 4O7TA 4Z3VA 5C8MA 2OICA 4YTIA 5M55A 4RWLA 5A4TA 3F9NA 4FYOA 3C4EA 3NLBA 2JIIA 1ERKA 4YBJA 2OBJA 5AUVA 2IW8A 2WXVA 3VO3A 4CFUA 2CNVA 1Q97A 3N4VA 4CFFA 4ENYA 4OTWA 3IONA 5DYJA 3HECA 4PQNA 3V5TA 5KHWA 1LEWA 2YA9A 4YSMA 2OFUA 3LE6A 3DU8A 4U5JA 1PF8A 3HVCA 2HZNA 3VUKA 1DS5A 5IMXA 2PZPA 2UW3A 4EWHA 5E8WA 3ZO4A 1YHWA 4HPTE 4IZ5A 5HICA 3OS3A 3ZFXA 3DK7A 2WMBA 2WO6A 5M4CA 1NA7A 1H1RA 1PHKA 1H8FA 1J7UA 2UZTA 3CKXA 3EQCA 3U9CA 4FTIA 4DFNA 4FT5A 1W84A 2EXMA 4FV0A 2QR7A 3DJ5A 3WE4A 3EQDA 4JT3A 4X3FB 4D5HA 4J52A 3EN4A 5JZNA 3UODA 2QOIA 4HJOA 3LFEA 4EK8A 3NWWA 3QXOA 4BDAA 2PZ5A 2PVNA 5D11A 3M42A 1XHAA 3KK9A 4JBPA 1A06A 2WQNA 4QMMA 1JBPE 5M4IA 1OI9A 2JGZA 3COHA 1NVRA 4Y72A 3QA8A 4F7LA 3OOGA 3GU5A 3DDQA 5EI6A 4DEBA 5J1VA 4XEYA 3PA4A 3BWFA 3KN6A 4HPUE 2C5YA 4U6RA 2QURA 4NCTC 5LVLA 3C13A 3UQCA 4HNFA 1UNHA 1Y6BA 5ANDA 3ROCA 4XP2A 3KRLA 4V01A 1JPAA 2JKOA 2IW9A 5JRQA 3W32A 3MVJA 4KSQA 5EDQA 2GHGA 5LVOA 3UG1A 4ZTLA 3BLRA 1SVEA 2E9PA 3BIZA 4E7WA 4EHVA 4YR8A 2JDRA 5A4LA 2C6EA 4KRCA 4NEUA 5AAEA 4FVQA 3EN9A 3P7CA 4KIKB 3BV3A 4ZY6A 4ALUA 3R0TA 3AMBA 1OKVA 3Q2MA 3RP9A 3UNJA 3ZBXA 5DOSA 5KKRC 4LG4A 4NM7A 1JAMA 4IANA 4H36A 3REPA 4PPBA 5CX9A 3PDTA 5CQUA 2C6OA 2PVMA 2OJ9A 3P5KA 3FKLA 2WU6A 3QCSA 4EH3A 4JDJA 4O2PA 2ITVA 4DGGA 3S3IA 4XYFA 5CVFA 3EJ1A 1XJDA 4RQVA 2VN9A 1FMOE 1RQQA 1OIYA 5IDNA 2QQ7A 2CPKE 1JQHA 3ALNA 3C4ZA 3C4XA 3MESA 1REKA 4BBFA 4P4CA 4RFYA 4ZK5A 2HW6A 2H9VA 5D12A 3MFSA 4X3JA 5KZ0A 3KREA 4ACCA 4MAOA 1OITA 3FWQA 1J3HA 3UJGA 3U55A 4OR5A 3DOGA 2W99B 4FV7A 3ORTA 1K3AA 4W4XA 3W8LA 4BY9E 4D2RA 2VTTA 2OGVA 4GUEA 2GMXA 4G2FA 3EQIA 3QRIA 3R00A 3FZSA 3O7LD 3A8XA 5TO8A 3EQBA 2ZB0A 3JS2A 4L68A 4O0RA 5AADA 3MY1A 3IDPA 4HVHA 1B39A 4RRVA 4FNZA 3IG7A 4EOOA 3LFSA 5BVNA 1DAWA 3C0IA 2V0DA 3QC9A 2PY3A 1ZYJA 3C1XA 4BKJA 4EOSA 4FZ7A 2R3RA 1ZY4A 1W8CA 1BX6A 2PWLA 2H6DA 2QOBA 2CLXA 4HGLA 4F9YA 5CAPA 5KMOA 1LEZA 2LAVA 4FSQA 3KXMA 3ZM9A 1YXUA 4U7ZA 5FWKK 1WVXA 4O21A 3QZGA 3UIMA 4BCPA 3AT4A 5CTPA 3DFCB 4CD0A 2XIYA 5CVGA 2ZDTA 5M07A 3GEQA 5I5ZA 1ZMVA 2FVDA 2O5KA 5J9YA 4FIEA 4TNDA 4ZZMA 4ZXTA 4ENXA 1XO2B 3VS5A 4DFZE 2BUJA 3TI1A 4O2ZA 2YIRA 4ACDA 3WIGA 2X2LA 2XKDA 1F5QA 4D2TA 3SOAA 5AP5A 5L8KA 1XH8A 3BYOA 4EUTA 4GK3A 1XKKA 2C3JA 3AMYA 3KXZA 3NDMA 4XV3A 5HNGA 3DQXA 4OAUC 2GQGA 2VTQA 3TCPA 4BHZA 3D15A 4L8MA 2VU3A 5CU4A 1JSUA 4AX8A 3HRFA 3SOCA 4B9DA 3U6IA 2RFDA 5L2SA 4NKSA 4XLIA 5F94A 2UZEA 4WNKA 2IW6A 3IQ7A 4GYGA 3VAPA 3IPHA 3PLSA 3LFAA 2WQOA 1OKZA 3F82A 3ZUUA 4FV3A 3DT1A 3NNUA 3RALA 3UYTA 4DT8A 5IA5A 4JAIA 4C34A 4LGDA 4QP4A 5EI2A 3SXSA 1H07A 2O64A 3P4KA 5J7HA 3HMIA 5J9ZA 5EM5A 2WMQA 5HG5A 4C3PA 3OMVA 3DZOA 3FZPA 5M51A 3GU6A 4RZVA 2UVZA 3QYZA 4XV1A 4J53A 4BCKA 4WNOA 4GT4A 4YJRA 3F61A 2RGPA 4I6QA 4A9RA 5LMKC 5IMEA 2HELA 3FYKX 2QOFA 3GB2A 2O3PA 1PXPA 2WTKB 2JFLA 4BBMA 4CFNA 4BGGA 3K5UA 4FL2A 4YJTA 2B9FA 3EN6A 4AA0A 2PL0A 4EZ3A 3WF7A 4F1TA 2XK4A 3A7JA 2R7IA 2PZIA 3PWDA 4J8MA 4RIWA 5HNBA 4FT9A 4AWIA 2VWYA 3UP2A 2CLQA 5I9ZA 3EHAA 5GJGA 4TZRA 4Q9ZA 2BRHA 3ZEWA 2QLQA 2XVDA 5DT3A 4F7SA 4CXAA 5GIPE 3TG1A 2XRUA 1CTPE 1REJA 4EOPA 3O0GA 3R6XA 5E8TA 4MXYA 2BKZA 3KL8A 1IRKA 2JC6A 2X4ZA 3DGKA 4B7TA 3QUDA 3F66A 5LWMA 5CEIA 1R0EA 2X7FA 3MH1A 4M67A 4MX9A 4EK4A 2R7BA 4X3FC 3OCSA 4O1OA 4UWCA 5GJFA 3II5A 5DHJA 4XBRA 2UZVA 4F7NA 2BVAA 3R1QA 5B2LA 4GT5A 2B9IA 3B8QA 3MTLA 3U4WA 4H3QA 2XB7A 3FLNC 4LGHA 2PZYA 4BCOA 3Q6WA 1OPKA 1YRPA 2GS6A 4JG8A 5ANJA 4LL5A 4BDIA 4X6QC 3MBLA 4UMUA 1U59A 2HY0A 5BYLA 4U3ZA 3OF0A 4GRBA 3UNZA 4IMYA 5C26A 4CFVA 3NIZA 2R3GA 1OIQA 3VJNA 3ATSA 4UXQA 4YZNA 2EU9A 4PF4A 3QTWA 4M3QA 4RIYA 4FZ6A 4PV0A 3DAKA 5IQAA 3JVRA 3SGCA 2B53A 4XG9A 3NR9A 3K5VA 4FTMA 3CY3A 3QGWA 3ZTXA 2BTSA 4E8AA 5DPVA 4FEVA 3DK6A 1DAYA 4YLJA 3I81A 5FRIA 2Q0NA 2YABA 4MD9E 5HX8A 3PJ8A 3EL8A 4MVFA 5KE0A 3CTHA 4AOIA 2BAJA 3D2KA 4LV5A 3OW3A 4K18A 3QTUA 4XMOA 4YJUA 3ZZWA 4R8QA 5CEOA 3NVMB 4NTTA 4F4PA 2Y7JA 2ITXA 2QO9A 5L3AA 2CNQA 4L44A 4M13A 3RMFA 3H30A 5BYZA 2G2IA 5ITAA 4DEAA 4JVGA 3OXZA 3R7GA 2HK5A 2YWPA 3KF4A 4QQCA 4RIWB 4Y95A 3TIZA 5KMKA 4FV9A 4O7LA 4X2KA 5AR4A 4ZJVA 1WBOA 4BTFA 3SD0A 3CTQA 2OXXA 3QD3A 4AA4A 2DS1A 3EZRA 2YM4A 5B0XA 1KSWA 5CAVA 3D5UA 3NS9A 4O7WA 4U3YA 4O86A 1H25A 3MVLA 3NEWA 2C68A 3FMKA 3P86A 4EH9A 2E9OA 1GZKA 2WOTA 4QMNA 5DBXA 3ZDIA 4EHZA 3HRBA 1XQZA 3Q4TA 4WO5A 1IASA 2W1HA 4APPA 4QTEA 2CN5A 2R3OA 1J1BA 2YM3A 4F9AA 4BCJA 2Z7SA 4PTEA 3COKA 4A9UA 5DNRA 5LCKA 3VS4A 5DG5A 3I0OA 5HD4A 2AYPA 3OEFX 4QTAA 2ITUA 2XK7A 4RBLA 4TKSA 3MVMA 2OF4A 5LJJA 3FHIA 3CKWA 4G31A 3ORNA 3E87A 4ANOA 2UUEA 1V0BA 2JD5A 4ASZA 2DWBA 4R7HA 4TL0A 3R7UA 3HAMA 4AZFA 3DAEA 3ZUTA 4FV2A 2J0KA 2RSVA 4AFEA 3LMHA 4C4JA 3QTXA 4CQEA 5T6KA 2Y9QA 4DN5A 2J2IB 4JIKA 2J0MB 4BZDA 2YEXA 3WIKA 2ONLA 4QPAA 4BICA 1UVRA 2HOGA 1PMVA 4FSNA 4KINA 3CTJA 4JG6A 4I5MA 2I0HA 4D55A 2O2UA 3P08A 5BMMA 3ZLWA 4CRSA 4A9YA 2NO3A 2VUWA 3GBZA 4ZTMA 5BVOA 4FG7A 3EFLA 4XG2A 5IEYA 1LP4A 4ZSAA 5H3QA 2CCIA 4AGDA 4DTAA 2ZAZA 2W4KA 3KB7A 4IWOA 3HUBA 4QP2A 1T46A 4CZTA 4CMTA 2Y4PA 4QMQA 5EQYA 4GMYA 2XBAA 3BEAA 2BHEA 4MKCA 4EL9A 4QMOA 4HCVA 4U9AA 3A7HA 3AC5A 3R9NA 2YACA 3ORPA 4PY1A 4QNYA 2QLUA 3O2MA 3POZA 5JK3A 1DM2A 3FYJX 2C3IB 2BRGA 2ZYBA 2GU8A 5KMNA 4A4OA 4O83A 2WGJA 5BVWA 2C0IA 2YDIA 3TNIA 3CCNA 3ZLXA 2FSTX 4IEBA 2R3JA 1W0XC 2IVUA 3K54A 2BZJA 2UW5A 3AGMA 4O38A 2UW9A 3R8ZA 4DH7A 4EHGA 5A9UA 5KMLA 4IWQA 1JSVA 3EH9A 4D4VA 5D7VA 3MDYA 1OVEA 1PXJA 4C3RA 3SW4A 5AV2A 4XP0A 2CGXA 2YAAA 3TNPC 2RFSA 3C0HA 3BE9A 4TYEA 3TKIA 3QTSA 2CGWA 4FV6A 5DH3A 4CLJA 5EQEA 5CAUA 5LMAA 4BDBA 2YISA 3LKMA 1M2PA 3CPCA 3MFTA 4E1ZA 4MWIA 3IK3A 3GC9A 3QRUA 3VRYA 3FKNA 5IZFA 4RPVA 5LVPA 4AFJA 2ETRA 4OW8A 3ZZEA 1IR3A 1HOWA 3C51A 4BWPA 2JLDA 4O6EA 2J0LA 3QALE 5FGKA 3NNWA 4ZJIA 3RAKA 3RWPA 3LFFA 3Q4UA 1Q8TA 4MXCA 4FX3A 5ANKA 3ZSHA 3PA5A 4UMTA 2E2BA 2YJSA 4AE9A 1YWNA 3FMHA 4Y73A 4AZTA 5KBRA 4BCFA 1G8SA 1Z57A 4EZ5A 4BDKA 4BF2A 2BDJA 4GKIA 2WELA 4Z9LA 1Q8UA 3BBWA 4NJDA 3R9RA 4JDIA 3W2SA 4Z16A 3WF9A 2YCFA 1WBNA 4FEXA 4G3DA 1H1SA 5AUUA 1VR2A 5LXMA 4YZDA 5J5TA 3NAXA 3GGFA 2W1GA 3FI8A 1CSNA 1RW8A 4I6FA 3KRJA 4PX6A 4A07A 5KCVA 3H3CA 3D7ZA 2I1MA 1YXVA 4IFGA 4L45A 2SRCA 5L2QA 4BWKA 4YHFA 2VGPA 4D2WA 3UVPA 2BROA 4QQ5A 3U8WA 5DR2A 3LM5A 3BHUA 4EEVA 2F9GA 4YNOA 1OECA 3OWKA 4CLIA 5AAGA 2J50A 3KMMA 3BWJA 5KUPA 1PRYA 4DC2A 2XNOA 3FQSA 3OWPA 3UC3A 1PYEA 3ZO1A 3JYAA 2GDOA 4LOOA 3AC4A 2OJFE 5A46A 4CKJA 2BZIB 5DR9A 3V8WA 2BIKB 2PVRA 2R9SA 3DAJA 2VTJA 2XNMA 3R8LA 3VUTA 3R8MA 2UW4A 3HZTA 3PG1A 2OFVA 5H2UA 3T3VA 5E9EA 2I0YA 3BPRA 3PVGA 5HIDA 3IW6A 3TEIA 4EQUA 5KMJA 4AS0A 1YDRE 4B6LA 4DBXA 2PK9A 4FSZA 4CVAA 5AR7A 4USFA 4M15A 3F5XA 3QTZA 1KE8A 3EWHA 3L8VA 4XG4A 4EOJA 4L3PA 3KA0A 3QZIA 4MQ1A 4LV8A 3Q4CA 5HD7A 2R3LA 3DKOA 5E4HA 1Q99A 4GL9A 5AEPA 4QT1A 5FM3A 4R3RA 3MFRA 3OFMA 4PL3A 2EB3A 3UTOA 3QC4A 3UZTA 3NNXA 4E4XA 3AD6A 2XNGA 3T9TA 4AG8A 4Q5EA 1VJYA 3FI2A 5CF8A 4G34A 3BKBA 3CD8A 4EK5A 4C2VA 4O0WA 3NNVA 3KFAA 4I5HA 4O0VA 5HCXA 3Q2JA 4KA3A 1YXTA 2JITA 4I24A 4AGWA 4ZOGA 5AP3A 4AN2A 1SMHA 4IVDA 5DGZA 2OXYA 3OCTA 4B4LA 2VTIA 3R9HA 3LJ2A 3D2IA 3OY1A 4O7RA 4MD8E 3H9OA 1KV2A 3FZTA 4NFMA 1H24A 2RIOA 4IDTA 1CM8A 4FKQA 5FBOA 2J6MA 2BZKB 2YIYA 1Y57A 3OG7A 1GIHA 5I9YA 4RVKA 2F4JA 3E92A 2X39A 2P55A 3D7TB 3R04A 3A62A 4NT4A 4FKTA 5F20A 3UQFA 3MY5A 2CKOA 1F0QA 4NL0A 3FLWA 3QA0A 2YM6A 4NM5A 3E64A 4BCMA 4ANMA 3L9NA 1Y8GA 4FF8A 2FB8A 3EKNA 3DBEA 1SYKA 2OJIA 3OC1A 3DJ6A 3D14A 3OT8A 4O0SA 4IDVA 3TTJA 3V6SA 3ZRLA 3VBWA 5EM8A 4EYJA 1MQBA 1OZ1A 1ND4A 4EOLA 4EYMA 1NVSA 2C0OA 2EXCX 4OTGA 4OTRA 2VTAA 4RX8A 3AC2A 4ZTSA 3TZ8A 5IISA 4JR7A 4ARKA 3H0ZA 3E7VA 2HZ4A 4RVMA 2BDFA 1X8BA 4S34A 3QUEA 3OUKA 2P2IA 2QO7A 2R3FA 4TN6A 3KKVA 5EYDA 1YOMA 1R39A 2PE2A 5EW8A 1JOWB 4ANBA 3O51A 3HV5A 5LCJA 1H1PA 1G8AA 1M7NA 3DBDA 3E5AA 2QHMA 2X9EA 4RLLA 4U42A 2FGIA 2B55A 3QXPA 3VS6A 3RGFA 1RDQE 5HZNA 1BL7A 4QRCA 4V05A 3MA3A 2BFXA 5CY3A 4FYNA 2QOKA 4PL4A 3UOHA 2JEDA 3ZSIA 4ACMA 3FLQA 3UIBA 4AF3A 2JDSA 3QCQA 2PPQA 2GHMA 1OKWA 3D94A 2J5EA 5CSHA 5CU3A 4RIXA 1W82A 5HORA 4I22A 2W4JA 3GU8A 5CS6A 2QU5A 1P4OA 5C03A 3FUPA 3Q9ZA 3PXFA 4U45A 4JS8A 3U9NA 3WZUA 5C27A 1UKHA 4E5AX 4ITIA 4F0GA 4BCHA 4FZDB 4GFOA 3MB6A 4ZS0A 4BWXA 2C5VA 4FT7A 4MF0A 5EYKA 5A4CA 1YXSA 1SVGA 2WMUA 5AM7A 4QP7A 4AZVA 4BIDA 4EHEA 2CN8A 4F0FA 3R2BA 4P90A 5BVFA 2YIWA 1A9UA 4IVAA 2H8HA 2VTOA 2YFXA 3V3VA 1MP8A 3I79A 4L67A 3RHXA 4F0IA 5IKWA 3NX8A 3HX4A 3C7QA 1WBTA 5EHYA 3QWKA 5I9WA 5M06A 2FO0A 2RG6A 4G9RA 4RA4A 4RC3A 5HEZA 4U40A 1ATPE 2XKEA 1ZYDA 3KGAA 2VTHA 2Z2WA 3DNEA 3DKFA 2R0IA 4DG0E 1JSTA 2XNNA 2J51A 5HVJA 4CRLA 4JQ7A 4FODA 3G6HA 2W9ZB 1PYXA 3BHTA 2CKEA 2Z60A 3NUYA 3P0MA 3ITZA 3PIZA 3PTGA 1Q3DA 3CY2A 5CXHA 2WMSA 3UOJA 4NTSA 5TF9A 2C5OA 1H08A 1R0PA 4CV8A 1J7IA 1PXLA 4OGRA 4D2SA 2J9MA 4ZTNA 3EL7A 4CMOA 1JVPP 1M52A 2ONLC 2WHBA 3PVBA 1B38A 1XWSA 4QP1A 4UMPA 2B9JA 3MI9A 4EWQA 3VNTA 3WZJA 2QG7A 4G17A 2R3NA 4AT3A 3KU2A 4DE4A 3R28A 3QUPA 2W5AA 1ZY5A 2QO2A 1XBAA 4GJ3A 4NJ3A 5BUIA 2R3HA 3GT8A 2GNIA 4ACHA 2X8EA 2B4SB 2GNJA 4BGQA 2PE0A 3NAYA 4O7YA 1M7QA 2OH4A 4MF1A 3F3VA 1BMKA 4R7BA 2VTRA 1MUOA 4MBLA 4ZTRA 5HO6A 5JGAA 3QTQA 1FMKA 2C6DA 2HXQA 1WVWA 2YCRA 4FTQA 2YM7A 5EM7A 3TIYA 5K4IA 3VRZA 3F5UA 4CG8A 3QCYA 2HIWA 4EJ7A 4DFBA 3KXHA 3LAUA 3QGYA 4J95A 4O7SA 1GNGA 4KS7A 5AP4A 3QLGA 5CWZA 3RJCA 4F70A 4OUCA 3ZH8A 3BLQA 1Z9XA 3EFWA 2XCKA 5ETFA 5I3OA 4FG8A 5AA8A 4IH8A 4U80A 1SNUA 3ORXA 4BIBA 1OL2A 5BYYA 4E6DA 3QLFA 4L3JA 5C9CA 2YJRA 4BFMA 3JR1A 1YI4A 5BX0A 4USEA 3OOMA 3ZXTA 5IA0A 5HBHA 5I4NA 4FKJA 3B8RA 4ASDA 4OTDA 4KD1A 5ANGA 3A99A 3UMWA 2NRYA 3VUHA 3JY0A 2EWAA 4FTUA 4G6OA 4BHNA 3TNWA 2C5NA 3F3TA 2PVYA 4N6YA 3KCFA 3WBLA 4CV9A 5I3RA 3V8SA 3LFCA 5HKMA 4KUJA 1BLXA 1E1XA 4FKRA 4IE9A 2YM8A 2W5HA 3TTIA 2G9XA 3AG9A 5CF6A 4HOKA 4AT5A 4EOKA 5IUHA 2ITOA 5K4JA 5C01A 4PDYA 3U51A 1L8TA 3I6UA 4RLKA 4IX3A 4QPMA 4W4WA 4YZBA 3UO6A 4GK4A 3ZO2A 2UZLA 5E8ZA 1OIUA 2IVSA 2WB8A 3CPBA 4I6HA 4IB0A 4S31A 2YDKA 1UNLA 4YJQA 5L2WA 5AP1A 3FLZA 3QRJA 2VGOA 3LFNA 1XBBA 2F49A 3QKMA 4IZYA 4XOZA 2XK8A 4K9YA 3LFDA 4HGTA 4IX6A 4O27B 5HG8A 3VBQA 4JQEA 4CGAA 1S9IA 3VWAA 3DFAA 5CSWA 1OB3A 4OT6A 1U5QA 4RIOA 2V22A 4IBMA 4L43A 3GVUA 4E73A 3E8DA 3PA3A 3PXYA 5DN3A 3LLTA 4M14A 3I4BA 4CNHA 4D1ZA 4ANSA 4IAZA 4PTCA 4AE6A 3OD6X 4BTKA 4IAIA 5TE0A 4FKIA 4JBVA 3BGPA 3G9NA 2V62A 4K1BA 4X2NA 1G3NA 2OZOA 3UMXA 3UC4A 3EQGA 2WTJA 4BCGA 2F7ZE 4S33A 2VTMA 3E88A 1U5RA 2EVAA 4C4EA 4AGCA 2IZTA 4E26A 4TYIA 5F1ZA 3PJCA 5EYMA 4RC2A 3VN9A 5LWNA 2UVXA 4Q2AA 5CU6A 3QD0A 4ZLZA 5DMZA 2Y0AA 4R5SA 2Z8CA 2WQMA 3PE1A 2XJ2A 4L7FA 2DQ7X 3R22A 2X81A 4ZMEA 3MW1A 4I5PA 5JN2A 3F3UA 5B2MA 1KWPA 1AQ1A 3FQEA 3QF9A 4TT7A 4JX7A 5IA2A 4WD5A 4YZCA 1K9AA 3ORZA 5LQFA 2IVTA 3WARA 2BZHB 5IQIA 2KULA 2VTPA 2Q83A 5D9HA 4FNWA 4YZ9A 4AXAA 3FMJA 3SV0A 1KE9A 4BDDA 1OL5A 1U54A 4KWPA 3WF8A 2NRUA 5FD2A 4GW8A 3ZO3A 3QYWA 4N6ZA 3F2NA 4NH1A 3DXQA 3A7IA 4RJ4A 1VEBA 5HG9A 4FA2A 3EOCA 3H10A 2VO3A 4U43A 3GI3A 4OTQA 1Q5KA 3E3PA 3GFWA 5AA9A 1FOTA 4QMSA 4MNFA 5ANEA 1CDKA 4RJ5A 2UW7A 5J1WA
chains in the Genus database with same CATH superfamily
4JRVA 4F09A 4WSYA 1RE8A 3LQ8A 4GEOA 2HZ0A 1I44A 4FT0A 4KS8A 4MK0A 3QTRA 3O96A 5AV1A 3TACA 4FKLA 3NW6A 3RI1A 3MVHA 3OEZA 4PNIA 5FXQA 3NVKI 2XK6A 4KNBA 3LXKA 5JGBA 4IFCA 1XR1A 1GY3A 3FE3A 1PXIA 2DYLA 3IECA 4JQ8A 5G1XA 4PMTA 5K0XA 2ITTA 5KMIA 4EQMA 4I21A 2C1BA 4O84A 5T3QA 3FMLA 1IAJA 1Y91A 1GZ8A 3DBQA 5BUEA 3FHRA 1XH6A 3LCKA 4OAVB 4QTDA 3TUDA 1BYGA 4ANNA 4DTBA 1OPJA 2E9UA 4QPSA 2XIRA 5TR6A 2PVLA 4BGHA 1QPEA 2RKUA 4KBKA 4FSUA 3SVVA 4X21A 1S9JA 4O6LA 3O8TA 3LMIA 2O0UA 4AZEA 2CNUA 4FTAA 3VVHA 2P0CA 3ZEPA 4HVGA 3EMGA 4FKGA 4D1SA 5J5SA 4CCBA 3VJOA 1BKXA 2WD1A 3IOKA 4WG4A 3IS5A 4MCVA 4RC4A 4ITJA 4GU6A 2WQBA 3G9LX 4Y83A 3D5VA 3ETAA 4BBEA 4RX5A 3TL8A 3PXQA 1H27A 5H8BA 4C2WA 3G90X 3BRBA 4DH1A 3FL4A 3O8PA 4ZMFA 1H28A 4LRKA 5ICPA 3FDNA 4YJNA 3DDPA 4AOTA 3T3UA 1U54B 2RG5A 4TW9A 2VNYA 4XX9A 2PU8A 1KUTA 3W2QA 1ZYLA 4I41A 1XBCA 5FG8A 5M4FA 3RK9A 1ZMUA 3FXWA 4IQ6A 4NZWB 4WKQA 3RPRA 1NXKA 3UDBA 2PTKA 1H00A 1PXKA 4BDFA 3CJFA 5JZJA 2J0IA 2OO8X 4RWKA 4CZUA 5L4QA 4CYIA 1ST4A 4I94A 5F9EA 3ZC6A 1PXNA 1Q8YA 3BBTB 4J8NA 5ETAA 4TWOA 3SKCA 5TOZA 4XS2A 5CI7A 4YGAA 4FE2A 3EFKA 4FK3A 3RZFA 2XM8A 3RM7A 5I0BA 3ZXZA 4O81A 4AXFA 2HENA 2YIXA 4AA5A 4I92A 4JBQA 4TXCA 3LXNA 3O8UA 4M97A 1MRYA 3P1AA 3WOWA 2YERA 3EFJA 5HHWA 2X2MA 4DHJA 5HIEA 1ZOGA 3I6WA 3PVUA 2OXDA 1ZAOA 2UZOA 3O71A 4QQJA 1PXOA 4X7QA 3UVQA 3W10A 4HYHA 3WE8A 5HTIA 2BR1A 4I4FA 2UV2A 2XM9A 3BGQA 2J4ZA 4A9SA 4FSYA 4HGSA 1OUYA 1FQ1B 3H4JA 4IVCA 4UB7A 3ZLYA 5HBJA 5HVKA 4K11A 2R5TA 4UY9A 3A7FA 4FK6A 2GTNA 5CANA 3CQEA 2IVVA 1OBDA 4WUAA 3GC7A 3NUNA 4F99A 3ODYX 4H1MA 5J87A 5J95A 5IEVA 4D9UA 1OL1A 5AV3A 4DLIA 4E5WA 4WNPA 2IPXA 3D9VA 5CZHA 4QQTA 2QOQA 5A3XA 4FGRA 5JFVA 5EHLA 5CEMA 3DLSA 1VYWA 4BRXA 4BTJA 4XBUA 5GINE 3BYVA 3C4WA 3CGFA 4O4FA 3VULA 4C35A 3AKKA 4NYEA 4ZS4A 3LCDA 5CAOA 4FVPA 3P7BA 4L01A 3VS2A 3S00A 3GOKA 2VWXA 4HVDA 3F2AA 2Y6OA 4XNEA 3ATTA 3G33A 3MH3A 3W2CA 5DIAA 4WG3A 3ZMMA 2X6EA 2QD9A 5FEDA 2UZDA 3U4UA 4DHIB 2Y4IB 4M84A 1TKIA 2ZB1A 3DXPA 4G3EA 1YWRA 4FI1A 3F7ZA 4FTNA 3TV4A 4E6CA 5C4LA 5AUYA 5FEEA 4MYGA 4FGBA 2YM5A 5IDPA 2IZRA 4NK9A 5FP6A 1UU7A 2OG8A 2WEVA 4YJVA 5IPJA 2IEWA 5HBEA 4OBOA 4W4YA 4DYMA 3C4FA 5DT0A 5DEYA 3TXOA 4PP7A 3W0SA 1JKSA 3BHHA 4IACA 3EB0A 2RL5A 4O0UA 4V04A 4HVSA 4D5KA 4UX9A 1IAHA 2C6KA 3N9XA 2ACXA 3HP5A 3MY0A 3Q9YA 3N4TA 2W17A 3NUUA 5FLFA 1GAGA 4IIRA 2VWIA 4F9CA 3U6HA 3HP2A 4AW1A 4F1MA 2WKMA 4BKYA 4EH2A 2I40A 1WBSA 4N4SA 1VZOA 4ZEGA 1TQIA 3FKOA 4RIYB 5I9UA 4O7NA 4PMSA 4GUBA 4UWYA 4ZSLA 4AOJA 4AQCA 3EN5A 3HL7A 4L3LA 2OJGA 5F4NA 4BB4A 5IQCA 2VWZA 4EKLA 3ZCLA 1KE6A 2JIVA 3KXNA 2XARA 2R3KA 3C4CA 3AKLA 4C4GA 3OCBA 4WRGA 4R1YA 5CENA 1WMKA 1M2QA 1Q62A 1QPCA 2A0CX 2PVKA 3S4QA 4WRSA 5FBNC 3NYXA 2XYUA 1PKGA 5M44A 4F7JA 3RNIA 5IQDA 5D1JA 4RVTA 4U81A 1UU3A 4MBIA 5J7BA 3CJGA 2IZSA 2FSOX 4F1OA 2GSFA 1STCE 3FMMA 3Q53A 5DI1A 3QHRA 4I6BA 3EYGA 5AX3A 4IAKA 1PKDA 2IZUA 1ZARA 5GHVA 3MTFA 3Q6UA 3TT0A 5HLNA 5M4UA 2B7AA 2ZMDA 3BYUA 4M8TA 4RX9A 2YDJA 3F3ZA 5IF1A 4E4NA 3LFBA 1O6KA 3B2WA 5AWMA 2BAKA 3CE3A 1H01A 4EQCA 2R64A 3ZOSA 4QP8A 5AUXA 4FTLA 5HU9A 3TUBA 2XUUA 4DT9A 5E1SA 3FLYA 5E8UA 1E9HA 1YOJA 3ERKA 5DA3A 2I0EA 2OKRA 3BU6A 2WTVA 1WBPA 2W5BA 3R7VA 3CP9A 3NFGB 3NMUF 2VWWA 4CZYB 5GZAA 3RCJA 1Q61A 1YXXA 3C5IA 5IQHA 4H1JA 5L2TA 1K2PA 3LFQA 4QYHA 5CASA 5CYIA 2XKFA 4NKAA 4WG5A 2WAJA 2F2CB 5DVRA 4FNYA 2UZBA 3BV2A 4UMRA 4F6WA 3QQGA 5FDXA 2GNFA 3ZS5A 3GQLA 2GFCA 3R9DA 2UZWE 4AZSA 4NWMA 2XA4A 3WILA 1V0PA 1QPDA 4CTBA 3A7GA 2WTKC 3DQWA 5ANOA 4WUNA 4NCTA 3MN3A 3WZKA 2XIKA 2WMXA 4J71A 3PE2A 4MEDA 4KRDA 2YN8A 5CVHA 4IJPA 4JI9A 2PUPA 4IADA 2OLCA 5TKDA 2YHVA 3DKCA 1SVHA 3W2RA 4AUAA 5BVKA 3RPYA 4E93A 3MV5A 5ANIA 5JT2A 5HNIX 5AV0A 2B54A 4K2RA 3IKAA 3WF5A 3UG2A 3QL8A 4M0ZA 4GKHA 5HIBA 4JXFA 2CCHA 3Q04A 3M11A 4FIJA 2VX1A 3I7BA 4IX5A 4O0TA 4YC3A 5EG3A 4U97A 5FXRA 2FH9A 3FPMA 4CKIA 3FC2A 5EOLA 4JMQA 5HTBA 4FEQA 2JFMA 4TY1A 5H8GA 5HE0A 3RCDA 3DK3A 2FA2A 4KKEA 3L9PA 3RK7A 3F2RA 4YPSA 3VUIA 2VX0A 3HDNA 4W4VA 4A9TA 5K3YA 3C5UA 2XZSA 4I5CA 5JRSA 2GQRA 2XANA 1KE7A 3KRWA 4C59A 3AOXA 4WOVA 4CT1A 4QTBA 3IDCA 4D4SA 4RJ3A 5I9XA 2G1TA 3U54A 3MWUA 2WQEA 3A61A 3GU7A 5E7RA 4CFXA 4W9WA 3FMEA 5AFVA 3LQ5A 4GG5A 4PUZA 3THBA 2QKWB 2Z7RA 3PIYA 2O65A 4IB5A 3CLYA 3R1SA 5FEQA 4EH7A 4BCIA 2UW0A 3PZEA 4YHJA 3W1FA 2QOLA 4DTKA 4UALA 2GHLA 4DGMA 5JEBA 1OKYA 2B52A 4EH8A 3S95A 4E20A 2WMVA 4QMYA 2Z7LA 3KVXA 4C3FA 2R3IA 2ZV8A 3QZHA 2JDVA 3R7OA 5IQGA 4C38A 3NYVA 4ZSEA 4BDEA 5L6OA 3ZDUA 4L52A 4DBNA 4G6LA 4TTHB 5CI6A 5IH4A 2VWUA 3GC8A 4EI4A 4DINA 2Z02A 4KBAA 4LRMA 3ZLSA 4BL1A 3DTWA 3EIDA 2R3MA 2AC5A 3OP5A 3EZVA 3OT3A 4PPCA 3P79A 4YPDA 3O17A 4GT3A 2PUIA 2JKQA 2WTWA 4HYIA 3V5WA 3HMOA 4OTFA 5D10A 3WZEA 2OF2A 4AAAA 1P4FA 2G2FA 3I5NA 5E91A 4CFMA 4FTJA 2OIBA 3QQFA 4XV2A 5F95A 2C0TA 3EN7A 3NPCA 2PMLX 4FEUA 4A06A 3P78A 3NUPA 4PPAA 1QCFA 5CU0A 2WIPA 3W16A 4DH8A 4AXEA 3L1SA 3OXIA 4JRNA 3HLLA 1W98A 4FOBA 4YU2A 2YWVA 5A6OA 1Y8YA 3HKOA 3NCGA 3PG3A 3Q5IA 2Y4IC 4LI5A 4FSRA 3SRVA 5KKRB 3TNHA 4APCA 2PVHA 2EUFB 2A27A 2W1FA 2X8DA 2ZOQA 4TRLA 2JAMA 3OW4A 4WBBB 4FIIA 3ORIA 2JDOA 4D2PA 3W0NA 3I0QA 4HYSA 4XJ0A 3V51A 4O0XA 3RNYA 5KMMA 4QYGA 3GCPA 4G3CA 5ACBC 4TYGA 3R30A 4KAOA 3BCEA 2ZDUA 4S30A 3V8TA 1VLRA 3L8XA 3VF9A 3O23A 4FEWA 4RMZA 3RAHA 3G5DA 1Q8ZA 2ZM1A 4EH6A 3LMGA 4XCUA 2XKCA 3IW7A 4FSMA 3PUPA 3LM0A 3SHEA 3DPKA 4N70A 5LVMA 4H3BA 3FEGA 1R78A 4JIAA 3P5JC 2BRMA 2IWIA 5KO1A 4LOQA 2WFYA 3FSKA 4R7IA 3AC3A 3CQUA 1HCKA 4AGUA 1FBNA 2C6IA 3WI6A 2OK1A 3ZU7A 5LMKA 3N51A 4FUXA 3GXLA 4LUDA 3V5QA 3UNKA 2B0QA 1OMWA 3QHWA 3F6XA 4BYJA 3E63A 4GIIA 2W7XA 5AP6A 3A2CA 5EHOA 2AEGA 5CXZA 3D5WA 1W83A 3V5JA 5JMSA 2QC6A 3G0FA 4EORA 3BI6A 4EK3A 5HESA 4HNIA 3DKGA 2XCHA 5BNJA 3NYNA 2W1EA 4UYAA 5JQ8A 5FUTA 5FXSA 3JUHA 4CEGA 1XH5A 4O4EA 5AIKA 3ZBFA 4IB1A 5A54A 2IO6A 1YKRA 1P14A 5HVYA 3UQGA 4RG0A 1YHVA 1AGWA 1URCA 2QKRA 3TKHA 2WU7A 4WNMA 2WZJA 4C37A 4R5YA 2X0GA 1ZRZA 3RM6A 3ID6C 4YZMA 2QNJA 2ETKA 2XNEA 4IWPA 1GZNA 4QMWA 4X6RA 5EK7A 3ZHPC 4BI1A 4NFNA 3SRVB 4GJ2A 2XNBA 2IG7A 4R1VA 4I23A 3LIJA 4NM0A 4D4RA 4F65A 3E93A 3HGKA 4IB3A 4K0YA 3VW8A 4Y8DA 3QQKA 4GCJA 3C9WA 1MRVA 4NUSA 3OVVA 4JNWA 3V04A 2G15A 1ZZLA 2ZVAA 4GYIA 2VX3A 1B6CB 3P7AA 1RJBA 4NU1A 4IZ7A 3DA6A 2LGCA 3FL5A 3RAIA 3CC6A 3NSZA 4AN3A 5BVEA 4QMUA 3BU3A 4G5PA 3COIA 4RWIA 3CIKA 3HEGA 4P5QA 3O5AA 4HW7A 2CMWA 3FSFA 1JWHA 4AW2A 1XH4A 3LQ3A 3GOPA 4IHPA 3G0EA 4HZSA 1IEPA 1V0OA 2H96A 1YW2A 5GJDA 3CSVA 3TNQB 2XIXA 1YHSA 3R7EA 4M12A 5FTOA 4D0WA 4OT5A 4PDOA 4GVAA 3UO4A 3NW7A 3SW7A 1BL6A 5DE2A 5D41A 1OBGA 1YDTE 2FUMA 2VTNA 3CBLA 2A4LA 4PMMA 2QOHA 3AGLA 4PWNA 4UYNA 4E6QA 5GNKA 2Q0BA 3S2PA 4RFZA 2WMTA 2F7XE 4N0SA 4K8AA 4G3GA 4ZY5A 2XNPA 4HZRA 1FPUA 5CEQA 4UV0A 4OBQA 5AV4A 4YSJA 5CF4A 5K5NA 1QL6A 4ONAA 4O82A 4JBOA 4R78A 4F64A 4E4LA 2C69A 3FLSA 3MJ1A 5DRDA 3R8PA 3VIDA 3KXGA 4Q9SA 4WBOA 5IG1A 4RJ6A 1YQJA 4I0SA 3ZRMA 4FIHA 4M7IA 4RIXB 3OUNB 1ZZ2A 3BYSA 4IAAA 4G3FA 2YZAA 3UDZA 3CEKA 2XBJA 5GIOE 3PZHA 2CGUA 4ASEA 4R3CA 3OBJA 2J0JA 2OIQA 3EQHA 2BCJA 4ZJJA 3VQUA 3FC1X 3L8PA 4ZLOA 2VTLA 5HOAA 3MH0A 3KULA 2W1IA 3MJ2A 4IC7A 3KXXA 5FQDC 3UYSA 5IEXA 1UWJA 3F69A 2ZV7A 3PLAE 4Y5QA 2PMNX 4RJ8A 2C1AA 3E7OA 1PMNA 1YVJA 3I7CA 3UZPA 4OTHA 4BZOA 3TZMA 3FXZA 4ZZNA 3KEXA 4DEHA 4DA5A 3PPJA 2VAGA 3VF8A 2ESMA 3MSSA 5EQPA 2RFNA 1V1KA 5BPYA 3M2WA 2REIA 4FZAB 3FY0A 4I3ZA 4A4LA 4BCQA 4FKPA 4DGOA 4DFUA 2WIHA 4QO9A 2BMCA 4N57A 4DDGA 1FVRA 3MFUA 4CT2A 2W0JA 3VBXA 3OY3A 2CKQA 3Q9WA 4OTPA 3DB6A 1L3RE 3ZFMA 3I60A 4UEUA 3LPBA 3DCVA 4O7VA 5CNNA 4BDHA 3QD2B 4XV9A 5AP7A 3D5XA 3GFEA 3LZBA 5B2KA 3VQHA 4GVJA 4F63A 3LXLA 5LVNA 2BKKA 3TDWA 1BI7A 3GCUA 3PUFC 4UZDA 3JPVA 1PXMA 2GS2A 3FAAA 2BHHA 1OPLA 3SQQA 4L00A 4YC8A 4ASXA 5EW3A 4S2ZA 2C5XA 4D58A 4DGLC 3PFYA 4MUQA 2X7GA 3SAYA 1Q8WA 3ALOA 3PY3A 2ZV9A 2VO0A 2BAQA 1NY3A 4XRLA 2X9FA 2VZ6A 2PVJA 4OLIA 5K0KA 3E8NA 3NRMA 3ULZA 4XUFA 3LVPA 3VS0A 2GNHA 2X6DA 3GU4A 5A4QA 1Q4LA 2WEIA 2W1ZA 3FQHA 3BGZA 5EH0A 1ZOEA 2BILB 3K3IA 3PPZA 4HCUA 5HCYA 3UOKA 2C4GA 4YTHA 4ZY4A 2ITYA 2PMOX 4IJ9A 4QMPA 5AX9A 3CR0A 4AW0A 3R1YA 4YLLA 5JFWA 5JSMA 5KBQA 3HV6A 4ITHA 4FG9A 4RFMA 4EOIA 1J7LA 2OH0E 4BJJA 4RT7A 3UBDA 2C6MA 4ALWA 1CKPA 4DITA 5E92A 3C0GA 3FZRA 2YCQA 2E9VA 3HMPA 3R71A 3L9LA 4LUEA 4J1RA 4RSSA 5EI8A 4IM3A 4MQ2A 3FJQE 5CZIA 5H9BA 3KULB 3W18A 4C33A 1URWA 2OZAA 2P4IA 1JLUE 4ZP5A 2EB2A 3WYYA 4D1XA 4F9WA 1ZXEA 3OWLA 3P9JA 1NT2A 1QPJA 4IAYA 2HWOA 3SC1A 3G15A 2V7AA 2EXEA 1JKKA 4FR4A 3E8EA 5A14A 4A7CA 1LUFA 4BDJA 1ST0A 1LPUA 2BFYA 3BHVA 3ORKA 3TDVA 2ITPA 4E5BA 4TWCA 4D4YA 2OI4X 5J9LA 5AUWA 3I5ZA 2VRXA 2AUHA 4TWNA 3SXRA 2VO6A 4KSPA 4X2GA 4ZLYA 1Q41A 3R7YA 3UO5A 4H05A 2I0VA 4DF3A 3UOLA 3PJ3A 5CEKA 1XH9A 3LW0A 4UBAA 5EDPA 4R6VA 4TYJA 4JAJA 4U0IA 2X0PA 2X7OA 5CALA 4YNEA 4H3PA 4ZZOA 2OW3A 3QD4A 5KHXA 3HA8A 4RGJA 5LOHA 4FV1A 3SA0A 4MBJA 3ENMA 1H1QA 5CLPA 4C4FA 4YHTA 2F2UA 4LRJA 4WSQA 4FNXA 4O1PA 3PJ2A 3R7IA 2XP2A 2J7TA 4Y85A 4M0YA 5HX6A 1O6YA 3W2PA 4ID7A 2PSQA 3GUBA 1ZOHA 1ZYSA 2JKMA 2PVFA 2NYAA 4FKWA 4A4XA 1UU9A 4XG3A 3QFVA 3JY9A 5C8NA 4JG7A 3FBVA 3W33A 3D0EA 2A1AB 3QKKA 1UNGA 4J7BA 5CSXA 4FZFB 2QR8A 4ZSGA 5IU2A 5DR6A 1AD5A 4LGGA 3PSCA 2DUVA 3QZFA 5L8JA 1YDSE 5E90A 5CSVA 3T8OA 1IG1A 2XEYA 3MIYA 4FSTA 4PTGA 4BCNA 3DTCA 4E6AA 5AAFA 3NUSA 2NP8A 3CQWA 3RHKA 5DFPA 4ORKA 3PIXA 3QRTA 3LJ1A 3QBNA 4YBKA 4BJJB 2OIDA 5AP0A 4O7ZA 5JKGA 1CKIA 4XLVA 3DBFA 4I20A 4C8BA 1H0VA 4I1ZA 3UZRA 2H34A 1DI8A 3TWJA 4U8ZA 5J79A 2HAKA 3ZC5A 4MXZA 4KIOA 3ZM4A 2OZAB 1I09A 3GQIA 3FI3A 2V55A 3PXZA 3R83A 4AP7A 3MIAA 4DHFA 5M53A 1T45A 4EJNA 2I6LA 3RPSA 3KF7A 4EKKA 4NIFA 4PP9A 2R4BA 3IGOA 4QMZA 4XRJA 5TT7A 2PYWA 3POOA 3NUXA 2KTYA 2P2HA 3ZSGA 5HCZA 5B7VA 4BI2A 3G2FA 4TPTA 3TYKA 1R1WA 2QHNA 1P5EA 3BX5A 4HGEA 4JLCA 3QRKA 3CXWA 5ETCA 2YITA 4GSBA 2XK3A 5HO7A 2VD5A 1WAKA 3AD4A 5HE1A 2GQSA 3Q3BA 4J97A 3VHEA 4QMLA 4DEEA 3TUCA 4FT3A 3PXRA 4XG8A 4Z7HA 4FUYA 4UXLA 3RBWA 3IW4A 1OM1A 4ERKA 5K5XA 5L6PA 2I7QA 4UMQA 2QODA 3IW8A 4YP8A 5AUZA 3RTPA 3FV8A 4EH4A 2YCSA 5C8KA 1CMKE 1O6LA 3FXXA 4IWDA 4MXAA 3JXWA 5DWRA 2AC3A 3DV3A 4KKGA 4DGNA 2IJMA 4YO6A 4X2FA 5CT0A 3HMMA 4DFXE 3OXTA 4AZWA 4DFLA 3A8WA 3IW5A 1PMEA 3PXKA 3S0OA 3W0PA 1Z5MA 2C6TA 3LCSA 3ZONA 3QU0A 3TN8A 2WNTA 4FTCA 3CD3A 2J5FA 2WPAA 4L7SA 2ZM3A 4LQMA 5FTQA 4E4MA 1GZOA 2R0UA 4U44A 2JIUA 4M69A 3N4UA 2WOUA 4QNAA 5FTGA 2UZNA 3QCXA 3F7WA 4AT4A 5E8XA 4QMXA 3Q9XA 4KIPA 3EQFA 4C4HA 1KV1A 2W96B 5BMSA 4DCAA 4AAYA 5J8IA 3RZBA 2ITZA 1CKJA 4RX7A 4BYIA 4DLJA 1OL7A 3DB8A 2QONA 3U87A 5AR3A 4B8LA 5EKNA 2VNWA 5DEWA 3L9MA 2X4FA 3H0YA 5HG7A 3HV7A 4Z55A 2QOCA 5GZ9A 5FM2A 5HO8A 3TV7A 4FV8A 3VHKA 3ZFYA 5EDRA 3H9RA 3VUDA 4YO4A 3OHTA 3TJDA 2QVSE 3SG8A 3ACKA 1YWVA 2BRBA 4GK2A 3QKLA 5HQ0A 4U41A 4JL9A 5HE3A 4BTMA 4NIFB 2ERZE 2J90A 3FPQA 4YTCA 3UPXA 4QP9A 3ENHA 3HUCA 2GPHA 2F57A 2NPQA 4O96A 4ANLA 4BC6A 4IX4A 3WZDA 3UE4A 2X0OA 4MXOA 4I0TA 4D9TA 2YAKA 3AMAA 3QQHA 4Y5HA 4V0GA 3QAME 3PRIA 3OTVA 4NW5A 3RVGA 2W05A 4P7EA 5LMBA 4G16A 4PL5A 5LARA 3B2TA 3QQUA 4LMNA 1W2DA 2XIZA 4KABA 3LHJA 5D7AA 5BQ0A 4GFMA 2OJJA 5AJQA 4PMPA 5BUJA 2HY81 3V5LA 4FVRA 4HVIA 3F5PA 3PJ1A 3OROA 4FTKA 5AR8A 3RK5A 3NUAA 1MRUA 3DNDA 3RPVA 4EONA 3D4QA 1PMUA 3BELA 4YUQA 2ETMA 4C61A 1MQ4A 2CGVA 3Q4ZA 4R3PA 1UU8A 4O22A 2ITQA 3UP7A 1BUHA 1SM2A 5M09A 3PRFA 1ZYCA 4C36A 5M08A 4TNBA 1H26A 2RFEA 2XF0A 2XK9A 3CS9A 2ZJWA 3HA6A 1SZMA 4CG9A 5HLWA 4MNEA 5IA4A 3ANQA 4FIFA 3SLSA 2R3PA 4ALVA 4PDPA 2IN6A 3ZYAA 2C30A 5E1EA 4M69B 4CCUA 5JQ5A 4BR3A 2W1DA 4J96A 4LL0A 3GCQA 4LM5A 4FKOA 1UKIA 3BHYA 3VBYA 3HAVA 4DG2E 4EOQA 4E3CA 3MA6A 5FDPA 5IQBA 4YMJA 5CNOA 3ULIA 4YTFA 4AXDA 4O0YA 1OL6A 1UWHA 2YLEA 4G5JA 3WF6A 2QI8A 2E9NA 3ODZX 5CU2A 2HCKA 4JDKA 2UW6A 3F5GA 3F3WA 4HYUA 4QOXA 4QYEA 3QQLA 2G2HA 4C7TA 5CT7A 3DS6A 4L42A 2CHLA 3LOKA 1M14A 4L53A 4C0TA 4JR3A 1NW1A 5IQEA 1ZMWA 5HGIA 4EUUA 1KOBA 4QMVA 4JDHA 5CAQA 3MB7A 5M57A 3BE2A 4QMTA 4FOCA 4D28A 1IA8A 4QTCA 2ZMCA 4OTIA 5EM6A 4II5A 2JBPA 1M17A 3QX2A 4H58A 4V0GB 3PFQA 4IM0A 2Y8OA 4EBVA 4CKRA 2G01A 4WIHA 1ZWSA 3KMWA 4DAWA 4IC8A 4RVLA 4GS6A 3IGGA 4O91A 4UWBA 3MS9A 1SNXA 1TQMA 2FSLX 4P5ZA 2PZRA 5ETIA 5EYCA 4BDCA 3IO7A 4BKZA 1OUKA 3RPOA 4ZSJA 4EC9A 3G6GA 3RKBA 4ZAUA 4S32A 4FBXA 2VO7A 3EQPA 5DT4A 4L46A 5JFXA 4BVUA 4RZWA 4K77A 4EK6A 3KY2A 4XOYA 3VW6A 4NM3A 3ET7A 3ZUVA 4D2VA 4MD7E 2XRWA 3HV3A 3KRXA 2YIQA 1H1WA 4DEIA 2P33A 1F3MC 1VYZA 4U79A 2WMAA 5IH6A 4ACGA 3KMUA 4MNEB 4QP6A 3U6JA 3R02A 3K2LA 1GOLA 4GIHA 4QD6A 4AN9A 3KIOC 5T68A 2XS0A 4GFGA 3AT3A 3ORMA 3O50A 5CEPA 2HXLA 3UGCA 4BZNA 3RAWA 1GIJA 4YJPA 1WBVA 3G51A 3TJCA 2CKPA 5HTCA 2BDWA 4JOAA 4XG7A 1Q3WA 3M1SA 4NW6A 4XHKB 3V5PA 1YI3A 4CTCA 3A4OX 3H9FA 4FKVA 5DLSA 4XG6A 1GIIA 5AP2A 4IM2A 2B1PA 4LYNA 3QTIA 3V01A 5A4EA 4G6NA 1EH4A 3DZQA 3QX4A 5E8YA 5JH6A 4K6ZA 1APME 2ERKA 4M66A 4FSWA 4C4IA 3R8VA 1G5SA 4ZTHA 2CSNA 3Q60A 2PHKA 3D83A 4QYYA 4H39A 4MHAA 3LXPA 4EC8A 3C50A 4YURA 3SXFA 3DY7A 1H4LA 3AC8A 4Q5HA 5C1QB 2BTRA 3UPZA 5AIRA 3MGYA 4RQKA 2PMIA 1PY5A 1NVQA 2RF9A 2UW8A 2B9HA 3NYOA 3R8UA 1A48A 3F88A 4FKUA 4AW5A 3I1AA 5IUIA 1U46A 1JKTA 4MWHA 4B99A 3PY0A 4TWPA 5E8VA 3KRRA 5FP5A 2GS7A 4CQGA 5CF5A 4R77A 2P3GX 3BZ3A 3R73A 4OBPA 2WMWA 4FL3A 5EFQA 3NIEA 2CJMA 3PSDA 4YC6A 5H8EA 1J1CA 4BIEA 3ACJA 4I0RA 1WCCA 3LCTA 4MTAA 3Q96A 3ZRKA 4ERWA 3MYGA 3HV4A 3IOPA 2GTMA 4FTOA 5AMNA 4DH5A 1IA9A 5EW9A 4B8MA 5AR5A 1YI6A 5K9IA 4YJSA 4RA5A 1PJKA 1FGIA 4G1WA 3VS7A 3EKKA 3W0MA 2A19B 4K33A 1Y6AA 2GNGA 3BU5A 3LJ0A 4FV4A 4QYFA 4Y46A 4NSTA 5ACKA 3UVRA 3O7LB 2O63A 1W2CA 4BN1A 4L9IA 4IVBA 3AQVA 4CFWA 5HU3A 4F6UA 5KX8A 3D7TA 4CMUA 3QQJA 2UZUE 3R21A 3NCZA 3Q52A 4FIGA 3WYXA 5CQWA 1WFCA 3FI4A 2R3QA 4MXXA 2XMYA 3DBCA 3IDBA 4FMQA 3RWQA 3NZ0A 2JDTA 3CGOA 3NGAA 3OWJA 1HCLA 3E8CA 1FVVA 3UIUA 3A4PA 3PP1A 4UZHA 4I4EA 2XJ0A 4LOPA 3DJ7A 3TKUA 1LR4A 3VS1A 2YLFA 1W7HA 3HDMA 2VWVA 4JX3A 1JKLA 4FL1A