4DN5A

Crystal structure of nf-kb-inducing kinase (nik)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
344
structure length
331
Chain Sequence
SVEEYLVHALQGSVSSGQAHSLTSLAKTWAARGSRSREPSPKTEDNEGVLLTEKLKPVDYEYREEVHWATHQLRLGRGSFGEVHRMEDKQTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLVKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVCLQIPGTETHMAPEVVLGRSCDAKVDVWSSCCMMLHMLNGCHPWTQFFRGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPIHRVSAAELGGKVNRALQQVGGLKSPWRGEYKEPRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mitogen-activated protein kinase kinase kinase 14
publication title Structure of Nuclear Factor Kappa B-inducing kinase domain reveals a constitutively active conformation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 106
structure length 331
sequence length 344
chains with identical sequence B
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dn5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dn5A01
2RFNA 3O2MA 4RA4A 2C1AA 1SZMA 2WFYA 2R2PA 2Z7QA 3HZTA 1SNXA 3KN5A 1OL5A 3Q96A 4TXCA 3C0GA 3VBYA 3W8LA 1H27A 5GIPE 5C8MA 5J5TA 3GU4A 4X0MA 4QPAA 2HZ0A 5D7VA 4BY9E 1Y91A 3COIA 3UOKA 4IC8A 4QQTA 2XJ2A 1B38A 3QCQA 4BCPA 3DKCA 1I44A 4CT1A 5A4QA 1OPLA 2XRWA 4IADA 2ITQA 3KXXA 5JFWA 4G34A 1MRVA 4AGUA 3O8TA 4QO9A 2P2IA 4BCOA 1PJKA 3ZFXA 4W4YA 3OEFX 5FP6A 2VTOA 5HEZA 3UGCA 4BKZA 2WKMA 3Q2JA 2X8IA 4AGCA 4AX8A 2HXQA 5LOHA 4RWIA 1OI9A 2G2IA 2ETMA 4O1PA 2BTSA 2CLQA 2JEDA 2VTQA 4HGEA 3OWPA 4I41A 4GFOA 3RALA 2B4SB 4J97A 3FAAA 3NUNA 4MNEA 5AIKA 3CPBA 4MWIA 3QTSA 2IZRA 4I6HA 2WMVA 5C03A 3NEWA 2Z8CA 4DH7A 4FIIA 4JQ7A 5BX0A 4PY1A 3UP2A 3Q4ZA 5HIDA 2BIYA 2C6EA 1UNHA 3HGKA 3QQGA 3ORTA 3QTIA 1U59A 2ZM3A 4AT4A 5L8LA 4LRJA 1BI8A 2JIIA 4PDSA 4PMSA 3FKLA 4C2WA 1M7NA 1Q8TA 3QRJA 3RM6A 3ULIA 5CEKA 4HZSA 4O7LA 4H05A 3NIEA 3A7JA 4EH2A 3GQLA 3NLBA 4F09A 3I6WA 3HAMA 2A4LA 4EZ3A 3QC9A 2XKDA 3VUIA 5IMEA 3ZU7A 4TYGA 5E91A 3FDNA 1WBWA 2XBJA 1R78A 4DLJA 2UW7A 4BCFA 5CF8A 3F5PA 3L8PA 5IF1A 4FI1A 4ZJVA 3RP9A 3D5UA 3IO7A 2X0GA 2BZHB 3R7UA 4CZUA 3BRBA 4KIQA 3HP5A 3AD4A 3FI2A 4F6WA 3MJ1A 4K77A 2YM4A 3GCPA 3ZXZA 4YJTA 3KQ7A 4I93A 4YBKA 3AOXA 3H9FA 5E4HA 4TWCA 3NYOA 3FI8A 2IZSA 4A7CA 5JZJA 4C4EA 1NY3A 1PXPA 4C4JA 1P14A 3E93A 3ZLSA 3NDMA 4F0GA 5LCJA 3RJCA 2IO6A 4KKHA 2ZDUA 3VBTA 2VUWA 5HX8A 3NMUF 2VTRA 4I24A 5I5ZA 3E64A 4CLJA 2B52A 2C5XA 4EUUA 1YDSE 4TW9A 2R3GA 3HECA 1BUHA 4QQJA 3QRIA 4AN3A 4PNIA 4D1ZA 2VWVA 4U81A 3C5IA 4Q5HA 1FOTA 1R39A 3HMMA 4FE2A 2WMRA 3CSVA 1Q8UA 4U80A 1RE8A 1PXJA 3DBDA 3MVLA 3QA8A 5M55A 4BDCA 1YXTA 5E8TA 2FVDA 3I1AA 4JL9A 5IH6A 4GW8A 4L42A 4HCUA 3IECA 4FTRA 2YCRA 3NNUA 4QMYA 4Z7HA 4GFMA 4WIHA 3I0OA 4UYAA 5IQBA 4CRLA 4KIKB 3HMIA 4P5QA 5F4NA 5H9BA 3BQRA 3F6XA 4P7EA 4W8EA 2QC6A 4XLVA 2YDIA 4YNEA 5AUTA 3PXYA 2R3QA 1PYEA 3QYZA 4BWKA 4OBOA 3NSZA 5JQ5A 4ZTHA 4LOPA 4BCJA 5M06A 5GIOE 3ZO1A 4DINA 3FMDA 1F5QA 4U0IA 2XYNA 4GUBA 3ZBXA 5AX3A 4EJ7A 5H2UA 3MN3A 4YGAA 4BTKA 3H9RA 4X2GA 2GMXA 4E4XA 2FSMX 4C59A 1ZYJA 3ZOSA 3C51A 4F08A 2PZYA 1JKLA 3F3WA 2XJ0A 5A3XA 3WOWA 3RK7A 3CJFA 2WD1A 3HV3A 1YOJA 4PV0A 4ZJJA 4N4SA 3GU6A 5T68A 4IWDA 4B7TA 3D2IA 4Y85A 3GOPA 3MVMA 2V7OA 3TNQB 5J9ZA 2O0UA 4C35A 3QD3A 2X81A 4FICA 1T45A 3FBVA 4MK0A 3COMA 3DU8A 3PZEA 2VWIA 4O7VA 3BLQA 4FV1A 4MQ1A 3OS3A 3KMMA 2UZTA 4MBIA 3UVQA 4QMOA 4G6NA 3EKKA 3I60A 3FLZA 4FKWA 4K18A 4I23A 3V5PA 5F94A 4MBLA 2X9EA 1NT2A 2PZ5A 1OIYA 5ETAA 3VS1A 1XH8A 4ZZMA 2I0YA 1BX6A 4MEDA 3QUEA 3ZS5A 4EK4A 3BEAA 2HWPA 1QMZA 3EWHA 4L43A 4WNKA 1I09A 1U5QA 2OF4A 3HLLA 3W10A 3NW7A 2VWYA 2C6KA 4DTBA 2W5AA 5C9CA 3QTUA 2Y7JA 3BE2A 3HV5A 3VBXA 2Y6OA 3E88A 5A54A 3DLZA 3F5XA 5BUIA 1OVEA 4RX8A 5CI7A 3Q9XA 3I0QA 3ORLA 5HI2A 4DEBA 5CU0A 5F95A 4R78A 1XH9A 5J7BA 4IFCA 2JBOA 3FJQE 4A4LA 2I1MA 2G1TA 3W2CA 2C0TA 3FMLA 3TZ7A 2HK5A 5DMZA 2P33A 1YHVA 2YLFA 4YJVA 4OAUC 3LXPA 1GY3A 3D15A 3HRBA 1Q3WA 3EN9A 3IOPA 5HIBA 1OZ1A 4ITIA 5AV3A 4X21A 3OT3A 4UWBA 4FZDB 3L8XA 4I6QA 3QC4A 3QZIA 2EXEA 1OIQA 3RPSA 2C6OA 1H25A 5BYYA 5IG1A 1FQ1B 1QPEA 1O6KA 3LOKA 4FSYA 3QU0A 4MF1A 4P2KA 5ANGA 3TIZA 2E9UA 4APPA 4CKRA 2VX3A 4D4VA 2E9NA 3RPVA 5FXRA 5DRBA 3RVGA 5AA8A 4GK4A 4H3PA 1YXUA 4XG2A 5CSHA 4IXPA 4FL2A 4IFGA 1JLUE 3FI4A 4XLIA 2QOBA 4YJSA 4KINA 4KIKA 3ELJA 1FGIA 2Z2WA 3GCUA 1Y6BA 2BR1A 4HYIA 2GNLA 2HWOA 2ITXA 4DN5A 4UMPA 2VX0A 2OW3A 4F9WA 1ZXEA 2R3FA 2X39A 3O71A 5G1XA 2QODA 3RHKA 2IZTA 4U40A 1H1WA 5HKMA 4MVFA 4TRLA 5EI8A 5ANDA 2ZAZA 3IDBA 4GIIA 1OL1A 2WMQA 5I9YA 3OFMA 4TPTA 1JVPP 3Q04A 3HA8A 3FLQA 2VNYA 3RTPA 3SRVA 4DTAA 3FLWA 2C69A 2ZJWA 4FUYA 2J5FA 5CQWA 4DFBA 4DA5A 2QVSE 4L7FA 4QP9A 4KWPA 5IQHA 3F3TA 3ROYA 2SRCA 3U87A 2G01A 3EZVA 5LVPA 2A27A 4BKJA 4NUSA 4I92A 4WD5A 2HZ4A 4UEUA 5ANOA 4RFZA 2QHNA 3V51A 1ZMUA 4UB7A 4EQUA 1H07A 4RX7A 3FYKX 3Q6WA 1FMOE 1PYXA 2EXCX 1XKKA 2WTWA 4Z9LA 5AAFA 1Q8ZA 4UWYA 4K11A 4RVKA 3T3UA 3OCSA 2XIZA 4X6QC 4YTHA 3GU5A 4QMWA 2R4BA 4TNBA 5DVRA 1BKXA 1Q61A 4OAVB 2ITPA 3P7BA 4LGHA 4CV9A 1CKIA 1O6YA 3NW6A 4EHZA 2HENA 2B9FA 3CD3A 3EN6A 5D12A 3O8UA 1YI4A 3BHTA 2I7QA 3QZFA 1P5EA 4FKVA 3UMWA 2C1BA 2QKWB 5EW9A 3ZFYA 4FNXA 4JX7A 4Z16A 2W5BA 1UNLA 4IAIA 4Q9SA 4M8TA 4TNDA 4AP7A 2QU5A 1NVQA 5IA0A 1YHSA 1J1CA 3F82A 1R0PA 5GINE 5JK3A 1CMKE 3C50A 3KRRA 2OGVA 3E3PA 3R63A 4DH8A 3COHA 2P0CA 4IVCA 5T3QA 3PJCA 3TTJA 4QTBA 4K9YA 3EN5A 2UZUE 3D2KA 3JY9A 2WU6A 3GEQA 2ZV8A 3QA0A 5IQAA 2PY3A 1U46A 5BVKA 2QOLA 3QXPA 2XEZA 3AGLA 4X3JA 4YTIA 1YHWA 2VTMA 5AUVA 2QD9A 4PUZA 1DI9A 2XP2A 4CCUA 4JRNA 1SM2A 3BYVA 5KBRA 2YFXA 4R7BA 2VO6A 1LPUA 5EYCA 4TL0A 3THBA 4ANQA 5JKGA 1WBTA 4O0UA 4GU9A 1A06A 3P1AA 3E7OA 4IAZA 3V04A 5T6KA 2OIDA 5I3OA 5EW3A 4H1MA 4AUAA 3LLTA 5KO1A 4FX3A 4QMVA 4QT1A 3R9RA 4F1MA 4Y95A 3GB2A 4FC0A 1J7UA 3OTVA 5LJJA 3EKNA 4BDJA 4PTEA 1GOLA 1MRUA 2UW5A 4OBQA 2PMIA 2CKQA 2IZUA 2PVRA 3KF7A 5EQYA 3KRXA 3SA0A 3EFJA 2V62A 4C4HA 5HTCA 4CXAA 4R7IA 1XH6A 2HW7A 3WI6A 3EQPA 4A4XA 4AAAA 3VHKA 3DBEA 4ZSAA 2JIVA 3LQ3A 4U42A 5DYJA 3TXOA 3R7EA 3LFBA 4HZRA 4XS2A 5AP2A 5E92A 1YVJA 4MD8E 4DH5A 3D5VA 3RM7A 5IDNA 4DITA 4GKHA 5I3RA 2QO2A 4ITHA 1P4FA 4TTHB 4BGHA 4QMMA 4ZTSA 4WG4A 5IDPA 2QU6A 2WMWA 4PX6A 5FTQA 4GH2A 1R0EA 3ATTA 3CTQA 4KNBA 1Z5MA 1NVSA 1M17A 4M68A 3U9CA 4EOMA 2FSLX 2QG5A 2WQOA 3LXLA 4FNZA 4ORKA 4KIOA 5CAVA 3UP7A 5I9ZA 3VS3A 3QX4A 1GZ8A 4JDJA 3LW0A 1U5RA 2JIUA 2X2LA 3HV6A 4FT0A 3ORNA 3T9IA 1OKVA 4D2PA 4M0ZA 2FGIA 5AA9A 4MNFA 3E8DA 5DT0A 2ETKA 3C0HA 3CTHA 5FTOA 2ITUA 3K5UA 4W8DA 2YJSA 4IW0A 4EEVA 4FKIA 3FXZA 5FXSA 3TV4A 4EH9A 2CNQA 3GQIA 5C01A 5FDPA 4ACCA 1OMWA 2B1PA 2X4ZA 3DAJA 2H34A 2W1DA 3LQ8A 3MB6A 5L2SA 1H1QA 3FL5A 2IPXA 2BAKA 3R71A 4UZDA 1STCE 3JYAA 3TIYA 2BTRA 2UVZA 5EHLA 3BGZA 2XH5A 5K5NA 3HNGA 4DG2E 5K0KA 2YHVA 4RVLA 1Q4LA 2EWAA 5AP5A 1WVXA 5EYKA 3VF9A 3QQFA 4YU2A 3BWJA 3GVUA 2XNBA 2YISA 2XIRA 5KBQA 4E26A 3S4QA 4ZSLA 2ZB1A 3O8PA 4UN0C 2PTKA 3I7BA 3ERKA 3QQJA 4LYNA 4XMOA 4RIXB 4UMRA 4N6ZA 3EMGA 3PE1A 1HOWA 5AR3A 3PJ2A 2E9OA 4WG5A 3PLAE 4MX9A 4DFLA 3JR1A 4IANA 5AP7A 3NS9A 4WHZA 4CMTA 5JH6A 3FMNA 5LARA 4NTSA 3ACJA 2BROA 2PE0A 5EM5A 2CKPA 3K3JA 3IW8A 4OGRA 3QLGA 2VV9A 4AWIA 1YI3A 3FHRA 5BNJA 1SNUA 3GC7A 3Q9WA 5LVNA 2CGUA 3FZRA 4IX4A 5DR2A 3CP9A 4O22A 1TQPA 2ITVA 3C4XA 2NRUA 4GT5A 2RSVA 5M44A 2IN6A 4MYGA 2X1NA 3VNTA 3C4FA 3PVWA 3W16A 3CQWA 4ANBA 2WTDA 5DEYA 1OL7A 3KVWA 4XG4A 2DQ7X 4BCQA 1Q24A 3FXWA 3PA5A 2P2HA 4C4IA 4BR3A 4AZWA 4G17A 5HORA 3KMUA 4G6LA 2HY0A 2Y8OA 4FV3A 4L53A 4F9CA 3JUHA 2V55A 4F7LA 5AAEA 3MW1A 1CSNA 4YTCA 4IB3A 4O96A 3ORPA 3QD0A 5CAOA 4XH6A 5FP5A 4AA5A 4RIWA 4IVBA 4OT5A 4FKRA 3DLSA 4JLCA 2QURA 4S33A 2OJ9A 4O91A 2XJ1A 3R21A 1XBCA 5DG5A 5EI2A 1FVTA 5IQCA 4LOQA 1DI8A 3Q6UA 4GS6A 4JIKA 2PPQA 3KXHA 4MXXA 4QQCA 2CLXA 5IEYA 2PE2A 4DBNA 1OGUA 5JRQA 2QOIA 2PMLX 3P08A 3PJ1A 4AOIA 4PMPA 2WTIA 3ID6C 5CALA 3F2NA 2OFVA 5GZ8A 3OG7A 4KRDA 3KU2A 1WZYA 3UDBA 4AZVA 5C8KA 2XNGA 3DAEA 4UY9A 3UZRA 4E93A 4NSTA 2QQ7A 3POZA 4BVUA 3W2OA 1DAWA 2QCSA 3QYWA 3ACKA 3UG1A 4FSQA 4S2ZA 3D94A 3HUBA 4IZ5A 4KA3A 5LWMA 4N57A 5BVWA 4K33A 3FQEA 1PHKA 5TOZA 5D1JA 2B7AA 4YLLA 5CEMA 2ERZE 2OH4A 4A9UA 4DG0E 3MIAA 1NXKA 4P90A 3WF7A 4DGGA 4ZTMA 1UU8A 2YIRA 4LMUA 4ZLOA 2YIQA 3IK3A 2IW9A 3QD4A 4Y46A 3DDQA 3MI9A 2OWBA 4ZTQA 4CQEA 3MFUA 1U54B 4F6UA 4LGGA 4EONA 3ZO2A 4C3FA 4GVJA 1XR1A 3A60A 3FEGA 4F1TA 2XM8A 4AT3A 3OXTA 4MWHA 4ANLA 3P4KA 1ZMVA 4C2VA 3M2WA 3ORXA 4RIXA 3SXFA 2GFCA 4LUEA 2F9GA 3LHJA 4L3PA 4WO5A 2OO8X 2VTAA 3C9WA 2ZMCA 4E6DA 2PUIA 4HPTE 4ZSEA 2W1ZA 1BL6A 4UBAA 3CTJA 4XX9A 3DKFA 4XRJA 5B2KA 4FV7A 3NUSA 4IMYA 5KX8A 3BCEA 5GZ9A 4IZAA 3KF4A 3H9OA 4FNWA 3SLSA 5IQGA 3NUPA 4R3CA 1ZMWA 3SKCA 1TQIA 4OTPA 4BCGA 4DG3E 4NM3A 2CGXA 3D7ZA 1JKKA 4YZBA 3F61A 5J1WA 3QRUA 4FK6A 1H24A 5DE2A 3C4ZA 4BCMA 2W1EA 2WOUA 1WBSA 4K0YA 4GL9A 5CZIA 4ARKA 4AQCA 4L01A 4E4LA 5C8NA 5HVJA 3WYYA 5L8KA 3HMOA 2YCQA 2JD5A 4BGGA 3Q9YA 4JBVA 3Q5IA 3TKUA 5AP0A 3ZH8A 2NRYA 4ZAUA 2J7TA 2E9VA 3KULB 3TWJA 3R1NA 2W9FB 5IPJA 4ITJA 2J0IA 4ANSA 3A4OX 3AQVA 2JDVA 2YM6A 4ASXA 1XBBA 5F20A 3Q3BA 4JIAA 2QOHA 2VO3A 4X2JA 3ENMA 5KZ0A 3TZ9A 2Y6MA 3DJ6A 4R5YA 4USDA 5AAGA 5CASA 4IH8A 2QKRA 4QMSA 2JKQA 4O82A 3LZBA 3PIYA 4HW7A 5M08A 1WMKA 2JKMA 4AGWA 1W0XC 3TL8A 2R3PA 1ZARA 4E5AX 4GIHA 1RJBA 3HL7A 4PPBA 3TNHA 4AW0A 1ZOGA 3QCXA 4IACA 2JDSA 4YO6A 3VVHA 5A14A 3F2AA 3IKAA 4IEBA 4KS8A 2XIXA 4J52A 3RAWA 2OZAA 3PE2A 4EH6A 3QCSA 2OJGA 5IKWA 2UW9A 4FT5A 4PTGA 4UMTA 4E6QA 3H4JA 3FLNC 3UIUA 1XHAA 2R3OA 4M66A 4PDPA 3V01A 5K4JA 3T8OA 2VRXA 4C0TA 2C47A 3P0MA 4DT9A 2R3NA 3R2YA 4X3FC 3UJGA 3R83A 4AXAA 3O50A 3OW4A 4F65A 2Y4PA 3PXRA 4RC3A 5JRSA 5I9WA 4FKGA 2WMAA 1REJA 4O21A 5BQ0A 2IW8A 3LMIA 5HX6A 1PMNA 2X8EA 4D1XA 3IDPA 3EFKA 2BALA 3AMAA 4LRMA 5A4LA 4ZY4A 2AC5A 5AR2A 1OM1A 2GHLA 4I20A 4UV0A 4GK3A 2PVJA 4XOZA 1UNGA 1IAJA 4N6YA 1U54A 4CG9A 3R04A 4KSPA 4TYHB 3M42A 1GNGA 5FM2A 4FSRA 4ZEGA 3VBQA 1GZOA 4C61A 3KCFA 4YLKA 2RKUA 3QTXA 4HNIA 4PL5A 3PVBA 4RIYB 5BYZA 3G9LX 2YM5A 1TVOA 4BC6A 4EOIA 1A48A 4FKUA 3OP5A 4C7TA 3PRFA 4C4FA 3VRZA 1JKTA 3CCNA 3RCJA 3RNYA 3EFWA 2XNPA 5K5XA 2R7BA 5H3QA 4C33A 4MXCA 3IPHA 5M51A 5EQEA 3GI3A 3LCKA 4RQVA 2E2BA 5FWKK 4Z3VA 5GZAA 3LFEA 4WT6A 2XNOA 3LQ5A 4IAYA 4QTAA 3TN8A 1YOMA 4HJOA 2FSOX 3ETAA 3IGOA 5H8BA 4C3RA 1ZLTA 2VWWA 3LCDA 1LEZA 4LL5A 5DT3A 5AR4A 4ZK5A 5ANKA 3VS6A 4CFVA 3R8UA 4D4SA 4YZ9A 4E3CA 3ZC5A 2HW6A 4AZSA 4MD9E 2VTHA 3E5AA 4DFNA 4BTMA 3O23A 5HE1A 4M0YA 1PXKA 1WBOA 4IE9A 2I0VA 3ZUTA 2WQMA 5CAUA 4C62A 4DTKA 4YJUA 3FPMA 2C0OA 2KTYA 4FTCA 3VS7A 4BTJA 4QMNA 3SG9A 3LFCA 3V5TA 3ZONA 1CKJA 3NNWA 4PWNA 3KULA 4R5SA 5ANIA 5AR7A 3ZZWA 4J8NA 4A9TA 1OBGA 3ZDUA 4AN2A 4YHJA 2VTNA 2J4ZA 1QPDA 2F7XE 5J95A 3UBDA 3CJGA 3DBFA 5L2QA 5CEIA 2YAKA 3SX9A 4CFFA 3PDTA 3RPYA 4I0TA 4GFGA 4RFMA 3DBQA 4IQ6A 2JDOA 4CNHA 2WHBA 2PVNA 5AM6A 4MXAA 4IZ7A 4LUDA 2VWXA 4X3FB 4FTTA 5BYLA 3C4WA 3P5KA 1ZWSA 2YCFA 1ZY5A 5GJGA 4BI0A 5JN2A 3WZDA 1M7QA 1Q62A 2PVKA 2W1IA 3VBVA 5J5SA 1K2PA 1TQMA 3WILA 5BVDA 5ITAA 2UVXA 2V7AA 2YCSA 1MP8A 1KV2A 5EH0A 1V1KA 4CFMA 3MTLA 4YR8A 2OJFE 3UNZA 3KFAA 4BB4A 4HYUA 4DFUA 2GHGA 3MPAA 3DNEA 2KULA 3G6GA 4FIHA 4FSWA 4K1BA 4S30A 5CU2A 5EDQA 1M14A 2PWLA 2A1AB 3KRLA 3NUUA 4HOKA 4XNEA 4ANNA 4RBLA 5TT7A 4YJPA 1G8AA 2EB3A 4F6SA 5CSWA 3UPZA 4O86A 4GT4A 4R6VA 5HGIA 4FT7A 5EDRA 4YC3A 3SG8A 3F88A 1VZOA 4AZFA 5CVFA 1QPCA 5TF9A 3WZJA 3A99A 3BV3A 3ROCA 4DBXA 2BRNA 2VWBA 2O64A 2WPAA 3NPCA 4Z55A 4R3PA 3UG2A 2VTSA 2GS6A 4FG7A 3LJ2A 3MY0A 4OT6A 1FVRA 3LPBA 3TT0A 2B55A 3BYOA 3GT8A 5A4CA 2PUPA 3AD6A 3TCPA 2LAVA 4MQ2A 1NW1A 4BCHA 4EH7A 5CYIA 3F5UA 3F3VA 3SW7A 2R5TA 4RIYA 4IZYA 3WIKA 5IQFA 4GG7A 4I6BA 3NUXA 4C34A 4D58A 4I0SA 1H01A 4FEVA 4FV4A 4J96A 4APCA 4YJQA 5HNGA 3TDVA 5M4IA 3OF0A 5F9EA 3UC3A 4UXLA 4RQKA 4QP1A 5EKOA 2BAJA 4EWHA 2W7XA 1MUOA 3BPRA 4LOOA 2Z7RA 3Q5ZA 3QHRA 2Z60A 3ZEWA 4EK8A 2C68A 4TKSA 1IA8A 4EHEA 5HD4A 3I5ZA 4OBPA 4ASDA 3R0TA 4II5A 3LKMA 4BYIA 4O7SA 3DS6A 5AUXA 1XH4A 3BU5A 3PWYA 3C4CA 4G5PA 4H36A 4H39A 4O0VA 4D4YA 5B2MA 4B9DA 3VF8A 2UUEA 5FRIA 1PKDA 3UNKA 2CKEA 4JXFA 4BZOA 2W4OA 4M15A 3LE6A 2R9SA 2XMYA 3BIZA 3EOCA 3VS0A 3AG9A 2IWIA 3PG3A 1YQJA 4U97A 3BYMA 1Y8GA 3PIXA 3DZQA 3CD8A 4CFXA 2IVUA 4DEEA 4ZJIA 2JKOA 1WVYA 3OOMA 3R1SA 4QMTA 3UIBA 5LVMA 4NM7A 1OIRA 3TG1A 4U7ZA 1YRPA 3ZLXA 1IAHA 1X8BA 3MA6A 3DB8A 5KE0A 3OY3A 2WTKB 3PY0A 4FKTA 5D11A 4ZP5A 5HO8A 3NAXA 1Y57A 4BDDA 5FEQA 4EYJA 4O7YA 5M07A 3D7TB 1YDTE 4FZ7A 5EYMA 3VRYA 4EQMA 4BKYA 2JDTA 4E20A 2WMTA 4RX9A 4YC8A 4FV2A 4FT9A 5DIAA 4AU8A 3NYXA 2WB8A 4X3FA 3AT2A 1OPJA 3F69A 4L7SA 4WSYA 4Y73A 4CFUA 2X8DA 3L9MA 3V6SA 4M13A 4EOSA 2BDFA 4L45A 2O2UA 3LCTA 1V0PA 2UW8A 4IJPA 3BQCA 4XUFA 3RAKA 1H1RA 5DRDA 4BDFA 4IAFA 2RFDA 1Q8YA 3FY0A 1J3HA 3MB7A 1H28A 2OBJA 3OXIA 4BRXA 4JG8A 1WVWA 2BUJA 4QP8A 4G3EA 4CLIA 4RFYA 5CEPA 4ZTLA 5C4KA 3LCSA 2EUFB 3HYHA 3KB7A 3IW6A 4XV9A 4PNKA 4CTBA 2UZVA 4H3BA 2IW6A 4XV1A 4EK3A 1KWPA 2C30A 3TNWA 3CR0A 2YWPA 5CAPA 5DT4A 4YHTA 5GHVA 3ZYAA 2HELA 1VJYA 5CI6A 4D2SA 4GT3A 2YIYA 2BFYA 2ITWA 3N4TA 3KL8A 3R00A 4U8ZA 4AE9A 4D2RA 5KHWA 4BZDA 4LGDA 3MJ2A 3E92A 4O7TA 4E7WA 4DE4A 2W1CA 3HVCA 4FSZA 4IM2A 5HOAA 5J8IA 1H08A 3ZO3A 2XB7A 3DOGA 3GFWA 4XJ0A 4ZIMA 5HLWA 1Z9XA 1UA2A 4DGOA 4FTJA 2B0QA 4GV1A 3G51A 3R9OA 1Q8WA 4XG9A 4WUNA 2IVTA 5EHYA 3R8VA 2WXVA 3TUCA 3GENA 1CDKA 2BHEA 3KK8A 4HCVA 4OUCA 1IA9A 4NH1A 1TKIA 3QRKA 4QTDA 5IH5A 3PYYA 3PWDA 2ERKA 3EQBA 3L9LA 1SVHA 4BBFA 2R3RA 2Q83A 2W5HA 4PPAA 2E9PA 5FG8A 1JSUA 4YZDA 4R77A 3AC1A 4FTKA 3IW7A 4WA9A 3JPVA 4IWPA 5IQEA 3WBLA 3PXQA 2ITOA 3SQQA 2XA4A 5LCKA 5AV4A 2CMWA 3F66A 3PLSA 4FVQA 4DH1A 1W83A 4EH8A 3PJ3A 2H6DA 3SHEA 3AGMA 4TWPA 2AYPA 4XYFA 4F7JA 1H0WA 4EOQA 1NA7A 4G31A 5D41A 4CD0A 2VGPA 2PVFA 2XEYA 2PHKA 1ZZ2A 5DNRA 1XH5A 3D14A 4IVDA 2HXLA 4GEOA 4KB8A 4BBEA 5EKNA 1PF8A 1SMHA 3LM0A 5L4QA 3FQHA 3R8LA 3UYTA 5E8WA 1REKA 4Y83A 1OKZA 3A8XA 3R7YA 3AT3A 2RG6A 5AUZA 4AE6A 3DY7A 4YZMA 3ZUVA 4BTFA 5HQ0A 3PTGA 2V0DA 3D7TA 5AV1A 3LMGA 1ND4A 4XOYA 3WF5A 2X7OA 5JFXA 1OB3A 1FBNA 5CVGA 2W9ZB 3BYUA 4OLIA 2UZWE 2QG7A 3CQEA 4QPMA 3UIMA 4KRCA 5AM7A 2WTCA 3RK9A 5IISA 3PPZA 3D5XA 3MESA 5M56A 3OC1A 3R9NA 2W99B 3ZCLA 1PW2A 2J51A 1HCLA 3QUDA 4FIGA 4E73A 1VYZA 1W98A 4S32A 3WYXA 4LMNA 3QX2A 3MV5A 2PZIA 4IIRA 3ZRMA 4ACDA 4B8LA 3ANRA 3PVUA 5HESA 3V5WA 4J98A 3OWKA 3GGFA 4NEUA 3O0GA 1ZYDA 4GYGA 5FBOA 3P23A 3GP0A 4HVGA 3F7ZA 2WMUA 3NVMB 4FKPA 5EW8A 3TV6A 1RDQE 5J9LA 1H4LA 4MXOA 2BKKA 4G5JA 1GZKA 2PL0A 3HP2A 1XWSA 3K2LA 4JAJA 1CM8A 4Q2AA 4XEYA 2GNIA 3HDMA 3ZHPC 1RW8A 2GFSA 3K3IA 5E90A 3UVPA 2YZLA 5JGBA 2ONLC 3R9HA 5BPYA 5HG8A 2WQBA 1ZYCA 4R1YA 2ESMA 4G2FA 4N0SA 4EOPA 1J7LA 3MWUA 4U9AA 5DA3A 1H1SA 4O1OA 1GIHA 3PP1A 3WZEA 3SVVA 4I5PA 1YWVA 2QR8A 3A2CA 3H3CA 4GSBA 2NP8A 4JVGA 4PRJA 4DT8A 5E8UA 3FZ1A 1Q41A 5IA1A 1YWNA 5KMLA 4IJ9A 3LJ1A 3QGYA 4HGTA 5BVFA 2G2HA 4WG3A 3FSFA 1Q3DA 4ZS0A 4P5ZA 5HBJA 2DS1A 4U6RA 3DBCA 3RAHA 3W2PA 4O84A 2GTMA 2R64A 3S95A 4OTDA 4EOKA 4XG8A 1EH4A 2Z7SA 4MAOA 2V22A 5KNJA 3QWKA 3RK5A 4FODA 4ACMA 3RWPA 3SD0A 3JVRA 2X6DA 5JZNA 4FIJA 2OK1A 3WZUA 1BMKA 5AJQA 3GBZA 4QMUA 5CWZA 4EH5A 4AZTA 4IM0A 5AUUA 2XZSA 4NM5A 5B2LA 3EYHA 4QYEA 3JXWA 2PVHA 3CKXA 3ZFMA 2WMXA 4H58A 4FF8A 3WF6A 5JSMA 5DEWA 5FGKA 3W2RA 4AFJA 3S1HA 2VGOA 4XBUA 3NCZA 3V6RA 4DF3A 2QR7A 5FXQA 3MPTA 3B2WA 3D9VA 4RC2A 3FMMA 3VUTA 2O65A 2XKEA 4O0XA 1GAGA 4TZRA 4NFMA 4QYFA 4KS7A 4I4FA 5EOLA 4I1ZA 2J9MA 4CVAA 4UALA 1JOWB 2UZEA 4DC2A 4K6ZA 4RWLA 5AFVA 4B4LA 4ZXTA 4FV5A 4NCTC 2IG7A 3LFSA 4C02A 4YJNA 2R3HA 3NR9A 4FTMA 5DWRA 4JQ8A 4AACA 4DGNA 2J0JA 4C3PA 3PY3A 3HV4A 4CFWA 4LL0A 5HCYA 2F7ZE 4WBOA 4BYJA 2ITYA 3DTWA 1YWRA 4O0YA 4FTAA 3MS9A 2YACA 3L8SA 4U43A 5HNIX 2C6MA 3BV2A 4O7NA 3OROA 5FDXA 4KABA 5KUPA 2BVAA 3QLFA 1OUKA 4JDHA 2Z7LA 1UU9A 5BMSA 2VU3A 5ETCA 1XJDA 2B53A 2R3JA 1B39A 1M2PA 2GU8A 3B2TA 3R1YA 5TR6A 2Q0BA 2J50A 3OW3A 5KMMA 5BMMA 3RHXA 5IUIA 4E6AA 4GYIA 4EOJA 3L1SA 4F0IA 5CS6A 2I40A 4A9YA 5EG3A 2XVDA 2R0IA 3LFQA 1SVEA 3PXZA 3G90X 1FMKA 3R30A 1WAKA 3R7VA 1GJOA 3GCSA 4MH7A 4PDOA 1H8FA 4FSNA 4E4MA 1OKWA 4DEAA 3FZTA 2PSQA 5GNKA 3U6IA 3A7GA 4PPCA 4RSSA 4NK9A 5KMKA 4F0FA 3BBTB 3RBWA 1G8SA 3U55A 2PVMA 2BMCA 4ZLYA 4MXZA 4XP2A 2R3IA 3Q4TA 3REPA 3UNJA 3TJCA 2WMBA 3OEZA 2RFEA 2BRBA 5CXHA 3CXWA 4JDKA 4EK5A 5IU2A 1OL2A 2W17A 4L3LA 4X6RA 4RVMA 4IAAA 2PZRA 4RT7A 2W4KA 3DT1A 3ORZA 4FBXA 1JSVA 3FV8A 4MF0A 3NIZA 4YURA 5LWNA 3R01A 3TTIA 4MHAA 4BDAA 5HG7A 2VO0A 4L44A 2WIPA 4RC4A 4D9UA 1MQBA 2BFXA 4FGRA 5ANJA 2X6EA 3MFTA 3EN7A 4FT3A 5EYDA 4F9YA 4W9WA 5D9HA 2ZVAA 3DZOA 3EHAA 4GUEA 4XCUA 3VS4A 4EJNA 2W0JA 4C37A 3UVRA 4ZLZA 3ZUUA 3V8SA 5IA3A 1PRYA 4NIFB 4J95A 3DXPA 4K2RA 3TDWA 4LV8A 5EQPA 5CF4A 1QPJA 3CY3A 3BI6A 3KCKA 3PUPA 4BI1A 4RX5A 1W8CA 3LAUA 2PK9A 4WSQA 4ZY6A 3FC2A 1KE8A 4CMOA 1V0OA 2X4FA 4D28A 5AP3A 5CEOA 5CTPA 3GOKA 2J0LA 3KY2A 3DKOA 5GJDA 3VUMA 1PXMA 2YERA 4BCKA 3DPKA 2XK6A 4BHNA 1YXXA 5HE0A 3BU6A 3FY2A 3I7CA 1FPUA 1UKHA 4OTFA 4QMPA 5AWMA 4RJ8A 4WNMA 4MCVA 4Y72A 4PP7A 4W4WA 3TACA 3ZXTA 4AA0A 4Q9ZA 2UZOA 2FYSA 4O0RA 1SYKA 4FTIA 4F99A 1UV5A 1OKYA 4QP2A 2XF0A 5EFQA 1SVGA 2GNGA 4V0GB 3VUHA 3NCGA 2W1GA 3V3VA 4FV8A 1YOLA 4V04A 3EH9A 3ZSHA 3I4BA 3NYVA 4U79A 3V8WA 3ZDIA 2X2MA 1XBAA 4C4GA 4CGAA 4GK2A 3VC4A 3DJ5A 2P4IA 2YIWA 3OXZA 1K3AA 1JPAA 4JDIA 3FWQA 5M09A 3PPKA 4JJRA 4YO4A 2XIKA 1ZYLA 3P78A 4IWQA 5E1EA 5LVLA 1JAMA 4FOCA 3AMBA 2CCIA 2VTLA 4ZZOA 2HAKA 3GFEA 1MRYA 3AT4A 4S34A 1CKPA 2VX1A 4EZ7A 4BF2A 3QKMA 3E7VA 3ZLYA 5B0XA 4RPVA 4EBVA 3RMFA 5AUWA 2EVAA 4D5HA 1KE9A 2QO7A 5E7RA 5HHWA 2QOOA 3KREA 2YZAA 3QFVA 4YBJA 4YJOA 2YLEA 2ONLA 4H1JA 5F1ZA 3ZSIA 4GKIA 4O27B 5LMBA 4X2KA 4BL1A 3DAKA 4LRKA 3U6HA 3BGPA 1OPKA 2G9XA 3HRCA 1UU3A 1WBNA 3M1SA 3NNXA 2RL5A 3O96A 2OH0E 3PZHA 3F2RA 2YITA 2CNVA 3W1FA 3FLYA 4UMQA 2VTTA 4AGDA 3DQXA 3QKKA 5FEEA 2ZDTA 3QTQA 1Q97A 2WOTA 4CYJA 4BICA 2XUUA 3B8QA 3MH2A 5CNNA 2DYLA 4BDHA 2BIKB 4FK3A 2XS0A 5DH3A 4O83A 5L6OA 3PPJA 3MSSA 5IUGA 4GMYA 3TNIA 5JFSA 2OSCA 3FXXA 3IDCA 2ITNA 1YDRE 1JNKA 4C38A 4FKJA 2GS7A 4NZWB 4MXYA 4J8MA 2Y4IB 3MA3A 5AEPA 2C5YA 3E3BX 5L8JA 1MQ4A 4MD7E 4OTWA 3AMYA 4KD1A 2G15A 3DTCA 4O6LA 3BU3A 4M69B 5AR5A 2XKFA 4FEUA 1WCCA 2X7FA 3PSBA 2OF2A 3KK9A 4YUQA 3SDJA 5LMKC 5EHOA 3TKIA 3QQHA 5DI1A 4IX6A 3UZPA 3D83A 4BDGA 2JAVA 4KSQA 4U45A 4NIFA 4IBMA 3W8QA 2F2CB 2OIQA 2CHLA 5BUJA 3H0YA 4O38A 3C4EA 2ZM4A 5CT0A 4NCTA 1KOBA 2UW0A 3HX4A 2YAAA 4XP0A 4YC6A 4PQNA 5J87A 4FYOA 4J71A 1ZYSA 4FR4A 3BHUA 3UE4A 1V0BA 2CCHA 3V8TA 4EBWA 5IMXA 1B6CB 1OL6A 4EKKA 2X7GA 3TM0A 4ZTRA 1AQ1A 4CV8A 1FVVA 4O6EA 2XK9A 3R8MA 2C6TA 2GQGA 4L46A 4QP4A 3CY2A 2OXYA 3OY1A 3R22A 5TE0A 3BHHA 4BDIA 4OW8A 3UIXA 4XG7A 3V5JA 3UO5A 3E8CA 5HTIA 5ANEA 3Q52A 4JG6A 5BUEA 4RLLA 4MBJA 3ANQA 1H1PA 4GU6A 4V0GA 4YTFA 2WU7A 3EJ1A 4FL3A 5TO8A 3HRFA 5M57A 2C3IB 3GXLA 2LGCA 4IDVA 5KCVA 2B9IA 2F7EE 4RG0A 3DXQA 1YXVA 4DEIA 2R3KA 1ZAOA 3UQFA 3MH3A 5CSPA 4D4RA 4M97A 5ICPA 4RJ7A 1KE7A 3BX5A 4WNPA 4EWQA 3VW8A 3G5DA 2JFMA 4FSTA 1OECA 2FO0A 3LMHA 4JT3A 4K8AA 4USEA 4YPDA 4KBAA 5HU3A 3HMPA 1UKIA 2AC3A 2GDOA 4TWOA 5JFVA 4E4NA 4D9TA 2OXXA 5IQIA 2OLCA 3CS9A 1ZOHA 3OUKA 3C7QA 3NUAA 2W05A 4ZSJA 4ANOA 3W32A 2UZBA 1WBPA 1KE6A 1QL6A 2H8HA 4DAWA 5A4EA 5DPVA 5IEXA 1ZOEA 4L67A 2RIOA 4L9IA 4WNOA 5HE3A 3RCDA 4GCJA 4BDBA 3AC2A 5ETFA 4BCNA 2A0CX 5I0BA 2W4JA 2ZMDA 3A62A 3UODA 4J1RA 2CGVA 3NW5A 5LXMA 2FSTX 2XRUA 4AW1A 1U4DA 3NVKI 4QMZA 2JBPA 1DS5A 3BHVA 4DFZE 3QL8A 4PL3A 3CLYA 1Q5KA 3VUGA 5KKRC 2R7IA 3Q2MA 3G15A 4FZFB 4C8BA 3QAME 3FC1X 5A6OA 4H3QA 5EDPA 3I79A 2YDKA 4E5BA 3UO6A 3KXMA 4QQ5A 1APME 3Q4CA 2W96B 3BHYA 3DA6A 1JBPE 2ZOQA 4M69A 3OCTA 4DCEA 2YA9A 4A4OA 3A8WA 2WTKC 3Q4UA 4FIFA 4QTEA 4YNOA 2GNJA 2XM9A 3FUPA 3OCGA 1J91A 2PMOX 3HKOA 4NYEA 4WKQA 4AG8A 4AS0A 4EQCA 2PE1A 3VWAA 5CY3A 2PZPA 4FEQA 4B8MA 3TI1A 5CAQA 2NPQA 3QQLA 4DEGA 1PKGA 3GU8A 4QNAA 4BBMA 2YDJA 3MTFA 3ORIA 2BRGA 3R1QA 2VWZA 2WTJA 3ZZEA 3AXWA 3DNDA 4JG7A 1M2RA 2REIA 3DCVA 4IB1A 4BWXA 3LFFA 1NVRA 1LUFA 2BILB 3D5WA 3LCOA 2C3JA 4IVAA 2F4JA 3F5GA 3ALOA 4LM5A 4JQEA 4ID7A 2H9VA 2ITTA 5ACKA 4DYMA 1S9IA 2GQRA 3H30A 5FQDC 2J5EA 3BWFA 5M4UA 3CBLA 5M4CA 4I5MA 3VBWA 5C1QB 4TN6A 1ERKA 2WNTA 4QYHA 4TYHA 2VTIA 4YZCA 4EH4A 4RVTA 5BVOA 4O7ZA 2P55A 5AADA 4TYIA 4ASEA 5HO6A 2J2IB 5CQUA 2QOCA 4GJ3A 1VEBA 3SXRA 3LFNA 3MY5A 3OTUA 4KKEA 3TEIA 4HVSA 5LQFA 3KGAA 4RMZA 1AGWA 2AUHA 3AC5A 3M11A 2WGJA 3UOHA 3QCYA 3CE3A 3RZBA 4F63A 5JQ8A 1W84A 3A61A 3PJ8A 3R02A 3FPQA 3S3IA 3TV7A 3WARA 2UW6A 2YM3A 4AOTA 2A19B 4DFYA 3DGKA 4I21A 1PMEA 4FKQA 4JAIA 5D10A 3SOCA 3U51A 3FKOA 4CMUA 5CENA 4F64A 4CKJA 5IA4A 3NNVA 4FMQA 4ENYA 2FB8A 3FZSA 3FI3A 4O0SA 2JC6A 2H96A 3PG1A 3SRVB 3BGQA 3MFRA 2PUUA 3E8NA 2C0IA 2C3KA 5GJFA 1PMUA 3CEKA 3ZO4A 2GTNA 3SOAA 2GCDA 3SW4A 1ZY4A 2PUNA 4HVHA 2GNFA 2VTPA 1AD5A 4Y5HA 3PXFA 3VUDA 3Q60A 5FBNC 1KE5A 4G3DA 4ALWA 4EKLA 5KKRB 3P7CA 5CSVA 1L8TA 2GPHA 2GS2A 3U8WA 5HVKA 4PL4A 1URWA 4HGSA 3AC4A 1O9UA 4R8QA 4JBOA 3WF9A 3GU7A 2XKCA 5LMAA 2JGZA 3U4UA 4USFA 5L6PA 2JDRA 4E5WA 3ZEPA 2HYYA 3EN4A 3LJ0A 3ZLWA 5KMNA 1KSWA 3F7WA 2FA2A 4FSUA 1OUYA 1URCA 3G0FA 2VD5A 5DBXA 2XIYA 3N51A 3KRWA 4FVPA 4EL9A 3DQWA 5A9UA 2QOFA 1DM2A 2VWUA 3ULZA 4DHFA 3UO4A 1VR2A 5LMKA 5AV2A 3DKGA 4QP6A 3TZMA 3PRIA 4NL0A 2WAJA 3GNIB 3MYGA 2I6LA 4G3GA 4U41A 1WBVA 3JS2A 3RKBA 2BCJA 2XNEA 5ETIA 4HVDA 2J90A 2VNWA 3R7IA 4RJ6A 4OTQA 4G3CA 5BVEA 4UX9A 2QI8A 4RZVA 3GCVA 5ACBC 2ETRA 2R0UA 1FGKA 4ONAA 4UMUA 4RJ4A 2C5VA 3ATSA 1P2AA 2DWBA 4L6QA 3UMXA 2JLDA 3I81A 1T46A 4I3ZA 3ZM9A 3VQUA 4BIBA 5M53A 3ZSGA 1IASA 2CDZA 3U4WA 5HTBA 4MKCA 3UC4A 4EUTA 4FTNA 2XK4A 4NW5A 2OKRA 3EQCA 3OWLA 4G16A 5DGZA 1PXOA 1IEPA 2ZYBA 4EORA 4OTRA 5C26A 5AUYA 5FUTA 2CJMA 4BN1A 4CFNA 3FHIA 4QD6A 4ASZA 5LVOA 2CPKE 5E8ZA 3C0IA 3LXKA 3L9NA 4FTQA 4XV2A 4YMJA 1R1WA 3TKHA 5HLNA 4NTTA 5JGAA 2OZOA 3E62A 4LV5A 3EQIA 1S9JA 3NAYA 4FGBA 4KBKA 3FYJX 5AP1A 4PMMA 4TYJA 1O6LA 3P9JA 4MTAA 1K9AA 2OU7A 3BKBA 2WEIA 2UW3A 3PP0A 2GHMA 1F0QA 3FMEA 2UZNA 5E1SA 5FD2A 5JEBA 3QHWA 3FL4A 1XH7A 4NU1A 5DR6A 4FYNA 3CKWA 3OZ6A 4R3RA 3OOGA 5HG5A 5CF6A 5AP4A 3U54A 2RFSA 4KKGA 4L52A 4N70A 4A06A 2Y9QA 3V5LA 4D2TA 2OXDA 4QP3A 3VUKA 3JY0A 5CVHA 4F7NA 4JBPA 1PXIA 4M14A 2OJJA 3QZGA 4V05A 4YJRA 5EM6A 4QP7A 3VJNA 4QMXA 1UWJA 3OCBA 1J1BA 3H0ZA 5J79A 1ZZLA 4QNYA 1BL7A 2UZDA 2XYUA 4KAOA 2B54A 5CLPA 4BWPA 2XNMA 5FTGA 2RF9A 3PA3A 4M84A 2ITZA 4FVRA 4R1VA 1RQQA 3UPXA 3UTOA 1E1XA 3GC9A 1BYGA 3DB6A 4WRGA 2XK7A 2OI4X 3LM5A 2O3PA 3NGAA 3QGWA 4QYGA 4FL1A 4O0WA 3MY1A 3QBNA 2BZJA 2BDWA 4EHGA 2R3MA 4L68A 2Y0AA 2B9HA 5IUHA 3G0EA 3HDNA 2GNHA 3NUYA 3VHEA 1PXLA 5DN3A 4I5HA 4XRLA 5EM8A 5KMIA 4FTOA 4CKIA 1XQZA 3KMWA 3KEXA 4LQMA 4C36A 4E6CA 4YSJA 3OBGA 3TNPC 3TZ8A 1W7HA 4LG4A 2JFLA 3WF8A 2QOQA 3WIGA 3MIYA 2WTVA 5E8VA 4B6LA 4EH3A 1JKSA 4XBRA 5K4IA 2W1HA 3ALNA 5IA5A 4FEXA 4E8AA 3BYSA 4RLKA 2XCKA 3QD2B 3R9DA 3VIDA 3QF9A 5I4NA 3A7HA 4IDTA 3KVXA 3PSCA 4RRVA 2XK3A 3NRMA 5L2IA 3IG7A 1IR3A 4XHKB 1Q99A 3DK3A 3R28A 4FIEA 5IEVA 1E9HA 2GQSA 2C5NA 3S00A 4BHZA 4I6FA 2FUMA 4J99A 4PTCA 3VQHA 5M4FA 1YW2A 4D2WA 2F2UA 4B99A 4DGMA 2C3LA 2W1FA 3CIKA 4JS8A 3KC3A 4FV0A 5HD7A 3EIDA 3O7LB 4RGJA 2Z02A 5KZIA 4WUAA 3E87A 4ALVA 2BHHA 3R8ZA 3OUNB 1LEWA 5J1VA 2VTJA 2CGWA 2UV2A 3MPMA 4L3JA 3PY1A 2NO3A 4G9RA 5IH4A 5KMOA 2C6LA 4IX3A 4NWMA 5EI6A 2B9JA 4I4EA 5HVYA 4DH3A 3KA0A 5HG9A 2RG5A 2WQNA 2F49A 5DOSA 5J9YA 3UQCA 4NJ3A 4DEDA 2G2FA 3RI1A 3IS5A 3BLHA 3IQ7A 4NJDA 4QOXA 1DAYA 4FG8A 4HVIA 5B7VA 3DFAA 3KRJA 5HCZA 2O63A 2FH9A 4WRSA 3RWQA 2IJMA 5AIRA 3EQHA 4FSMA 3C5UA 4Q5EA 3NWWA 4ZZNA 3ZRKA 2PVYA 4U44A 3IGGA 4A9SA 5HZNA 2YIXA 3KXZA 4EZ5A 5JGDA 2WIHA 2VZ6A 5CU6A 2NNWB 3NX8A 3FMHA 3N4UA 2BDJA 3RAIA 4ACGA 3O17A 1ZRZA 3R2BA 4CQGA 1YKRA 3L8VA 4M7IA 4BIDA 4IC7A 4FV9A 2QONA 3L9PA 5CU4A 1H00A 4HNFA 2YABA 5L2TA 4FZAB 4JRVA 3NZ0A 3ORKA 3TJDA 2HZNA 2A2AA 5FM3A 3UYSA 1OIUA 2YM7A 2J6MA 4HYSA 4GG5A 1QCFA 4W4VA 3QXOA 2J0KA 3MVJA 2BZIB 2QLQA 3EL7A 4RIWB 5DHJA 1ATPE 2OICA 3KKVA 4D0XA 5EM7A 4I94A 4ZTNA 4NM0A 4M12A 4ZOGA 3BEGA 4C58A 3LXNA 2HY81 4RWJA 5L2WA 4ZMFA 3PXKA 3IW4A 4TWNA 4EK6A 4O7WA 1LP4A 4O7RA 4J7BA 4RZWA 2IVSA 3PA4A 1GIIA 1H26A 1KOAA 3QTWA 4JR7A 4KBCA 4QMLA 3POOA 5AP6A 3HUCA 3KN6A 3R8PA 4FUXA 4UWCA 3EQRA 2ZV9A 5C4LA 3CGOA 4Y8DA 4JR3A 5HICA 4AN9A 1UWHA 3DDPA 2BZKB 3O51A 5CU3A 5FLFA 4FA2A 5L3AA 1M2QA 2EXMA 4I22A 4L00A 1E1VA 2EB2A 3IW5A 3F3UA 1WFCA 3MH0A 3BLRA 4JI9A 4YZNA 5EOBA 4AT5A 4F9BA 2QHMA 5L6WL 5HNBA 2CN8A 3PSDA 3BELA 3G9NA 2XNNA 4ANMA 4G6OA 4QPSA 3VULA 4ALUA 4KIPA 2BKZA 1VYWA 2VO7A 4I5CA 5AX9A 1L3RE 5C27A 4QTCA 4QMQA 2QNJA 4HCTA 4HPUE 5HCXA 3IOKA 5EK7A 3A4PA 4EC8A 3RPOA 1JWHA 2UZLA 4GJ2A 4D2VA 4CT2A 5I9VA 1UVRA 5AR8A 4A9RA 3TUDA 4QYYA 2ZM1A 2ZV2A 4GVAA 4XG3A 4RJ3A 3ZM4A 2BPMA 4UYNA 4CEGA 3CPCA 4M67A 4AZEA 2OFUA 1GIJA 2V5QA 4AFEA 4DFXE 3GCQA 3QUPA 3OBJA 3R73A 3VW6A 2HCKA 3ZMMA 3IONA 4AF3A 4C57A 1M52A 4HGLA 3BE9A 4ERWA 4IM3A 3HMNA 4YHFA 1OITA 3OT8A 3LFDA 5HE2A 3RZFA 2YWVA 4XG6A 5I9UA 4YPSA 2PYWA 2YJRA 3EQDA 4NW6A 3A7IA 2JKKA 2CN5A 3R6XA 5CX9A 3WE8A 2DUVA 3I5NA 3NYNA 4V01A 3ZBFA 3QZHA 4D0WA 5IQDA 1G3NA 4DCAA 3DFCB 1P4OA 3Q9ZA 3ZRLA 2PULA 4BDKA 2WQEA 3AC8A 4CSVA 3R7OA 2HIWA 1R3CA 3QALE 4Z7GA 3UZTA 5K0XA 1BI7A 4E1ZA 1H0VA 4TYEA 4AOJA 5G6VA 4FV6A 3QQKA 4O0TA 5HIEA 5HLPA 3W2SA 5IA2A 4O2ZA 4AA4A 1BLXA 3RINA 3GC0A 3WZKA 4BI2A 4FG9A 5H8EA 2CKOA 4U3ZA 4UXQA 3CQUA 3OMVA 3T9TA 3EQFA 5KHXA 2CNUA 3I6UA 4PF4A 1IG1A 5HBHA 4FEWA 5E8XA 3GC8A 3LVPA 1UU7A 3G6HA 2YEXA 4W9XA 1Z57A 1F3MC 2BRHA 4LFIA 4BFMA 4JOAA 3Q32A 2XCHA 4EC9A 4OTHA 4ERKA 1OBDA 3ZC6A 3W33A 1FINA 2C5OA 2I0EA 3E8EA 3HAVA 1KUTA 1PMVA 3EFLA 1Y6AA 3H10A 3K54A 3MFSA 3S2PA 1J7IA 2C6DA 5DR9A 4FKOA 2Y4IC 3LIJA 4OR5A 4XP3A 5CNOA 4YP8A 3RNIA 4JNWA 4BCIA 4PP9A 4F9AA 5KMJA 4KUJA 3VAPA 2OZAB 5E8YA 3SAYA 2QO9A 2QOKA 3UQGA 3DJ7A 2I0HA 4TY1A 2BAQA 4W4XA 3VS2A 5D7AA 4ENXA 1GZNA 4M3QA 5H8GA 5AMNA 3MH1A 3RPRA 3COKA 3OVVA 4FTUA 4IB5A 4ZSGA 3EQGA 5J7HA 3SGCA 4L8MA 2P3GX 4IWOA 3FZOA 3QKLA 4CCBA 1KV1A 1W82A 3QTZA 2ZV7A 5CZHA 4GRBA 1XO2B 2OG8A 2RGPA 4ACHA 3VS5A 4ZMEA 2WMSA 3OHTA 5I9XA 4QRCA 5TKDA 4X2FA 4FZ6A 3PIZA 2GSFA 4AW5A 2C4GA 3FQSA 3EYGA 5BVNA 2OJIA 3K5VA 4CZTA 5A46A 3ORMA 3UOJA 3U9NA 3N9XA 2BRMA 4I0RA 4CRSA 2PU8A 4NFNA 3QTRA 3FZPA 4F70A 3W18A 3CC6A 3FSKA 2VN9A 2XK8A 3OD6X 4NKAA 3VN9A 3DV3A 3AC3A 4EHVA 5K9IA 4EI4A 3W2QA 4D5KA 5A6NA 3E63A 1IRKA 2X2KA 3SXSA 3SC1A 3OWJA 1LR4A 4BDEA 2HZIA 5A4TA 3EB0A 3FLSA 3VJOA 4PDYA 5CF5A 3P79A 4IAKA 4DEHA 3C13A 5CANA 3WE4A 1YXSA 4WOVA 4BZNA 3N4VA 4IHPA 5FEDA 4MNEB 2HOGA 4U5JA 4O81A 1CTPE 5HBEA 3SV0A 3BBWA 3ENHA 2WZJA 3G33A 3RGFA 4IX5A 4JBQA 2R3LA 3JVSA 4OTIA 2IVVA 2O8YA 4BIEA 4UZHA 3U6JA 3MDYA 5E8SA 4EOLA 1Y8YA 4YSMA 3W55A 3AD5A 3DK6A 3KXNA 2WEVA 3EZRA 2YM8A 3LLAA 1YI6A 2ZB0A 4F4PA 4RJ5A 4WBBB 4G3FA 4X2NA 3HA6A 5CT7A 4DLIA 4F7SA 2QLUA 4EOOA 3QRTA 2F57A 2WO6A 3F9NA 3BZ3A 3FKNA 3MGYA 4S31A 3B8RA 2O5KA 4TT7A 3ODZX 3QWJA 4O2PA 3GUBA 3LFAA 4D1SA 2JITA 4RWKA 5HU9A 3ET7A 3ODYX 2JAMA 4CTCA 3V5QA 3DK7A 4JX3A 3D0EA 4NKSA 1G5SA 2UW4A 3UOLA 5AV0A 5IZFA 2X9FA 4G9CA 2Q0NA 4FKLA 3T3VA 4IB0A 3F3ZA 3ITZA 4BGQA 3CGFA 3MVHA 4OTGA 4RA5A 4EYMA 4XV3A 5K3YA 5JMSA 4F1OA 4CYIA 4X7QA 1JQHA 3II5A 4HYHA 4U3YA 3VO3A 3QQUA 3HV7A 3R7GA 3FE3A 5DLSA 4FOBA 5DFPA 3P86A 5CSXA 4RIOA 4YLJA 3TUBA 4CG8A 3DXNA 4ZY5A 3ZTXA 4J53A 3PVGA 4FNYA 4NT4A 1A9UA 4Y5QA 2OIBA 2CSNA 4AW2A 5CEQA 2VAGA 2YN8A 4FKSA 4A07A 4D55A 4PMTA 3D4QA 3MBLA 4DGLC 1PXNA 3FMJA 4P4CA 4R7HA 3S0OA 2PMNX 5E9EA 3O7LD 2XBAA 3G2FA 1JSTA 2WELA 5HO7A 4ZS4A 3Q53A 3HEGA 5CXZA 4CZYB 3C1XA 2ACXA 5JT2A 3P7AA 2UVYA 4G1WA 3KXGA 1HCKA 4B0GA 2PVLA 2J0MB 2EU9A 3PFQA 4FTLA 4LI5A 1PY5A 2C6IA 3A7FA 3FMKA 2W06A 3EL8A
chains in the Genus database with same CATH superfamily
2RFNA 3O2MA 4RA4A 2C1AA 1SZMA 2WFYA 2R2PA 2Z7QA 3HZTA 1SNXA 3KN5A 1OL5A 3Q96A 4TXCA 3C0GA 3VBYA 3W8LA 1H27A 5GIPE 5C8MA 5J5TA 3GU4A 4X0MA 4QPAA 2HZ0A 5D7VA 4BY9E 1Y91A 4DDGA 3COIA 3UOKA 4IC8A 4QQTA 2XJ2A 1B38A 3QCQA 4BCPA 3DKCA 1I44A 4CT1A 5A4QA 4QDEA 1OPLA 2XRWA 4IADA 2ITQA 3KXXA 5JFWA 4G34A 1MRVA 4AGUA 3O8TA 4QO9A 2P2IA 4BCOA 1PJKA 3ZFXA 4W4YA 3OEFX 5FP6A 2VTOA 5HEZA 3UGCA 4BKZA 2WKMA 3Q2JA 2X8IA 4AGCA 4AX8A 2HXQA 5LOHA 4RWIA 1OI9A 2G2IA 2ETMA 4O1PA 2BTSA 2CLQA 2JEDA 2VTQA 4HGEA 3OWPA 4I41A 4GFOA 3RALA 2B4SB 4J97A 3FAAA 3NUNA 4MNEA 5AIKA 3CPBA 4MWIA 3QTSA 2IZRA 4I6HA 2WMVA 5C03A 3NEWA 2Z8CA 4DH7A 4FIIA 4JQ7A 5BX0A 4PY1A 3UP2A 3Q4ZA 5HIDA 2BIYA 2C6EA 1UNHA 3HGKA 3QQGA 3ORTA 3QTIA 1U59A 2ZM3A 4AT4A 5L8LA 4LRJA 1BI8A 2JIIA 4PDSA 4PMSA 3FKLA 4C2WA 1M7NA 1Q8TA 3QRJA 3RM6A 3ULIA 5CEKA 4HZSA 4O7LA 4H05A 3NIEA 3A7JA 4EH2A 3GQLA 3NLBA 4F09A 3I6WA 3HAMA 2A4LA 4EZ3A 3QC9A 2XKDA 3VUIA 5IMEA 3ZU7A 4TYGA 5E91A 3FDNA 1WBWA 2XBJA 1R78A 4DLJA 2UW7A 4BCFA 5CF8A 3F5PA 3L8PA 5IF1A 4FI1A 4ZJVA 3RP9A 3D5UA 3IO7A 2X0GA 2BZHB 3R7UA 4CZUA 3BRBA 4KIQA 3HP5A 3AD4A 3FI2A 4F6WA 3MJ1A 4K77A 2YM4A 3GCPA 3ZXZA 4YJTA 3KQ7A 4I93A 4YBKA 3AOXA 3H9FA 5E4HA 4TWCA 3NYOA 3FI8A 2IZSA 4A7CA 5JZJA 4C4EA 1NY3A 2XAOA 1PXPA 4C4JA 1P14A 3E93A 3ZLSA 3NDMA 4F0GA 5LCJA 3RJCA 2IO6A 4KKHA 2ZDUA 3VBTA 2VUWA 5HX8A 3NMUF 2VTRA 4I24A 5I5ZA 3E64A 4CLJA 2B52A 2C5XA 4EUUA 1YDSE 4TW9A 2R3GA 3HECA 1BUHA 4QQJA 2XALA 3QRIA 4AN3A 4PNIA 4D1ZA 2VWVA 4U81A 3C5IA 4Q5HA 1FOTA 1R39A 3HMMA 4FE2A 2WMRA 3CSVA 1Q8UA 4U80A 1RE8A 1PXJA 3DBDA 3MVLA 3QA8A 5M55A 4BDCA 1YXTA 5E8TA 2FVDA 3I1AA 4JL9A 5IH6A 4GW8A 4L42A 4HCUA 3IECA 4FTRA 2YCRA 3NNUA 4QMYA 4Z7HA 4GFMA 4WIHA 3I0OA 4UYAA 5IQBA 4CRLA 4KIKB 3HMIA 4P5QA 3ML1A 5F4NA 5H9BA 3BQRA 3F6XA 4P7EA 4W8EA 2QC6A 4XLVA 2YDIA 4YNEA 5AUTA 3PXYA 2R3QA 1PYEA 3QYZA 4BWKA 4OBOA 3NSZA 5JQ5A 4LV7A 4ZTHA 4LOPA 4BCJA 5M06A 5GIOE 3ZO1A 4DINA 3FMDA 1F5QA 4U0IA 2XYNA 4GUBA 3ZBXA 5AX3A 4EJ7A 5H2UA 3MN3A 4YGAA 4BTKA 3H9RA 4X2GA 1ST0A 2GMXA 4E4XA 2FSMX 4C59A 1ZYJA 3ZOSA 3C51A 4F08A 2PZYA 1JKLA 3F3WA 2XJ0A 5A3XA 3WOWA 3RK7A 3CJFA 2WD1A 3HV3A 1YOJA 4PV0A 4ZJJA 4N4SA 3GU6A 5T68A 4IWDA 4B7TA 3D2IA 4Y85A 3GOPA 3MVMA 2V7OA 3TNQB 5J9ZA 2O0UA 4C35A 3QD3A 2X81A 4FICA 1T45A 3FBVA 4MK0A 3COMA 3DU8A 3PZEA 2VWIA 4O7VA 3BLQA 4FV1A 4MQ1A 3OS3A 3KMMA 2UZTA 4MBIA 3UVQA 4QMOA 4G6NA 3EKKA 3I60A 3FLZA 4FKWA 4K18A 4I23A 3V5PA 5F94A 4MBLA 2X9EA 1NT2A 2PZ5A 1OIYA 5ETAA 3VS1A 1XH8A 4ZZMA 2I0YA 1BX6A 4MEDA 3QUEA 3ZS5A 4EK4A 3BEAA 2HWPA 1QMZA 3EWHA 4L43A 4WNKA 1I09A 1U5QA 2OF4A 3HLLA 3W10A 3NW7A 2VWYA 2C6KA 4DTBA 2W5AA 5C9CA 3QTUA 2Y7JA 3BE2A 3HV5A 3VBXA 2Y6OA 3E88A 5A54A 3DLZA 3F5XA 5BUIA 1OVEA 4RX8A 4F78A 5CI7A 3Q9XA 3I0QA 3ORLA 5HI2A 4DEBA 5CU0A 5F95A 4R78A 1XH9A 5J7BA 4IFCA 2JBOA 3FJQE 4A4LA 2I1MA 2G1TA 3W2CA 2C0TA 3FMLA 3TZ7A 2HK5A 5DMZA 2P33A 1YHVA 2YLFA 4YJVA 4OAUC 3LXPA 1GY3A 3D15A 3HRBA 1Q3WA 3EN9A 3IOPA 5HIBA 1OZ1A 4ITIA 5AV3A 4X21A 3OT3A 4UWBA 4FZDB 3L8XA 4I6QA 3QC4A 3QZIA 2EXEA 1OIQA 3RPSA 2C6OA 1H25A 5BYYA 5IG1A 1FQ1B 1QPEA 1O6KA 3LOKA 4FSYA 3QU0A 4MF1A 4P2KA 5ANGA 3TIZA 2E9UA 4APPA 4CKRA 2VX3A 4D4VA 2E9NA 3RPVA 5FXRA 5DRBA 3RVGA 5AA8A 4GK4A 4H3PA 1YXUA 4XG2A 5CSHA 4IXPA 4FL2A 4IFGA 1JLUE 3FI4A 4XLIA 2QOBA 4YJSA 4KINA 4KIKA 3ELJA 1FGIA 2Z2WA 3GCUA 1Y6BA 2BR1A 4HYIA 2GNLA 2HWOA 2ITXA 4DN5A 4UMPA 2VX0A 2OW3A 4F9WA 1ZXEA 2R3FA 2X39A 3O71A 5G1XA 2QODA 3RHKA 2IZTA 4U40A 1H1WA 5HKMA 4MVFA 4TRLA 5EI8A 5ANDA 2ZAZA 3IDBA 4GIIA 1OL1A 2WMQA 5I9YA 3OFMA 4TPTA 1JVPP 3Q04A 3HA8A 3FLQA 2VNYA 3RTPA 3SRVA 4DTAA 3FLWA 2C69A 2ZJWA 4FUYA 2J5FA 5CQWA 4DFBA 4DA5A 2QVSE 4L7FA 4QP9A 4KWPA 5IQHA 3F3TA 3ROYA 2SRCA 3U87A 2G01A 3EZVA 5LVPA 2A27A 4BKJA 4NUSA 4I92A 4WD5A 2HZ4A 4UEUA 5ANOA 4RFZA 2QHNA 3V51A 1ZMUA 4UB7A 4EQUA 1H07A 4RX7A 3FYKX 3Q6WA 1FMOE 1PYXA 2EXCX 1XKKA 2WTWA 4Z9LA 5AAFA 3AKJA 1Q8ZA 4UWYA 4LDTA 4K11A 4RVKA 3T3UA 3OCSA 2XIZA 4X6QC 4YTHA 3GU5A 4QMWA 2R4BA 4TNBA 5DVRA 1BKXA 1Q61A 4OAVB 2ITPA 3P7BA 4LGHA 4CV9A 1CKIA 1O6YA 3NW6A 4EHZA 2HENA 2B9FA 3CD3A 3EN6A 5D12A 3O8UA 1YI4A 3BHTA 2I7QA 3QZFA 1P5EA 4FKVA 3UMWA 2C1BA 2QKWB 5EW9A 3ZFYA 4FNXA 4JX7A 4Z16A 2W5BA 1UNLA 4IAIA 4Q9SA 4M8TA 4TNDA 4AP7A 2QU5A 1NVQA 5IA0A 1YHSA 1J1CA 3F82A 1R0PA 5GINE 5JK3A 1CMKE 3C50A 3KRRA 2OGVA 3E3PA 3R63A 4DH8A 3COHA 2P0CA 4IVCA 5T3QA 3PJCA 3TTJA 4QTBA 4K9YA 3EN5A 2UZUE 3D2KA 3JY9A 2WU6A 3GEQA 2ZV8A 3QA0A 1ST4A 2PY3A 1U46A 5IQAA 5BVKA 2QOLA 3QXPA 2XEZA 3AGLA 4X3JA 4YTIA 1YHWA 2VTMA 5AUVA 2QD9A 4I6LA 4PUZA 1DI9A 2XP2A 4CCUA 4JRNA 1SM2A 3BYVA 5KBRA 2YFXA 4R7BA 2VO6A 1LPUA 5EYCA 4TL0A 3THBA 4ANQA 5JKGA 1WBTA 4O0UA 4O4CA 4GU9A 1A06A 3P1AA 3E7OA 4IAZA 3V04A 5T6KA 2OIDA 5I3OA 5EW3A 4H1MA 4AUAA 3LLTA 5KO1A 4FX3A 4QMVA 4QT1A 3R9RA 4F1MA 4Y95A 3GB2A 4FC0A 1J7UA 3OTVA 5LJJA 3EKNA 4BDJA 4PTEA 1GOLA 1MRUA 2UW5A 4OBQA 2PMIA 2CKQA 2IZUA 2PVRA 3KF7A 5EQYA 3KRXA 3SA0A 3EFJA 2V62A 4C4HA 5HTCA 4CXAA 4R7IA 1XH6A 2HW7A 3WI6A 3EQPA 4A4XA 4AAAA 3VHKA 3DBEA 4ZSAA 2JIVA 3LQ3A 4U42A 5DYJA 3TXOA 3R7EA 3LFBA 4HZRA 4XS2A 5AP2A 5E92A 1YVJA 4MD8E 4DH5A 3D5VA 3RM7A 5IDNA 4DITA 4GKHA 5I3RA 2QO2A 4ITHA 1P4FA 4TTHB 4BGHA 4QMMA 4ZTSA 4WG4A 3W0PA 5IDPA 2QU6A 2WMWA 4PX6A 5FTQA 4GH2A 1R0EA 3ATTA 3CTQA 4KNBA 1Z5MA 1NVSA 1M17A 4M68A 3U9CA 4EOMA 2FSLX 2QG5A 2WQOA 3LXLA 4FNZA 4ORKA 4KIOA 5CAVA 1OGYA 3UP7A 5I9ZA 3VS3A 3QX4A 1GZ8A 4JDJA 3LW0A 1U5RA 2JIUA 2X2LA 3HV6A 4FT0A 3ORNA 3T9IA 1OKVA 4D2PA 4M0ZA 2FGIA 5AA9A 4MNFA 3E8DA 5DT0A 2ETKA 3C0HA 3CTHA 5FTOA 2ITUA 3K5UA 4W8DA 2YJSA 4IW0A 4EEVA 4FKIA 3FXZA 5FXSA 3TV4A 4EH9A 2CNQA 3GQIA 5C01A 5FDPA 4ACCA 1OMWA 2B1PA 2X4ZA 3P5JC 3DAJA 2H34A 2W1DA 3LQ8A 3MB6A 5L2SA 1H1QA 3FL5A 2IPXA 2BAKA 3R71A 4UZDA 1STCE 3JYAA 3TIYA 2BTRA 2UVZA 5EHLA 3BGZA 2XH5A 5K5NA 3HNGA 4DG2E 5K0KA 2YHVA 4RVLA 1Q4LA 2EWAA 5AP5A 1WVXA 5EYKA 3VF9A 3QQFA 4YU2A 3BWJA 3GVUA 2XNBA 2YISA 2XIRA 5KBQA 4E26A 3S4QA 4ZSLA 2ZB1A 3O8PA 4UN0C 2PTKA 3I7BA 3ERKA 3QQJA 4LYNA 4XMOA 4RIXB 4UMRA 4N6ZA 3EMGA 3PE1A 1HOWA 5AR3A 4DDIA 3PJ2A 2E9OA 4WG5A 1TFFA 3PLAE 4MX9A 4DFLA 3JR1A 4IANA 5AP7A 3NS9A 4WHZA 4CMTA 5JH6A 3FMNA 5LARA 4NTSA 3ACJA 2BROA 5BV3A 2PE0A 5EM5A 2CKPA 3K3JA 3IW8A 4OGRA 3QLGA 2VV9A 4AWIA 1YI3A 3FHRA 5BNJA 1SNUA 3GC7A 3Q9WA 5LVNA 2CGUA 3FZRA 4IX4A 5DR2A 3CP9A 4O22A 1TQPA 2ITVA 3C4XA 2NRUA 4GT5A 2RSVA 4DHJA 5M44A 2IN6A 4MYGA 2X1NA 3VNTA 3C4FA 3PVWA 3W16A 3CQWA 4ANBA 2WTDA 5DEYA 1OL7A 3KVWA 4XG4A 2DQ7X 4BCQA 1Q24A 3FXWA 3PA5A 2P2HA 4C4IA 4BR3A 4AZWA 4G17A 5HORA 3KMUA 4G6LA 2HY0A 2Y8OA 4FV3A 4L53A 4F9CA 3JUHA 2V55A 4F7LA 5AAEA 3MW1A 1CSNA 4YTCA 4IB3A 4O96A 3ORPA 3QD0A 5CAOA 4XH6A 5FP5A 4AA5A 4RIWA 4IVBA 4OT5A 4FKRA 3DLSA 4JLCA 2QURA 4S33A 2OJ9A 4O91A 2XJ1A 3R21A 1XBCA 5DG5A 5EI2A 1FVTA 5IQCA 4LOQA 1DI8A 3Q6UA 4GS6A 4JIKA 2PPQA 3KXHA 4MXXA 4QQCA 2CLXA 5IEYA 2PE2A 4DBNA 1OGUA 5JRQA 2QOIA 2PMLX 3P08A 3PJ1A 4AOIA 4PMPA 2WTIA 3ID6C 5CALA 3F2NA 2OFVA 5GZ8A 3OG7A 4KRDA 3KU2A 1WZYA 3UDBA 4AZVA 5C8KA 2XNGA 3DAEA 4UY9A 3UZRA 4E93A 4NSTA 2QQ7A 3POZA 4BVUA 3W2OA 1DAWA 2QCSA 3QYWA 3ACKA 3UG1A 4FSQA 4S2ZA 3D94A 3HUBA 4IZ5A 4KA3A 5LWMA 4N57A 5BVWA 4K33A 3FQEA 1PHKA 5TOZA 4QEBA 5D1JA 2B7AA 4YLLA 5CEMA 2ERZE 2OH4A 4A9UA 4DG0E 3MIAA 1NXKA 4P90A 3WF7A 4DGGA 4ZTMA 1UU8A 2YIRA 4LMUA 4ZLOA 2YIQA 3IK3A 2IW9A 3QD4A 4Y46A 3DDQA 3TYKA 3MI9A 2OWBA 4ZTQA 4CQEA 3MFUA 1U54B 4F6UA 4LGGA 4EONA 3ZO2A 4C3FA 4GVJA 1XR1A 3A60A 3FEGA 4F1TA 2XM8A 4AT3A 3OXTA 4MWHA 4ANLA 3P4KA 1ZMVA 4C2VA 3M2WA 3ORXA 4RIXA 3SXFA 2GFCA 4LUEA 2F9GA 3LHJA 4L3PA 4WO5A 2OO8X 2VTAA 3C9WA 2ZMCA 4E6DA 2PUIA 4HPTE 4ZSEA 2W1ZA 1BL6A 2A98A 4UBAA 3CTJA 4XX9A 3DKFA 4XRJA 5B2KA 4FV7A 3NUSA 4IMYA 5KX8A 3BCEA 5GZ9A 4IZAA 3KF4A 3H9OA 4FNWA 3SLSA 5IQGA 3NUPA 4R3CA 1ZMWA 3SKCA 1TQIA 4OTPA 4BCGA 4DG3E 4NM3A 2CGXA 3D7ZA 1JKKA 4YZBA 3F61A 5J1WA 3QRUA 4FK6A 1H24A 5DE2A 3C4ZA 4BCMA 2W1EA 2WOUA 1WBSA 4K0YA 4GL9A 5CZIA 4ARKA 4AQCA 4L01A 4E4LA 5C8NA 5HVJA 3WYYA 5L8KA 3HMOA 2YCQA 2JD5A 4BGGA 3Q9YA 4JBVA 3Q5IA 3TKUA 5AP0A 3ZH8A 2NRYA 4ZAUA 2J7TA 2E9VA 3KULB 3TWJA 3R1NA 2W9FB 5IPJA 4ITJA 2J0IA 4ANSA 3A4OX 3AQVA 2JDVA 2YM6A 4ASXA 1XBBA 5F20A 3Q3BA 4JIAA 2QOHA 2VO3A 4X2JA 3ENMA 5KZ0A 3TZ9A 2Y6MA 3DJ6A 4R5YA 4USDA 5AAGA 5CASA 4IH8A 2QKRA 4QMSA 2JKQA 4O82A 3LZBA 3PIYA 4HW7A 5M08A 1WMKA 2JKMA 4AGWA 1W0XC 3TL8A 2R3PA 1ZARA 4E5AX 4GIHA 1RJBA 3HL7A 4PPBA 3TNHA 4AW0A 1ZOGA 3QCXA 4IACA 2JDSA 4YO6A 3VVHA 5A14A 3F2AA 3IKAA 4IEBA 4KS8A 2XIXA 4J52A 3RAWA 2OZAA 3PE2A 4EH6A 3QCSA 2OJGA 5IKWA 2UW9A 4FT5A 4PTGA 4UMTA 4E6QA 3H4JA 3FLNC 3UIUA 1XHAA 2R3OA 4M66A 4PDPA 3V01A 5K4JA 3T8OA 2VRXA 4C0TA 2C47A 3P0MA 4DT9A 4AQKA 2R3NA 3R2YA 4X3FC 3UJGA 3R83A 4AXAA 3O50A 3OW4A 4F65A 2Y4PA 3PXRA 4RC3A 5JRSA 5I9WA 3W0QA 4FKGA 2WMAA 1REJA 4O21A 5BQ0A 2IW8A 4O4FA 3LMIA 5HX6A 1PMNA 2X0OA 2X8EA 4D1XA 3IDPA 3EFKA 3AKKA 2BALA 3AMAA 4LRMA 5A4LA 4ZY4A 2AC5A 5AR2A 1OM1A 2GHLA 4I20A 4UV0A 4GK3A 2PVJA 4XOZA 1UNGA 1IAJA 4N6YA 1U54A 4CG9A 3R04A 4KSPA 4TYHB 3M42A 1GNGA 5FM2A 4FSRA 4ZEGA 3VBQA 1GZOA 4C61A 3KCFA 4YLKA 2RKUA 3QTXA 4HNIA 4PL5A 3PVBA 4RIYB 2X0PA 3G9LX 2YM5A 5BYZA 1TVOA 4BC6A 4EOIA 1A48A 4FKUA 3OP5A 4C7TA 3PRFA 4C4FA 3VRZA 1JKTA 3CCNA 3RCJA 3RNYA 3EFWA 2XNPA 5K5XA 3PFYA 2R7BA 5H3QA 4C33A 4MXCA 3IPHA 5M51A 5EQEA 3GI3A 3LCKA 4RQVA 2E2BA 5FWKK 4Z3VA 5GZAA 3LFEA 4WT6A 2XNOA 3LQ5A 4IAYA 4QTAA 3TN8A 1YOMA 4HJOA 2FSOX 3ETAA 3IGOA 5H8BA 4C3RA 1ZLTA 2VWWA 3LCDA 1LEZA 4LL5A 5DT3A 5AR4A 4ZK5A 5ANKA 3VS6A 4CFVA 3R8UA 4D4SA 4YZ9A 4E3CA 3ZC5A 2HW6A 4AZSA 4MD9E 2VTHA 3E5AA 4DFNA 4BTMA 3O23A 5HE1A 4M0YA 1PXKA 1WBOA 4IE9A 2I0VA 3ZUTA 2WQMA 5CAUA 4C62A 4DTKA 4YJUA 3FPMA 2C0OA 2KTYA 4FTCA 3VS7A 4BTJA 4QMNA 3SG9A 3LFCA 3V5TA 3ZONA 1CKJA 3NNWA 4PWNA 3KULA 4R5SA 5ANIA 5AR7A 3ZZWA 4J8NA 4A9TA 1OBGA 3ZDUA 4AN2A 4YHJA 2VTNA 2J4ZA 1QPDA 2F7XE 5J95A 3UBDA 3CJGA 3DBFA 5L2QA 5CEIA 2YAKA 3SX9A 4CFFA 3PDTA 3RPYA 4I0TA 4GFGA 4RFMA 3DBQA 4IQ6A 3NFFB 2JDOA 4CNHA 2WHBA 2PVNA 5AM6A 4MXAA 4IZ7A 4LUDA 2VWXA 4X3FB 4FTTA 5BYLA 3C4WA 3P5KA 1ZWSA 2YCFA 1ZY5A 5GJGA 4BI0A 5JN2A 3WZDA 1M7QA 1Q62A 2PVKA 2W1IA 3VBVA 5J5SA 1K2PA 1TQMA 3WILA 5BVDA 5ITAA 2UVXA 2V7AA 2YCSA 1MP8A 1KV2A 5EH0A 1V1KA 4CFMA 3MTLA 4YR8A 2OJFE 3UNZA 3KFAA 4BB4A 4HYUA 4DFUA 2GHGA 3MPAA 3DNEA 2KULA 3G6GA 4FIHA 4FSWA 4K1BA 4S30A 5CU2A 5EDQA 1M14A 2PWLA 2A1AB 3KRLA 3NUUA 4HOKA 4XNEA 4ANNA 4RBLA 5TT7A 4YJPA 1G8AA 2EB3A 4F6SA 5CSWA 3UPZA 4O86A 4GT4A 4R6VA 5HGIA 4FT7A 5EDRA 4YC3A 3SG8A 3F88A 1VZOA 4AZFA 5CVFA 1QPCA 5TF9A 3WZJA 3A99A 3BV3A 1W2DA 3ROCA 4DBXA 2BRNA 2VWBA 2O64A 2WPAA 3NPCA 4Z55A 4R3PA 3UG2A 2VTSA 2GS6A 4FG7A 3LJ2A 3MY0A 4OT6A 1FVRA 3LPBA 3TT0A 2B55A 3BYOA 3GT8A 5A4CA 2PUPA 3AD6A 3TCPA 2LAVA 4MQ2A 1NW1A 4BCHA 4EH7A 3NFGB 5CYIA 3F5UA 3F3VA 3SW7A 2R5TA 4RIYA 4IZYA 3WIKA 5IQFA 4GG7A 4I6BA 3NUXA 4C34A 4D58A 4I0SA 1H01A 4FEVA 4FV4A 4J96A 4APCA 4YJQA 5HNGA 3TDVA 5M4IA 3OF0A 5F9EA 3UC3A 4UXLA 4RQKA 4QP1A 5EKOA 2BAJA 4EWHA 2W7XA 1MUOA 3BPRA 4LOOA 2Z7RA 3Q5ZA 3QHRA 2Z60A 3ZEWA 4EK8A 2C68A 4TKSA 1IA8A 4EHEA 5HD4A 3I5ZA 4OBPA 4ASDA 3R0TA 4II5A 3LKMA 4BYIA 4O7SA 3DS6A 5AUXA 1XH4A 3BU5A 3PWYA 3C4CA 4G5PA 4H36A 4H39A 4O0VA 4D4YA 5B2MA 4B9DA 3VF8A 2UUEA 5FRIA 1PKDA 3UNKA 2CKEA 4JXFA 4BZOA 2W4OA 4M15A 3LE6A 2R9SA 2XMYA 3BIZA 3EOCA 3VS0A 3AG9A 2IWIA 3PG3A 1YQJA 4U97A 3BYMA 1Y8GA 3PIXA 3DZQA 3CD8A 4CFXA 2IVUA 4DEEA 4ZJIA 2JKOA 1WVYA 3OOMA 3R1SA 4QMTA 3UIBA 3KIOC 5LVMA 4NM7A 1OIRA 3TG1A 4U7ZA 1YRPA 3ZLXA 1IAHA 1X8BA 3MA6A 3DB8A 5KE0A 3OY3A 2WTKB 3PY0A 4FKTA 5D11A 4ZP5A 5HO8A 3NAXA 1Y57A 4BDDA 5FEQA 4EYJA 4O7YA 5M07A 3D7TB 1YDTE 4FZ7A 5EYMA 3VRYA 4EQMA 4BKYA 2JDTA 4E20A 2WMTA 4RX9A 4YC8A 4DHZA 4FV2A 4FT9A 5DIAA 2AQXA 4AU8A 3NYXA 2WB8A 4X3FA 3AT2A 1OPJA 3F69A 4L7SA 4WSYA 4Y73A 4CFUA 2X8DA 3L9MA 3V6SA 4M13A 4EOSA 2BDFA 4L45A 2O2UA 3LCTA 1V0PA 2UW8A 4IJPA 3BQCA 4XUFA 3RAKA 1H1RA 5DRDA 4BDFA 4IAFA 2RFDA 1Q8YA 3FY0A 1J3HA 3MB7A 1H28A 2OBJA 3OXIA 4BRXA 4JG8A 1WVWA 2BUJA 4QP8A 4G3EA 4CLIA 4RFYA 5CEPA 4ZTLA 5C4KA 3LCSA 2EUFB 3HYHA 3KB7A 3IW6A 4XV9A 4PNKA 4CTBA 2UZVA 4H3BA 2IW6A 4XV1A 4EK3A 1KWPA 2C30A 3TNWA 3CR0A 2YWPA 5CAPA 5DT4A 4YHTA 5GHVA 3ZYAA 2HELA 1VJYA 5CI6A 4D2SA 4GT3A 2YIYA 2BFYA 2ITWA 3N4TA 3KL8A 3R00A 4U8ZA 4AE9A 4D2RA 5KHWA 4BZDA 4LGDA 3MJ2A 3E92A 4O7TA 4E7WA 4DE4A 2W1CA 3HVCA 4FSZA 4IM2A 5HOAA 5J8IA 1H08A 3ZO3A 2XB7A 3DOGA 3GFWA 4XJ0A 4ZIMA 5HLWA 1Z9XA 1UA2A 4DGOA 4FTJA 2B0QA 4GV1A 3G51A 3R9OA 1Q8WA 4XG9A 4WUNA 2IVTA 5EHYA 3R8VA 2WXVA 3TUCA 3GENA 1CDKA 2BHEA 3KK8A 4HCVA 4OUCA 1IA9A 4NH1A 1TKIA 3QRKA 4QTDA 5IH5A 3PYYA 3PWDA 2ERKA 3EQBA 3L9LA 1SVHA 4BBFA 2R3RA 2Q83A 3BL9A 2W5HA 4PPAA 2E9PA 5FG8A 1JSUA 4YZDA 4R77A 3AC1A 4FTKA 3IW7A 4WA9A 3JPVA 4IWPA 5IQEA 3WBLA 3PXQA 2ITOA 3SQQA 2XA4A 5LCKA 5AV4A 2CMWA 2X0QA 3F66A 3PLSA 4FVQA 4DH1A 1W83A 4EH8A 3PJ3A 2H6DA 3SHEA 3AGMA 4TWPA 2AYPA 4XYFA 4F7JA 1H0WA 4EOQA 1NA7A 4G31A 5D41A 4CD0A 2VGPA 2PVFA 2XEYA 2PHKA 1ZZ2A 5DNRA 1XH5A 3D14A 4IVDA 2HXLA 4GEOA 4KB8A 4BBEA 5EKNA 1PF8A 1SMHA 3LM0A 5L4QA 3FQHA 3R8LA 3UYTA 5E8WA 1REKA 4Y83A 1OKZA 3A8XA 3R7YA 3AT3A 2RG6A 5AUZA 4AE6A 3DY7A 4YZMA 3ZUVA 4BTFA 5HQ0A 3PTGA 2V0DA 3D7TA 5AV1A 3LMGA 1ND4A 4XOYA 3WF5A 2X7OA 5JFXA 1OB3A 1FBNA 5CVGA 2W9ZB 3BYUA 4OLIA 2UZWE 2QG7A 3CQEA 4QPMA 3UIMA 4KRCA 5AM7A 2WTCA 3RK9A 5IISA 3PPZA 3D5XA 3MESA 5M56A 3OC1A 3R9NA 2W99B 3ZCLA 1PW2A 2J51A 1HCLA 3QUDA 4FIGA 4E73A 1VYZA 1W98A 4S32A 3WYXA 4LMNA 3QX2A 3MV5A 2PZIA 4IIRA 3ZRMA 4ACDA 4B8LA 3ANRA 3PVUA 5HESA 3V5WA 4J98A 3OWKA 3GGFA 4NEUA 3O0GA 1ZYDA 4GYGA 5FBOA 3P23A 3GP0A 4HVGA 3F7ZA 2WMUA 3NVMB 4FKPA 5EW8A 3TV6A 1RDQE 5J9LA 1H4LA 4MXOA 2BKKA 4G5JA 1GZKA 2PL0A 3HP2A 1XWSA 3K2LA 4JAJA 1CM8A 4Q2AA 4XEYA 2GNIA 3HDMA 4FRFA 3ZHPC 1RW8A 2GFSA 3K3IA 5E90A 3UVPA 2YZLA 5JGBA 2ONLC 3R9HA 5BPYA 5HG8A 2WQBA 1ZYCA 4R1YA 2ESMA 4G2FA 4N0SA 4EOPA 1J7LA 3MWUA 4U9AA 5DA3A 1H1SA