4DN5A

Crystal structure of nf-kb-inducing kinase (nik)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
344
structure length
331
Chain Sequence
SVEEYLVHALQGSVSSGQAHSLTSLAKTWAARGSRSREPSPKTEDNEGVLLTEKLKPVDYEYREEVHWATHQLRLGRGSFGEVHRMEDKQTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLVKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVCLQIPGTETHMAPEVVLGRSCDAKVDVWSSCCMMLHMLNGCHPWTQFFRGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPIHRVSAAELGGKVNRALQQVGGLKSPWRGEYKEPRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Mitogen-activated protein kinase kinase kinase 14
publication title Structure of Nuclear Factor Kappa B-inducing kinase domain reveals a constitutively active conformation
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 331
sequence length 344
chains with identical sequence B
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dn5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dn5A01
2B0QA 1G3NA 1H1RA 3CTJA 3DBEA 3Q6WA 3MFTA 1GZ8A 4R8QA 3E93A 1YW2A 3FI4A 4I6HA 4E4XA 5CEMA 3OT8A 2QD9A 2UZBA 2YIRA 4PMTA 5DI1A 4DGGA 3AOXA 4AFJA 2HZIA 4TWOA 4ZJVA 1GAGA 2VTMA 2CJMA 2BKZA 2UVXA 2XK7A 3QD0A 3LJ2A 4R6VA 5D7VA 4AG8A 4C2WA 3VS4A 4O1OA 4AT4A 3BRBA 5JGDA 3FL4A 3IQ7A 2VWWA 3H3CA 3HNGA 2AC3A 1A48A 3EIDA 3K5UA 2QURA 1GJOA 4LI5A 3AC3A 5J9ZA 5L8KA 1UU7A 1IASA 4ZTHA 4DFXE 3ACJA 2R3GA 4X3FA 4CRLA 4JLCA 4GL9A 3UOHA 5HO7A 5HNIX 3TN8A 2QKWB 3TZ9A 4LUEA 4WUNA 3HAVA 5IMEA 3H30A 3MY0A 2R7BA 1RQQA 2YITA 1YDSE 2ITOA 3GC9A 3R2BA 1PMEA 4GFGA 2YIYA 4RRVA 5IQEA 3NX8A 2A27A 5L4QA 4RLLA 2UZWE 3G9NA 5AV2A 3UNJA 3MA3A 2A19B 4PMMA 3F7WA 3I81A 3ZO1A 2CNQA 3CS9A 3C51A 5AEPA 3HP5A 3KCKA 3LCDA 3NNUA 2C5XA 5FXSA 3WZDA 5FEQA 4CKJA 3GB2A 4AX8A 2BHEA 3FKLA 2X39A 4GFMA 5H9BA 4O0SA 4IDTA 4MTAA 2YAKA 3W2QA 5GIPE 3MBLA 1ZXEA 2WMVA 2W5HA 2EWAA 4C0TA 5CYIA 4CV8A 5E8SA 3DQXA 4G34A 1KV2A 2J2IB 3DCVA 2XVDA 3ZO3A 3DJ7A 4U3YA 5FBNC 3PLAE 4O7NA 3OT3A 3BWFA 2RFDA 4YLKA 4ZLZA 3UMXA 2O63A 5H8GA 4DEEA 4S32A 2H9VA 2CMWA 2C4GA 4O0UA 2ITVA 1LEWA 3P7BA 4D58A 2Z7RA 5M4FA 4NFNA 2XK3A 4O6LA 4JDHA 1Q62A 4ALVA 3LQ3A 3ORXA 1WBTA 4ZJIA 3V8SA 1I09A 4YLLA 4BRXA 5CU3A 3RHXA 5C4KA 1PXJA 3B8QA 1BL6A 4LL0A 3VJNA 4YHJA 3NUYA 3Q04A 2F2CB 4IAYA 3K3IA 3JXWA 4DBNA 4MK0A 2NRYA 2OJFE 4NH1A 3ZSIA 4CMUA 4F63A 3DPKA 1O6KA 4ZK5A 3D83A 3FHIA 4DEGA 4L42A 4E5BA 1PXKA 1W98A 4IH8A 4JG6A 4LFIA 3L8VA 3H4JA 2VV9A 5IKWA 2CGUA 4AU8A 4MD8E 4CD0A 3EFLA 5BVOA 5D11A 3EMGA 4D4VA 4O7YA 4DHFA 2AYPA 2X7OA 5AAEA 5GZAA 2HELA 2I0YA 2WHBA 1OL5A 5LVOA 4HCVA 4FV0A 1H1WA 4J8NA 5A6NA 4FKVA 2YDKA 2Z7LA 3LE6A 4U8ZA 4E6DA 4HVSA 5K4JA 1OPLA 5L3AA 1H4LA 1SNXA 2BTRA 4BDEA 4QNAA 5ANEA 3SRVA 2V5QA 3BYUA 3D0EA 5EDPA 4ZJJA 2ETMA 3QGYA 1HOWA 2JC6A 2C0OA 5BUEA 5E8XA 2X2KA 3P7AA 4OAUC 2WMTA 2R0UA 4DFYA 5CEQA 3UYSA 3UNKA 3AGLA 5CZHA 3P1AA 4D1SA 4NUSA 3ZZWA 5I4NA 2C0TA 3MYGA 3Q9ZA 5EI2A 3HMIA 4Y73A 4MNEB 2H8HA 3QCQA 2QHMA 3IGOA 1REKA 3A60A 3DFCB 4OBOA 4OBQA 4BKJA 4FGBA 5I9WA 2ETRA 5L6PA 3O8UA 3QFVA 1ZLTA 2HWOA 3WI6A 3QA0A 4D4RA 4WT6A 4K6ZA 4YZBA 4YZCA 4GKHA 4MXOA 3HVCA 5J9LA 3QQFA 1KUTA 4E6AA 5J5TA 3ZO2A 2RF9A 3AQVA 3CTQA 4J96A 3VUDA 1M7NA 1OL6A 4MWHA 4HGLA 2YCSA 5JRSA 3P23A 4HCUA 3SLSA 2XIXA 3E8DA 2OO8X 4XUFA 2QU6A 4YSJA 2DS1A 2X6EA 5ACBC 3V5PA 4A4OA 4X2NA 4EWQA 2SRCA 2CKOA 4C59A 3RCDA 3ET7A 4FBXA 3UGCA 1U5QA 3C0GA 3PJ1A 3W2PA 4UMRA 5A4CA 4LMUA 4QQCA 2YDIA 2WOUA 4JR7A 2GNLA 4FEWA 1Q3DA 4B8MA 3PJCA 5AUTA 5LVPA 5EHLA 5HG5A 2B9HA 3NYXA 3CD3A 3Q4ZA 4FTOA 4BDFA 4F0IA 4ASDA 3ORPA 4BTKA 1OUKA 4RG0A 3WIGA 3KULB 4M3QA 1JKKA 4OTIA 3P7CA 4EHGA 3IW8A 1Q5KA 2W0JA 1TQPA 3F5UA 3BELA 2X4FA 4I6QA 3F3ZA 3M2WA 4PL3A 1VYWA 3A4OX 1LP4A 3QXPA 1PKDA 4Q2AA 4P7EA 2GMXA 2VO6A 3CPBA 3F3UA 4XOYA 3SD0A 5LWMA 4QPAA 5D7AA 3IPHA 3NW5A 3ZSGA 2GS6A 5ACKA 5HIEA 3FEGA 4GJ3A 5L8LA 5IUHA 4ZSEA 4BB4A 3TV7A 4Y95A 1JQHA 4EOIA 4XHKB 3EH9A 4DEIA 2R3PA 3OY1A 1XO2B 2X8EA 3AMYA 3E92A 3MVJA 3ODYX 2P4IA 3PXRA 4J1RA 3DDPA 4Q5EA 4CLJA 1WZYA 3OWJA 5HLNA 1PXNA 1U4DA 3AT2A 2I1MA 3DBDA 4MVFA 3BV3A 1BKXA 1SYKA 4EYMA 3CBLA 1GZNA 3MWUA 1OIRA 5E8TA 5FGKA 5BVKA 4Z16A 1BMKA 2IVSA 2UW9A 3V51A 3DXNA 5CSPA 1PJKA 5DN3A 4PTGA 2ITWA 3TV6A 4CFNA 3IK3A 1RE8A 3SOCA 4O38A 5JGAA 4ZS4A 4N6ZA 3PPKA 4FTIA 2XEYA 2PMLX 4QOXA 5DVRA 4EH5A 5L2IA 4KBAA 4ZTRA 3VBVA 2NP8A 3JUHA 3UOKA 2XYUA 4QMWA 5LMBA 3KFAA 3WARA 4O0WA 4BR3A 4EWHA 5IDPA 3DTCA 4LGDA 4PPBA 2Y6OA 3W2CA 3UOJA 3ZDUA 4FKLA 1IA9A 5JZJA 4QQJA 2R3JA 4PP9A 4M8TA 4BDCA 3P9JA 2OI4X 4B6LA 2BHHA 3ULIA 2IZSA 4O0XA 4QMQA 5I9UA 1KE8A 2IZTA 5EYDA 3NUSA 3TV4A 2XJ1A 3PJ8A 3NLBA 2ZMCA 5TR6A 3DU8A 3WIKA 4A07A 4AT5A 2YZLA 3PPJA 3F69A 2I40A 4NKAA 4USFA 5BYLA 4NTTA 2HCKA 4YSMA 4HVGA 3KF4A 3G2FA 3IGGA 2J51A 3MPAA 5FBOA 3FMNA 4GRBA 1YXSA 4AN2A 5FTGA 2Y4IC 4XX9A 3OS3A 4RWJA 3TZ8A 1YXTA 5GZ9A 4A4XA 4FK6A 4G31A 2YJRA 4AW5A 1NY3A 2VO7A 4GT3A 4QP3A 4OBPA 2P2HA 2UW6A 4QYGA 4E8AA 1LPUA 5CT7A 4HGEA 5H3QA 3FZPA 3E63A 2W5AA 1XR1A 4YHTA 2WMSA 4TYIA 4HNIA 3ZXTA 4TYEA 3ZSHA 3FQHA 4FA2A 4D9TA 1OL2A 3EYGA 1EH4A 4F1OA 2DQ7X 2RFSA 4FIEA 4XV1A 2GQRA 1WVXA 3E62A 3HRBA 3QD2B 4UMUA 4J52A 4UMTA 4R5YA 4Q9ZA 2BDJA 4FV8A 3NVMB 2FSLX 4WNMA 5J5SA 5CEPA 1U54A 4RFZA 4BWPA 4NM0A 5IUIA 3IKAA 2ITUA 4TYHA 3QRTA 3CCNA 4U80A 3TUBA 2BFXA 3AC8A 3AC5A 4O7TA 4R7BA 2JFLA 4ZXTA 2WPAA 2AC5A 5DT4A 3VHEA 5EFQA 4EK3A 5M56A 3TKHA 5IMXA 4DTAA 4RJ3A 4I4FA 4MF1A 2BAQA 2R64A 5IQGA 3FLZA 3RPYA 3FPQA 4S31A 3AC1A 2BZHB 3I79A 4KAOA 2VNWA 4FKUA 3EJ1A 5L2QA 2WELA 4FNWA 5HCXA 3D15A 5M53A 4IEBA 4IJ9A 3SQQA 4JL9A 4O84A 2PZPA 3LFAA 1G5SA 4RQVA 5KMNA 3UIMA 3TKIA 2F7EE 1R1WA 3ORNA 2XUUA 4MXCA 4YJPA 2BCJA 5DHJA 3WF8A 2YWVA 2HXLA 1KWPA 4GH2A 4O0VA 5AFVA 1XKKA 3PIXA 2B9IA 2JAVA 2IVVA 1FVVA 3TJCA 3M11A 2QG7A 4GYIA 3OMVA 3RPRA 2WMXA 2VWIA 3EHAA 2NRUA 5DOSA 5F9EA 2R0IA 4JI9A 4R3PA 2IW6A 4GKIA 4MHAA 2YCFA 5AP2A 4LOOA 3NPCA 4U3ZA 4YHFA 1NXKA 3C1XA 1YRPA 5CENA 2X8DA 2IZUA 4QYYA 5EOBA 4ANMA 5KMJA 3HA6A 4KBCA 3ZBXA 4U81A 4WIHA 3CSVA 3PSBA 4M69B 4L52A 4BCQA 4ZSAA 4FZ6A 3FZTA 4FNYA 2HY0A 2PY3A 4G1WA 3H10A 2PUIA 3IS5A 5I9YA 4FTTA 1Q8TA 5FDXA 4EBWA 5EQEA 3ELJA 1FQ1B 3FZOA 5AP6A 5D12A 3WYYA 4F6SA 1PRYA 2ITTA 1IG1A 3GCSA 4A4LA 5LMKC 3HMPA 4QP9A 1PF8A 2XH5A 4XMOA 3W16A 4U6RA 2C68A 5E4HA 3KU2A 4ZY4A 3ZRKA 2C30A 3UO6A 3V01A 4JXFA 4KS8A 3HV3A 4FEUA 1MRYA 1ZYJA 1A9UA 3C0IA 2ZV8A 3KN6A 4IFGA 4N0SA 4ZY6A 1MQ4A 2GQGA 3RINA 5LCJA 1IAJA 4IXPA 1CM8A 2RG6A 3N4UA 2CKEA 4YC8A 4QMSA 3FMJA 5AV0A 4WRGA 4IACA 3QA8A 3DZQA 5M08A 5CU2A 4IBMA 3VUIA 2HAKA 1BI7A 1F3MC 3RCJA 3R7YA 5CAUA 1CSNA 3GCPA 3Q9YA 2EXMA 3VS3A 2XIRA 3UJGA 1TQMA 3NIZA 4L01A 1OM1A 4L67A 4C38A 2XEZA 3QLGA 1OKZA 2YAAA 2O3PA 4L7FA 4R5SA 5HO8A 2X81A 3I7BA 4MNFA 1Z5MA 3JYAA 4IVAA 4Y72A 3VNTA 4BBEA 3KB7A 2F4JA 5CSXA 4KIKB 4I92A 4CV9A 3DAEA 4CTCA 5I3RA 3DJ5A 4IE9A 2BTSA 3VUMA 5EK7A 1CMKE 2IJMA 3CJGA 1ZYLA 1XHAA 4AZFA 3GC0A 3KGAA 3PVGA 3QTQA 3LCTA 3FXWA 4F7LA 4PTCA 3S00A 1KOAA 1ERKA 2IZRA 3QRUA 4O6EA 3PY3A 3ZZEA 4I0RA 4QMTA 5M55A 3ZOSA 2GFSA 2ITYA 2B9FA 4G9RA 4IWOA 3ZLYA 4IAZA 5I3OA 2DYLA 4HNFA 2RL5A 4K9YA 1SMHA 2QLUA 5CS6A 5HG8A 2W1CA 2E2BA 1XBBA 2GPHA 2YERA 4I20A 1PXIA 4EQMA 5AUUA 5B0XA 1OBDA 3BCEA 1UNLA 1B38A 2WMUA 4M67A 4W8EA 4QT1A 2HYYA 4FSQA 2X6DA 1JNKA 4MYGA 2VTLA 5FD2A 3ALOA 4YURA 4O7ZA 4HGTA 3WOWA 1NVQA 3A8WA 1Q97A 3G0FA 5FM2A 3QTRA 4KABA 3QHWA 4GK3A 3KF7A 3MH3A 1JAMA 3BLQA 2GTNA 4RIYB 4S33A 4DG0E 2XCHA 2VTPA 4OGRA 4RFMA 1KE7A 4BZOA 4EH6A 3FI2A 3MDYA 2P3GX 1FOTA 4PF4A 1P14A 1GY3A 3G5DA 2JIIA 3ORMA 4MKCA 3V8WA 4E5WA 4IZ7A 5FEDA 3T3UA 4IC7A 1RW8A 2KTYA 3D5WA 3EN4A 4U42A 4Y85A 5EYMA 5FP6A 5TF9A 4UZDA 4EYJA 3VAPA 3I0OA 5CF4A 2W9ZB 5BVDA 4AP7A 4M15A 4IANA 4E6QA 3VBXA 4HGSA 5HESA 1HCLA 3RZBA 3C4FA 2ITPA 4CFUA 3FLWA 4GV1A 2H34A 3BQCA 3AT4A 2F57A 4HPUE 4Y83A 2JIUA 3DDQA 2NNWB 2OKRA 3D7ZA 3HKOA 4EHEA 5CTPA 4BGHA 4QP7A 3RK5A 3U55A 5JGBA 1B39A 2GS2A 3UDBA 3NYVA 4F7NA 1ZARA 3AG9A 4F64A 4EONA 4HYSA 4EBVA 3LXNA 2XCKA 4QYEA 4RPVA 5C8MA 1HCKA 3QAME 3VUGA 2WOTA 4ANOA 1FVTA 4AAAA 1QCFA 2QO9A 2QHNA 2IG7A 4ANLA 4M13A 4TWNA 4BBFA 4M84A 3D7TB 4LMNA 4AA0A 4R3RA 2VGOA 4IQ6A 5EQYA 2YJSA 2WZJA 2VO3A 4RBLA 1H27A 2XBJA 4FVQA 4XBRA 3DZOA 2XK4A 4GIIA 4H1MA 4WNOA 3KMWA 2GNIA 3F5GA 3NNVA 5KE0A 4WUAA 5LVNA 2F49A 1T45A 4ERWA 5CAOA 1YWVA 3U6JA 4FX3A 4TT7A 5CWZA 5AJQA 5DR9A 4J98A 1Y57A 2W1HA 4WNKA 5CSWA 3D5VA 4BI0A 4DH5A 3DGKA 5GJGA 3L9MA 4MXXA 2ERZE 3RWQA 3UO4A 4BZNA 4OUCA 4F0GA 5K0XA 4FG9A 3NR9A 2Q0BA 4MCVA 3VUTA 2VX0A 5IQFA 1DI9A 1PMNA 4FOCA 3AD5A 3NNWA 2FSTX 3D94A 4MD7E 3GNIB 4F08A 4HYHA 1JVPP 2UW5A 3U6HA 2OJ9A 4UWYA 3GU5A 3TDVA 2VUWA 2Y9QA 4PMSA 2WU6A 4L3PA 3RP9A 2C1BA 5DWRA 4CT2A 4QP4A 1YHWA 1YXUA 2WFYA 4GG5A 4Z3VA 2ITZA 2QI8A 1E1VA 2HZNA 2R3QA 3BGQA 5F95A 3GFEA 3QYZA 4FV3A 2XBAA 2JBPA 5HCZA 3VJOA 2PVNA 3MA6A 5F1ZA 3S3IA 4KRCA 3TJDA 4J71A 2BRGA 2O2UA 5KO1A 2XKEA 2CGWA 1XH5A 3IOKA 5EYKA 3LQ5A 3ATSA 2ESMA 3SV0A 5BUIA 4NT4A 4DINA 4IMYA 1BI8A 3BKBA 4TTHB 3QZHA 4CMTA 4F9CA 1YI3A 3CP9A 4JQ8A 4RSSA 4BYJA 5J79A 1ND4A 4WBOA 3NUNA 1J7IA 4FOBA 1Q41A 3OWPA 4DLJA 4MX9A 5ANJA 4F6UA 2FYSA 3UQFA 2PZRA 3KN5A 4EK8A 1YKRA 1FPUA 2VWXA 3FZSA 1V0PA 3RNYA 5AUWA 4EOPA 4YUQA 2X8IA 4RQKA 5JN2A 2O0UA 2W05A 4WA9A 4AOIA 5DPVA 1KV1A 3OVVA 4TYGA 4XG4A 2WD1A 1L8TA 3TT0A 5AR5A 5LVMA 4TYJA 2QU5A 1ZRZA 3RTPA 3CLYA 2G1TA 2OK1A 1PXPA 3ORIA 4X21A 3ZMMA 3KRJA 2LGCA 3HMMA 3OXTA 3BEAA 4O86A 4ZOGA 2XNPA 1H26A 5F20A 5F4NA 3R7OA 4PV0A 4LG4A 3DAKA 5EDRA 1Y8GA 4GT5A 5DRBA 4ZEGA 1FVRA 4FYNA 2WB8A 4M12A 3UC3A 4L9IA 2IWIA 2YWPA 3MFRA 5L2WA 3MGYA 3PA5A 4KIPA 3G51A 3IOPA 5I0BA 3GUBA 3BQRA 4WSYA 5LARA 4BHZA 4RWIA 4FSYA 3VF9A 1WBPA 3DFAA 2OFUA 4BDGA 3BU6A 3PVWA 3VBQA 4MBJA 4E7WA 4HJOA 5KHXA 3SG8A 3ZDIA 4AFEA 3SX9A 2CCHA 4K18A 4AA5A 1JBPE 5KMOA 4M0ZA 4EOJA 1PXOA 2VTAA 3GENA 4ORKA 2ERKA 2E9UA 1CDKA 3COIA 2R3KA 2CHLA 4GSBA 4M68A 3ID6C 3GC8A 4KWPA 4MXYA 3VUHA 2WMQA 2XRWA 2R3IA 1LEZA 1OUYA 3PWDA 1H8FA 5JT2A 2OZOA 3FLYA 2VWUA 2W7XA 4UMPA 2BR1A 1IEPA 3C13A 2GNHA 3C50A 3PA3A 3REPA 4MNEA 3ROCA 5AP7A 5KKRB 2OW3A 4FV2A 4U45A 2PL0A 3DKCA 3WILA 2OJGA 2BFYA 2EB2A 4OTDA 3TTIA 3UO5A 2HW6A 2JDSA 5ANGA 4DGMA 4NU1A 3FV8A 3HLLA 4FKTA 3WE8A 4EH2A 5DYJA 3VWAA 3ZUTA 3KRXA 5A14A 4EH3A 3FYKX 5ANKA 3TNPC 3WZEA 4EC9A 2YIWA 4EORA 4HOKA 5GHVA 4YJSA 1PXMA 3EFJA 1AQ1A 4FV5A 2WMAA 4IAIA 2J0MB 3V6RA 3FMDA 4BCMA 4NK9A 4P90A 5A4LA 5AR8A 3VBWA 1WCCA 4BF2A 4DH8A 4GVAA 5BVFA 1JKLA 1P2AA 4FT7A 2RG5A 3R8LA 3RALA 1OIUA 3G6GA 3MJ2A 4FC0A 3C4EA 3UOLA 4RC2A 4AS0A 4XP0A 4EH7A 5I9XA 1NVSA 2XJ2A 3SG9A 4FIIA 2WQOA 2WTKB 4B8LA 4HPTE 3RGFA 5HHWA 3IDBA 3MVLA 1XH7A 5DA3A 2FA2A 3TNIA 3L9LA 3KULA 5M4IA 5DR6A 3R7VA 4XBUA 3QKKA 4ZIMA 4O7WA 3BU5A 3LFNA 3SDJA 4Y8DA 2X4ZA 4YC6A 3NUPA 1XWSA 5LCKA 4C4FA 4LV5A 1L3RE 4TPTA 2HXQA 3TDWA 2OIQA 3F66A 3GU4A 3PY0A 2DWBA 1H1SA 2A0CX 4CFFA 2FGIA 4DGOA 1IA8A 3BWJA 3NCZA 4BCOA 3SXSA 3O23A 4EOOA 5AUXA 5K9IA 2O5KA 2ZMDA 3PIZA 5ANDA 3UVPA 2VNYA 4F7SA 1VJYA 1YDRE 2JGZA 4V0GB 2PSQA 3C0HA 4RZVA 2ZM1A 2YZAA 4EUUA 5CSHA 4NL0A 4R3CA 4IFCA 1NW1A 4ZTLA 3MPMA 3MB6A 5HVYA 3I5ZA 2BDWA 2OH0E 3RAIA 5B2LA 4YJVA 4O22A 3HGKA 5TE0A 5J8IA 3F2NA 4RLKA 2I7QA 3UQGA 4HW7A 2WTCA 4JG7A 4L00A 4RWLA 3LFBA 5KZ0A 3PE1A 1YWNA 1QPCA 1KE6A 4YJRA 3FXZA 3RPVA 2WKMA 4DTBA 5K4IA 2XK8A 2OF4A 3A7HA 2PMOX 3VBYA 3CQEA 2GFCA 4KIOA 3L8SA 3S0OA 1KE5A 3R22A 2R3OA 3OBJA 2QG5A 3ZC5A 2PVMA 2JAMA 3QU0A 4G9CA 5GZ8A 5L2SA 1V1KA 4R1YA 5CU6A 3GBZA 5CY3A 3R8MA 4JAJA 2ZVAA 5K5NA 1E1XA 3L9NA 3GOPA 2HWPA 3R1QA 4EOKA 1VR2A 3TUDA 2P33A 3BE9A 4XCUA 2CN8A 4FTNA 3KEXA 4U40A 2PZ5A 3Q5ZA 2ZV9A 2VWZA 4DC2A 4OTHA 3VIDA 5AMNA 4HVHA 4GMYA 4O7VA 3WE4A 2UZLA 3AC4A 3HDMA 2Y4IB 1J1BA 3NYOA 4ASZA 1UKHA 3I6WA 3QALE 2YFXA 4X6QC 4QMMA 3FMLA 1WBWA 1OB3A 2W4KA 4K0YA 5HLWA 4IWQA 2REIA 1XH6A 2BZJA 2OIDA 5E8ZA 4QQTA 3EQFA 4G2FA 4BICA 4EKLA 5B7VA 2BMCA 4NM5A 1VYZA 3ROYA 2C3IB 4R78A 3TM0A 3A4PA 2BUJA 3OTVA 5C1QB 5A3XA 3LJ1A 5IZFA 2PVYA 2R3LA 4C33A 5DE2A 3VRZA 1OIQA 4A9TA 5AAGA 3IW6A 3C4ZA 4FKGA 3PXZA 4D5KA 2BALA 2EB3A 1FINA 3BYMA 4QTCA 4QYHA 5D41A 4ZTMA 3HA8A 3IW5A 3SC1A 1Y6BA 5LQFA 2J5FA 3DQWA 2VN9A 4AGUA 5IA1A 5JRQA 4NJ3A 1G8SA 3GGFA 4D0XA 4OTRA 2OXDA 3MH2A 1SVHA 1JSVA 3ZC6A 4RJ5A 5HO6A 2IVTA 1ZOHA 3OOGA 2X2MA 3D5XA 5EHYA 4BCNA 1IR3A 1H1QA 4II5A 1O6LA 1J91A 3FI3A 3OCTA 3PE2A 3ZUVA 4DFLA 4FYOA 3T8OA 3AT3A 3LQ8A 3D4QA 3DBCA 4APPA 4DH7A 2B53A 4J7BA 3V04A 3VF8A 4NTSA 4CEGA 4IDVA 3RJCA 3UG2A 2W5BA 3OROA 4DEAA 4QPSA 4RX7A 3FXXA 4XYFA 4BI1A 4RIOA 3BLRA 2VU3A 2Z2WA 3SXFA 3LMIA 4GJ2A 1VZOA 5EW8A 1H25A 4FNZA 4IZYA 3FY0A 2XIKA 2VTIA 3EQRA 4AOTA 3GOKA 2PZYA 4X2GA 5I5ZA 3V5TA 2R3FA 1SVEA 3LCSA 3Q53A 4HYIA 3KK8A 3A99A 2J9MA 4G3FA 5AWMA 4B0GA 5M06A 4PP7A 3DK3A 4ACMA 3ZEWA 3GU8A 3F82A 4Z7GA 3DK6A 4FNXA 3U54A 4BTFA 5HTCA 1BL7A 3NVKI 5LJJA 2OIBA 5B2MA 3CKWA 4BYIA 3WF7A 1OGUA 3PYYA 4NW6A 5ANOA 4E5AX 1V0BA 3KXHA 2XM8A 3R8VA 2Z7QA 3QCXA 4IM2A 4NYEA 2PE1A 5LXMA 1W82A 3FLSA 2QO7A 5HEZA 2O64A 3DY7A 1O6YA 3FC2A 4MF0A 3UPXA 3RZFA 5G6VA 4D55A 4ZZNA 2VX1A 3EQPA 4E3CA 1ZZLA 2YCQA 4N4SA 1H00A 3RPOA 3AMAA 1UWHA 4APCA 4JNWA 4QMNA 2Z02A 4IZ5A 3OFMA 1WBNA 3CE3A 3R7EA 2YLFA 4FTKA 4M69A 4EQCA 4NIFB 2Q83A 5M07A 1OECA 4EOMA 1UU9A 3TACA 1GNGA 2FUMA 3R30A 4CNHA 3AMBA 4U5JA 2WQNA 3E8EA 3HECA 4UEUA 3SW7A 4C3PA 4H3PA 2CLXA 3KKVA 4AN9A 3W2RA 4OLIA 3T9IA 2UW7A 3Q3BA 3II5A 4F6WA 3I0QA 4P5QA 2W96B 2F7ZE 1WBOA 4NFMA 5EM7A 2C6IA 4ZTNA 2JEDA 3NDMA 3BBWA 3OG7A 3P78A 2PUUA 2RFEA 4L3JA 1GIJA 4OR5A 4W9XA 3QTUA 4FSRA 5AP3A 4I23A 3HX4A 4IX5A 1H0WA 3COHA 4E4NA 4PRJA 3A7GA 4IADA 3ZFYA 2YM4A 2ZDUA 3TNHA 3A7FA 4K77A 4FUXA 5GINE 3UQCA 4FSZA 4ERKA 5HLPA 2Y8OA 5DIAA 5HIDA 2ZAZA 1Q3WA 4IM0A 4PUZA 3SOAA 4ZMEA 5EOLA 2C1AA 3Q96A 3AXWA 2PVFA 3G90X 4DG3E 2OSCA 3POOA 2YM3A 3PP1A 4FF8A 4FTMA 3ODZX 2Z7SA 3JS2A 5E8YA 3UYTA 4EH9A 2WTIA 3IDPA 5TO8A 1FMKA 4AA4A 2YACA 4BCGA 2PVLA 5HORA 5HG7A 4BN1A 2WMBA 1P4OA 3FHRA 3FZRA 4RVTA 4D1ZA 3ZU7A 1J7LA 3EL8A 4KIKA 4QP6A 5JKGA 4DF3A 2XIZA 4PX6A 2HIWA 4RVKA 3TKUA 3V5WA 4TNDA 3W33A 3KCFA 4OT6A 5C26A 4R7IA 3QCYA 4RX9A 4O96A 3LFSA 3MESA 3D14A 3JY9A 3PZHA 4JX7A 3SGCA 3U4WA 2W4OA 4FTQA 2VTOA 5HNGA 3PRFA 4BDAA 4FL2A 4KD1A 2BRNA 3A8XA 4KSQA 2VX3A 3VQHA 1RJBA 4DCEA 4EZ7A 3DV3A 2W1EA 4RZWA 4MQ1A 1TVOA 4AW2A 2CCIA 4W8DA 4CZTA 5M44A 2GQSA 2UUEA 5BVWA 4QMVA 5KHWA 3FBVA 3LFCA 2JITA 4M97A 4YO6A 3U51A 3UZRA 3VN9A 2C3KA 4M66A 3TZMA 3W32A 2X1NA 4KKGA 4RIWB 4ITIA 2V55A 4FSWA 2EUFB 4CCBA 4KA3A 5AM6A 1JOWB 2A1AB 2WQMA 2GSFA 2HZ4A 3F88A 4IC8A 4P5ZA 4DGNA 1JKSA 2BAJA 5JQ5A 4FZAB 4RIYA 4YJQA 5FRIA 1JPAA 3HAMA 4HYUA 2OU7A 3BHYA 4RX5A 4QQ5A 2YLEA 4XJ0A 5DRDA 5CANA 2QOQA 3R02A 4C34A 2E9PA 3EOCA 3DKOA 4X3FC 3FKNA 5HBHA 5CEIA 5CT0A 3TWJA 4C7TA 3JR1A 4X0MA 4CLIA 4YTCA 5DLSA 1MUOA 1FGIA 2VGPA 2BVAA 5TKDA 1GOLA 2OFVA 3LM5A 1H0VA 2XYNA 4H3QA 2LAVA 4AZVA 3HDNA 5AM7A 4XP2A 3OP5A 5E90A 2BRHA 4EZ3A 3VO3A 5FUTA 3ERKA 2E9NA 3R73A 3V5QA 3G15A 3PIYA 2OJIA 3QTIA 2VTNA 4GUBA 5DH3A 1M7QA 4ANNA 5KMMA 4X7QA 4EHVA 3UC4A 4UXLA 5EM6A 5ITAA 2PVKA 1NT2A 3QF9A 4RX8A 4WO5A 4HVDA 2W1ZA 2CNVA 4XV2A 3ZYAA 3F5PA 2ZDTA 4LOPA 2ACXA 2O8YA 4B99A 3VW6A 3OW3A 4F1TA 5M57A 2W1DA 2ZV7A 5HTBA 2R7IA 3LPBA 4OTWA 3W1FA 4USEA 4XRLA 3UODA 2G2IA 3ZTXA 3JVSA 2H6DA 2VO0A 3GI3A 3Q4TA 1XH8A 4XV3A 3EKNA 3LKMA 4PDSA 3ALNA 3E5AA 2ZM3A 3R28A 3D7TA 4JDIA 3UPZA 1CKIA 1PY5A 2OLCA 3DXQA 1J7UA 5IH6A 4NCTA 5HVJA 2XNGA 3B8RA 4PDOA 5IQCA 2BPMA 3FY2A 4CFMA 2YM5A 4R77A 4QP2A 1DS5A 2JKMA 2VAGA 1ZMWA 4GW8A 3GP0A 2QOCA 1QPEA 3Q60A 4JG8A 4JQEA 5DFPA 2ETKA 3DXPA 1BX6A 3OOMA 4Z7HA 5LWNA 5A4QA 3EWHA 3MIYA 5ANIA 5EG3A 3RAHA 3F9NA 4K2RA 2WEVA 4ZMFA 3LLTA 4PTEA 3QD4A 4YMJA 4YTHA 5IQHA 4L45A 2OH4A 4QMZA 1UNHA 2P0CA 4H1JA 4YPSA 5AX9A 4LL5A 2Z60A 3FQSA 3MH1A 2C47A 3DTWA 3EFKA 3QQLA 3VUKA 4U9AA 4UY9A 4ZSJA 4BDDA 3DLZA 2OWBA 3NSZA 3ZFXA 2OGVA 4WSQA 3FE3A 4O7SA 1R39A 4WKQA 5BMSA 4ENXA 1UV5A 4AZWA 2QOFA 5CF8A 3L8PA 2UZDA 3G9LX 1QPDA 2XB7A 4I5MA 1U46A 4ZLOA 2VWBA 3B2WA 4DA5A 3I4BA 5F94A 3QBNA 4A9YA 2XNBA 2YCRA 2OBJA 3Q9WA 4D9UA 1J3HA 3KMMA 4IVDA 5HI2A 2PTKA 4L3LA 3QKMA 1OITA 4C4HA 2PMNX 3AC2A 2VZ6A 5KUPA 3C5IA 4YZNA 5HX8A 4K33A 3KXMA 3O0GA 1ATPE 1PMUA 2XMYA 4I5CA 4C57A 4DFZE 4F09A 4W4YA 4D2VA 2UZVA 4AF3A 5M51A 2XZSA 3MH0A 4L8MA 2GTMA 3QQHA 2XKCA 3F3VA 2IPXA 3A61A 3R71A 2ZV2A 5TT7A 3LZBA 5EDQA 4AGDA 1U54B 4FZDB 5IA5A 4CMOA 3ZLWA 5KBQA 1PYEA 2E9VA 2JDRA 2BIYA 2JLDA 2WTVA 3OXZA 3POZA 3TZ7A 3EQIA 4ONAA 3HP2A 4GVJA 4WNPA 1S9JA 3BBTB 4ID7A 4MAOA 2PVRA 2VTTA 2R5TA 2YEXA 3UIXA 5HG9A 3SKCA 4ANQA 5HOAA 4C4GA 4F9WA 3OZ6A 5L8JA 4ZAUA 3R1NA 2J0KA 3RK9A 4FIHA 5I9ZA 1TKIA 4AN3A 5GNKA 3KREA 2PVJA 1ZYDA 4EK4A 3NYNA 2GNJA 4FL1A 3TL8A 5JMSA 2GCDA 2HZ0A 2UZUE 4B4LA 5I9VA 4GG7A 2UW4A 1Y91A 2CGVA 2YM7A 5E1EA 3VQUA 4RT7A 3QL8A 5CAPA 3C7QA 2WMWA 5K0KA 4E20A 4EUTA 2UW3A 2XKDA 1M14A 3BHVA 3L8XA 4YO4A 3LXPA 2J50A 3HV4A 4AOJA 4MBIA 1W83A 1WVWA 1BLXA 4DN5A 4D28A 3QTWA 3W10A 2PK9A 2XNMA 3G33A 2BAKA 3QTXA 4QYFA 4TN6A 5BVEA 2VWVA 2W06A 2UVZA 3CPCA 4X6RA 4JVGA 3UIBA 4KSPA 4EHZA 3Q6UA 4RIXB 2A2AA 5HGIA 4FV1A 4GUEA 3IDCA 3ZH8A 3ORLA 2XNOA 2CKQA 3ZBFA 3RMFA 4ZSGA 4BL1A 5CEOA 5JFSA 2P55A 4O83A 4DEHA 5DR2A 5AX3A 3MSSA 2GHGA 3WF5A 1I44A 4BTMA 3E7OA 1ZYSA 3R04A 4YZ9A 4E4MA 4PDPA 2YABA 1MP8A 5D9HA 3GC7A 2RIOA 2XJ0A 2I0EA 4BWXA 5EKNA 2A4LA 5T3QA 3MW1A 3VC4A 4BCKA 1YOJA 3FPMA 3QWJA 4FKQA 2JBOA 3DT1A 4MQ2A 1PW2A 3ZM9A 1H1PA 3L9PA 2G2FA 5L2TA 2EVAA 5ETIA 1FBNA 3KVXA 2XA4A 2QNJA 4FI1A 4BKYA 4BY9E 2E9OA 3R8PA 2X0GA 1O9UA 5DNRA 3CGOA 2J6MA 2JDOA 3OUNB 3QXOA 2C5NA 3D9VA 3QC4A 5TOZA 3S1HA 4RJ7A 4IX6A 2J90A 3UNZA 4G6NA 4U7ZA 3CTHA 4AW1A 3WZUA 3DKGA 4JRVA 4XG9A 3T3VA 2QQ7A 2ZB1A 5H8EA 1W84A 2I0VA 3ULZA 2UZOA 2IVUA 1OMWA 4U41A 3F7ZA 5FTQA 4AT3A 3Q32A 4YJNA 4EOSA 3LM0A 5T68A 4LRJA 1AGWA 4D2TA 5CF5A 3MN3A 4FSMA 3R6XA 4V0GA 3PSCA 2X9FA 3IONA 4ANSA 4FV9A 2VRXA 3HUCA 3IW7A 3QTZA 2YN8A 4YBJA 4YJUA 4FMQA 5IQIA 2ITNA 1OKWA 1UWJA 3JY0A 2CNUA 3Q2JA 4C37A 2IW9A 4EH4A 1ZOEA 4G3CA 3CC6A 5HE0A 5ETFA 5ETCA 2PHKA 3TIYA 5AR3A 5JSMA 1KE9A 5IF1A 3PLSA 5C8NA 4QNYA 2IW8A 2FB8A 4LQMA 3I60A 3TXOA 2BKKA 3ORTA 2RFNA 1DAYA 3DAJA 3MB7A 2ZJWA 4YZMA 2XK9A 2BRMA 4IB5A 4D2SA 4YTFA 3OTUA 3DNEA 3LHJA 1B6CB 5CQWA 5HVKA 1UU3A 5AA8A 1UNGA 3JVRA 3OEFX 5E8WA 2OZAB 4Q9SA 5HQ0A 5IH4A 5AUVA 5DT0A 4ZY5A 3UZTA 2IN6A 1UA2A 3EZVA 4IW0A 2G01A 4ACCA 3AD6A 3P4KA 5DT3A 5FWKK 2YIQA 4RGJA 4FV7A 2G15A 2WMRA 1K3AA 4G3GA 4ANBA 4MH7A 4QP8A 4YLJA 4O21A 2JFMA 3UVQA 2HOGA 3GT8A 2Y0AA 2GHLA 4O0YA 5AIKA 5AP0A 3MS9A 3R63A 1M2QA 2XNEA 3NIEA 4DT9A 3W2OA 4QD6A 2WEIA 3FKOA 4CTBA 3VHKA 5GIOE 3MV5A 4QP1A 3FL5A 4KUJA 4L6QA 4DFBA 3IG7A 3K2LA 4X2JA 5CASA 4FT0A 4FT3A 3R1YA 2V0DA 1XH4A 3DK7A 3VRYA 1WMKA 5CEKA 3A7JA 3CQWA 4CCUA 2FH9A 3JPVA 4N57A 4BCPA 4S30A 4O7RA 3KXNA 4E26A 4FTJA 2WNTA 4NSTA 1ZY4A 4AGWA 3PVUA 3QGWA 3MTFA 3R9OA 1ZOGA 3ZM4A 2F2UA 4NKSA 5KCVA 2QLQA 3LLAA 2C5YA 3EQHA 3H9FA 4D1XA 5EI8A 4FVRA 3UP2A 5CXHA 3RPSA 3NRMA 3ITZA 4YU2A 5CAVA 5HU3A 4CYJA 3I7CA 4OW8A 4QO9A 5DBXA 5HICA 3HV7A 4QMXA 3ZONA 1BYGA 1LUFA 3EB0A 1XQZA 3RK7A 5ICPA 2BDFA 3E3BX 4WG4A 3VS1A 3QZGA 1ZZ2A 1DM2A 4S2ZA 4C61A 4EK6A 4JR3A 3BYSA 5E8VA 2C6OA 3FSKA 3BI6A 3C4XA 3M1SA 4IAFA 3C4WA 5FG8A 4C02A 4DE4A 4O91A 3OCGA 3RBWA 1F0QA 3KXGA 4FICA 4OTFA 3H0ZA 5A4EA 5HTIA 4O7LA 2PUNA 1UU8A 4F0FA 4YGAA 1MRVA 4IB1A 3TNWA 4L43A 5EQPA 3CIKA 3EN6A 3F61A 4OTGA 3KRRA 1G8AA 4GK2A 4NCTC 4LGGA 4UMQA 4I22A 3BYOA 4UYNA 4FKIA 2Q0NA 3EKKA 4IVBA 3R7UA 3RWPA 3KXXA 3PFQA 4CG9A 3ZFMA 2YISA 1WBSA 3MFUA 3PDTA 5EI6A 4FKWA 3ZHPC 1TQIA 4GU6A 4WG5A 4J8MA 3DKFA 3E8CA 4TZRA 3OUKA 4HZRA 1KSWA 4F7JA 4CGAA 3IW4A 1R78A 4YZDA 4DH3A 3CXWA 4V01A 4XH6A 1S9IA 3OBGA 4H3BA 5BUJA 5H2UA 4LRKA 2ZM4A 3R1SA 3RI1A 2VTQA 4DAWA 3TI1A 4IB0A 3NW6A 2XP2A 5EHOA 4DBXA 2QOOA 3E88A 1OVEA 3FWQA 3FZ1A 4D5HA 4FEXA 2B55A 3UG1A 3PTGA 3BYVA 5EM8A 1XJDA 3W8LA 4EZ5A 4I41A 5LMKA 4NIFA 5FLFA 2C6EA 4RVLA 2BZKB 3QUEA 5BVNA 3KVWA 2HENA 1WBVA 3ZO4A 5EW9A 2CSNA 4BDBA 4ACHA 3E8NA 2PWLA 4QTDA 5AUYA 3UE4A 1F5QA 3EFWA 4GIHA 5JEBA 4IWDA 3GU6A 5AR2A 4P2KA 4XLVA 4FUYA 3TG1A 3OCSA 3Q4CA 3FYJX 4TWCA 4PPCA 4BWKA 3OXIA 3KL8A 4GYGA 2QCSA 4UYAA 5C01A 4H58A 4DG2E 3SAYA 3R2YA 2RKUA 2XK6A 5L6OA 1IAHA 4C58A 3R00A 5FTOA 1YHSA 1JSTA 3QKLA 1SVGA 4PL4A 1NVRA 1XBCA 2RSVA 2PVHA 3EQBA 4W4WA 2FSOX 1Y6AA 5J7BA 4IAKA 5IEXA 3AGMA 4BIDA 4BIBA 4ZZMA 4TWPA 4J97A 3MY1A 5HU9A 5E7RA 3VS5A 4EJNA 4W4VA 4BCIA 4GU9A 2QR8A 3FUPA 4JX3A 5HCYA 5BMMA 1Q8WA 3CEKA 3PXKA 4GT4A 3E87A 3FLNC 3DA6A 3QC9A 3GQIA 4IX3A 3KQ7A 4AGCA 4G6LA 4M7IA 3QQGA 4CSVA 3FSFA 3PXQA 1M52A 3V5JA 2GS7A 2OJJA 3DLSA 1URCA 1OPKA 1UKIA 4G5PA 4C3RA 1CKJA 3OC1A 4A7CA 2B52A 3LFQA 4O82A 4UXQA 2VD5A 4A9RA 3G0EA 4I94A 1SNUA 1M2RA 3HV5A 3EN5A 1H07A 4OTPA 3NNXA 4RJ8A 3OW4A 4FTLA 4TXCA 5E1SA 3W2SA 4WOVA 4DLIA 2RGPA 1R0PA 5AP5A 4YP8A 5J7HA 2DUVA 5A54A 3ENMA 4UWCA 1JSUA 5BQ0A 4ZZOA 2KULA 4HZSA 4I6BA 2BZIB 4O0TA 2B4SB 3ENHA 3FMHA 4FKRA 4FV4A 5CX9A 4FKOA 2C5VA 3BHTA 4CRSA 4RMZA 2H96A 4NM3A 3VBTA 4CZUA 4DYMA 5KKRC 4O81A 4ITHA 5AR4A 2X9EA 4WHZA 1X8BA 3IECA 4BCFA 5LVLA 4U0IA 3BE2A 2OICA 3FJQE 4C4JA 4WBBB 4AWIA 4FKPA 4RIWA 4CFWA 4Z9LA 3F5XA 5HE1A 4KIQA 4EOLA 4CVAA 3EQCA 4UWBA 1YOLA 5GJFA 1IRKA 4I3ZA 4X3FB 3PJ3A 4L53A 5H8BA 2I6LA 3QX2A 4X2KA 3NEWA 3A2CA 5CVFA 5HE3A 3QHRA 4KINA 5KZIA 2W1GA 3EYHA 5GJDA 5M09A 2PULA 2FVDA 2FO0A 4G16A 2VTSA 2YDJA 4AUAA 1P5EA 4IM3A 2JIVA 5CSVA 4F65A 1WAKA 4OAVB 4ENYA 1YXVA 5IA4A 3MVMA 4JIKA 4N70A 3SHEA 5JFWA 3P5KA 4XEYA 4MXAA 4HVIA 4J99A 3FLQA 2ZB0A 4OT5A 5FXQA 4CZYB 2B7AA 3CQUA 2UV2A 4QRCA 5HX6A 2ONLA 1YI6A 2WTKC 4QTAA 1UVRA 3WYXA 3WZJA 3R9NA 2QOBA 5IA3A 4YR8A 4E93A 2OG8A 4MXZA 1Z9XA 3HUBA 3PY1A 4F70A 2XRUA 5BNJA 5IA2A 4YJOA 3EQDA 3U8WA 3EL7A 4H05A 5E9EA 2X7GA 2UVYA 2OXYA 2F9GA 3NGAA 3QWKA 4F9BA 1OL1A 2W17A 3ACKA 5M4CA 5CI6A 4C2VA 1STCE 4EC8A 3O7LB 4MD9E 3RAWA 2JDTA 2J0IA 4IIRA 2C3JA 3Q52A 1OKVA 4X3JA 3QUPA 5C03A 3TUCA 2QR7A 5KNJA 1W7HA 4RA5A 3EN9A 3MIAA 3A62A 5HIBA 2V22A 1Q99A 4TRLA 3A7IA 3E64A 3F3WA 1M2PA 4BGQA 4FEQA 4K11A 4QMUA 4U44A 4JDKA 1R3CA 4I5PA 3ORZA 3BHUA 4UZHA 5ETAA 3ETAA 4KB8A 4CT1A 3F3TA 3HYHA 1J1CA 3N51A 4DFNA 3NAXA 5LMAA 2CLQA 5EH0A 4BZDA 4ZSLA 4MBLA 4NM7A 3O7LD 2B1PA 2C6LA 5CQUA 5EKOA 3GCQA 4QTEA 4UN0C 3RAKA 3UVRA 2B9JA 4FK3A 3V6SA 5JFVA 3C4CA 3HV6A 1DI8A 1M17A 1V0OA 2QOIA 3TNQB 3UIUA 4BIEA 4F99A 5KBRA 4C4EA 4WRSA 1CTPE 1WVYA 4ZTSA 4XG2A 4FG7A 4CFVA 3GQLA 2VWYA 1FMOE 3CJFA 5JFXA 5KMLA 1QPJA 2J0LA 5HNBA 3U9CA 3U4UA 2QODA 3CD8A 3PJ2A 5HD7A 3RM6A 3UMWA 1PMVA 2WTDA 4RJ6A 4V05A 4D4YA 2C0IA 1PHKA 3PSDA 5J1VA 5A46A 4PL5A 3COMA 2W4JA 3R83A 2CKPA 3NUXA 3SRVB 4ZLYA 3FI8A 1R0EA 3IO7A 5IUGA 4G5JA 5JK3A 3LMHA 3NZ0A 4KRDA 4NWMA 2B54A 3F2RA 4JDJA 2J5EA 4AZEA 4LGHA 3GCVA 3QQJA 3W55A 1ZYCA 4BDIA 2HK5A 3C5UA 4KS7A 4L46A 1CKPA 4KNBA 2WTJA 3HZTA 1ZMVA 4EQUA 4FR4A 4KKEA 1GZOA 4NW5A 1VEBA 3TIZA 3V8TA 3FMKA 3KY2A 2C6DA 4L68A 5AIRA 2AUHA 5CNOA 5FDPA 3DB6A 3R7GA 2I0HA 4L7SA 4DTKA 5HKMA 3RVGA 2G9XA 2ITXA 2R3MA 5FP5A 4QPMA 5IEYA 4FSTA 4ALUA 3S4QA 3MJ1A 3M42A 3R0TA 5DEYA 3BU3A 3SVVA 2WQEA 1T46A 3ZUUA 4FSUA 4FEVA 2OXXA 4Q5HA 1YQJA 4F1MA 1Q8ZA 3MI9A 4FIGA 4TL0A 4LM5A 1PYXA 4IB3A 4RC4A 3FMEA 4XG8A 4CG8A 4RWKA 4GK4A 5IPJA 3Q4UA 3QX4A 4R7HA 3NAYA 2C6MA 1Z57A 2ITQA 3D2IA 4C35A 4FE2A 1WFCA 4XNEA 3OY3A 2WIHA 2PE2A 3UBDA 5KMIA 2XF0A 5AAFA 4S34A 2W1FA 4I24A 2BRBA 3GCUA 1KOBA 4DCAA 4EJ7A 2YHVA 2Y4PA 4GCJA 1ZAOA 4JRNA 5J9YA 1H28A 4Y46A 5AV1A 3V5LA 4GS6A 3VS0A 3VS2A 2XKFA 4FGRA 1ZMUA 2W9FB 4QMPA 3LJ0A 5C8KA 4L44A 1YDTE 3KC3A 5CZIA 4UX9A 4G3EA 4I21A 4JT3A 4BGGA 4E73A 5E8UA 3T9TA 4XV9A 2UW8A 4YNOA 4D4SA 4ZTQA 2HY81 4DT8A 3UP7A 4C8BA 3OWKA 3ZS5A 2BIKB 2XNNA 2ZOQA 3PG3A 3R8UA 4AE9A 3PA4A 1APME 4AZSA 2R3RA 3LCOA 3PG1A 4ASXA 4PQNA 3R7IA 2BROA 3GFWA 4AZTA 2QKRA 4FODA 1E9HA 4BHNA 2WQBA 3QLFA 3PZEA 4JQ7A 4WG3A 4ZP5A 4QMOA 4QMYA 3B2TA 1Q8YA 2JDVA 2UZNA 1OIYA 5D1JA 4XG7A 2W99B 4JAIA 4A9SA 3ZRLA 5D10A 3D5UA 4CXAA 3PUPA 2R9SA 4RIXA 2Y6MA 5FEEA 3BEGA 3THBA 3CY3A 3GVUA 4FKSA 2EU9A 4UBAA 4EH8A 2PYWA 5E92A 3QYWA 2P2IA 1GIIA 4LOQA 3UTOA 3BLHA 3QUDA 3VS7A 3SA0A 4XRJA 3O51A 3NWWA 5AV3A 4DEBA 3NUUA 4W4XA 1MQBA 3EQGA 3PVBA 4FL3A 5HD4A 4Z55A 3BIZA 3QRIA 4O27B 1QL6A 4I4EA 4ITJA 1YHVA 2WIPA 4IZAA 4E6CA 1JKTA 2XM9A 5EW3A 2Z8CA 5BX0A 4N6YA 4AE6A 3W18A 2PUPA 4ACDA 3P08A 5L6WL 4I6FA 3D2KA 5AR7A 4C36A 1YI4A 5DMZA 3KXZA 2C6KA 3LAUA 1XH9A 3DBQA 5CLPA 5AA9A 3P86A 4FV6A 4CYIA 3RM7A 3DJ6A 4FTCA 1GZKA 4BDHA 5A9UA 5IQBA 4RVMA 1DAWA 1OKYA 2UZEA 2EXEA 4TY1A 3V3VA 3HEGA 4C4IA 1ZWSA 3MVHA 1BUHA 3QRKA 3GEQA 4O0RA 2C5OA 4BDKA 4IVCA 1NA7A 4IHPA 4E4LA 4CQGA 2R4BA 4M0YA 5A6OA 1U5RA 3ANQA 3OD6X 4YC3A 5T6KA 2CN5A 1ZY5A 4G6OA 4MWIA 3SW4A 4D2PA 4PMPA 4ARKA 3C9WA 1XBAA 3S2PA 2QC6A 4O1PA 4XLIA 4IX4A 3R9RA 4ALWA 4I0TA 2YM6A 3HMOA 4TW9A 4R1VA 3RKBA 5IDNA 2NO3A 5CVHA 4BKZA 4W9WA 3LW0A 4O2PA 5KMKA 5LOHA 5HZNA 5G1XA 3VW8A 1Q24A 1H08A 5KX8A 2PMIA 5FQDC 2YA9A 3MPTA 4I93A 4FTUA 2JKQA 5J95A 1P4FA 4FG8A 3Q9XA 3FDNA 4A06A 4NZWB 3S95A 4USDA 3ZLSA 3PXYA 5FXRA 3K5VA 3U9NA 3G6HA 3H9RA 2O65A 4WD5A 2VTHA 4KKHA 4YJTA 2R3NA 4PNKA 3DOGA 4TYHB 3NMUF 1YXXA 4OTQA 4FIFA 2EXCX 4FZ7A 3HRCA 1U59A 2QO2A 4I5HA 2OZAA 1YOMA 1YVJA 4I0SA 4AXAA 2X7FA 5E91A 3WF9A 4BFMA 3F6XA 3TCPA 2C69A 3BX5A 4DH1A 3VVHA 4JS8A 2JKOA 4H36A 5AUZA 2V62A 3TTJA 3MY5A 4NEUA 4JBVA 5AP4A 3MFSA 3O71A 3E7VA 3KMUA 5J87A 3N4VA 4ASEA 1JWHA 3DBFA 3H9OA 3LXKA 4YBKA 3DB8A 3GU7A 3NW7A 2GDOA 3ORKA 4XG3A 3L1SA 4EKKA 3EZRA 3KRWA 4G17A 4FKJA 4JBOA 4UALA 4XS2A 3CY2A 2ZYBA 3R8ZA 5IG1A 4IJPA 3OCBA 5AV4A 3QQUA 2WTWA 3I1AA 3LMGA 1FGKA 2HW7A 4XG6A 2QOHA 1URWA 1Q4LA 5HBEA 3WBLA 5IEVA 3BGPA 4FTAA 4XP3A 5M4UA 4YPDA 4A9UA 4C62A 4J53A 3QD3A 3FMMA 5EM5A 3OWLA 4J95A 4EL9A 2PPQA 4JIAA 5K5XA 3O2MA 3QTSA 5BYYA 4JBPA 2UZTA 3N9XA 3KRLA 2ONLC 5CU4A 3DS6A 4PNIA 5C4LA 4JBQA 4ZS0A 1MRUA 5C9CA 1K9AA 3COKA 5AP1A 4DITA 1SZMA 3R9DA 3MTLA 1W8CA 1REJA 3WZKA 4CKIA 2FSMX 4G3DA 3K3JA 3LOKA 3PXFA 5DGZA 4EI4A 2XS0A 1PXLA 3O96A 4K8AA 3NCGA 2CGXA 3BHHA 4QTBA 3R9HA 4F9AA 5HBJA 4BBMA 4O2ZA 3Q5IA 3FAAA 2PZIA 3CR0A 5B2KA 5C27A 3ZXZA 5CVGA 4TNBA 2WGJA 4CKRA 3BPRA 2WO6A 3O8TA 2QOLA 2QVSE 4E1ZA 3BZ3A 1K2PA 3E3PA 4C3FA 3LCKA 4UV0A 4U43A 3W8QA 2V7AA 4X2FA 2VTJA 3I6UA 3NUAA 3K54A 5DEWA 2J7TA 3LFFA 2GNGA 1OL7A 4KBKA 4BC6A 4PDYA 5IA0A 4EK5A 2YIXA 5IQAA 4PY1A 4AW0A 4RA4A 5EYCA 3HL7A 2QOKA 2GU8A 4JJRA 5J1WA 4FZFB 3GXLA 3N4TA 4F9YA 4PPAA 2NPQA 4BCHA 2X2LA 4RFYA 4JOAA 4IAAA 3LVPA 4YTIA 4BDJA 4ACGA 2VTRA 3SXRA 5DG5A 4D0WA 4DEDA 3BGZA 5CALA 3ATTA 2J4ZA 2YM8A 3CKXA 4UB7A 3P0MA 4IWPA 2R3HA 4U79A 4XOZA 3U6IA 3UZPA 2UW0A 4FTRA 3I5NA 2J0JA 1PKGA 4DFUA 5AADA 2CPKE 5JH6A 4GEOA 5CF6A 1OBGA 2WXVA 3F2AA 4AQCA 2BILB 2GNFA 3QZFA 4QMLA 4EEVA 1QMZA 1A06A 3QCSA 4YNEA 4AACA 4CFXA 3O17A 3OHTA 4H39A 4LV8A 3FQEA 4FT5A 4FT9A 4M14A 5CNNA 4D2WA 4B9DA 3WF6A 2XIYA 2C6TA 4LUDA 2W1IA 2GHMA 3O50A 3ZCLA 3ANRA 3OF0A 3LFDA 3R21A 3P79A 1W0XC 4BCJA 3RHKA 5JQ8A 2JKKA 1Q8UA 1RDQE 4I1ZA 3ZLXA 2V7OA 5BYZA 5CAQA 3OEZA 2WAJA 3H0YA 5IISA 3CGFA 3HRFA 4DGLC 5CXZA 5A4TA 4FVPA 3R01A 3QZIA 3PRIA 4B7TA 5CI7A 3PPZA 3ZRMA 2IO6A 3KK9A 4RC3A 4TKSA 2WU7A 3PWYA 4LYNA 4BTJA 3EN7A 2C3LA 3HMNA 3VS6A 4U97A 1OPJA 3LFEA 4HCTA 5FM3A 3ZEPA 2R2PA 1H01A 4FIJA 5IQDA 3AD4A 4BI2A 1JLUE 3LIJA 3QRJA 4RJ4A 5IH5A 2QONA 2G2HA 3O8PA 4D2RA 4LRMA 1Q61A 1Y8YA 3BV2A 3LXLA 3RNIA 3VULA 4PWNA 4NJDA 4BVUA 2Y7JA 1AD5A 4P4CA 2PE0A 4GFOA 3FC1X 3QQKA 4F4PA 4V04A 1SM2A 2CDZA 5HE2A 3U87A 4CQEA 1OI9A 3DNDA 1OZ1A 1LR4A 2F7XE 3PP0A 1H24A 5BPYA 3KA0A 3NS9A 1YWRA 3Q2MA 5CU0A 5IU2A 4FSNA 2JD5A 4MEDA 5JZNA 1GIHA 2PU8A 2OF2A 5K3YA 4Y5QA 4EOQA 4K1BA 3TEIA 4Y5HA
chains in the Genus database with same CATH superfamily
2B0QA 1G3NA 1H1RA 3CTJA 3DBEA 3Q6WA 3MFTA 1GZ8A 4R8QA 3E93A 1YW2A 3FI4A 4I6HA 4E4XA 5CEMA 3OT8A 2XALA 2QD9A 2UZBA 2YIRA 4PMTA 5DI1A 4DGGA 3AOXA 4AFJA 2HZIA 4TWOA 4ZJVA 4LDTA 1GAGA 2VTMA 2CJMA 2BKZA 2UVXA 2XK7A 3QD0A 3LJ2A 4R6VA 5D7VA 4AG8A 4C2WA 3VS4A 4O1OA 4AT4A 3BRBA 5JGDA 3FL4A 3IQ7A 2VWWA 3H3CA 3HNGA 2AC3A 1A48A 3EIDA 3K5UA 2QURA 1GJOA 4LI5A 3AC3A 5J9ZA 5L8KA 1UU7A 1IASA 4ZTHA 4DFXE 3ACJA 2R3GA 4X3FA 4CRLA 4JLCA 4GL9A 3UOHA 5HO7A 5HNIX 3TN8A 2QKWB 3TZ9A 4LUEA 4WUNA 3HAVA 5IMEA 3H30A 3MY0A 2R7BA 1RQQA 2YITA 1YDSE 2ITOA 3GC9A 3R2BA 1PMEA 4GFGA 2YIYA 4RRVA 2X0QA 3NX8A 2A27A 3VONA 5L4QA 4RLLA 2UZWE 3G9NA 5AV2A 3UNJA 3MA3A 2A19B 4PMMA 3F7WA 3I81A 3ZO1A 2CNQA 3CS9A 3C51A 5AEPA 3HP5A 3KCKA 3LCDA 3NNUA 2C5XA 5FXSA 3WZDA 5FEQA 4CKJA 3GB2A 4AX8A 2BHEA 1XMLA 3FKLA 2X39A 4GFMA 5H9BA 4O0SA 4IDTA 4MTAA 2YAKA 3W2QA 5GIPE 3MBLA 1ZXEA 2WMVA 2W5HA 2EWAA 4C0TA 5CYIA 4CV8A 5E8SA 3DQXA 4G34A 1KV2A 2J2IB 3DCVA 2XVDA 3ZO3A 3DJ7A 4U3YA 5FBNC 3PLAE 4O7NA 3OT3A 3BWFA 2RFDA 4YLKA 4ZLZA 3UMXA 2O63A 5H8GA 4DEEA 4S32A 2H9VA 2CMWA 2C4GA 4O0UA 2ITVA 1LEWA 3P7BA 4D58A 2Z7RA 5M4FA 4NFNA 2XK3A 4O6LA 4JDHA 1Q62A 4ALVA 3LQ3A 3ORXA 1WBTA 4ZJIA 3V8SA 1I09A 4YLLA 4BRXA 5CU3A 3RHXA 5C4KA 1PXJA 3B8QA 1BL6A 4LL0A 3VJNA 4YHJA 3NUYA 3Q04A 2F2CB 4IAYA 3K3IA 3JXWA 4DBNA 4MK0A 2NRYA 2OJFE 4NH1A 3ZSIA 4CMUA 4F63A 1ST0A 3DPKA 1O6KA 4ZK5A 3D83A 3FHIA 4DEGA 4L42A 4E5BA 1PXKA 1W98A 4IH8A 4JG6A 4LFIA 3L8VA 3H4JA 2VV9A 5IKWA 2CGUA 4AU8A 4MD8E 4CD0A 3EFLA 5BVOA 5D11A 3EMGA 4D4VA 4O7YA 4DHFA 2AYPA 2X7OA 5AAEA 5GZAA 2HELA 2I0YA 2WHBA 1OL5A 5LVOA 4HCVA 4FV0A 1H1WA 4J8NA 5A6NA 4FKVA 2YDKA 2Z7LA 3LE6A 4U8ZA 4E6DA 4HVSA 5K4JA 1OPLA 5L3AA 1H4LA 1SNXA 2BTRA 4BDEA 4QNAA 5ANEA 4BJJA 3SRVA 2V5QA 3BYUA 3D0EA 5EDPA 4ZJJA 2ETMA 3QGYA 1HOWA 2JC6A 2C0OA 5BUEA 5E8XA 2X2KA 3P7AA 4OAUC 2WMTA 2R0UA 4DFYA 5CEQA 3UYSA 3UNKA 3AGLA 5CZHA 3P1AA 4D1SA 4NUSA 3ZZWA 5I4NA 2C0TA 3MYGA 3Q9ZA 5EI2A 3HMIA 4Y73A 4MNEB 2H8HA 3QCQA 2QHMA 3IGOA 1REKA 3A60A 3DFCB 4OBOA 4OBQA 4BKJA 4FGBA 5I9WA 2ETRA 5L6PA 3O8UA 3QFVA 1ZLTA 2HWOA 3WI6A 3QA0A 4D4RA 4WT6A 4K6ZA 4YZBA 4YZCA 4GKHA 4MXOA 3HVCA 5J9LA 3QQFA 1KUTA 4E6AA 5J5TA 3ZO2A 2RF9A 3AQVA 3CTQA 4J96A 3VUDA 1M7NA 1OL6A 4MWHA 4O4BB 4HGLA 2YCSA 5JRSA 3P23A 4HCUA 3SLSA 2XIXA 3E8DA 2OO8X 4XUFA 2QU6A 4YSJA 2DS1A 2X6EA 5ACBC 3V5PA 4A4OA 4X2NA 4EWQA 2SRCA 2CKOA 4C59A 3RCDA 3ET7A 4FBXA 3UGCA 1U5QA 3C0GA 3PJ1A 3W2PA 4UMRA 5A4CA 4LMUA 4QQCA 2YDIA 2WOUA 4JR7A 2GNLA 4FEWA 1Q3DA 4B8MA 3PJCA 5AUTA 5LVPA 5EHLA 5HG5A 2B9HA 3NYXA 3CD3A 3Q4ZA 4FTOA 4BDFA 4F0IA 4ASDA 3ORPA 4BTKA 1OUKA 4RG0A 3WIGA 3KULB 4M3QA 1JKKA 4OTIA 3P7CA 4EHGA 3IW8A 1Q5KA 2W0JA 1TQPA 3F5UA 3BELA 2X4FA 4I6QA 3F3ZA 3M2WA 4PL3A 3P5JC 1VYWA 3A4OX 1LP4A 3QXPA 1PKDA 4Q2AA 4P7EA 2GMXA 2VO6A 3CPBA 3F3UA 4XOYA 3SD0A 5LWMA 4QPAA 5D7AA 3IPHA 3NW5A 3ZSGA 2GS6A 5ACKA 5HIEA 3FEGA 4GJ3A 5L8LA 5IUHA 4ZSEA 4BB4A 3TV7A 4Y95A 1JQHA 4EOIA 4XHKB 3EH9A 4DEIA 2R3PA 3OY1A 1XO2B 2X8EA 3AMYA 3E92A 3MVJA 3ODYX 2P4IA 3PXRA 4J1RA 3DDPA 4Q5EA 4CLJA 1WZYA 3OWJA 5HLNA 1PXNA 1U4DA 3AT2A 2I1MA 3DBDA 4MVFA 3BV3A 1BKXA 1SYKA 2NYAA 4EYMA 3CBLA 1GZNA 3MWUA 1OIRA 5E8TA 5FGKA 5BVKA 4Z16A 1BMKA 2IVSA 2UW9A 3V51A 3DXNA 5CSPA 1PJKA 5DN3A 4PTGA 2ITWA 3TV6A 4CFNA 3IK3A 1RE8A 3SOCA 4O38A 5JGAA 4ZS4A 4N6ZA 3PPKA 4FTIA 2XEYA 2PMLX 4QOXA 5DVRA 4EH5A 5L2IA 5IQEA 4KBAA 4ZTRA 3VBVA 2NP8A 3JUHA 3UOKA 2XYUA 4QMWA 5LMBA 3KFAA 3WARA 4O0WA 4BR3A 4EWHA 5IDPA 3DTCA 4LGDA 4PPBA 2Y6OA 3W2CA 3UOJA 3ZDUA 4FKLA 1IA9A 4AXFA 5JZJA 4QQJA 2R3JA 4PP9A 4M8TA 4BDCA 3P9JA 2OI4X 4B6LA 2BHHA 3ULIA 2IZSA 4O0XA 4QMQA 5I9UA 1KE8A 2IZTA 5EYDA 3NUSA 3TV4A 2XJ1A 3PJ8A 3NLBA 2ZMCA 5TR6A 3DU8A 3WIKA 4A07A 4AT5A 2YZLA 3PPJA 3F69A 2I40A 4NKAA 4USFA 5BYLA 4AAYA 4NTTA 2HCKA 4YSMA 4HVGA 3KF4A 3G2FA 3IGGA 2J51A 3MPAA 5FBOA 3FMNA 4GRBA 1YXSA 4AN2A 5FTGA 2Y4IC 4XX9A 3OS3A 4RWJA 3TZ8A 1YXTA 5GZ9A 4A4XA 4FK6A 4G31A 2YJRA 4AW5A 1NY3A 2VO7A 4GT3A 4QP3A 4OBPA 2P2HA 2UW6A 4QYGA 4E8AA 1LPUA 5CT7A 4HGEA 5H3QA 3FZPA 3E63A 2W5AA 1XR1A 4YHTA 2WMSA 4TYIA 4HNIA 3ZXTA 4TYEA 3ZSHA 3FQHA 4FA2A 4D9TA 1OL2A 3EYGA 1EH4A 4F1OA 2DQ7X 2RFSA 4FIEA 4XV1A 2GQRA 1WVXA 3E62A 3HRBA 3QD2B 4UMUA 4J52A 4UMTA 4R5YA 4Q9ZA 2BDJA 4FV8A 3NVMB 2FSLX 4WNMA 5J5SA 5CEPA 1U54A 4RFZA 4BWPA 4NM0A 5IUIA 3IKAA 2ITUA 4TYHA 3QRTA 3CCNA 4U80A 3TUBA 2BFXA 3AC8A 3AC5A 4O7TA 4R7BA 2JFLA 4ZXTA 2WPAA 2AC5A 5DT4A 3VHEA 5EFQA 4EK3A 5M56A 3TKHA 5IMXA 4DTAA 4RJ3A 4I4FA 4MF1A 2BAQA 2R64A 5IQGA 3FLZA 3RPYA 3FPQA 4S31A 3AC1A 2BZHB 3I79A 4KAOA 2VNWA 4FKUA 3EJ1A 5L2QA 2WELA 4FNWA 5HCXA 3D15A 5M53A 4IEBA 4IJ9A 3SQQA 4JL9A 4O84A 2PZPA 3LFAA 1G5SA 4RQVA 5KMNA 3UIMA 3TKIA 2F7EE 1R1WA 3ORNA 2XUUA 4MXCA 4YJPA 2BCJA 5DHJA 3WF8A 2YWVA 2HXLA 1KWPA 4GH2A 4O0VA 5AFVA 1XKKA 3PIXA 2B9IA 2JAVA 2IVVA 1FVVA 3TJCA 3M11A 2QG7A 4GYIA 3OMVA 3RPRA 2WMXA 2VWIA 3EHAA 2NRUA 5DOSA 5F9EA 2R0IA 4JI9A 4R3PA 2IW6A 4GKIA 4MHAA 2YCFA 5AP2A 4LOOA 3NPCA 4U3ZA 4YHFA 1NXKA 3C1XA 1YRPA 5CENA 2X8DA 2IZUA 4QYYA 5EOBA 4ANMA 5KMJA 3HA6A 4KBCA 3ZBXA 4U81A 4WIHA 3CSVA 3PSBA 4M69B 4L52A 4BCQA 4ZSAA 4FZ6A 3FZTA 4FNYA 2HY0A 2PY3A 4G1WA 3H10A 2PUIA 3IS5A 5I9YA 4FTTA 1Q8TA 5FDXA 4EBWA 5EQEA 3ELJA 1FQ1B 3FZOA 5AP6A 5D12A 3WYYA 4F6SA 1PRYA 2ITTA 1IG1A 3GCSA 4A4LA 5LMKC 3HMPA 4QP9A 1PF8A 2XH5A 4XMOA 3W16A 4U6RA 2C68A 5E4HA 3KU2A 4ZY4A 3ZRKA 2C30A 3UO6A 3V01A 4JXFA 4KS8A 3HV3A 4FEUA 1MRYA 1ZYJA 1A9UA 3C0IA 2ZV8A 3KN6A 4IFGA 4N0SA 4ZY6A 1MQ4A 2GQGA 3RINA 5LCJA 1IAJA 1OGYA 4IXPA 1CM8A 2RG6A 3N4UA 2CKEA 4YC8A 4QMSA 3FMJA 5AV0A 4WRGA 4IACA 1TZDA 3QA8A 3DZQA 5M08A 5CU2A 4IBMA 3VUIA 2HAKA 1BI7A 1F3MC 3RCJA 3R7YA 5CAUA 1CSNA 3GCPA 3Q9YA 2EXMA 3VS3A 2XIRA 3UJGA 1TQMA 3NIZA 4L01A 1OM1A 4L67A 4C38A 2XEZA 3QLGA 1OKZA 2YAAA 2O3PA 4L7FA 4R5SA 5HO8A 2X81A 3I7BA 4MNFA 1Z5MA 3JYAA 4IVAA 4Y72A 3VNTA 4BBEA 3KB7A 2F4JA 5CSXA 4KIKB 4I92A 4CV9A 3DAEA 4CTCA 5I3RA 3DJ5A 4IE9A 2BTSA 3VUMA 5EK7A 1CMKE 2IJMA 3CJGA 1ZYLA 1XHAA 4AZFA 3GC0A 3KGAA 3PVGA 3QTQA 3LCTA 3FXWA 4F7LA 4PTCA 3S00A 1KOAA 1ERKA 2IZRA 3QRUA 4O6EA 3PY3A 3ZZEA 4I0RA 4QMTA 5M55A 3ZOSA 2GFSA 2ITYA 2B9FA 4G9RA 4IWOA 3ZLYA 4IAZA 5I3OA 2DYLA 4HNFA 2RL5A 4K9YA 1SMHA 2QLUA 5CS6A 5HG8A 2W1CA 2E2BA 1XBBA 2GPHA 2YERA 4I20A 4QDEA 1PXIA 4EQMA 5AUUA 5B0XA 1OBDA 3BCEA 1UNLA 1B38A 2WMUA 4M67A 4W8EA 4QT1A 2HYYA 4FSQA 2X6DA 1JNKA 4MYGA 2VTLA 5FD2A 3ALOA 4YURA 4O7ZA 4HGTA 3WOWA 1NVQA 3A8WA 1Q97A 3G0FA 5FM2A 3QTRA 4KABA 3QHWA 4GK3A 3KF7A 3MH3A 1JAMA 3BLQA 2GTNA 4RIYB 4S33A 4DG0E 2XCHA 2VTPA 4OGRA 4RFMA 1KE7A 4BZOA 4EH6A 3FI2A 3MDYA 2P3GX 1FOTA 4PF4A 1P14A 1GY3A 3G5DA 2JIIA 3ORMA 4MKCA 3V8WA 4E5WA 4IZ7A 5FEDA 3T3UA 4IC7A 1RW8A 2KTYA 3D5WA 3EN4A 4U42A 4Y85A 5EYMA 5FP6A 5TF9A 4UZDA 4EYJA 3VAPA 3I0OA 5CF4A 3UDZA 2W9ZB 5BVDA 4AP7A 4M15A 4IANA 3W0PA 4E6QA 3VBXA 4HGSA 5HESA 1HCLA 3RZBA 3C4FA 2ITPA 4CFUA 3FLWA 4GV1A 2H34A 3BQCA 3AT4A 2F57A 4HPUE 4Y83A 2JIUA 3DDQA 2NNWB 2OKRA 3D7ZA 3HKOA 4EHEA 5CTPA 4BGHA 4QP7A 3RK5A 3U55A 5JGBA 1B39A 2GS2A 3UDBA 3NYVA 4F7NA 1ZARA 3AG9A 4F64A 4EONA 4HYSA 4EBVA 3LXNA 2XCKA 4QYEA 4RPVA 5C8MA 1HCKA 3QAME 3VUGA 2WOTA 4ANOA 1FVTA 4AAAA 1QCFA 2QO9A 2QHNA 2IG7A 4ANLA 4M13A 4TWNA 4BBFA 4M84A 3D7TB 4LMNA 4AA0A 4R3RA 2VGOA 4IQ6A 5EQYA 2YJSA 2WZJA 2VO3A 4RBLA 3W0NA 1H27A 2XBJA 4FVQA 4XBRA 3DZOA 2XK4A 4GIIA 4H1MA 4WNOA 3KMWA 2GNIA 3F5GA 3NNVA 5KE0A 4WUAA 5LVNA 2F49A 1T45A 4ERWA 5CAOA 1YWVA 3U6JA 4FX3A 4TT7A 5CWZA 5AJQA 5DR9A 4J98A 1Y57A 2W1HA 4WNKA 5CSWA 3D5VA 4BI0A 4DH5A 3DGKA 5GJGA 3L9MA 4MXXA 2ERZE 3RWQA 3UO4A 4BZNA 4OUCA 4F0GA 5K0XA 4FG9A 3NR9A 2Q0BA 4MCVA 3VUTA 2VX0A 5IQFA 1DI9A 1PMNA 4FOCA 3AD5A 3NNWA 2FSTX 3D94A 4MD7E 3GNIB 4F08A 4HYHA 1JVPP 2UW5A 3U6HA 2OJ9A 4UWYA 3GU5A 3TDVA 2VUWA 2Y9QA 4PMSA 2WU6A 4L3PA 3RP9A 2C1BA 5DWRA 4CT2A 4QP4A 1YHWA 1YXUA 2WFYA 4GG5A 4Z3VA 2ITZA 2QI8A 1E1VA 2HZNA 2R3QA 3BGQA 5F95A 3GFEA 3QYZA 4FV3A 2XBAA 2JBPA 5HCZA 3VJOA 2PVNA 3MA6A 5F1ZA 3S3IA 4KRCA 3TJDA 4J71A 2BRGA 2O2UA 5KO1A 2XKEA 2CGWA 4AQKA 1XH5A 3TYKA 3IOKA 5EYKA 3LQ5A 3ATSA 2ESMA 3SV0A 5BUIA 4NT4A 4DINA 4IMYA 1BI8A 3BKBA 4TTHB 3QZHA 4CMTA 4F9CA 1YI3A 3CP9A 4JQ8A 4RSSA 4BYJA 5J79A 1ND4A 4WBOA 3NUNA 1J7IA 4FOBA 1Q41A 3OWPA 4DLJA 4MX9A 5ANJA 4F6UA 2FYSA 3UQFA 2PZRA 3KN5A 4EK8A 1YKRA 1FPUA 2VWXA 3FZSA 1V0PA 3RNYA 5AUWA 4EOPA 4YUQA 2X8IA 4RQKA 5JN2A 2O0UA 2W05A 4WA9A 4AOIA 5DPVA 1KV1A 3OVVA 4TYGA 4XG4A 2WD1A 1L8TA 3TT0A 5AR5A 5LVMA 4TYJA 2QU5A 1ZRZA 3RTPA 3CLYA 2G1TA 2OK1A 1PXPA 3ORIA 4X21A 3ZMMA 3KRJA 2LGCA 3HMMA 3OXTA 3BEAA 4O86A 4ZOGA 2XNPA 1H26A 5F20A 5F4NA 3R7OA 4PV0A 4LG4A 3DAKA 5EDRA 1Y8GA 4GT5A 5DRBA 4ZEGA 1FVRA 4FYNA 2WB8A 4M12A 3UC3A 4L9IA 2IWIA 2YWPA 3MFRA 5L2WA 3MGYA 3PA5A 4KIPA 3G51A 3IOPA 5I0BA 3GUBA 3BQRA 4WSYA 5LARA 4BHZA 4DHJA 4RWIA 4FSYA 3VF9A 1WBPA 3DFAA 2OFUA 4BDGA 3BU6A 3PVWA 3VBQA 4MBJA 4E7WA 4HJOA 5KHXA 3SG8A 3ZDIA 4AFEA 3SX9A 2CCHA 4K18A 4AA5A 1JBPE 5KMOA 4M0ZA 4EOJA 1PXOA 2VTAA 3GENA 4ORKA 2ERKA 2E9UA 1CDKA 3COIA 2R3KA 2CHLA 4GSBA 4M68A 3ID6C 3GC8A 4KWPA 4MXYA 3VUHA 2WMQA 2XRWA 2R3IA 1LEZA 1OUYA 3PWDA 1H8FA 5JT2A 2OZOA 3FLYA 2VWUA 2W7XA 4UMPA 2BR1A 1IEPA 3C13A 2GNHA 3C50A 3PA3A 3REPA 4MNEA 3ROCA 5AP7A 5KKRB 2OW3A 4FV2A 4U45A 2PL0A 3DKCA 3WILA 2OJGA 2BFYA 2EB2A 4OTDA 3TTIA 3UO5A 2HW6A 2JDSA 5ANGA 4DGMA 4NU1A 3FV8A 3HLLA 4FKTA 3WE8A 4EH2A 5DYJA 3VWAA 3ZUTA 3KRXA 5A14A 4EH3A 3FYKX 5ANKA 3TNPC 3WZEA 4EC9A 2YIWA 4EORA 4HOKA 5GHVA 4YJSA 1PXMA 3EFJA 1AQ1A 4FV5A 2WMAA 4IAIA 2J0MB 3V6RA 3FMDA 4BCMA 4NK9A 4P90A 5A4LA 5AR8A 3VBWA 1WCCA 4BF2A 4DH8A 4GVAA 5BVFA 1JKLA 1P2AA 4FT7A 2RG5A 3R8LA 3RALA 1OIUA 3G6GA 3MJ2A 4FC0A 3C4EA 3UOLA 4RC2A 4AS0A 4XP0A 4EH7A 5I9XA 1NVSA 2XJ2A 3SG9A 4FIIA 2WQOA 2WTKB 4B8LA 4HPTE 3RGFA 5HHWA 3IDBA 3MVLA 1XH7A 5DA3A 2FA2A 3TNIA 3L9LA 3KULA 5M4IA 5DR6A 3R7VA 4XBUA 3QKKA 4ZIMA 4O7WA 3BU5A 3LFNA 3SDJA 4Y8DA 2X4ZA 4YC6A 3NUPA 1XWSA 5LCKA 4C4FA 4LV5A 1L3RE 4TPTA 2HXQA 3TDWA 2OIQA 3F66A 3GU4A 3PY0A 2DWBA 1H1SA 2A0CX 4CFFA 2FGIA 4DGOA 1IA8A 3BWJA 3NCZA 4BCOA 3SXSA 3O23A 4EOOA 5AUXA 5K9IA 2O5KA 2ZMDA 3PIZA 5ANDA 3UVPA 2VNYA 4F7SA 1VJYA 1YDRE 2JGZA 4V0GB 2PSQA 3C0HA 4RZVA 2ZM1A 2YZAA 4EUUA 3BL7A 5CSHA 4NL0A 4R3CA 4IFCA 1NW1A 4ZTLA 3MPMA 3MB6A 5HVYA 3I5ZA 2BDWA 2OH0E 3RAIA 5B2LA 4YJVA 4O22A 3HGKA 5TE0A 3NFFB 5J8IA 3F2NA 4RLKA 2I7QA 3UQGA 4HW7A 2WTCA 4JG7A 4L00A 4RWLA 3LFBA 5KZ0A 3PE1A 1YWNA 1QPCA 1KE6A 4YJRA 3FXZA 3RPVA 2WKMA 4DTBA 5K4IA 2XK8A 2OF4A 3A7HA 2PMOX 3VBYA 3CQEA 2GFCA 4KIOA 3L8SA 3S0OA 1KE5A 3R22A 2R3OA 3OBJA 4QDVA 2QG5A 3ZC5A 2PVMA 2JAMA 3QU0A 4G9CA 5GZ8A 5L2SA 1V1KA 4R1YA 5CU6A 3GBZA 5CY3A 3R8MA 4JAJA 2ZVAA 5K5NA 1E1XA 3L9NA 3GOPA 2HWPA 3R1QA 4EOKA 1VR2A 3TUDA 2P33A 3BE9A 4XCUA 2CN8A 4FTNA 3KEXA 4U40A 2PZ5A 3Q5ZA 2ZV9A 2VWZA 4DC2A 4OTHA 3VIDA 5AMNA 4HVHA 4GMYA 4O7VA 3WE4A 2UZLA 3AC4A 3HDMA 2Y4IB 1J1BA 3NYOA 4ASZA 1UKHA 3I6WA 3QALE 2YFXA 4X6QC 2XARA 4QMMA 3FMLA 1WBWA 1OB3A 2W4KA 4K0YA 5HLWA 4IWQA 2REIA 1XH6A 2BZJA 2OIDA 5E8ZA 4QQTA 3EQFA 4G2FA 4BICA 4EKLA 5B7VA 2BMCA 4NM5A 1VYZA 3ROYA 2C3IB 4R78A 3TM0A 3A4PA 2BUJA 3OTVA 5C1QB 5A3XA 3LJ1A 5IZFA 4FJVA 2PVYA 2R3LA 4C33A 5DE2A 3VRZA 1OIQA 4A9TA 5AAGA 3IW6A 3C4ZA 4FKGA 3PXZA 4D5KA 2BALA 2EB3A 1FINA 3BYMA 4QTCA 4QYHA 5D41A 4ZTMA 3HA8A 3IW5A 3SC1A 1Y6BA 5LQFA 2J5FA 3DQWA 2VN9A 4AGUA 5IA1A 5JRQA 4NJ3A 1G8SA 3GGFA 4D0XA 3W0RA 4OTRA 2OXDA 3MH2A 1SVHA 1JSVA 3ZC6A 4RJ5A 5HO6A 2IVTA 1ZOHA 3OOGA 2X2MA 3D5XA 5EHYA 4BCNA 1IR3A 1H1QA 4II5A 1O6LA 4AXCA 1J91A 3FI3A 3OCTA 3PE2A 3ZUVA 4DFLA 4FYOA 3T8OA 3AT3A 3LQ8A 3D4QA 3DBCA 4APPA 4DH7A 2B53A 4J7BA 3V04A 3VF8A 4NTSA 4CEGA 4IDVA 3RJCA 3UG2A 2W5BA 3OROA 4DEAA 4QPSA 4RX7A 3FXXA 4XYFA 4BI1A 4RIOA 3BLRA 2VU3A 2Z2WA 3SXFA 3LMIA 4GJ2A 1VZOA 5EW8A 1H25A 4FNZA 4IZYA 3FY0A 2XIKA 2VTIA 3EQRA 4AOTA 3GOKA 2PZYA 4X2GA 5I5ZA 3V5TA 2R3FA 1SVEA 3LCSA 3Q53A 4HYIA 3KK8A 3A99A 2J9MA 4G3FA 5AWMA 4B0GA 5M06A 4PP7A 3DK3A 4ACMA 3ZEWA 3GU8A 3F82A 4Z7GA 3DK6A 4FNXA 3U54A 4BTFA 5HTCA 1BL7A 3NVKI 5LJJA 2OIBA 5B2MA 3CKWA 4BYIA 3WF7A 1OGUA 3PYYA 4NW6A 5ANOA 4E5AX 1V0BA 3KXHA 2XM8A 3R8VA 2Z7QA 3QCXA 4IM2A 4NYEA 2PE1A 5LXMA 1W82A 3FLSA 2QO7A 5HEZA 2O64A 3DY7A 1W2DA 1O6YA 3FC2A 4MF0A 3UPXA 3RZFA 5G6VA 4D55A 4ZZNA 2VX1A 3EQPA 4E3CA 1ZZLA 2YCQA 4N4SA 1H00A 3RPOA 3AMAA 1UWHA 4APCA 4JNWA 4QMNA 2Z02A 4IZ5A 3OFMA 1WBNA 3CE3A 3R7EA 2YLFA 4FTKA 4M69A 4EQCA 4NIFB 2Q83A 5M07A 1OECA 4EOMA 1UU9A 3TACA 1GNGA 2FUMA 3R30A 4CNHA 3AMBA 4U5JA 2WQNA 3E8EA 3HECA 4UEUA 3SW7A 4C3PA 4H3PA 2CLXA 3KKVA 4AN9A 3W2RA 4AXDA 4MUQA 4OLIA 3T9IA 2UW7A 3Q3BA 3II5A 4F6WA 3I0QA 4P5QA 2W96B 2F7ZE 1WBOA 4NFMA 5EM7A 2C6IA 4ZTNA 2JEDA 3NDMA 3BBWA 3OG7A 3P78A 2PUUA 2RFEA 4L3JA 1GIJA 4OR5A 4W9XA 3QTUA 4FSRA 5AP3A 4I23A 3HX4A 4IX5A 1H0WA 3COHA 4E4NA 4PRJA 3A7GA 4IADA 3ZFYA 2YM4A 2ZDUA 3TNHA 3A7FA 4K77A 3W0MA 4FUXA 5GINE 3UQCA 4FSZA 4ERKA 5HLPA 2Y8OA 5DIAA 5HIDA 2ZAZA 1Q3WA 4IM0A 4PUZA 3SOAA 4ZMEA 5EOLA 2C1AA 3Q96A 3AXWA 2PVFA 3G90X 4DG3E 4O4FA 2OSCA 3POOA 2YM3A 3PP1A 4FF8A 4FTMA 3ODZX 2Z7SA 3JS2A 5E8YA 3UYTA 4EH9A 2WTIA 3IDPA 5TO8A 1FMKA 4AA4A 2YACA 4BCGA 2PVLA 5HORA 5HG7A 4BN1A 2WMBA 1P4OA 3FHRA 3FZRA 4RVTA 4D1ZA 3ZU7A 1J7LA 3EL8A 4KIKA 4QP6A 5JKGA 4DF3A 2XIZA 4PX6A 2HIWA 4RVKA 3TKUA 3V5WA 4TNDA 3W33A 3KCFA 4OT6A 5C26A 4R7IA 3QCYA 4RX9A 4O96A 3LFSA 3MESA 3D14A 3JY9A 3PZHA 4JX7A 3SGCA 3U4WA 2W4OA 4FTQA 2VTOA 5HNGA 3PRFA 4BDAA 4FL2A 4KD1A 4DHZA 2BRNA 3A8XA 4KSQA 2VX3A 3VQHA 1RJBA 4DCEA 4EZ7A 3DV3A 2W1EA 4RZWA 4MQ1A 1TVOA 4AW2A 2CCIA 4W8DA 4CZTA 5M44A 2GQSA 2UUEA 5BVWA 4QMVA 5KHWA 3FBVA 3LFCA 2JITA 4M97A 4YO6A 3U51A 3UZRA 3VN9A 2C3KA 4AXEA 4M66A 3TZMA 3W32A 1VLRA 2X1NA 4KKGA 4RIWB 4ITIA 2V55A 4FSWA 2EUFB 4CCBA 4KA3A 5AM6A 1JOWB 2A1AB 2WQMA 2GSFA 2HZ4A 3F88A 4IC8A 4P5ZA 4DGNA 3AKJA 1JKSA 2BAJA 5JQ5A 4FZAB 4RIYA 4YJQA 5FRIA 1JPAA 3HAMA 4HYUA 2OU7A 3BHYA 4RX5A 4QQ5A 3W0OA 2YLEA 4XJ0A 2X0OA 5DRDA