5AA9A

Structure of l1198f mutant human anaplastic lymphoma kinase in complex with pf-06463922 ((10r)-7-amino-12-fluoro-2,10,16-trimethyl- 15-oxo-10,15,16,17-tetrahydro-2h-8,4-(metheno)pyrazolo(4,3-h)(2,5,11) benzoxadiazacyclotetradecine-3-carbonitrile).
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
309
structure length
295
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLEFMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title Resensitization to Crizotinib by the Lorlatinib Alk Resistance Mutation L1198F.
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 295
sequence length 309
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5aa9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5aa9A01
3OOMA 5C8KA 2QI8A 3LIJA 4BCJA 3RGFA 1OL2A 3DB8A 3CBLA 5EDQA 3D2IA 3VBWA 4EKLA 4F9AA 4FZFB 5AUXA 3FMKA 4C34A 3KK9A 3Q4CA 4HZSA 1RQQA 3NW6A 2ZM1A 5K3YA 1PXIA 5FM2A 2IW9A 4GS6A 2HXLA 1YWNA 2ZM3A 4DBNA 2VO0A 4DLIA 1ZMUA 4DEHA 2CCIA 4IEBA 3IW7A 3VHKA 4PL3A 4M69B 3M2WA 3AMBA 5DGZA 4O0VA 5JSMA 4GSBA 3NX8A 4QP7A 4D0WA 2CKPA 4IX3A 3FL5A 3NVMB 5BPYA 4RC2A 3C5IA 4BKYA 4N0SA 5D7AA 5HE0A 3PIYA 4O0TA 2RF9A 3WZDA 4GFOA 4N70A 4AG8A 3NVKI 2XBJA 5DPVA 4F9WA 2C3JA 1NVRA 1UWJA 2J50A 3AC1A 3GEQA 5J5TA 5HO6A 1J7UA 5J1VA 2GNHA 1YHSA 2ITWA 3QQHA 4ENYA 2QO2A 4I93A 4QYHA 3W33A 3PVUA 2CN8A 2ITZA 2WU7A 4HNIA 1OIYA 4YJRA 4QMPA 3RALA 2R2PA 3DV3A 2BRNA 2CDZA 3SDJA 3NUUA 3A4OX 3TT0A 4M68A 4D58A 3DXPA 3ORTA 3TNPC 3VULA 2ITYA 4YU2A 4AWIA 2OXYA 3WYYA 1OUYA 3PJ2A 5E92A 2QOIA 2I7QA 4J7BA 4QPAA 1UA2A 3QX4A 2PUIA 3OVVA 3DJ7A 3EFLA 3DU8A 3TNQB 5AWMA 1P14A 3O8TA 4WSYA 2BKKA 2YHVA 4LV5A 3HVCA 2XJ2A 2B4SB 5C4LA 1QL6A 4XJ0A 3B8QA 3O0GA 2WMUA 3MFTA 4XCUA 4WBBB 3PXFA 3ZBXA 3I6UA 4KD1A 2G2FA 4F7JA 4AW5A 2EXMA 1PXOA 3A8XA 3R9OA 4G6LA 2BAQA 4GV1A 3R04A 4YZCA 2OKRA 3QTQA 1YXVA 2R3OA 1DAYA 4U40A 5HIEA 1UU8A 4CV8A 5ANEA 3PA5A 2W1GA 2BFXA 3O50A 3ENHA 2OIBA 2IW6A 3LFEA 5HBEA 3DA6A 3V3VA 3COKA 3KVXA 4UMTA 5CU3A 1TQPA 5E8ZA 3RAWA 4DT9A 4QP8A 3KN6A 4DGGA 4KRDA 2XRUA 3GI3A 3QQKA 3BU6A 4JR3A 2WMWA 4X3FA 4XP0A 2J4ZA 3IG7A 4ZZMA 5LVLA 4AOIA 5HCYA 3PVWA 3ZO3A 3VBQA 3BZ3A 2GQGA 3BI6A 3DZOA 4FTIA 2E9VA 4EORA 4FTLA 1KOAA 4FTUA 3KA0A 4MXZA 4BL1A 3A60A 4FG8A 2DYLA 4P5QA 1PY5A 3R2YA 4PDOA 4U7ZA 3KREA 3TZ8A 4DCAA 3UPZA 3D83A 3ODYX 4USDA 5IUIA 4FA2A 5IA3A 3U55A 2QHNA 3OTVA 2C3IB 4F6UA 1T46A 3UPXA 4AZFA 1O6KA 4DGMA 3A61A 3LFDA 2W1DA 3R9DA 3WI6A 4IIRA 4TNDA 3ZDIA 5HO8A 4E73A 3F3WA 3BE2A 3FMLA 3D9VA 5CEOA 3AC2A 3DT1A 1UV5A 2VGOA 3BHUA 3HAMA 2QR7A 2O63A 2VX1A 3LCDA 4MBIA 3ORIA 2F49A 2P55A 2KULA 3GCVA 4L42A 1BKXA 1OBDA 2VNWA 1H0WA 3ATTA 2XBAA 3DAKA 1J1CA 3RZFA 4BIBA 4QTDA 5CT7A 3CQWA 4APCA 1ERKA 4E1ZA 3UP7A 4BGHA 5IH6A 4KUJA 3T8OA 1OECA 2B55A 3GU5A 4MXCA 4PDSA 3TKHA 3ZLSA 5FUTA 4F4PA 3A8WA 3A7FA 2BZJA 1OZ1A 4D1ZA 5GJGA 4XLIA 2XF0A 4OAVB 1R3CA 3LM5A 4FT9A 4FTTA 4BCIA 2GTMA 2WIPA 4DG0E 4TYGA 1G8AA 3W2OA 4U8ZA 1Q8ZA 4C3RA 3QZFA 4V01A 2V7OA 5CALA 3BLHA 3P1AA 4MCVA 5AAGA 2PZ5A 4EWQA 4YC8A 5TR6A 4DT8A 3MBLA 2C30A 3QUEA 3E8NA 2ITPA 3UMWA 5H3QA 3OY3A 4BIDA 2WXVA 4WD5A 4BCKA 4QMMA 4J71A 4GRBA 5DA3A 4DHFA 3L9PA 3V6RA 1GJOA 3DAEA 2W5AA 5HKMA 3RWQA 3ATSA 3HEGA 1OITA 3TDWA 3VO3A 3T9IA 5IKWA 3D94A 5AR3A 3PG1A 3QCXA 2OH0E 4R1YA 1XH5A 3V5JA 1I09A 4BBMA 3SGCA 5M56A 5AUWA 3PRFA 2J5EA 3RTPA 2CSNA 3PJ3A 4KBAA 5M4IA 3LKMA 1H08A 2ETRA 4OBOA 1Q8TA 4PNIA 3V04A 4FODA 4EQMA 1UU7A 3FQEA 3TZ9A 3KMWA 3U9CA 2OU7A 1J7LA 1WBSA 3BV3A 3WE4A 3G15A 3MB7A 2OO8X 3R7YA 2QHMA 4O7NA 4DA5A 4XOYA 3H0ZA 3E3PA 5AR7A 2GS7A 3DDQA 3QQJA 4NKSA 4HW7A 4GMYA 3A7IA 3RMFA 3RHKA 4S31A 1P4OA 1ZYCA 4FG7A 1FGKA 5BQ0A 3QRTA 1OL5A 2CGWA 5GIOE 2FSLX 5DHJA 4EUTA 3R8MA 1JKLA 5KZ0A 2WQEA 3R21A 4TXCA 1PJKA 3NNVA 4XP2A 5L6PA 2XA4A 1YOMA 2XB7A 3ZC5A 2XK9A 3QHWA 5IQHA 5E8UA 3FI8A 2VU3A 4CYJA 3RM6A 5FXSA 4WIHA 2XJ0A 5H8GA 3TXOA 4F6WA 3KCFA 2OF2A 2QC6A 4M84A 4CKRA 3DNEA 1Q99A 1KV2A 3OT3A 4H3QA 4AT3A 4GYGA 4MQ2A 5LARA 2BAKA 5J95A 4AE9A 4EI4A 3D4QA 3E8DA 2CNVA 4TWNA 1HOWA 4Z9LA 4CZTA 5AP3A 2XM9A 4C7TA 4BDCA 4O0XA 3N4TA 3QXOA 2OJGA 3TI1A 2GQRA 4WBOA 3B8RA 2JEDA 4GK4A 4I4FA 2YLEA 4V05A 4MQ1A 4RVLA 2BDFA 3FZRA 4O6LA 2WTDA 2GCDA 1RDQE 4BI2A 4W8EA 2IZRA 3TWJA 3L8SA 5HU3A 2YDJA 4KABA 4QO9A 4AZWA 2DWBA 5CYIA 3FMEA 3MESA 4DFYA 3RPOA 3R9NA 4LQMA 4R1VA 3TV7A 1V0OA 2R5TA 1OPKA 3MVHA 4IX4A 2PY3A 2GS6A 4FTCA 3W2PA 2JC6A 4ANSA 2OG8A 3EMGA 5KHXA 4ZSLA 3TTIA 2H6DA 3G90X 5ANKA 2C5YA 4RJ3A 4YNEA 3F3VA 5FLFA 4BKZA 4YJOA 3FQSA 5DBXA 3WF7A 5EYMA 4CCUA 5HTCA 1F3MC 1XH4A 3FLSA 5L2TA 3KXGA 4IVBA 1YOJA 3PXRA 4XG4A 4Y5QA 3RVGA 3EZVA 4OTPA 5FP6A 3ACKA 2QU6A 3MPAA 1E1XA 4FIEA 4I1ZA 4E93A 1H1QA 3MB6A 2I0EA 4QP9A 2X1NA 3PXQA 3ZXZA 1XBAA 1KSWA 4ORKA 5EQEA 5HVKA 5L8JA 3CTHA 5E91A 2ZMCA 1Z5MA 4EYJA 4X2KA 3MA3A 4FKOA 3DS6A 4LOOA 4MKCA 3G33A 3LXKA 5ANGA 4FK6A 3UOLA 4EK4A 1JPAA 4FV2A 3ZLYA 2XEYA 4BDBA 4QMYA 4O7TA 1JOWB 5EM7A 3HMOA 3RHXA 5I3OA 4RJ5A 4D2VA 4AUAA 3PTGA 4JX7A 3RPRA 3V5QA 2ONLA 2A4LA 2RG5A 4FSWA 4GH2A 3BU3A 4J98A 4N4SA 3KULA 3G9LX 4EEVA 4EH4A 1MUOA 5JK3A 1KE5A 5LMKA 1DM2A 1H1PA 4Y95A 3C4XA 1H24A 5BUJA 3MJ1A 4O21A 4JR7A 3ALOA 4HGEA 1NVQA 1YI3A 2P0CA 4BCOA 4DH7A 5HX6A 4R77A 5CT0A 5HE2A 4BZDA 4TRLA 4JRVA 4LFIA 4DAWA 1JKSA 5L6WL 3KEXA 3Q5ZA 4G6NA 5T3QA 1OKYA 3LMGA 4GU6A 2WO6A 3WIKA 4FV3A 1PXPA 5KE0A 5IQIA 3VVHA 5C8MA 4KIKA 4ASXA 4ZTMA 2WMVA 4MD8E 3F2RA 2UW9A 3PLSA 1W0XC 4AACA 2UZLA 4D4YA 4FZ7A 2WZJA 1FMKA 3EKKA 4I5CA 4BCGA 2QCSA 4QYEA 4EH8A 5CAVA 3VS1A 1OIUA 2UW7A 3E88A 3OCBA 4EOKA 3C5UA 4PTGA 4EH3A 3F7ZA 2F7ZE 4R7HA 2V0DA 4H58A 3ODZX 2YLFA 4XBUA 3PY3A 4HZRA 4JL9A 3ZU7A 3D5UA 3LLTA 1KUTA 4YTIA 1Q62A 4ZAUA 2OLCA 2YJRA 1WBWA 3CD8A 4QP6A 2QNJA 4MF0A 5AIKA 4I23A 1CM8A 2PMIA 3I6WA 3F3UA 4K1BA 4CTBA 4RA5A 3N4VA 4FOBA 5EI2A 4FV9A 3VUGA 4XP3A 3Q53A 1NA7A 3PXKA 4CV9A 3RCJA 3L9NA 1JAMA 3MJ2A 3NEWA 5F1ZA 5CF6A 3ALNA 2JKMA 3Q4TA 4ITHA 2O5KA 3QUDA 2XNPA 4XG8A 2ITOA 5EM5A 2CLXA 5EW8A 3ZHPC 4IFGA 4E3CA 1PKDA 4GIIA 4RIXA 2A0CX 3ULZA 3F5PA 2X6EA 4IBMA 3RWPA 4WOVA 1X8BA 2O0UA 5D10A 5M53A 4GEOA 3BHHA 3MA6A 3S2PA 4O38A 1YXUA 5CEKA 5BUIA 3M11A 2IW8A 3NW5A 3PJ8A 1ZRZA 4UB7A 2QR8A 3MW1A 4HCVA 4R7IA 3I0QA 3P5KA 4CT2A 3R1YA 4O0UA 3U87A 2R7IA 3I7BA 3Q04A 4XS2A 5LOHA 3ZRKA 4JOAA 2YDIA 3W55A 2W96B 2HY0A 4KIOA 5EG3A 3FV8A 5CZHA 5AEPA 5TE0A 3V8WA 5LVMA 3C1XA 2SRCA 3JUHA 4JDKA 4NZWB 1SVEA 3DFCB 3R7IA 4Q5EA 3ZUTA 2BPMA 4IE9A 3W2CA 5L2SA 5AUYA 3F9NA 3PWYA 3VJOA 4NH1A 2VTSA 3AXWA 4ITIA 1H0VA 4K11A 3F5UA 4FEXA 1WBOA 2X6DA 5JZNA 5DWRA 5FXRA 1ZOGA 4O81A 3VQUA 4FKSA 1QCFA 3V5TA 2R0IA 1PXKA 3REPA 4UZDA 4GYIA 3L9LA 3DKGA 4CFMA 4M7IA 3TNWA 2NP8A 2CGUA 3HV4A 2HYYA 2J7TA 4X7QA 3T3UA 4C36A 3LMIA 2FH9A 3VQHA 4RWJA 3U51A 3NWWA 1CDKA 5CNNA 3F5XA 4DH8A 5CEMA 4O83A 3LLAA 3VUIA 4EL9A 2PMLX 2UUEA 4LGHA 4EJNA 5I9YA 3OTUA 2X0GA 3QX2A 5DE2A 3ZM9A 1B6CB 3LCTA 4FBXA 3SRVA 2VTPA 4MBJA 2W06A 4F64A 4FV1A 4ONAA 4KS7A 3TNHA 5IG1A 4BWXA 3GC9A 3RAKA 3BGPA 2PVJA 2OJFE 1ZY5A 3H10A 4JT3A 3SX9A 3WZKA 2J0KA 1Q5KA 4FSQA 4K8AA 4BCPA 4UEUA 1DAWA 2QKRA 5M09A 1H28A 4IZAA 4UMRA 5IDPA 2C69A 4RJ7A 1IG1A 3VS0A 2VWYA 5L4QA 5FEDA 1JKKA 5BVWA 5HNBA 3SAYA 5EQPA 4JS8A 1M2QA 2BUJA 3HMMA 5ACBC 5AADA 3IS5A 4H36A 3R8ZA 3UC3A 4DITA 3OC1A 3HV7A 3IGOA 3F69A 3OFMA 3E7OA 3OXIA 2JAMA 3LFFA 1UWHA 3CY3A 1OPJA 2C3LA 1XHAA 4OGRA 5JRQA 3NMUF 3DTCA 4RRVA 2Y7JA 1WMKA 1Y6AA 4GKHA 5DFPA 2PU8A 3IONA 4YO4A 1XBCA 4NKAA 3VBVA 3PE1A 4L53A 5LCJA 2QVSE 4IM0A 4YZBA 4U3ZA 1MRVA 2XS0A 4MXOA 5AJQA 3D5XA 5EI6A 2R3RA 2GHGA 3I0OA 5DYJA 1PXJA 4JI9A 3ZLXA 3R02A 1WZYA 3VRYA 5K5NA 4YUQA 4S30A 1GZOA 2WTIA 3SOCA 3P7CA 2C5VA 1KE8A 4G3FA 3R83A 3BHYA 4TWCA 3JR1A 1V0BA 2R3NA 4GG5A 4RZWA 3CPBA 2HZ4A 1HCKA 4G9CA 1Q3DA 1QPEA 4RX7A 4UWBA 2XYNA 4Q5HA 3DB6A 1IASA 3ORLA 1S9IA 1FGIA 4NM3A 4W9XA 3SXRA 5L8LA 5J1WA 4PTCA 4RIOA 3H4JA 2AUHA 4MVFA 4PPBA 2VTTA 4BTFA 4D4SA 5M51A 3ITZA 4B99A 2XIRA 4ZTQA 5A4EA 4CD0A 3WF9A 3C13A 4CFXA 3PSDA 4D2WA 1JVPP 2UZTA 2W5BA 3MPMA 3AMAA 4MF1A 2I40A 2JGZA 2PK9A 3ORMA 3RAIA 3LAUA 5T6KA 3HV5A 3G9NA 1W84A 4AAAA 2A27A 2G9XA 4WO5A 5CLPA 4AF3A 3CP9A 4F7LA 4ZTSA 3TIYA 2XNEA 5IA2A 2XNMA 3EFWA 4L6QA 2ZOQA 3MH1A 5M4CA 4LI5A 3FAAA 3BLRA 3PFQA 4D1SA 4ALWA 5H8BA 2V7AA 1BL6A 4FF8A 2PUUA 4RIWB 4FNXA 3HX4A 4FSYA 1J91A 5EDPA 5TO8A 5AAFA 1V0PA 2BROA 4X2GA 3LXNA 1TVOA 2XIYA 4MNEA 3DY7A 2HELA 3MS9A 3RI1A 4RPVA 4BI0A 1U46A 3GNIB 4PQNA 5EYKA 3ZXTA 4NU1A 1QPCA 2C5XA 3A99A 3KMUA 5CVHA 4FKTA 2JFLA 4BR3A 3LW0A 5K0XA 3EB0A 2QG5A 2YCSA 5DEWA 4HVGA 4O7YA 4QRCA 1GZ8A 4TYHB 2PMOX 3E62A 2FGIA 3A4PA 2WEIA 3K2LA 5E8SA 2J5FA 3R6XA 5FGKA 3UZTA 4ZS4A 4JQ8A 4HOKA 5J7BA 3F3ZA 2QURA 1PKGA 4RSSA 4V04A 5F9EA 4IB1A 3THBA 2O65A 2Y8OA 4BF2A 3KRXA 3R8VA 3PZEA 1SNUA 2XK6A 3ORZA 4M69A 5EYCA 3PXYA 5J87A 4K2RA 3TIZA 4JNWA 3GQLA 4C62A 3ET7A 1BI7A 4CSVA 3HUCA 4FTOA 2GFCA 3LCKA 4C3FA 4OBPA 5FG8A 4FV7A 3QTXA 5IEYA 4IJPA 2PUPA 3ID6C 2I0VA 1CKJA 3MV5A 4RX9A 4U81A 5DVRA 3PDTA 5J79A 4EOQA 3KY2A 3AD6A 3HLLA 1H4LA 3D7TB 2BVAA 3T3VA 3HP2A 2Y0AA 2JDTA 4ZSJA 5HTBA 4AXAA 2PVYA 3CKWA 3KXZA 3CQUA 1JWHA 4JAJA 4YHFA 3ZO1A 2Z7LA 4GVJA 4QP1A 4ZZOA 4IAFA 2FSOX 3FLWA 5IQCA 3RPYA 4FV5A 1LEZA 3FC1X 5CSVA 3VIDA 3BV2A 5LMAA 3PP1A 3D0EA 3PPJA 4MHAA 4UMQA 4O6EA 5G1XA 5FP5A 3SOAA 5BUEA 2WTCA 1OL6A 4WRSA 5AM7A 3O8PA 3O51A 4AN3A 5DR6A 4F63A 3CC6A 3QXPA 5IISA 4BY9E 2VWBA 4W9WA 5HNGA 3P7AA 3QQGA 3UC4A 2HWPA 4NL0A 3F2AA 1G3NA 4AW0A 4PTEA 2V62A 1OKZA 1Q24A 2B54A 5EK7A 4NM5A 3VN9A 4GJ2A 4BBEA 4F9BA 4F1TA 4NM7A 4A4XA 1M7QA 1FVTA 1FVVA 2AC5A 3R01A 2VWZA 3BQCA 4XH6A 5AUVA 3DXQA 2FSMX 5TF9A 4I6BA 1PF8A 3PSCA 3HAVA 2QQ7A 2NPQA 3F61A 1XH8A 3A7GA 3NAYA 2OXXA 4J8MA 4CFFA 3C4FA 3LCSA 3HP5A 4YZ9A 4WT6A 3ZM4A 3LFAA 5CWZA 2R4BA 3TZMA 3QWJA 3SW4A 2HAKA 4ANNA 2RL5A 5DNRA 4B7TA 2BFYA 4FYOA 3VS4A 4C58A 3H9RA 2R3JA 1P5EA 1Y8GA 4W4YA 3SLSA 2O3PA 3FKOA 4YJNA 4O7VA 3NZ0A 3ZYAA 2XK4A 3ZH8A 2V22A 5E8VA 3LMHA 3UOJA 3EQIA 2BKZA 3QCSA 4NTTA 4WG4A 5DG5A 2CGVA 4QTEA 5IU2A 2ZV8A 3R0TA 3NUSA 1PXNA 3OG7A 4ALUA 2I0HA 3FZ1A 4D2TA 4YJVA 2ETKA 4JG8A 4F09A 1CKPA 4FT0A 4IWQA 1U4DA 3EYGA 4QTAA 5GINE 4YP8A 3FMNA 4RJ6A 4IM3A 2XYUA 4O96A 4Y85A 4QQJA 5KX8A 3QTZA 1U59A 2XMYA 3PE2A 3OD6X 4YJTA 5C27A 4BCFA 5KCVA 4U43A 4LG4A 5AP1A 1ZARA 2WMBA 4BHNA 2R3HA 5E8WA 3VUHA 1XH6A 4IAIA 3VC4A 5HG7A 4MWIA 5D41A 5GZAA 2XRWA 2YM6A 2PE2A 4ANQA 4BDJA 4BWKA 3N51A 3NCZA 5CAUA 3DLSA 3P78A 3QAME 3H0YA 3BLQA 4LV8A 4BTJA 4DH3A 4E8AA 2XNNA 3CSVA 3EQPA 4JQEA 4HYUA 4QNYA 3TN8A 2O64A 5AM6A 5CEIA 3RPVA 1PW2A 2UZUE 3R71A 3OWJA 4FG9A 4L3PA 4YTHA 1OMWA 4F1OA 1JQHA 4FKRA 3OY1A 5M06A 3FXWA 5HHWA 2C6LA 4IAKA 3LQ3A 4E5WA 2YIXA 3UYSA 3O7LD 3E93A 3LFSA 3W1FA 2ERZE 3D5WA 3AQVA 3CE3A 3CR0A 4LRJA 2QOQA 2AC3A 4ZTHA 4JBPA 4HVIA 4YJQA 4UBAA 1IR3A 4ANMA 1BI8A 4C4HA 2PVNA 2CMWA 2W4JA 1M7NA 4ZLZA 1AQ1A 1IA8A 4BTKA 4QPMA 3BE9A 3AGMA 3E8EA 2YITA 5DN3A 3WZEA 2EWAA 2JLDA 3KU2A 4D2PA 4FSRA 1SNXA 4EOSA 5BVEA 3R1SA 3W2RA 3P79A 2CKQA 4FVQA 4FIFA 4L43A 2BRHA 2ITQA 1QMZA 3NDMA 4JQ7A 3F6XA 3VBTA 1VR2A 4DLJA 4IH8A 2A19B 2J90A 2Z7RA 5AUZA 5HBHA 3WF5A 5JFSA 5EW3A 4AW1A 4HVSA 1OVEA 1Q97A 2Q0BA 4FC0A 4P5ZA 5GNKA 5EKNA 1IAHA 2NO3A 3KRLA 5DIAA 5JKGA 3FKNA 5HCZA 5CF8A 3QTSA 4JDIA 4H05A 1R0PA 4FIHA 4X2JA 3FXZA 4E4NA 4XOZA 4ERKA 2ZV9A 1BMKA 4XRLA 3QGWA 3VNTA 3UE4A 3PWDA 3LFQA 4YJPA 4I5PA 1REJA 2OH4A 2OXDA 2ZV7A 3PA3A 4RWKA 4X3JA 5IQAA 3ZCLA 3QLGA 2GFSA 3POOA 4C57A 4ZXTA 2YCFA 2OWBA 3TACA 2YZAA 4DGOA 4G17A 3CQEA 1WBVA 2Q0NA 4N6YA 5KZIA 2HW7A 1A06A 2WQOA 5HQ0A 5AUTA 4W4XA 5HICA 3FY2A 4NW6A 4R3RA 5ETFA 3V6SA 2R3QA 5CSXA 4O1PA 5IDNA 4G5PA 4UYAA 2W0JA 1U5QA 4XX9A 1E1VA 3MI9A 5HORA 5C1QB 5L2QA 3FMJA 4O7ZA 3ZO2A 2HENA 2XZSA 4UV0A 3QUPA 2UV2A 3FUPA 4BDAA 4P4CA 4GL9A 3E3BX 2BHHA 3Q9XA 5CAOA 5I9VA 2JD5A 1JKTA 3GU7A 3IW6A 4IDVA 2VWIA 4A9TA 1HCLA 3KCKA 2ITTA 2ZMDA 4QP4A 2CGXA 1PRYA 5LVPA 2F7XE 3AT2A 5K0KA 4BC6A 5LVNA 4EZ5A 3VHEA 3KMMA 4AFJA 5F94A 4F70A 2W1EA 2BRBA 2WQNA 3KF7A 1TQMA 2HW6A 5LCKA 3SC1A 4FUXA 3S4QA 4AW2A 2OBJA 2VTAA 1KV1A 3CY2A 3KL8A 3SW7A 4YHTA 2BILB 3FKLA 5E8TA 3D15A 3V01A 2BTRA 3PVBA 2BR1A 4O2PA 4QMXA 4WNKA 4YHJA 4DEIA 4A9RA 2XNGA 4YNOA 2FVDA 5AX9A 1PMVA 3CGOA 2G2HA 3TZ7A 2XIXA 3UOHA 4KKHA 4A4OA 4QMNA 5KMNA 4BZOA 1WCCA 3AGLA 3I4BA 1ND4A 2B9JA 4I5MA 4FUYA 5AV3A 1ZAOA 3DCVA 5C03A 3RNYA 1H26A 4AN9A 5JEBA 4YO6A 2HY81 3M1SA 3Q9YA 4QMQA 5KUPA 2IZTA 2P3GX 2Q83A 2NRUA 5A4CA 3CGFA 5AMNA 5K5XA 4QP2A 5AR4A 4E20A 4BCHA 1RW8A 3QZHA 4J95A 4E4XA 3S0OA 3DJ5A 4R3PA 2GNIA 3R7UA 3IO7A 1BUHA 4FKIA 5CAPA 4JBQA 2C0IA 2FSTX 1CKIA 3OT8A 4IVCA 4EH6A 2F2CB 4NYEA 2IJMA 3AC4A 3PZHA 5HBJA 4WA9A 4ZLOA 5J5SA 4PP9A 5HD7A 4L68A 2IWIA 2R3LA 1H00A 2LAVA 4CKIA 3P86A 4L7SA 4CNHA 5BMSA 2X4ZA 4W4VA 4YBJA 4FKWA 3EN7A 4OTQA 4DTAA 4IZ5A 2YM5A 3OW3A 2J2IB 5F4NA 3HNGA 4I94A 3BYUA 2CN5A 2UVZA 4HVHA 3UYTA 4LM5A 4QQCA 1SVHA 4I92A 3ERKA 5I5ZA 1GZNA 3SG8A 3VUMA 5CI6A 4I0SA 5GJFA 4IWDA 4E4LA 4JRNA 5EQYA 2OFVA 3MFSA 4IWPA 4EOLA 4W4WA 3MH3A 4ZK5A 5FDPA 2QONA 3FHRA 3GGFA 4RVMA 5K4IA 4ZOGA 2B1PA 3EQDA 4FV0A 5IQFA 3FMDA 3O17A 2Y4IC 3LFBA 4FKLA 4LGDA 5EKOA 5CU2A 5KMOA 3DAJA 3VW8A 4FTAA 4IACA 4F0FA 3H9FA 3G2FA 4FSUA 4KIQA 4NIFB 1H1WA 3CS9A 2WQBA 4I41A 2PULA 4RLKA 4NFNA 3EQRA 3O7LB 4U5JA 4JDHA 3ZUVA 2FO0A 4BDHA 3KRWA 3V5PA 5JT2A 3VAPA 2ITVA 2C6KA 4EH9A 2BIYA 2H34A 1U54B 5BVFA 3R63A 4GT3A 3QKLA 4CXAA 3Q32A 4FVPA 5TT7A 5IH5A 4EZ7A 2XK3A 2GHLA 2VD5A 5CX9A 3CJGA 4I6FA 4O84A 1M17A 4IXPA 4C38A 3SVVA 2ONLC 4FOCA 3OF0A 1XH9A 3I60A 1ZYDA 3FMMA 4HPUE 4MYGA 4X6RA 5FXQA 2UW5A 3IGGA 3KXHA 3POZA 4OTRA 4F1MA 2VTRA 4DEEA 3DPKA 4Z3VA 3QBNA 3GC0A 4K77A 4O1OA 5A6NA 4AGUA 1H25A 4M0ZA 3UDBA 2XP2A 4OTFA 3JY9A 3GU8A 3VJNA 3DJ6A 1NY3A 3DK7A 4HYSA 1XKKA 1ZXEA 2UZOA 5C01A 3TJDA 5HNIX 4MBLA 2LGCA 1PYEA 3C4ZA 4MWHA 4EOMA 5CASA 1O9UA 2PZPA 3ZZWA 2JDSA 3DBCA 3DK6A 4QMZA 4YTCA 3Q2JA 4FT7A 4A9SA 2C0TA 2FUMA 4OTWA 4DG3E 4CFUA 1KWPA 4EJ7A 4UMPA 3CIKA 3QRJA 3U6JA 2XVDA 3KGAA 2C68A 4DTBA 3LFNA 2WMQA 3ORNA 4F6SA 2UZNA 4GK2A 2Z02A 4E6CA 4UXQA 3DKCA 3ETAA 4BDIA 1PMUA 1V1KA 3BBTB 3EQBA 4FGBA 4M66A 3ZTXA 4CEGA 2FYSA 4AE6A 2PVLA 3EL7A 3NLBA 2YAKA 3NYNA 4AGDA 2UZVA 3R22A 4RC4A 2W17A 1JSUA 4YURA 4TNBA 3DDPA 3HKOA 3NAXA 3CTJA 3K54A 4Z16A 5CF5A 4GG7A 5HVYA 3PP0A 4FK3A 1OI9A 3K3IA 1ZWSA 3Q4UA 4V0GA 2EB2A 1Z9XA 4EHZA 5I9WA 2VO6A 2UVYA 5JFWA 3C50A 4ERWA 4CMOA 3CJFA 3MFUA 2ZB0A 3ZDUA 4ALVA 2YN8A 2OJIA 3FLZA 2PVHA 4ZZNA 4EHVA 2IVTA 5LQFA 1FMOE 1ATPE 2X4FA 2PPQA 5HCXA 1SMHA 3RK7A 3R9RA 3W18A 3KVWA 1OL1A 3G6HA 4IMYA 4TN6A 4FL2A 4B0GA 3ZONA 5GZ9A 2PMNX 4B4LA 2C6MA 4UN0C 2PL0A 2VTLA 4LMUA 1DS5A 5KBRA 5CAQA 3DNDA 4C4FA 2R0UA 3KXXA 2YISA 4IX5A 4IZYA 3C0HA 5DOSA 2WQMA 1PMNA 4JDJA 1BYGA 3OEFX 5FWKK 3ZEPA 3PJ1A 5DMZA 5E9EA 3BIZA 3K5UA 2R3GA 3RBWA 2JKKA 2WNTA 2WEVA 4G1WA 4U42A 4D28A 5C26A 4CZUA 4YZNA 4U79A 2Y4IB 3R9HA 1B38A 3PUPA 2KTYA 4X21A 4BRXA 5JFXA 5L3AA 2CHLA 1G5SA 2WMTA 2ZB1A 4HGTA 4G5JA 4F65A 4X2NA 3PXZA 2PYWA 2XM8A 3GOPA 3V51A 1E9HA 3O8UA 1FBNA 2X8IA 3OS3A 3RPSA 1LUFA 1ZZ2A 2IN6A 3BU5A 5FRIA 5AV1A 2YABA 3DZQA 1UKIA 3IDBA 4Z7GA 2WOUA 2VN9A 4IAYA 4PWNA 4AQCA 3QZGA 4AN2A 4UMUA 2PVRA 1YRPA 3QTRA 4I20A 4ZIMA 4FEWA 1UU9A 5I9XA 3D5VA 3VWAA 2VV9A 4RA4A 3FPQA 3L8XA 4UXLA 4BVUA 2W1IA 4S32A 4NEUA 3GUBA 5KMLA 1FPUA 4D0XA 2F4JA 2JDVA 4EC8A 5CQWA 1ZY4A 1WFCA 4JG7A 2WB8A 5EM8A 3UQFA 4RJ4A 4BFMA 2BZIB 4PF4A 3L8VA 4DFBA 5KMJA 3Q6WA 4F9YA 2YJSA 2GHMA 3I7CA 3O96A 3GT8A 3IOPA 4R3CA 2A2AA 4G3DA 4ZJIA 4YZMA 4E6QA 1APME 1EH4A 4AU8A 3CXWA 3QQLA 3DBQA 2WELA 2WHBA 1M52A 5IQBA 2B9FA 1TKIA 2R3KA 3AOXA 3F3TA 3NW7A 3EN6A 3QD0A 1KOBA 2WU6A 2Z8CA 4IAZA 4EUUA 5K4JA 2QO9A 5LWMA 2JFMA 3UNKA 4IC8A 4PPCA 3S95A 3OW4A 4J8NA 4BI1A 4PRJA 2JAVA 4K0YA 4MXXA 3AG9A 5AP7A 4HYHA 4EWHA 4QQTA 5D7VA 3C4EA 4QMTA 1UU3A 3TKIA 4TZRA 2YZLA 4MD9E 1GNGA 3TV4A 3UBDA 2VAGA 3JPVA 2OIDA 3VBXA 2XJ1A 4U41A 4BCMA 3IECA 2PVFA 4USEA 4D2SA 5GHVA 1ZOEA 4FIGA 5ANJA 5DT4A 1REKA 4LL0A 3ZFMA 3EFJA 5FTQA 5AP6A 3PJCA 3EOCA 1WVWA 3WBLA 4BZNA 4M14A 2CKEA 4RGJA 4E7WA 3P7BA 1ZLTA 4FZAB 3CD3A 2BZHB 3GQIA 4O0RA 4ENXA 2F7EE 1YHWA 2R9SA 3PLAE 3HMNA 5AV0A 1R0EA 3VS6A 3KF4A 5CI7A 3R00A 3LZBA 4Q9ZA 4FKQA 3NUPA 4CRSA 4L01A 4TYHA 1H27A 2G2IA 3FYKX 3FI3A 4NJ3A 3CKXA 3QFVA 4YSMA 4EK5A 3C7QA 3EN9A 3MN3A 4AA5A 3R7OA 5KKRC 3LPBA 4E6DA 5E1SA 4M3QA 1YOLA 2B9HA 2BRGA 3E8CA 3D14A 4J53A 5DRDA 4RIXB 3VUKA 4DINA 5HLPA 4E5BA 4KBCA 5CF4A 2XKEA 4NFMA 4TTHB 3F2NA 5HE3A 5DLSA 1YDTE 2XCKA 3ORXA 4CMTA 1UNHA 5IQDA 2C5OA 3RCDA 3QCYA 2YCRA 2ZYBA 4JVGA 5CXZA 4QOXA 4L3JA 3FJQE 3BPRA 1JSTA 1JSVA 3OWPA 2FB8A 3PPZA 3UMXA 2VTJA 5AFVA 3GCPA 2ZJWA 5E4HA 3QC4A 2GSFA 2PZIA 3R2BA 3G5DA 4YLJA 5ETCA 4M12A 3FBVA 3UVQA 4DG2E 2G1TA 3LFCA 4FTKA 3SXSA 3UP2A 1OL7A 5HG8A 4C2WA 4TL0A 4E6AA 3P0MA 2QO7A 3FQHA 3LJ0A 3QTWA 3WZJA 3BYOA 4D5HA 4D2RA 4MAOA 4XG3A 3EWHA 2PVKA 1OUKA 1K2PA 3P08A 3PSBA 3QC9A 4D9UA 3QD3A 3ZO4A 2CJMA 4C02A 1XJDA 5IEVA 4C33A 2OW3A 2WOTA 1YVJA 3UIMA 3P23A 5IA4A 5EHOA 5H8EA 4IVDA 2VWUA 3G51A 4WNOA 5M07A 1YDRE 3QD2B 1JBPE 3ORKA 1W8CA 5EHLA 2C1AA 3MVMA 2YAAA 3ZFYA 2HWOA 2X7OA 3QQFA 4YC3A 1IA9A 4J96A 3GCUA 5HIBA 3UIXA 2VTOA 4X6QC 5BYZA 4ZSEA 4EQUA 2WGJA 2X2MA 2X7GA 2YEXA 5CZIA 5F95A 5JGDA 3V5LA 2UW3A 3EN5A 3OBJA 2P4IA 2HK5A 4BDFA 3S1HA 3UJGA 5E7RA 4D4RA 3QGYA 2YM3A 5J7HA 5AP0A 3PIZA 3W2QA 3KQ7A 3L9MA 5CY3A 5J9ZA 2JDOA 1TQIA 3IKAA 4NCTC 1FVRA 5JMSA 3ROYA 4IQ6A 3LQ8A 4C61A 2QLQA 4YZDA 4BCNA 3DBFA 4RBLA 1R1WA 5IMXA 2VTNA 1BX6A 4L9IA 4YJUA 1XBBA 2XK8A 3Q52A 4KNBA 3R30A 4KRCA 4RQVA 3HGKA 2F2UA 2YCQA 3EQGA 1Q4LA 3MY0A 1URCA 3HZTA 3QRKA 4FZDB 4H1JA 4XV2A 1KE6A 3OCGA 4HJOA 4IC7A 1SVGA 2W99B 3CTQA 3E63A 5BYYA 4QMUA 4BIEA 5M4FA 4CGAA 3IW8A 3KXMA 4GFMA 4O7RA 5FTGA 3BCEA 3OUKA 3TNIA 3AD4A 4LOQA 4IDTA 4E4MA 1PHKA 2HOGA 4XV1A 4RVKA 5EDRA 3II5A 4UYNA 5HGIA 3TEIA 5EW9A 2HZ0A 3EJ1A 3P9JA 5CU6A 4ZLYA 2H8HA 4O0SA 4FSNA 4JIKA 4QYGA 1J1BA 2ZVAA 3MH0A 4M8TA 3GB2A 1BLXA 4YPSA 2BALA 5CENA 3LQ5A 1H1SA 4PMSA 4BICA 5CQUA 4PMPA 2YM7A 4BN1A 2BZKB 3OWLA 4FV4A 2YFXA 3TTJA 4QMVA 4FZ6A 5IUGA 4F7SA 4EZ3A 4K6ZA 3WILA 3U9NA 4FL3A 3A62A 3NCGA 4OW8A 4XG2A 5FTOA 3I1AA 2ZV2A 3ZSIA 3ANQA 3ZOSA 2YWVA 4AGWA 4ZY5A 3DBEA 4WNPA 4A7CA 3HA6A 3DOGA 4G3EA 5I0BA 4RIYB 3NUNA 4DEAA 3SXFA 5JGAA 5KKRB 5A4QA 3L8PA 4L44A 2ITUA 3EL8A 1W98A 3GC7A 3PY0A 1YHVA 4L46A 5DH3A 2GPHA 2Y9QA 1ZYJA 3HRBA 2HXQA 2UW6A 3ULIA 1M2RA 1IAJA 1ZZLA 2G01A 1L3RE 1RE8A 2OZAB 4OBQA 4PDPA 3BWFA 5IUHA 4Z55A 1BL7A 5JQ5A 3KN5A 4FEQA 4IB5A 4NW5A 5D1JA 2CCHA 4CT1A 5JQ8A 5AR2A 4H3PA 3HYHA 4IWOA 4R6VA 3LE6A 3FZSA 2PWLA 2VWWA 2XEZA 4IX6A 2WMRA 4P7EA 4O22A 4FNZA 1WBTA 3LJ2A 5I9UA 4MD7E 3AC3A 3UZRA 3ZS5A 2X39A 4KS8A 2AYPA 4CG9A 3ENMA 4Q2AA 4KINA 3FLQA 5FD2A 3EIDA 5CEQA 4DGNA 4RQKA 4AZVA 3D2KA 4XMOA 1F0QA 4M15A 3DTWA 3QU0A 3U54A 5EOLA 4QD6A 3HA8A 4GT5A 1PMEA 4UWCA 4X0MA 2W4KA 1OIRA 5CS6A 3HMPA 1MRUA 5LMBA 5D12A 2E9PA 5CSWA 2QOOA 1UNLA 3UNZA 4C0TA 4J1RA 2FA2A 3PRIA 2UW0A 2ZDTA 3C0IA 3NIZA 4CFNA 4KBKA 1URWA 4KB8A 5AR8A 4IJ9A 3M42A 2WTVA 5B0XA 4WUNA 4OUCA 4PMTA 5BVOA 1WVYA 2IVSA 4APPA 3EN4A 3BQRA 4TYEA 4EH5A 4CG8A 3MIAA 3WZUA 5H2UA 4BWPA 2OJJA 2W9FB 3DFAA 4X3FC 3ZFXA 3JS2A 3FHIA 3TDVA 4FSZA 4GKIA 4TWOA 2JIIA 2EUFB 2R3MA 2W5HA 4UWYA 4J52A 3A7JA 4DBXA 3V5WA 4EK8A 4AT4A 4BBFA 4YPDA 2W9ZB 2OIQA 4ASDA 2WAJA 5ACKA 2VTIA 3FE3A 3KKVA 1A48A 2QG7A 3GFWA 4FSTA 4ID7A 4I21A 2QOCA 3MSSA 4GW8A 5DI1A 2ERKA 5HEZA 2VUWA 2UZWE 2R3FA 3OROA 4XBRA 4YJSA 3MVLA 4GK3A 4L67A 4NK9A 4CYIA 4EONA 4RX5A 3SV0A 2QOHA 5A14A 5D11A 1IEPA 2H96A 5DT3A 4XG9A 2ITXA 3Q96A 5LJJA 5JGBA 3ZBFA 3HECA 5B2KA 1Q8UA 3OWKA 2HZNA 4JBVA 4JXFA 2BMCA 4QTCA 1MP8A 4L00A 5E8YA 4GIHA 3R7VA 3BYSA 4G3GA 4ACMA 4EOJA 3ZRLA 2IZUA 4AGCA 2VO3A 4PL4A 3DKFA 4RLLA 3ZLWA 4FI1A 4FT3A 3TCPA 4ZTNA 4NM0A 2UZDA 3KFAA 3F88A 2HIWA 4IAAA 4MXAA 4QP3A 5IPJA 2PUNA 5ICPA 5KO1A 3GENA 5HG9A 4RC3A 4A06A 4ITJA 4CMUA 5M08A 5K9IA 3LXPA 1STCE 4EBWA 2ESMA 4R78A 4RG0A 5AA8A 1CSNA 4WG3A 4XLVA 1YXTA 4ZJJA 3VS7A 4PNKA 4FE2A 3K3JA 4HVDA 2CNQA 5TOZA 2WIHA 3PG3A 1OPLA 2YIRA 3NNWA 3QF9A 5HZNA 4QPSA 4ZY6A 3FSFA 1UKHA 3RP9A 4GT4A 3EQCA 1SM2A 4A4LA 5BMMA 3JYAA 5IMEA 1Z57A 4DCEA 5IA1A 4RZVA 2Y6MA 3QCQA 5I3RA 4FEUA 4EOOA 5I4NA 3NSZA 5DR2A 1PXMA 3GVUA 4FKGA 4IM2A 4W8DA 4DE4A 3F66A 3R8UA 3AC5A 5CU0A 5AP5A 5CU4A 3P4KA 4YLLA 3PY1A 2WTKC 2XIKA 5EI8A 4GUEA 3KRRA 4XRJA 2OGVA 1M14A 2WKMA 3G0EA 3NPCA 2W4OA 2WTJA 3EH9A 3Q6UA 3TUCA 1WAKA 5AP2A 3KB7A 2XNOA 4FV8A 2XKDA 5DEYA 3O2MA 1I44A 3FI2A 4XNEA 1MQ4A 3SHEA 3ORPA 4AP7A 5J9YA 1G8SA 3DQXA 1FQ1B 4OTGA 3EQHA 2W7XA 4ZTLA 4EK6A 4BDDA 2C6TA 3AD5A 3PYYA 4EC9A 2OZOA 3JXWA 4G3CA 2QOKA 4HNFA 3S3IA 5HVJA 4BDKA 3AT4A 4NIFA 4P2KA 1B39A 3UO4A 1OBGA 3OZ6A 3GXLA 1WBPA 3S00A 3LJ1A 4DYMA 3VUTA 2VZ6A 2VX3A 3BKBA 4U6RA 4G6OA 5CTPA 3E64A 2XH5A 4DFNA 4PDYA 4AT5A 5HIDA 4I4EA 1P2AA 1U54A 2R7BA 4P90A 3UODA 4AOJA 2YIQA 3BGZA 3E92A 1LR4A 2XIZA 3GBZA 3HRFA 5FEQA 1XQZA 3ZSHA 1ZOHA 5T68A 4FTQA 3FZPA 4BCQA 4CRLA 4M13A 4BYIA 4MTAA 4FNYA 4JJRA 3JVRA 1A9UA 2YM8A 4ACGA 2OFUA 3H9OA 3IDPA 3QA8A 4H39A 2BDJA 2B9IA 4GCJA 1DI9A 2VO7A 3A2CA 4BGGA 1CTPE 3D7ZA 1H8FA 2O8YA 4G34A 4X3FB 4OT6A 5J8IA 1K9AA 2VWVA 3R73A 1YDSE 4NT4A 4ANLA 5C8NA 3DXNA 3GCSA 4KSQA 3WF6A 3Q5IA 1PYXA 3I5ZA 4MX9A 4PMMA 4XG7A 3WE8A 3ZMMA 4F9CA 5L6OA 2PZYA 4YTFA 3UVRA 2P2IA 2X2KA 4IB3A 3FXXA 1Y8YA 2ITNA 3CPCA 1VZOA 2BDWA 2J0IA 2J6MA 2Y4PA 5C9CA 3W16A 2JKOA 2WD1A 4QMLA 5B7VA 4QMOA 2VTMA 3FPMA 4OTIA 2V55A 3T9TA 3TV6A 1W7HA 4IW0A 5KMKA 1T45A 3EFKA 3GU4A 3CCNA 4HPTE 2QU5A 5I9ZA 5J9LA 4JBOA 3W10A 1ZYLA 1YQJA 5F20A 2OK1A 3MIYA 3NYVA 4UY9A 2P2HA 5BVNA 4KSPA 4PX6A 4KA3A 1L8TA 3MTLA 4FEVA 5H9BA 4CQEA 4M0YA 5A6OA 5HLWA 3BWJA 3HV3A 5JFVA 4XUFA 2BAJA 2GTNA 2Y6OA 5L2WA 5E8XA 4JG6A 4CVAA 4LUDA 3TUDA 4R5YA 2HZIA 4ZEGA 4YR8A 1NT2A 4M97A 3RAHA 2C0OA 3GC8A 4DFZE 4FTRA 3VW6A 3IK3A 4TKSA 4DH5A 3QD4A 4FTNA 3OMVA 4J97A 4TT7A 3W8QA 4NSTA 4OT5A 3ZZEA 4B6LA 3AT3A 4K9YA 4B8LA 4EQCA 5HTIA 4PUZA 2IO6A 1CMKE 1XO2B 4C8BA 3CLYA 4LYNA 2JIVA 4HCTA 5FEEA 1FOTA 4RWLA 2DUVA 4EOPA 4O27B 3I79A 2BIKB 3FZOA 4DN5A 3U6IA 2E9UA 5HO7A 5CXHA 5AX3A 3B2TA 1YKRA 2EB3A 4U9AA 4USFA 4HGLA 2R3IA 2J51A 4J99A 2E9OA 4RVTA 2Z2WA 3QRIA 4G31A 4O7SA 3COMA 4O2ZA 4ASEA 4BTMA 1GY3A 4BHZA 4C35A 2RIOA 3SQQA 5LMKC 4Y8DA 5LWNA 1VYZA 4MK0A 1FINA 2PTKA 2WTKB 3FYJX 4RX8A 3UIBA 3N4UA 3MPTA 3UG2A 3Q3BA 2RFNA 3KRJA 5BX0A 2V5QA 3PVGA 4MH7A 3SG9A 2X2LA 3H30A 4GFGA 4KKEA 3HMIA 3AC8A 4L52A 4TWPA 2WFYA 4ZP5A 3W32A 3BBWA 1GOLA 3QKMA 2X81A 3R1QA 1QPDA 4LRKA 3MWUA 3UO6A 3OBGA 4ANBA 4ZS0A 2XCHA 3ACJA 2F57A 5G6VA 3MY5A 4QTBA 4RMZA 5B2MA 1LPUA 4QMSA 1OB3A 4XV3A 3DBDA 4O82A 4CQGA 3FZTA 5CANA 3QYWA 2WMAA 2YIYA 4X2FA 2QOBA 5HX8A 5HD4A 2YIWA 3U6HA 4LUEA 2PHKA 3ZC6A 2RFEA 4ASZA 5DRBA 3KXNA 2WMSA 3HDNA 2UZBA 2X7FA 3LOKA 3TL8A 2X9EA 1J3HA 3CEKA 3FDNA 3QZIA 4C59A 4LRMA 5IQEA 1Q3WA 3C9WA 3HRCA 2GU8A 2JIUA 5B2LA 4XYFA 3OUNB 5M4UA 3MGYA 1GZKA 2I6LA 3Q2MA 3QA0A 1OKVA 1RJBA 2B52A 3BHVA 4WUAA 3GOKA 3LXLA 4O7WA 2R3PA 4WG5A 2C6OA 1Q41A 3G6GA 4YLKA 4IFCA 4LGGA 3NRMA 2B7AA 3MH2A 5E90A 2W1CA 4TPTA 4E26A 2RFSA 4HYIA 4Y72A 4N57A 4OLIA 3COIA 3LVPA 3IDCA 4YC6A 3NNXA 4LL5A 5JRSA 5JZJA 4BB4A 3U4UA 4ACDA 5IZFA 3KC3A 3ZRMA 5C4KA 2Z7SA 3WOWA 4RFYA 3UO5A 4PY1A 5D9HA 5JN2A 2X8DA 1U5RA 3NUXA 4DEGA 5L8KA 5GJDA 5HG5A 2NNWB 3RINA 4I0TA 1H1RA 2B0QA 4IHPA 2OJ9A 3I5NA 4KIPA 3B2WA 2BCJA 2UW4A 5ANDA 5IQGA 3O23A 5KHWA 3QTUA 4RFMA 2GNGA 3UZPA 4QT1A 3BEAA 4XV9A 3FEGA 3HL7A 4Q9SA 4D1XA 1J7IA 1KE9A 5A4LA 3RM7A 2C6IA 3I81A 3FI4A 3PPKA 4I5HA 4YGAA 5TKDA 3ROCA 3FSKA 5CVGA 4Y46A 2B53A 4LOPA 4HGSA 4O7LA 3E87A 4L45A 4S2ZA 4YBKA 5BYLA 2CLQA 2H9VA 4S34A 4CFWA 2YACA 1Q61A 2C6DA 3Q9ZA 4FL1A 2XKCA 5ETIA 4UX9A 2PSQA 3ZUUA 2IVUA 1M2PA 5L2IA 2REIA 2O2UA 1JLUE 2E2BA 4XHKB 2YERA 3QLFA 4GU9A 3DKOA 3VS2A 3W2SA 4F0GA 3L1SA 3MY1A 3R28A 5CNOA 4A9UA 3OXTA 5KMIA 1AGWA 3QQUA 4WNMA 4WRGA 4MEDA 2ZM4A 5BVDA 2QKWB 1W82A 5A46A 1OKWA 3BHTA 2PZRA 4WKQA 4ZMEA 4FTMA 4FV6A 4CKJA 4QYFA 3EQFA 3RKBA 3RJCA 2GNFA 4I24A 3EKNA 4KWPA 3Q60A 3U4WA 1QPJA 2ZAZA 4ZMFA 3WYXA 4DC2A 2W05A 1F5QA 1Y57A 1VEBA 4N6ZA 3PA4A 4FVRA 4OR5A 4OTDA 4Y73A 5M57A 1NVSA 5JH6A 4FYNA 3RZBA 5IH4A 3LCOA 2JDRA 3HUBA 3R8LA 4C37A 4D5KA 4R5SA 2RGPA 3KULB 4BDEA 2YDKA 3IQ7A 2PE1A 3EHAA 2J9MA 3PIXA 3SD0A 3VBYA 4H3BA 3NNUA 3Q4ZA 5M44A 3OCSA 4O86A 5KNJA 3QALE 4JLCA 4NTSA 1XWSA 2CKOA 2IPXA 3VS5A 5LXMA 3TM0A 3ZSGA 1YI6A 3OCTA 3A7HA 2GDOA 3IW4A 3QRUA 4L7FA 5ANOA 4OAUC 4QNAA 4GUBA 4CZYB 5AR5A 4V0GB 2YA9A 4FX3A 2IZSA 2W1ZA 2XK7A 3OP5A 5AUUA 4KIKB 3O71A 2VTQA 4BKJA 4EBVA 2HCKA 3C51A 3WARA 4O0WA 4FMQA 2WMXA 5AIRA 2GS2A 4ARKA 4ZSGA 4WSQA 4RFZA 5FBNC 1WBNA 4U44A 3JVSA 3COHA 1GIHA 5EHYA 3VF9A 3FMHA 4JIAA 3ANRA 3W8LA 5CEPA 5HU9A 2CPKE 4AZSA 2UVXA 1YWVA 2PVMA 3F7WA 2GQSA 4L3LA 4Y5HA 5LVOA 2Z60A 1SYKA 3FLYA 3UOKA 1JNKA 4D9TA 2JBPA 3FY0A 4PP7A 4QYYA 4G2FA 4RIWA 5IEXA 4F0IA 2JBOA 4B9DA 3FWQA 3IPHA 1R78A 5EOBA 4DFLA 3NUAA 2GNLA 1MQBA 3E5AA 3MTFA 2C1BA 2JITA 1MRYA 2OI4X 2WPAA 2EXEA 1R39A 2DQ7X 2YWPA 2OSCA 4ACCA 1WVXA 4IVAA 4Y83A 2QOLA 3NUYA 1Q8YA 4YMJA 1ZYSA 4BDGA 1LEWA 3UTOA 3LHJA 4AA0A 4EH7A 5A9UA 4B8MA 5AV2A 3QHRA 4AX8A 5IA5A 3R7EA 4D4VA 4CLJA 2DS1A 2ACXA 4TYIA 4CFVA 4EHEA 3GP0A 4TY1A 2X8EA 4NUSA 4DFXE 2QOFA 3MFRA 5HE1A 1YI4A 4II5A 5AA9A 5CSPA 4DF3A 4PPAA 5GIPE 2G15A 4U0IA 5FM3A 4R7BA 1W83A 4AS0A 4ZTRA 1ZMVA 3V8SA 4C4GA 4EHGA 1ZMWA 3UNJA 3NGAA 3NS9A 2E9NA 4RWIA 3C4CA 1OM1A 2QODA 3MDYA 4DFUA 2EU9A 2PE0A 4TYJA 1NW1A 3G0FA 3BELA 3UQCA 3F5GA 1OIQA 4MNFA 5CVFA 2A1AB 3BGQA 3VS3A 3UVPA 1VYWA 2UZEA 4NJDA 3GU6A 3IW5A 1XH7A 3EZRA 2W1HA 4FKPA 4I3ZA 4JAIA 3RNIA 4I6QA 4XEYA 3WIGA 3D7TA 1Y91A 3QYZA 3DK3A 4EOIA 3GCQA 4DEDA 1NXKA 2Z7QA 1YWRA 5DR9A 2VWXA 1PXLA 3F82A 1XR1A 2I0YA 2OICA 2C47A 4KKGA 3MVJA 4A9YA 3DGKA 4I6HA 4C4JA 5DT0A 1Q8WA 3NIEA 4G9RA 5A4TA 4LMNA 2X9FA 2GNJA 3UIUA 5AV4A 3HDMA 2I1MA 1DI8A 3ZEWA 4IZ7A 3C4WA 1H01A 4XG6A 4FIIA 4U97A 4C4IA 4RIYA 5HOAA 3U8WA 4HCUA 3WF8A 4U80A 4K18A 4K33A 5IA0A 4FGRA 2F9GA 3NYOA 1UNGA 2C3KA 2RSVA 4H1MA 3QWKA 4CCBA 1YXSA 4F08A 4UZHA 3OXZA 3VRZA 5E1EA 3BRBA 4PV0A 3SRVB 4ACHA 2OZAA 2C4GA 2R64A 1YW2A 2JKQA 1O6LA 5ANIA 3FC2A 4EK3A 1H07A 4C3PA 4G16A 2BTSA 3ELJA 4UALA 4FIJA 3OHTA 3Q9WA 4S33A 4FR4A 5ETAA 3FL4A 5HESA 3TKUA 4FKUA 2RKUA 2VX0A 4OTHA 5FDXA 4F7NA 1IRKA 4FSMA 3C0GA 4U45A 3VF8A 3R7GA 3TJCA 4D55A 4FT5A 4IADA 1P4FA 5BVKA 5FBOA 5GZ8A 1LP4A 5EFQA 5CSHA 1K3AA 4I22A 4O0YA 3UG1A 4FKJA 5A54A 3IOKA 4YSJA 3JY0A 5FQDC 4AFEA 4ZY4A 4CLIA 2WTWA 3UQGA 4PL5A 4ZSAA 3QL8A 1O6YA 2J0MB 2QLUA 3DQWA 4QQ5A 4AA4A 3VUDA 5HLNA 4RJ8A 3SA0A 2C6EA 4C4EA 2YM4A 2BHEA 3QKKA 3QTIA 1GIJA 4GJ3A 4GVAA 5EH0A 4ZJVA 5IF1A 4JX3A 4DH1A 4ANOA 2J0LA 3EYHA 3TUBA 3UGCA 2EVAA 2XKFA 1KE7A 2P33A 3SKCA 4A07A 4FICA 4EYMA 3OEZA 4Z7HA 2XNBA 4FKVA 4RT7A 4FNWA 3NYXA 1SZMA 1YXXA 3R8PA 3K5VA 4AOTA 4KAOA 4CTCA 4EH2A 2W1FA 4R8QA 4EKKA 2EXCX 4DTKA 5A3XA 2UW8A 3TG1A 5BNJA 1GIIA 2BRMA 2C5NA 2VRXA 4TW9A 4WHZA 4L8MA 3HV6A 3NR9A 5M55A 5AAEA 5EYDA 4MXYA 5KMMA 1OGUA 4QMWA 2ETMA 3MYGA 4NCTA 1S9JA 3KK8A 3RK9A 2IG7A 1VJYA 3BYMA 2OF4A 3DLZA 5EM6A 3BX5A 4NWMA 2IVVA 4FTJA 5ITAA 2CNUA 5HI2A 2VGPA 4IANA 2VNYA 3GFEA 4BGQA 2QD9A 3BEGA 4U3YA 4I0RA 4DEBA 1UVRA 4BYJA 4DGLC 2GMXA 3AMYA 1GAGA 3OOGA 3FLNC 4M67A 2RFDA 2ZDUA 4MNEB 4E5AX 2VTHA 3RK5A 2RG6A 4O91A 1AD5A 2NRYA 5AP4A 3H3CA 3R1NA 3N9XA 3E7VA 3LM0A 2XUUA 3BYVA 4AZEA 4AZTA 4F99A 4C2VA 3V8TA 4IB0A 2J0JA 1Y6BA 5KBQA
chains in the Genus database with same CATH superfamily
3OOMA 5C8KA 2QI8A 3LIJA 4BCJA 3RGFA 1OL2A 3DB8A 3CBLA 5EDQA 3D2IA 3VBWA 4EKLA 4F9AA 4FZFB 5AUXA 3FMKA 4C34A 3KK9A 3Q4CA 4HZSA 1RQQA 3NW6A 2ZM1A 5K3YA 1PXIA 5FM2A 2IW9A 4GS6A 2HXLA 1YWNA 2ZM3A 3NFGB 4DBNA 2VO0A 4DLIA 1ZMUA 4DEHA 2CCIA 4IEBA 3IW7A 3VHKA 4PL3A 4M69B 3M2WA 3AMBA 5DGZA 4O0VA 5JSMA 4GSBA 3NX8A 4QP7A 4D0WA 2CKPA 4IX3A 3FL5A 3NVMB 5BPYA 4RC2A 3C5IA 4BKYA 4N0SA 5D7AA 5HE0A 3PIYA 4O0TA 2RF9A 3WZDA 4GFOA 4N70A 4AG8A 3NVKI 2XBJA 5DPVA 4F9WA 2C3JA 1NVRA 1UWJA 2J50A 3AC1A 3GEQA 5J5TA 5HO6A 1J7UA 5J1VA 2GNHA 1YHSA 2ITWA 3QQHA 4ENYA 2QO2A 4I93A 4QYHA 3BL7A 3W33A 3PVUA 2CN8A 2ITZA 2WU7A 4QEBA 4HNIA 1OIYA 4YJRA 4QMPA 3RALA 2R2PA 3DV3A 2BRNA 2CDZA 3SDJA 3NUUA 3A4OX 3TT0A 4M68A 4D58A 3DXPA 3ORTA 3TNPC 3VULA 2ITYA 4YU2A 4AWIA 2OXYA 3WYYA 1OUYA 3PJ2A 5E92A 2QOIA 2I7QA 4J7BA 4QPAA 1UA2A 3QX4A 2PUIA 3OVVA 3DJ7A 3EFLA 3DU8A 3TNQB 5AWMA 1P14A 3O8TA 4WSYA 2BKKA 2YHVA 4LV5A 3HVCA 2XJ2A 2B4SB 5C4LA 1QL6A 4XJ0A 3B8QA 3O0GA 2WMUA 3MFTA 4XCUA 4WBBB 3PXFA 3ZBXA 3I6UA 4KD1A 2G2FA 1TFFA 4F7JA 4AW5A 2EXMA 1PXOA 3A8XA 3R9OA 4G6LA 2BAQA 4GV1A 3R04A 4YZCA 2OKRA 3QTQA 1YXVA 2R3OA 1DAYA 4O4EA 4U40A 1UU8A 4CV8A 5ANEA 5HIEA 3PA5A 2W1GA 2BFXA 3O50A 3ENHA 2OIBA 2IW6A 3LFEA 5HBEA 3DA6A 3V3VA 3COKA 3KVXA 4UMTA 5CU3A 1TQPA 5E8ZA 4QDEA 3RAWA 4DT9A 4QP8A 3KN6A 4DGGA 4KRDA 2XRUA 3GI3A 3QQKA 3BU6A 4JR3A 2WMWA 4X3FA 4XP0A 2J4ZA 3IG7A 4ZZMA 5LVLA 4AOIA 5HCYA 3PVWA 3ZO3A 3VBQA 3BZ3A 2GQGA 3BI6A 3DZOA 4FTIA 2E9VA 4EORA 4FTLA 1KOAA 4FTUA 3KA0A 4MXZA 4BL1A 3A60A 4FG8A 2DYLA 4P5QA 1PY5A 3R2YA 4PDOA 4U7ZA 3KREA 3TZ8A 4DCAA 3UPZA 3D83A 3ODYX 4USDA 5IUIA 4FA2A 5IA3A 3U55A 2QHNA 3OTVA 2C3IB 4F6UA 1T46A 3UPXA 4AZFA 1O6KA 4DGMA 3A61A 3LFDA 2W1DA 3R9DA 3WI6A 4IIRA 4TNDA 3ZDIA 5HO8A 4E73A 3F3WA 3BE2A 3FMLA 3D9VA 5CEOA 3AC2A 3DT1A 1UV5A 2VGOA 3BHUA 3HAMA 2QR7A 2O63A 2VX1A 3LCDA 4MBIA 3ORIA 2F49A 2P55A 2KULA 3GCVA 4L42A 1BKXA 1OBDA 2VNWA 1H0WA 3ATTA 2XBAA 3DAKA 1J1CA 3RZFA 4BIBA 4QTDA 5CT7A 3CQWA 4APCA 1ERKA 4E1ZA 3UP7A 4BGHA 5IH6A 4KUJA 3T8OA 1OECA 2B55A 3GU5A 4MXCA 4PDSA 3TKHA 3ZLSA 5FUTA 4F4PA 3A8WA 3A7FA 2BZJA 1OZ1A 4D1ZA 5GJGA 4XLIA 2XF0A 4OAVB 1R3CA 3LM5A 4FT9A 4FTTA 4BCIA 2GTMA 2WIPA 4DG0E 4TYGA 1G8AA 3W2OA 4U8ZA 1Q8ZA 4C3RA 3QZFA 4V01A 2V7OA 5CALA 2AEGA 3BLHA 3P1AA 4MCVA 5AAGA 2PZ5A 4EWQA 4AXDA 4YC8A 5TR6A 4DT8A 3MBLA 2C30A 3QUEA 3E8NA 2ITPA 3UMWA 5H3QA 3OY3A 4BIDA 2WXVA 4WD5A 4BCKA 4QMMA 4J71A 4GRBA 5DA3A 4DHFA 3L9PA 3V6RA 1GJOA 3DAEA 2W5AA 5HKMA 3RWQA 3ATSA 3HEGA 1OITA 3TDWA 3VO3A 3T9IA 5IKWA 3D94A 5AR3A 3PG1A 3QCXA 2OH0E 4R1YA 1XH5A 3V5JA 1I09A 4BBMA 3SGCA 5M56A 5AUWA 3PRFA 2J5EA 3RTPA 2CSNA 3PJ3A 4KBAA 5M4IA 3LKMA 1H08A 2ETRA 4OBOA 1Q8TA 4PNIA 3V04A 4FODA 4EQMA 1UU7A 3FQEA 3TZ9A 3KMWA 3U9CA 2OU7A 1J7LA 1WBSA 3BV3A 3WE4A 3G15A 3MB7A 2OO8X 3R7YA 2QHMA 4O7NA 4DA5A 4XOYA 3H0ZA 3E3PA 5AR7A 2GS7A 3DDQA 3QQJA 4NKSA 4HW7A 4GMYA 3A7IA 3RMFA 3RHKA 4S31A 1P4OA 1ZYCA 4FG7A 1FGKA 5BQ0A 3QRTA 1OL5A 2CGWA 5GIOE 2FSLX 5DHJA 4EUTA 3R8MA 1JKLA 5KZ0A 2WQEA 3R21A 4TXCA 1PJKA 3NNVA 4XP2A 5L6PA 2XA4A 1YOMA 2XB7A 3ZC5A 2XK9A 3QHWA 5IQHA 5E8UA 3FI8A 2VU3A 4CYJA 3RM6A 5FXSA 4WIHA 2XJ0A 5H8GA 3TXOA 4F6WA 3KCFA 2OF2A 2QC6A 4M84A 4CKRA 3DNEA 1Q99A 1KV2A 3OT3A 4H3QA 4AT3A 4GYGA 4MQ2A 5LARA 2BAKA 5J95A 4AE9A 4EI4A 3D4QA 3E8DA 2CNVA 4TWNA 1HOWA 4Z9LA 4CZTA 5AP3A 2XM9A 4C7TA 4BDCA 4O0XA 3N4TA 3QXOA 2OJGA 3TI1A 2GQRA 4WBOA 3B8RA 2JEDA 4GK4A 4I4FA 2YLEA 4V05A 4MQ1A 4RVLA 2BDFA 3FZRA 4O6LA 2WTDA 2GCDA 1RDQE 4BI2A 4W8EA 2IZRA 3TWJA 3L8SA 5HU3A 2YDJA 4KABA 4QO9A 4AZWA 2DWBA 5CYIA 3FMEA 3MESA 4DFYA 3RPOA 3R9NA 4LQMA 4R1VA 3TV7A 1V0OA 2R5TA 1OPKA 3MVHA 2IF8A 4IX4A 2PY3A 2GS6A 4FTCA 3W2PA 2JC6A 4ANSA 2OG8A 3EMGA 5KHXA 4ZSLA 3TTIA 2H6DA 3G90X 5ANKA 2C5YA 4RJ3A 4YNEA 3F3VA 5FLFA 4BKZA 4YJOA 3FQSA 5DBXA 3WF7A 5EYMA 4CCUA 5HTCA 1F3MC 1XH4A 3FLSA 5L2TA 3KXGA 4IVBA 1YOJA 3PXRA 4XG4A 4Y5QA 3RVGA 3EZVA 4OTPA 5FP6A 3ACKA 2QU6A 3MPAA 1E1XA 4FIEA 4I1ZA 4E93A 1H1QA 3MB6A 2I0EA 4QP9A 3TMOA 2X1NA 3PXQA 3ZXZA 1XBAA 1KSWA 4ORKA 5EQEA 5HVKA 5L8JA 3CTHA 5E91A 2ZMCA 1Z5MA 4EYJA 4X2KA 3MA3A 4FKOA 3DS6A 4LOOA 4MKCA 3G33A 3LXKA 5ANGA 4FK6A 3UOLA 4EK4A 1JPAA 4FV2A 3ZLYA 2XEYA 4BDBA 4QMYA 4O7TA 1JOWB 5EM7A 3HMOA 3RHXA 5I3OA 4RJ5A 4D2VA 4AUAA 3PTGA 4JX7A 3RPRA 3V5QA 2ONLA 2A4LA 2RG5A 4FSWA 4GH2A 3BU3A 4J98A 4N4SA 3KULA 3G9LX 4EEVA 4EH4A 1MUOA 5JK3A 1KE5A 5LMKA 1DM2A 1H1PA 4Y95A 3C4XA 1H24A 5BUJA 3MJ1A 4O21A 4JR7A 3ALOA 4HGEA 1NVQA 1YI3A 2P0CA 4BCOA 4DH7A 5HX6A 4R77A 5CT0A 5HE2A 4BZDA 4TRLA 4JRVA 4LFIA 4DAWA 1JKSA 5L6WL 3KEXA 3Q5ZA 4G6NA 5T3QA 1OKYA 3LMGA 4GU6A 2WO6A 3WIKA 4FV3A 1PXPA 5KE0A 5IQIA 3VVHA 5C8MA 4KIKA 4ASXA 4ZTMA 2WMVA 4MD8E 3F2RA 2UW9A 3PLSA 1W0XC 4AACA 2UZLA 4D4YA 4FZ7A 2WZJA 1FMKA 3EKKA 4I5CA 4BCGA 2QCSA 4QYEA 4EH8A 5CAVA 3VS1A 1OIUA 2UW7A 3E88A 3OCBA 4EOKA 3C5UA 4PTGA 4EH3A 3F7ZA 2F7ZE 4R7HA 2V0DA 4H58A 3ODZX 2YLFA 4XBUA 3PY3A 3UDSA 4HZRA 4JL9A 3ZU7A 3D5UA 3LLTA 1KUTA 4YTIA 1Q62A 4ZAUA 2OLCA 2YJRA 1WBWA 3CD8A 4QP6A 2QNJA 4MF0A 5AIKA 4I23A 1CM8A 2PMIA 3I6WA 3F3UA 4K1BA 4CTBA 4RA5A 3N4VA 4FOBA 5EI2A 4FV9A 3VUGA 4XP3A 3Q53A 1NA7A 3PXKA 4CV9A 3RCJA 3L9NA 1JAMA 3MJ2A 3NEWA 5F1ZA 5CF6A 3ALNA 2JKMA 3Q4TA 4ITHA 4O4FA 2O5KA 3QUDA 2XNPA 4XG8A 2ITOA 5EM5A 2CLXA 5EW8A 3ZHPC 4IFGA 4E3CA 1PKDA 4GIIA 4RIXA 2A0CX 3ULZA 3F5PA 2X6EA 4IBMA 3RWPA 4WOVA 1X8BA 2O0UA 5D10A 5M53A 4GEOA 3BHHA 3MA6A 3S2PA 4O38A 1YXUA 5CEKA 5BUIA 3M11A 2IW8A 3NW5A 3PJ8A 1ZRZA 4UB7A 2QR8A 3MW1A 4HCVA 4R7IA 3I0QA 3P5KA 4CT2A 3R1YA 4O0UA 3U87A 2R7IA 3I7BA 3Q04A 4XS2A 5LOHA 3ZRKA 4JOAA 2YDIA 3W55A 2W96B 2HY0A 4KIOA 5EG3A 4AQKA 3FV8A 5CZHA 5AEPA 5TE0A 3V8WA 5LVMA 3C1XA 2SRCA 3JUHA 4JDKA 4NZWB 1SVEA 3DFCB 3R7IA 4Q5EA 3ZUTA 2BPMA 4IE9A 3W2CA 5L2SA 5AUYA 3F9NA 3PWYA 3VJOA 4NH1A 2VTSA 3AXWA 4ITIA 1H0VA 4K11A 3F5UA 4FEXA 1WBOA 2X6DA 5JZNA 5DWRA 5FXRA 1ZOGA 4O81A 3VQUA 4FKSA 1QCFA 3V5TA 2R0IA 1W2CA 4AXCA 1PXKA 3REPA 4UZDA 4GYIA 3L9LA 3DKGA 4CFMA 4M7IA 3TNWA 2NP8A 2CGUA 3HV4A 2HYYA 2J7TA 4X7QA 3T3UA 4C36A 3LMIA 2FH9A 3VQHA 4RWJA 3U51A 3NWWA 1CDKA 5CNNA 3F5XA 4DH8A 5CEMA 4O83A 3LLAA 3VUIA 4EL9A 2PMLX 2UUEA 4LGHA 4EJNA 5I9YA 3OTUA 2X0GA 3QX2A 5DE2A 3ZM9A 1B6CB 3LCTA 4FBXA 3SRVA 2VTPA 4MBJA 2W06A 4F64A 4FV1A 4ONAA 4KS7A 3TNHA 5IG1A 4BWXA 3GC9A 3RAKA 3BGPA 2PVJA 2OJFE 1ZY5A 3H10A 4JT3A 3SX9A 3WZKA 2J0KA 1Q5KA 4FSQA 4K8AA 4BCPA 4UEUA 1DAWA 2QKRA 5M09A 1H28A 4IZAA 4UMRA 5IDPA 2C69A 4RJ7A 1IG1A 3VS0A 2VWYA 5L4QA 5FEDA 1JKKA 5BVWA 5HNBA 3SAYA 5EQPA 4JS8A 1M2QA 2BUJA 3HMMA 5ACBC 5AADA 3IS5A 4H36A 3R8ZA 3UC3A 4DITA 3OC1A 3HV7A 3IGOA 3F69A 3OFMA 3E7OA 3OXIA 2JAMA 3LFFA 1UWHA 3CY3A 1OPJA 2C3LA 1XHAA 4OGRA 5JRQA 3NMUF 3DTCA 4RRVA 2Y7JA 1WMKA 1Y6AA 4GKHA 5DFPA 2PU8A 3IONA 4YO4A 1XBCA 4NKAA 3VBVA 3PE1A 4L53A 5LCJA 2QVSE 4IM0A 4YZBA 4U3ZA 1MRVA 2XS0A 4MXOA 5AJQA 3D5XA 5EI6A 2R3RA 2GHGA 3I0OA 5DYJA 1PXJA 4JI9A 3ZLXA 3R02A 1WZYA 3VRYA 5K5NA 4YUQA 4S30A 1G8JA 1GZOA 2WTIA 3SOCA 3P7CA 2C5VA 1KE8A 4G3FA 3R83A 3BHYA 4TWCA 3JR1A 1V0BA 2R3NA 4BJJA 4GG5A 4RZWA 3CPBA 2HZ4A 1HCKA 4G9CA 1Q3DA 1QPEA 4RX7A 4UWBA 2XYNA 4Q5HA 3DB6A 1IASA 3ORLA 1S9IA 1FGIA 4NM3A 4W9XA 3SXRA 5L8LA 5J1WA 4PTCA 4RIOA 3H4JA 2AUHA 4MVFA 4PPBA 2VTTA 4BTFA 4D4SA 5M51A 3ITZA 4B99A 2XIRA 4ZTQA 5A4EA 4CD0A 3WF9A 3C13A 4CFXA 3PSDA 4D2WA 1JVPP 2UZTA 2W5BA 3MPMA 3AMAA 4MF1A 2I40A 2JGZA 2PK9A 3ORMA 3RAIA 3LAUA 5T6KA 3HV5A 3G9NA 1W84A 4AAAA 2A27A 2G9XA 4WO5A 5CLPA 4AF3A 3CP9A 4F7LA 4ZTSA 3TIYA 2XNEA 5IA2A 2XNMA 3EFWA 4L6QA 2ZOQA 3MH1A 5M4CA 4LI5A 3FAAA 3BLRA 3PFQA 4D1SA 4ALWA 5H8BA 2V7AA 1BL6A 4FF8A 2PUUA 4RIWB 4FNXA 3HX4A 4FSYA 1J91A 5EDPA 5TO8A 5AAFA 1V0PA 2BROA 4X2GA 3LXNA 1TVOA 2XIYA 4MNEA 3DY7A 2HELA 3MS9A 3RI1A 4RPVA 4BI0A 1U46A 3GNIB 4PQNA 5EYKA 3ZXTA 4NU1A 1QPCA 2C5XA 3A99A 3KMUA 5CVHA 4FKTA 2JFLA 4BR3A 3LW0A 5K0XA 3EB0A 2QG5A 2YCSA 5DEWA 4HVGA 4O7YA 4QRCA 1GZ8A 4TYHB 2PMOX 3E62A 2FGIA 3A4PA 2WEIA 3K2LA 5E8SA 2J5FA 3R6XA 5FGKA 3UZTA 4ZS4A 4JQ8A 4HOKA 5J7BA 3F3ZA 2QURA 1PKGA 4RSSA 4V04A 5F9EA 4IB1A 3THBA 2O65A 2Y8OA 4BF2A 3KRXA 3R8VA 3PZEA 1SNUA 2XK6A 3ORZA 4M69A 5EYCA 3PXYA 5J87A 4K2RA 3TIZA 4JNWA 3GQLA 4C62A 3AKKA 3ET7A 1BI7A 4CSVA 3HUCA 4FTOA 2GFCA 3LCKA 4C3FA 4OBPA 5FG8A 4FV7A 3QTXA 5IEYA 4IJPA 2PUPA 3ID6C 2I0VA 1CKJA 3MV5A 4RX9A 4U81A 5DVRA 3PDTA 5J79A 4EOQA 3KY2A 3AD6A 3HLLA 1H4LA 3D7TB 2BVAA 3T3VA 3NFFB 3HP2A 2Y0AA 2JDTA 4ZSJA 5HTBA 4AXAA 2PVYA 3CKWA 3KXZA 3CQUA 1JWHA 4JAJA 4YHFA 3ZO1A 2Z7LA 4GVJA 4QP1A 4ZZOA 4IAFA 2FSOX 3FLWA 5IQCA 3RPYA 4FV5A 1LEZA 3FC1X 5CSVA 3VIDA 3BV2A 5LMAA 3PP1A 3D0EA 3PPJA 4MHAA 4UMQA 4O6EA 5G1XA 5FP5A 3SOAA 5BUEA 2WTCA 1OL6A 4WRSA 5AM7A 3O8PA 3O51A 4AN3A 5DR6A 4F63A 3CC6A 3QXPA 5IISA 4BY9E 2VWBA 4W9WA 5HNGA 3P7AA 3QQGA 3UC4A 2HWPA 4NL0A 3F2AA 1G3NA 4AW0A 4PTEA 2V62A 1OKZA 1Q24A 2B54A 5EK7A 4DHZA 4NM5A 3VN9A 4GJ2A 4BBEA 4F9BA 4F1TA 4NM7A 4A4XA 1M7QA 1FVTA 1FVVA 2AC5A 3R01A 2VWZA 3BQCA 4XH6A 5AUVA 3DXQA 2FSMX 5TF9A 4I6BA 1PF8A 4DHIB 3PSCA 2XAMA 3HAVA 2QQ7A 2NPQA 3F61A 1XH8A 3A7GA 3NAYA 2OXXA 4J8MA 4CFFA 3C4FA 3LCSA 3HP5A 4YZ9A 4WT6A 3ZM4A 3LFAA 5CWZA 2R4BA 3TZMA 3QWJA 3SW4A 2HAKA 4ANNA 2RL5A 5DNRA 4B7TA 2BFYA 4FYOA 3VS4A 4C58A 3H9RA 2R3JA 1P5EA 1Y8GA 4W4YA 3SLSA 2O3PA 3FKOA 4YJNA 4O7VA 3NZ0A 3ZYAA 2XK4A 3ZH8A 2V22A 5E8VA 3LMHA 3UOJA 3EQIA 2BKZA 3QCSA 4NTTA 4WG4A 5DG5A 2CGVA 4QTEA 5IU2A 2ZV8A 3R0TA 3NUSA 1PXNA 3OG7A 4ALUA 2I0HA 3FZ1A 4D2TA 4YJVA 2ETKA 4JG8A 4F09A 1CKPA 4FT0A 4IWQA 1U4DA 3EYGA 4QTAA 5GINE 4YP8A 3FMNA 4RJ6A 4IM3A 2XYUA 4O96A 4Y85A 4QQJA 5KX8A 3QTZA 1U59A 2XMYA 3PE2A 3OD6X 4YJTA 5C27A 4BCFA 5KCVA 4U43A 4LG4A 5AP1A 1ZARA 2WMBA 4BHNA 2R3HA 5E8WA 3VUHA 1XH6A 4IAIA 3VC4A 5HG7A 4MWIA 5D41A 5GZAA 2XRWA 2YM6A 2PE2A 4ANQA 4BDJA 4BWKA 3N51A 3NCZA 5CAUA 3DLSA 3P78A 3QAME 3H0YA 3BLQA 4LV8A 4BTJA 4DH3A 4E8AA 2XNNA 3CSVA 3EQPA 4JQEA 4HYUA 4QNYA 3TN8A 2O64A 5AM6A 5CEIA 3RPVA 1PW2A 2UZUE 3R71A 3OWJA 4FG9A 4L3PA 4YTHA 1OMWA 4F1OA 1JQHA 4FKRA 3OY1A 5M06A 3FXWA 5HHWA 2C6LA 4IAKA 3LQ3A 4E5WA 4AAYA 2YIXA 3UYSA 3O7LD 3E93A 3LFSA 3W1FA 2ERZE 3D5WA 3AQVA 3CE3A 3CR0A 4LRJA 2QOQA 4FRFA 2AC3A 4ZTHA 4JBPA 4HVIA 4YJQA 4O4BB 4UBAA 1IR3A 4ANMA 1BI8A 4C4HA 2PVNA 2CMWA 2W4JA 1M7NA 4ZLZA 1AQ1A 1IA8A 4BTKA 4QPMA 3BE9A 3AGMA 3E8EA 2YITA 5DN3A 3WZEA 2EWAA 2JLDA 3KU2A 4D2PA 4FSRA 1SNXA 4EOSA 5BVEA 3R1SA 3W2RA 3P79A 2CKQA 4FVQA 4FIFA 4L43A 2BRHA 2ITQA 1QMZA 3NDMA 4JQ7A 3F6XA 3VBTA 1VR2A 4DLJA 4IH8A 2A19B 2J90A 2Z7RA 5AUZA 5HBHA 3WF5A 5JFSA 5EW3A 4AW1A 4HVSA 1OVEA 1Q97A 2Q0BA 4FC0A 4P5ZA 5GNKA 5EKNA 1IAHA 2NO3A 3KRLA 5DIAA 5JKGA 3FKNA 5HCZA 5CF8A 3QTSA 4JDIA 4H05A 1R0PA 4FIHA 4X2JA 3FXZA 4E4NA 4XOZA 4ERKA 2ZV9A 1BMKA 4XRLA 3QGWA 3VNTA 3UE4A 3PWDA 3LFQA 4YJPA 4I5PA 1REJA 2OH4A 2OXDA 2ZV7A 3PA3A 4RWKA 4X3JA 5IQAA 3ZCLA 3QLGA 2GFSA 3POOA 4C57A 4ZXTA 2YCFA 2OWBA 3TACA 2YZAA 4DGOA 4G17A 3CQEA 1WBVA 2Q0NA 4N6YA 5KZIA 2HW7A 1A06A 2WQOA 5HQ0A 5AUTA 4W4XA 5HICA 3FY2A 4NW6A 4R3RA 5ETFA 3V6SA 2R3QA 5CSXA 4O1PA 5IDNA 4G5PA 4UYAA 2W0JA 1U5QA 4XX9A 1E1VA 3MI9A 5HORA 5C1QB 5L2QA 3FMJA 4O7ZA 3ZO2A 2HENA 2XZSA 4UV0A 3QUPA 2UV2A 3FUPA 4BDAA 4P4CA 4GL9A 3E3BX 2BHHA 3Q9XA 5CAOA 5I9VA 2JD5A 1JKTA 3GU7A 3IW6A 4IDVA 2VWIA 4A9TA 1HCLA 3KCKA 2ITTA 2ZMDA 4QP4A 2CGXA 1PRYA 5LVPA 2F7XE 3AT2A 5K0KA 4BC6A 5LVNA 4EZ5A 3VHEA 3KMMA 4AFJA 5F94A 4F70A 2W1EA 2BRBA 2WQNA 3KF7A 1TQMA 2HW6A 5LCKA 3SC1A 4FUXA 3S4QA 4AW2A 2OBJA 2VTAA 1KV1A 3CY2A 3KL8A 3SW7A 4YHTA 2BILB 2XALA 3FKLA 5E8TA 3D15A 3V01A 2BTRA 3PVBA 2BR1A 4O2PA 4QMXA 4WNKA 4YHJA 4DEIA 4A9RA 2XNGA 4YNOA 2FVDA 5AX9A 1PMVA 3CGOA 2G2HA 3TZ7A 2XIXA 3UOHA 4KKHA 4A4OA 4QMNA 5KMNA 4BZOA 1WCCA 3AGLA 3I4BA 1ND4A 2B9JA 4I5MA 4FUYA 5AV3A 1ZAOA 3DCVA 5C03A 3RNYA 1H26A 4AN9A 5JEBA 4YO6A 2HY81 3M1SA 3Q9YA 4QMQA 5KUPA 2IZTA 2P3GX 2Q83A 2NRUA 5A4CA 3CGFA 5AMNA 5K5XA 4QP2A 5AR4A 4E20A 4BCHA 1RW8A 3QZHA 4J95A 4E4XA 3S0OA 3DJ5A 4R3PA 2GNIA 3R7UA 3IO7A 1BUHA 4FKIA 5CAPA 4JBQA 2C0IA 2FSTX 1CKIA 3OT8A 4IVCA 4EH6A 2F2CB 4NYEA 2IJMA 3AC4A 3PZHA 5HBJA 4WA9A 4ZLOA 5J5SA 4PP9A 5HD7A 4L68A 2IWIA 2R3LA 1H00A 2LAVA 4CKIA 3P86A 4L7SA 4CNHA 1TZDA 5BMSA 2X4ZA 4W4VA 4YBJA 4FKWA 3EN7A 4OTQA 4DTAA 4IZ5A 2YM5A 3OW3A 2J2IB 5F4NA 3HNGA 4I94A 3BYUA 2CN5A 2UVZA 4HVHA 4F78A 3UYTA 4LM5A 4QQCA 1SVHA 4I92A 3ERKA 5I5ZA 1GZNA 3SG8A 3VUMA 5CI6A 4I0SA 5GJFA 4IWDA 4E4LA 4JRNA 5EQYA 2OFVA 3MFSA 4JMQA 4IWPA 4EOLA 1XMMA 4W4WA 3MH3A 4ZK5A 5FDPA 2QONA 3FHRA 3GGFA 4RVMA 5K4IA 4ZOGA 2B1PA 3EQDA 4FV0A 5IQFA 3FMDA 3O17A 2Y4IC 3LFBA 4FKLA 4LGDA 5EKOA 5CU2A 5KMOA 3DAJA 3VW8A 4FTAA 4IACA 4F0FA 3H9FA 3G2FA 4FSUA 4KIQA 4NIFB 1H1WA 3CS9A 2WQBA 4I41A 2PULA 4RLKA 4NFNA 3EQRA 3O7LB 4U5JA 4JDHA 3ZUVA 2FO0A 4BDHA 3KRWA 3V5PA 5JT2A 3VAPA 2ITVA 2C6KA 4EH9A 2BIYA 2A98A 2H34A 1U54B 5BVFA 3R63A 4GT3A 3QKLA 4CXAA 3Q32A 4FVPA 5TT7A 5IH5A 4EZ7A 2XK3A 2GHLA 2VD5A 5CX9A 3CJGA 4I6FA 4O84A 1M17A 4IXPA 4C38A 3SVVA 2ONLC 4FOCA 3OF0A 2XANA 1XH9A 3I60A 1ZYDA 3FMMA 4HPUE 4MYGA 4X6RA 5FXQA 2UW5A 3IGGA 3KXHA 3POZA 4OTRA 4F1MA 2VTRA 4DEEA 3DPKA 4Z3VA 3QBNA 3GC0A 4K77A 4O1OA 5A6NA 4AGUA 1H25A 4M0ZA 3UDBA 2XP2A 4OTFA 4DDGA 3JY9A 3GU8A 3VJNA 3DJ6A 1NY3A 3DK7A 4HYSA 1XKKA 1ZXEA 2UZOA 5C01A 3TJDA 5HNIX 4MBLA 2LGCA 1PYEA 3C4ZA 4MWHA 4EOMA 5CASA 1O9UA 2PZPA 3ZZWA 2JDSA 3DBCA 3DK6A 4QMZA 4YTCA 3Q2JA 4FT7A 4A9SA 2C0TA 2FUMA 4OTWA 4DG3E 3W0QA 4CFUA 1KWPA 4EJ7A 4UMPA 3CIKA 3QRJA 3U6JA 2XVDA 3KGAA 2C68A 4DTBA 3LFNA 2WMQA 3ORNA 4F6SA 3VONA 2UZNA 4GK2A 2Z02A 4E6CA 4UXQA 3DKCA 3ETAA 4BDIA 1PMUA 1V1KA 3BBTB 3EQBA 4FGBA 4M66A 3ZTXA 4CEGA 2FYSA 4AE6A 2PVLA 3EL7A 3NLBA 2YAKA 3NYNA 4AGDA 2UZVA 3R22A 4RC4A 2W17A 1JSUA 4YURA 4TNBA 3DDPA 3HKOA 3NAXA 3CTJA 3K54A 4Z16A 5CF5A 4GG7A 5HVYA 3PP0A 4FK3A 1OI9A 3K3IA 1ZWSA 3Q4UA 4V0GA 2EB2A 1Z9XA 4EHZA 5I9WA 2VO6A 2UVYA 5JFWA 3C50A 4ERWA 4CMOA 3CJFA 3MFUA 2ZB0A 3ZDUA 4ALVA 2YN8A 2OJIA 1ST4A 3W0MA 3FLZA 2PVHA 4ZZNA 4EHVA 2IVTA