4QMTA

Mst3 in complex with hesperadin
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
285
structure length
284
Chain Sequence
NLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 97
structure length 284
sequence length 285
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qmtA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qmtA01
3NW5A 3I81A 4BIEA 3R7EA 3U6HA 3ZEPA 3ZO2A 2XYNA 4RA4A 1JSVA 4O7ZA 3IKAA 2J9MA 3FWQA 4UXLA 4EBVA 1AQ1A 2HAKA 2WQOA 4G3EA 3Q04A 4FOCA 4JR3A 4M67A 1ZOGA 4BFMA 5LMAA 2C3LA 3MV5A 5C1QB 1ZY5A 5LMKC 3M11A 1FGIA 1I09A 5E9EA 4I24A 5AIKA 4A4LA 3G2FA 3E64A 4F1MA 2YWVA 3DJ5A 3EL7A 2UZWE 3OF0A 4GK3A 5HOAA 4C58A 4IAIA 4RQKA 3I6WA 3LKMA 4FF8A 4EZ5A 1P4FA 5FD2A 3V3VA 3POOA 4CLIA 4EQCA 4QMPA 3VAPA 3D7TA 4MNEB 2R9SA 4UALA 4U41A 3QTWA 3SQQA 2A19B 4LL5A 5CT7A 3EZVA 2ITNA 1WAKA 2EB2A 5ETFA 4ANMA 4JQ7A 5L8LA 5CU3A 5HLNA 4IDTA 1ZRZA 4DEDA 4ZEGA 3O51A 5J7HA 3NIEA 4C8BA 5KKRC 4U97A 4Y46A 2X81A 2EU9A 3FZOA 1M7NA 4EK5A 2UW5A 3C50A 4FSNA 5DN3A 3QA0A 5K5XA 1ZYJA 3R8LA 5HGIA 4AS0A 4FZ7A 3TXOA 5J9ZA 5G1XA 1OL1A 4J71A 4H3BA 1VYWA 4IWDA 4RPVA 4X2JA 2W1DA 2O63A 4U40A 4UV0A 2PMIA 5DIAA 4OTFA 4BDDA 4FSMA 4NIFA 5DHJA 3AC8A 4KIKA 4JDKA 3KY2A 5LVMA 5FEEA 3EQFA 3OOGA 4O7NA 3ORTA 5HO8A 4DH8A 3QHRA 3QBNA 4FKWA 2W4OA 2YIRA 4GVAA 5HKMA 5IQIA 2QOOA 4L42A 4TYIA 4OBPA 4IIRA 5FTOA 4FVQA 3K2LA 1ZAOA 4FV1A 4FICA 5A6NA 4BWXA 3UJGA 4DEIA 1H08A 4GV1A 4PTCA 5LVOA 2X2LA 2W1ZA 1Y8GA 4U81A 4W8EA 5JKGA 3EYHA 2HELA 3TZ7A 4KBCA 2E9NA 3HRCA 3NX8A 4FKGA 4GCJA 4CZUA 3BWFA 3FZSA 2QQ7A 4TW9A 3PSBA 4RJ7A 1JPAA 5CSHA 4QMTA 1OIRA 5L6WL 2WPAA 2PMOX 5ANIA 2ONLC 2YWPA 3WZUA 3R83A 2XIYA 3MA3A 4XRJA 3L9LA 1REJA 5M08A 1Q8TA 4S33A 3SA0A 3MSSA 3E63A 1VZOA 2G2HA 4D5HA 4EOPA 4ERKA 3LQ3A 5C8MA 3TJDA 2XNBA 3TIZA 2WTCA 4X2KA 4IVAA 5K5NA 3S00A 2W5AA 4YTCA 1OKWA 3OY1A 4EEVA 4I1ZA 1U4DA 4ANLA 3HDNA 3NYOA 5CVFA 3I7CA 4IZAA 1H1RA 4QMLA 4DLJA 3QRJA 2W99B 3ITZA 4TKSA 4EH2A 3ORZA 4F9AA 5EFQA 5E8SA 1BKXA 3ZU7A 4E26A 4J99A 4BGHA 5BVKA 3R8UA 3A7FA 2B53A 1DM2A 4ANSA 2BFXA 1TQMA 3AC1A 4FSQA 3F2RA 1H1SA 4QO9A 4E20A 3LFEA 5J9LA 1CKPA 2YIQA 4K0YA 3GU6A 1U46A 4ZTRA 5EW3A 4BTJA 1YQJA 5EH0A 4MBLA 5AR5A 2CPKE 3P7CA 4QMXA 4YHTA 3QLGA 1IASA 4OTRA 1FPUA 4QP4A 2VN9A 2YCQA 3D5VA 3QX4A 3G9LX 3O2MA 1ZYCA 2ACXA 1YWNA 3EHAA 3KMMA 4IB3A 3HGKA 5EQYA 1BI8A 4G5JA 5AP3A 4HVGA 3WI6A 4ID7A 3CGFA 4C3PA 3RNIA 1M2QA 4M3QA 4EK3A 4FKOA 2UVYA 4MQ1A 4ZSJA 4TYEA 1X8BA 4QP8A 2BRGA 4FE2A 3P86A 3MGYA 4FIJA 3ALOA 4Y72A 2W1IA 4L3JA 1QL6A 5CENA 3OT8A 3KRJA 2FVDA 3VS3A 4E6CA 3MFRA 2UZUE 3L8VA 3FI4A 3RNYA 3LCDA 3VUKA 4JS8A 5A46A 4NT4A 3VC4A 4J97A 1VEBA 3BPRA 4ZIMA 1KE8A 3KGAA 3QX2A 3B8QA 2JDRA 3K3IA 4UB7A 5AJQA 2F7EE 4NZWB 5AUVA 4EJNA 4F08A 5CF5A 2Y4IB 4JDIA 4NJDA 3HAVA 2ZDTA 4GG5A 4NL0A 4BGGA 1KSWA 3SVVA 4AFEA 2VX3A 3IW4A 3UVRA 3DY7A 4FG8A 1PF8A 2XB7A 4JG6A 3EKKA 3FMLA 1FMOE 5BVWA 2VD5A 4EHGA 5CTPA 3BYVA 5AEPA 3VRYA 5F94A 4IACA 3VS7A 4BZDA 5EW9A 4ONAA 4AE6A 2VAGA 4XP2A 3OOMA 5M4UA 5A4CA 5EHLA 1H01A 4RC4A 2Y9QA 3FMMA 3QALE 4R7HA 3EN9A 1NVQA 3R7UA 1PYEA 4HGTA 2GS7A 1LEWA 2W9FB 3PJ1A 2A4LA 1W7HA 3ANRA 3TG1A 5FGKA 4O6EA 4D2VA 4EC9A 5AA8A 5F4NA 4IVBA 4CV9A 3VS0A 2HW6A 3H3CA 3FI8A 5IF1A 2OG8A 4QQCA 3UOKA 5FUTA 1SNUA 4FV0A 3ZSHA 4JR7A 4M14A 2C0OA 2R3LA 4XYFA 2O0UA 5CS6A 1NY3A 5AP5A 5HVJA 3VBQA 4GIIA 4IX6A 3CJGA 5J8IA 3RAHA 5ACBC 2QKRA 2JIIA 4P90A 2WEVA 2HWPA 2XBAA 3Q9ZA 4E5AX 2JD5A 2NO3A 4L7SA 3A7IA 3QRUA 4J96A 5DNRA 4ZMEA 2GNGA 2IW6A 3U6IA 3QYWA 4JBQA 3H30A 3I0OA 3QZHA 2CMWA 3H4JA 4X3FB 2RIOA 3HV5A 4R1VA 3ZRKA 4IB1A 4FNWA 4JRVA 4MYGA 4FSWA 2R5TA 4HPUE 3TTIA 3UMXA 3MFTA 2PK9A 3IQ7A 4FIFA 5BYLA 4M69A 3SW4A 2B55A 3ERKA 3A7JA 5HD4A 4CG9A 2CKQA 2WTKC 3FZRA 3L9PA 5KMJA 4C4HA 2WD1A 2UZOA 3QCYA 3D5WA 3VRZA 2J0KA 4U3ZA 2IN6A 5EI2A 2FSMX 4YJQA 3RWQA 3TNHA 3DKFA 4IB0A 1KWPA 3PTGA 3GC0A 5KUPA 4BKZA 3COIA 2QVSE 4MEDA 4QPSA 2NP8A 4ACGA 4B7TA 5I3RA 3C4XA 3TV6A 3JPVA 3U9NA 4OAVB 4O7VA 1XJDA 3UIUA 3BHVA 4R6VA 3Q3BA 3ETAA 1W82A 2XVDA 3CY3A 4DFNA 3SD0A 2I6LA 1QMZA 1R78A 2GS2A 4BCOA 5KMNA 2F9GA 4OR5A 2LAVA 3U54A 3DBDA 3FPMA 3OWPA 4G6NA 4FKTA 4H3PA 3F3VA 3FC1X 2F4JA 3HV7A 4F9YA 3S1HA 2YM8A 1V0BA 1OIYA 1Y57A 2B1PA 4IMYA 2GNHA 3ELJA 2VO3A 5CZHA 5H8GA 4FG7A 3T8OA 3TV7A 5KBQA 4DFZE 2ETKA 4CRSA 1W8CA 5KZIA 3V04A 2QO2A 3Q60A 3TWJA 4IC8A 3CQEA 2QG5A 2JBOA 4I5PA 4PMTA 4WO5A 3VUMA 3QTIA 4EI4A 5DGZA 1U54B 3GC8A 4I4EA 2FUMA 4EOQA 2C6OA 3O71A 3WZEA 3D0EA 2YIYA 3DFAA 3IG7A 1WBPA 4FSRA 5CAVA 3FI2A 2Z7QA 4R3CA 1XBCA 4E4NA 2GHLA 3HMNA 2OGVA 3NNUA 3ROCA 3W8QA 2O5KA 3FMEA 2PVKA 4HNIA 2Z7SA 4AE9A 1ZYSA 2PSQA 1TQIA 3U6JA 4XH6A 3QQHA 4EK4A 2UZVA 2JFMA 4M68A 2VTAA 1H1PA 2QURA 4JOAA 5I0BA 2XH5A 4EH3A 3PXKA 1W0XC 5EHYA 2G1TA 4F9WA 3F6XA 2UW0A 5ANJA 2ZM3A 4Y5HA 3GUBA 1FMKA 3ZM4A 3KRWA 3OWJA 4EQMA 5ETAA 4U8ZA 2H34A 2GQSA 3G6HA 1W84A 3PP0A 5EDRA 3RCDA 3U4WA 4TL0A 5JSMA 5H8BA 2R3PA 4AF3A 3Q5IA 4F65A 3DB6A 4EH9A 3GEQA 1RDQE 3OP5A 5CVGA 1FVTA 4O7LA 1SVGA 1WBWA 3W33A 3A4PA 2VWYA 4MXXA 4YJRA 2ZOQA 2XMYA 4DFYA 5AUZA 3UC4A 4EHEA 3W1FA 1XBAA 4AT5A 4ACHA 3O0GA 2XK4A 2BZJA 2FB8A 1A06A 1JNKA 2PULA 4BWKA 3ROYA 3GOPA 2HZNA 4XG9A 3E7VA 3W18A 2BAQA 3W2RA 5CY3A 1PXNA 3DAEA 3DKGA 4TY1A 4Q9ZA 4DF3A 2BZHB 3E92A 4FYOA 4E4MA 3FLYA 3U4UA 5GJGA 2JDTA 5M4IA 4L00A 2VTRA 5BYYA 3IO7A 4PUZA 3ZFXA 4AOIA 2R3HA 3DGKA 2QI8A 2XZSA 3ZYAA 3TZ8A 4EK6A 3EWHA 3OD6X 3PIZA 2J6MA 3AC4A 1Q5KA 3ZUVA 4JRNA 5J1VA 3MTFA 3QD0A 1CDKA 4F7NA 3WF9A 3BBWA 5I9WA 4RIWA 1YVJA 4PDOA 5C4KA 2I40A 2W0JA 4PL3A 4ZLYA 5HU9A 3LLTA 3ORMA 5K0XA 3NDMA 2ZM1A 2CHLA 4ZLZA 5M4CA 3R71A 2YISA 4LUDA 1REKA 3WZKA 1OL5A 2IZUA 5KE0A 1OM1A 1YOLA 2BFYA 3R8MA 3RJCA 4N6YA 2I0YA 1OPJA 4FIIA 3W32A 2ZMCA 5IH6A 4KUJA 4ZTSA 3GNIB 4Z7HA 4USEA 3NGAA 4F1TA 3ACJA 3FLQA 5HTCA 5F95A 3BYSA 3DXNA 5CX9A 1LR4A 4G3CA 4L67A 3EQHA 4PMSA 2Q0BA 2UW3A 4ANNA 4WHZA 5A4EA 1QPDA 3U9CA 3RHKA 4CSVA 4PWNA 3R02A 1SYKA 3FL5A 4C33A 4RJ6A 3QC9A 3HMIA 4MVFA 1OKVA 2XBJA 2C69A 5CEIA 1ZWSA 3UQFA 2EWAA 4FG9A 2JAMA 4HCTA 2YCSA 4C35A 3P5KA 3I1AA 4KIPA 3G9NA 4MF0A 5EYCA 4NTSA 4FTIA 5EI6A 3ZRLA 3NUNA 4BGQA 4BKYA 2RGPA 5LXMA 4W4XA 5AP6A 2R7IA 5CQWA 3R7VA 4GEOA 4K9YA 2RSVA 4FT0A 4BI2A 4AZSA 2YDJA 3DKOA 4ZAUA 3FMNA 1SVEA 2XNOA 3DK7A 3OC1A 2QU6A 4GSBA 1OL2A 3RPRA 5BNJA 2OXXA 2WTVA 3KK8A 4QMMA 4D5KA 3M2WA 4EZ7A 4WBBB 4HCUA 1YDRE 4W8DA 3ZFMA 4ZS4A 3FXWA 2QOQA 3EQPA 4RSSA 3RBWA 3VNTA 4E5BA 3ODYX 4YBJA 3RK7A 3BHTA 5IA0A 1CTPE 4C57A 4L46A 1AD5A 1KE9A 4FL1A 4N70A 4EOKA 4H05A 2KULA 1CKIA 4M12A 2PMLX 3JR1A 4YTHA 3ZOSA 3BHUA 4ACCA 3MJ2A 2NRUA 5AMNA 2C6EA 4M0ZA 1OL6A 2HIWA 1SMHA 4IDVA 4I0RA 4IAZA 4PV0A 5FXSA 4BDHA 1YI3A 3VJOA 3RK5A 4L6QA 2B9HA 3LVPA 4RVTA 5CALA 4RWKA 3S95A 4DFLA 4XG4A 3COKA 3UPXA 4BC6A 3HAMA 1PXKA 4L53A 3O50A 5T6KA 2BUJA 2Q0NA 4TWPA 4TYHA 1IA9A 2BKKA 2WOUA 4S34A 4AZFA 5DR9A 2GFCA 3LXNA 3PP1A 4HGSA 3Q4ZA 5AX9A 1J7LA 2AUHA 4NW5A 1ZOEA 2J50A 2C5OA 2Y6MA 1U5RA 5ACKA 1OKZA 4RGJA 5JH6A 3PSCA 5AP7A 5CAPA 2XUUA 4RX7A 5AR2A 1IG1A 3H0ZA 4RZWA 5HCYA 2OZAB 3GQLA 4A9TA 5FM2A 2X8DA 3QWJA 5A14A 2H6DA 5IH5A 1OECA 3C0GA 4N4SA 5CAOA 2QR7A 5L2WA 4FGRA 4FOBA 4YJVA 4BDIA 5AUTA 4PNKA 2GTMA 3ZS5A 4D4SA 3LCTA 2C47A 4GS6A 1JSUA 2H96A 4W4VA 4A9UA 3N4VA 2XYUA 3FLSA 3UQCA 2GDOA 3N4UA 2XJ2A 5H2UA 3D94A 4EORA 2J0LA 2QLQA 4QMQA 1OZ1A 4IQ6A 4ASEA 3OBGA 4N57A 4BIDA 1XWSA 3P7AA 2E9PA 4U42A 1Y6BA 3OWLA 5EM6A 3KULA 3KRRA 1KE7A 4ALVA 1FQ1B 3RGFA 5HO7A 2QC6A 4XMOA 2XIRA 4PMPA 4FZDB 4BDFA 3IPHA 1WBTA 3F69A 4IFCA 2VTQA 4U44A 4MQ2A 5AV1A 3EFLA 4C34A 4CV8A 5L2IA 4CCUA 4DBXA 1R39A 1L8TA 4FKPA 4ENXA 3SHEA 2BRHA 3ZO1A 1GZ8A 3CLYA 5HG9A 4XG6A 4RFYA 5LARA 5CSWA 4L01A 4DEGA 3VF9A 4AW0A 4V01A 3UOJA 2UZTA 5BUJA 3AGLA 3MY1A 4I0TA 2Z2WA 3BWJA 4BHNA 3R22A 3R2YA 3KK9A 4YUQA 4Y73A 4OUCA 3ZC5A 2ETRA 3KRXA 3REPA 2VGOA 3F2AA 1KE5A 2BILB 2R3FA 4MD7E 3UNJA 4YSJA 4F9CA 5FLFA 2UV2A 5EYKA 4ACDA 3LMHA 5JZJA 1YWVA 2B52A 4AT3A 2BAJA 1FOTA 4HGLA 2UW9A 4I6HA 2XEZA 3ZC6A 3NLBA 2WIPA 4LRKA 2JKKA 2Z60A 3PZHA 4FC0A 2ITZA 1OUKA 3LQ5A 3CS9A 2PTKA 3Q6WA 3FQHA 4K18A 2I0EA 5C03A 1MRUA 4C2WA 3BLRA 4PQNA 5K0KA 5IH4A 4WKQA 3S4QA 2J7TA 2JDVA 5DT4A 5E8VA 5LVNA 4G1WA 4HZRA 4YJPA 5E8YA 1H28A 3IW7A 3MH1A 2RKUA 4I6BA 1STCE 3QYZA 3QKLA 2B7AA 3C0IA 5A4QA 4M13A 4IAAA 4QQ5A 4FA2A 4RC3A 3BU5A 4DA5A 5HBHA 2XP2A 4BCPA 2J0MB 2C30A 2R3OA 4RFMA 4I22A 2JEDA 3F82A 4YTFA 4XUFA 3UOLA 5FM3A 3FJQE 3SXFA 4FNZA 3THBA 4BDBA 3PXQA 3QQLA 5CQUA 4O96A 1U59A 4QTAA 3PJ3A 4DH1A 4MH7A 3BV2A 3W10A 2YCFA 2IO6A 3KXNA 4O82A 2YLFA 5HCXA 1B38A 4D0WA 3RWPA 4R3RA 2FA2A 3ET7A 4JVGA 2ZB1A 3LIJA 5DBXA 3CBLA 4ZK5A 4PP7A 1IRKA 2OJJA 3GCPA 4MXAA 4ARKA 3DXPA 1ZMUA 3AT3A 5E8ZA 3PPKA 4ZY6A 2XNGA 1Q41A 2GNJA 4LMUA 1H1WA 2GNFA 3LXKA 4EOLA 3P78A 1OGUA 2NRYA 5IISA 4DFUA 4E7WA 2UZLA 1YDTE 4RIXA 5E7RA 4FV3A 4IM2A 4BDAA 4RIYB 4NK9A 5JRSA 4DINA 5BVFA 4CKJA 3KQ7A 2VNYA 4MD9E 5AR4A 4EKKA 2VTOA 2XK8A 5TT7A 3UZRA 4FTUA 4EC8A 4S31A 1JAMA 4O27B 3UP7A 4QMOA 3NYNA 4FL3A 3UG1A 5KKRB 5AP4A 1JKSA 4II5A 3F9NA 4NYEA 2GHMA 4JIKA 1OVEA 2VX0A 1RJBA 4I3ZA 1KOAA 2JIVA 2UW7A 4RZVA 2CJMA 4JQEA 2IW8A 5JGAA 4S30A 4KAOA 1MQ4A 1JSTA 2B9IA 4WSQA 3QD2B 2P4IA 3RZFA 1YWRA 2ITPA 4O91A 4QP1A 3NAXA 4FV6A 5D12A 4ZSGA 3SRVA 3VIDA 2QOCA 3F5PA 3IDCA 4FV2A 3TV4A 2XK7A 5FDPA 3MFUA 4FR4A 2WTIA 4KRDA 3WF8A 4NUSA 3FLWA 4TZRA 3TL8A 3LFFA 2G15A 4BDCA 4LV5A 4DH7A 3D2KA 1M52A 2CKEA 3R7OA 2IW9A 2CNUA 5DT0A 3UYTA 5TOZA 4ZY5A 4A4OA 3DLSA 4RJ3A 3OG7A 3DK3A 3DBCA 5AUUA 4LFIA 2XJ0A 3T9TA 5IQFA 4FKUA 3MIYA 1Q3DA 3OXZA 4NSTA 4D1SA 3CE3A 4ZTLA 4R3PA 3WIKA 4ASDA 2GS6A 1Z57A 3C13A 2J0IA 2ZV9A 1P2AA 4QMZA 4EOMA 5CF6A 3ZM9A 3ANQA 2A2AA 3D5XA 3HX4A 2I0VA 2OSCA 3KB7A 2XCHA 3DQWA 2O65A 4LOQA 3CD3A 5ETCA 4CMOA 5CEOA 2PZRA 2B0QA 2YIWA 3VQUA 4EOOA 4RLLA 5CANA 3UTOA 3NYXA 4FSYA 3R01A 5HG7A 4UN0C 1A9UA 5BUIA 2BROA 4MK0A 4I23A 1UWJA 3DTWA 4GU9A 3F5UA 1VJYA 2BZIB 2GMXA 5A4TA 3PWYA 4OTHA 4G2FA 3P7BA 5EKOA 4IX5A 2BR1A 4L8MA 4ZXTA 2BZKB 4MTAA 3UODA 1RE8A 3VS2A 3PPZA 4QRCA 4B8MA 3PZEA 4MX9A 4QYEA 3VULA 4AW2A 4LGGA 3K5VA 4ZZNA 4J8MA 5DYJA 4YPDA 5FTGA 4XV1A 3MYGA 3V6SA 2GCDA 2Z02A 4MCVA 2OWBA 1UNHA 3KMUA 2VWZA 1BI7A 4D4VA 2OKRA 3V5PA 2UZNA 5IPJA 4AQCA 4JNWA 3R9DA 3VWAA 2FGIA 3HA8A 4U5JA 3ORIA 3NIZA 3U51A 2PVMA 5J95A 1PJKA 4QTCA 3TUBA 4CCBA 3ZBFA 1JKLA 4AAAA 3S3IA 3E93A 4M7IA 4QTDA 4AW5A 3Q2MA 1Y6AA 2AC3A 4FZAB 2ITQA 2W1FA 4KKGA 3U8WA 3SC1A 4QPAA 4XLVA 4U7ZA 4O1OA 5HO6A 3QAME 4EZ3A 2FH9A 3M1SA 2IZSA 2WZJA 5E90A 3OWKA 3ZBXA 2C0TA 2WMWA 3H9OA 4BWPA 3AC3A 1QPCA 2OZOA 3FSFA 3PVUA 4FTQA 2PVJA 4JDHA 1M2RA 4E6QA 1PXMA 2P33A 5C8NA 5CF8A 3BEGA 1PRYA 2X39A 3UIBA 3LLAA 4R78A 4BF2A 2HENA 4CEGA 3V01A 4O7SA 3CQWA 4TPTA 3WIGA 2VTIA 3CC6A 5AV4A 5IUIA 3HZTA 1UU8A 3AT4A 4AN3A 4C4EA 2GQRA 5E8UA 3R63A 2GFSA 2W7XA 4QYYA 4FEUA 3CTJA 5F9EA 4RWIA 5L2QA 2R4BA 5KBRA 4GT3A 3GCVA 5HNGA 3ZXTA 3Q4UA 4XBRA 2WMTA 3D9VA 4EBWA 1KV1A 3ID6C 4BR3A 4NW6A 5EDPA 2O64A 2XKEA 2UZBA 4GYIA 2PVRA 4XEYA 4PF4A 1H0VA 3FV8A 3GXLA 3KMWA 4E6AA 3NMUF 3KXHA 3F3WA 1PMNA 3LXPA 4L44A 3CEKA 4CMTA 2CSNA 4HGEA 4GJ3A 4DC2A 1FINA 4FKSA 3DBQA 3BKBA 1YXSA 5BMSA 2G01A 3WF5A 4DEHA 3RAWA 3C4WA 1M2PA 3QRKA 4QMVA 4EWQA 4DTBA 2X7FA 2BDWA 3C4ZA 3ULZA 2X9EA 3G51A 3ZZWA 5FQDC 3E62A 3D7TB 5J87A 2P2IA 3HKOA 2VUWA 2R3MA 1TKIA 4GFMA 1MUOA 4BZNA 1M7QA 3Q4CA 4P5ZA 3SV0A 1CM8A 2PVLA 3R9RA 2PY3A 2YDIA 3ZH8A 4AX8A 4GU6A 4LOOA 5AR3A 4D58A 3PXZA 3R1QA 4I6FA 1H24A 4BCFA 4CFVA 4MBJA 1YXTA 4X3FA 4G6LA 4NKAA 2R2PA 1B39A 2GHGA 3OTVA 4JG7A 3VVHA 4W9WA 3NNWA 3UQGA 2J5EA 3CKXA 4YLJA 3TTJA 2PUPA 3EQGA 5IA4A 2CGUA 4MD8E 5CVHA 4IM0A 3DT1A 2YZLA 2WMRA 3FQEA 3KFAA 3BLHA 3EB0A 4OAUC 2HWOA 4K2RA 1U5QA 4FKVA 4NIFB 5M06A 2C0IA 4KIKB 5A54A 2YM5A 4K77A 1OKYA 5I9VA 3RM6A 3LFSA 4ZTQA 3A60A 5LQFA 3GU7A 3F5XA 2ITVA 1YI6A 4FT5A 4KWPA 4ZTHA 4F6WA 3ZLWA 3QA8A 5BVEA 5IKWA 5CT0A 4A9SA 3Q2JA 3LJ2A 4BTFA 2YERA 5BYZA 1RW8A 2JDSA 3F7ZA 5IQEA 4LI5A 4QMYA 2GTNA 4ZJIA 4F70A 3OZ6A 3QL8A 3RCJA 4TTHB 4U3YA 3VBWA 1H07A 2UZDA 4IEBA 1P4OA 2YCRA 3FEGA 3A7HA 5KMIA 3F61A 4ZTMA 3U55A 2W5HA 3BI6A 4RLKA 5DRDA 3VBXA 3QQJA 4UYAA 4OW8A 4MNFA 1OMWA 3EQDA 5EHOA 2W1GA 3TEIA 2F7ZE 4XS2A 3W2OA 2ZV2A 2JKOA 3VW6A 4XOZA 3VUDA 3EL8A 4G31A 4KA3A 2WMVA 4EJ7A 3VUGA 4JI9A 3IECA 1UVRA 2X0GA 4IWOA 5AX3A 5EYMA 1XH7A 1ZMVA 4EYJA 4FKRA 2C5NA 2WU7A 2QOHA 4X0MA 3HRFA 3BE9A 5FEQA 5DR6A 3M42A 3Q9WA 1AGWA 3SLSA 5LMBA 3BCEA 3Q52A 3HP2A 4TN6A 5EOLA 4QYHA 3O96A 4ERWA 3V5JA 3LHJA 4D2RA 3EKNA 1O9UA 5D41A 4TRLA 3UG2A 5CASA 5EQEA 3HL7A 4AZTA 3SXSA 3NWWA 4X6QC 1ZZLA 4IAFA 2BDFA 3VQHA 2PVNA 3BHYA 3TI1A 1H00A 4E1ZA 5HQ0A 4CYIA 3F3TA 3V8WA 3T3UA 3RAIA 1YKRA 3WBLA 5F20A 5IA5A 2FO0A 5E4HA 4U79A 1Y91A 2C6IA 2ITTA 1PHKA 4FIHA 3AD5A 4GH2A 4F09A 3Q5ZA 3R8PA 4Q5EA 1OIUA 3MBLA 2YM6A 3UIXA 3PDTA 1QPJA 2X7GA 3G0EA 4IWQA 3SAYA 4BCGA 5KO1A 4O86A 3PY3A 4PPAA 4GKIA 4UMRA 2QHMA 4PMMA 3FXXA 4IZ5A 3SKCA 4AT4A 2IZTA 3LFNA 5HLWA 3MDYA 4IAYA 4MAOA 3MPAA 4UBAA 5B2KA 4EH8A 5IA3A 4YNEA 3C4EA 4BYIA 2RG5A 3ZSGA 1PY5A 4DGNA 4XG3A 4YURA 3WOWA 4I21A 2BRBA 4HOKA 3IW8A 4FTMA 5I4NA 3ALNA 2BHEA 1BL7A 3IW6A 1PW2A 4BDEA 5CXHA 4TWOA 2GQGA 4LOPA 5HEZA 4X2FA 5EDQA 1NT2A 4YZBA 1SNXA 3L8PA 3PRFA 2PL0A 4CQGA 5CEPA 3RZBA 5DMZA 3SOAA 5IDNA 5L4QA 5FP5A 2HW7A 3NVMB 1G5SA 3PVBA 4B4LA 3ORLA 3I4BA 3V8SA 3TNQB 3QGYA 5IEXA 3UO6A 5A3XA 2BTSA 4A7CA 4AW1A 4AOTA 4UEUA 2VV9A 4E8AA 4ZOGA 3LJ1A 3UOHA 2J90A 3HMMA 4FV7A 4J52A 3ZLYA 5FP6A 4EOIA 2DWBA 3DV3A 4DTAA 4BICA 4UZDA 4XBUA 4NKSA 2CN8A 4F1OA 2Y8OA 4D2TA 5J7BA 2OJFE 3I60A 5CSVA 2UUEA 2R3IA 1Z5MA 4F9BA 2BAKA 3QXPA 3QTSA 4I20A 4PL5A 3W2CA 3ZDUA 1J7UA 4CFUA 4E5WA 3KREA 3D5UA 3TIYA 5GZ9A 5HNIX 3JVSA 1PMUA 3FUPA 2IZRA 5HTBA 3VS5A 4LL0A 3ZDIA 3PIYA 2PPQA 2YHVA 1Y8YA 1CKJA 2FSLX 1JKTA 3GFWA 2Z7RA 3D4QA 1QCFA 3FYJX 2YFXA 1Q3WA 3C0HA 3LMGA 3QFVA 1FVVA 5E8WA 1GNGA 2GNIA 3VUTA 5TE0A 3QWKA 4C4FA 2OJIA 4FNYA 4BCKA 2OH4A 2QOBA 3UDBA 2WB8A 1BMKA 3D7ZA 3DFCB 3PY1A 4X3FC 4FSZA 2X8IA 4EHZA 4CKRA 1G8AA 3KCFA 5CU0A 3FY0A 2OH0E 3UC3A 4QP6A 3NPCA 2Y6OA 4XLIA 4H3QA 3COMA 4QP2A 3QCQA 4BDGA 4EOJA 4F0IA 3SG9A 4M69B 2H9VA 5AADA 2JKMA 5KMOA 5DR2A 3BU6A 5HD7A 4YC6A 4EUTA 5CNNA 4ZLOA 4R7BA 3C7QA 3CTQA 4NM5A 4Q5HA 4BCIA 4LV8A 2PZ5A 5C26A 5AIRA 2PYWA 1G3NA 4KKHA 3ZSIA 1YHVA 4P5QA 4A4XA 4KSQA 3T9IA 4G3GA 1J1CA 5JZNA 5M55A 4IH8A 4RVLA 3LFDA 3VJNA 4FT9A 4PNIA 4AFJA 4O81A 1FVRA 4GRBA 4DCAA 3Q9XA 4WG4A 4GUEA 3TUCA 3E5AA 4B99A 3R04A 4KIOA 1IAHA 2ZAZA 4USDA 3R8VA 3NR9A 3RKBA 3F88A 3JUHA 2VX1A 3CKWA 3HUCA 3ORNA 5FXQA 4O0UA 4KS8A 5HNBA 4D2SA 2WELA 2UW4A 3MB6A 4GT4A 4CFXA 2G9XA 5E92A 3LJ0A 3VBVA 5AUWA 5DEWA 4APPA 5M51A 2VRXA 3VUHA 1DS5A 3IGGA 5CF4A 3MFSA 2QHNA 4GFOA 2C6DA 2VO7A 3POZA 3QKMA 2KTYA 1F0QA 5HVKA 5L2SA 2FSOX 3QKKA 4FTTA 3AMAA 4J95A 4U9AA 3OY3A 3LXLA 4YPSA 4XP0A 3QTZA 3CJFA 2X2MA 5L8JA 4ZSLA 3OW3A 3LCKA 4V0GA 3FLNC 4YJNA 3ORXA 4DGLC 2G2IA 3ENMA 3N4TA 1RQQA 3HMOA 4TYJA 5CEMA 4MWHA 3TDVA 4MHAA 1V0OA 5IDPA 4AN9A 2HY0A 4XJ0A 4KKEA 2QOKA 2DYLA 3UNKA 4FEXA 2QR8A 3PXRA 4LYNA 5EM7A 5ANEA 3UZPA 2FYSA 4ASXA 3R00A 5AA9A 2J4ZA 2XCKA 3MS9A 5C27A 2WU6A 1OPKA 4IFGA 2XIKA 4IZYA 4TT7A 2OK1A 2YACA 2PZPA 2PE1A 2XNMA 3MJ1A 2VU3A 3A99A 3BQRA 4RG0A 4IXPA 3BU3A 1CSNA 3DB8A 3DBEA 1XH6A 3HEGA 3QQFA 4Q2AA 3RPOA 5KX8A 2W5BA 1XR1A 4YZCA 3AC2A 3B2TA 3R1NA 1J1BA 2DS1A 3FZ1A 4YC8A 1DAYA 5L6OA 2V5QA 4HNFA 4U0IA 4YC3A 4QQJA 3L9MA 3C5UA 3NNXA 1WBNA 2V22A 3TNWA 5C8KA 5HX8A 4OT6A 3UZTA 1Q97A 4ANBA 5LCJA 2HXQA 4R5YA 4GJ2A 4O22A 4B6LA 1PXJA 2PVHA 5ANOA 4JL9A 3JY0A 5CXZA 5CSPA 3OUKA 4MKCA 1UNLA 4PDPA 1PXPA 5CU2A 4L68A 5IZFA 3JYAA 4JT3A 4BCQA 3MI9A 3LMIA 4O84A 3TKUA 5B2LA 2E9UA 3G90X 3MVHA 2C5YA 4FSTA 2ZMDA 1R0EA 2ZVAA 3L8XA 4YJTA 4YZDA 5ETIA 1XQZA 3R8ZA 2WQBA 3TCPA 3G15A 3PXYA 3EMGA 3ZCLA 2WMXA 4BDJA 3IOKA 5G6VA 4EH5A 4HVIA 1WBSA 3UGCA 5BVOA 4E6DA 3UNZA 4I0SA 4OGRA 2YDKA 4OTGA 5HE1A 5IEYA 2VTTA 3EH9A 4MBIA 3KL8A 2XM8A 3CY2A 2WFYA 3WILA 5M4FA 1UU3A 4DEAA 2Q83A 3UYSA 1YOJA 4S32A 3QQGA 2PVFA 4FX3A 5M56A 4NWMA 4BI0A 4PP9A 1XH5A 2QG7A 3A7GA 4L52A 3CP9A 4FBXA 3WZDA 4JAJA 4JIAA 3MW1A 4GG7A 4RIWB 3BZ3A 2ZB0A 4PTEA 4X7QA 2VZ6A 4FIEA 5E1EA 2XK9A 3ACKA 2UW6A 4EWHA 1YOMA 5I9XA 2CGWA 4QP9A 3H9FA 4LUEA 4RRVA 2W9ZB 3TACA 3FC2A 5JFSA 3T3VA 2QODA 4DAWA 4LGDA 3QD4A 5IUGA 2VNWA 3OEZA 2J0JA 3OT3A 5AM6A 1JWHA 3ZUTA 4C4GA 4C7TA 4M15A 4OTIA 4C3RA 4YHFA 2GPHA 4YGAA 4CXAA 5M53A 5D1JA 5BVNA 3DBFA 5FBOA 2YM3A 4ANQA 4RX5A 3SGCA 5IQGA 3FKLA 3NW7A 5HTIA 4O0XA 3R1SA 3TJCA 2CDZA 3IK3A 1PXIA 3NUUA 3PJ2A 4GFGA 5J5SA 2PU8A 3RI1A 2XS0A 3RP9A 3ZRMA 3R28A 2Y4PA 4RVMA 4BY9E 3KKVA 3QTRA 3F3UA 2CN5A 5ITAA 2ITWA 4TWCA 3KN5A 1GJOA 1TVOA 3MPMA 3P23A 4M0YA 4EHVA 4L3PA 3QD3A 4AGUA 4U45A 4G17A 1CMKE 5HESA 4CT1A 3RAKA 4FTAA 4YBKA 3DS6A 3GBZA 3O7LB 1XO2B 3E8DA 4WUAA 5K9IA 4CG8A 4KINA 1YXUA 4NFNA 3TN8A 3UPZA 4IVCA 4BKJA 4EONA 2C3IB 2OJGA 4OLIA 3ATTA 2CCHA 2WIHA 4QQTA 3R21A 4U80A 3AG9A 2QO9A 5DRBA 3A62A 2ITYA 4YJSA 5E8XA 3IDBA 3UVQA 1H0WA 2OIQA 3NYVA 4CKIA 3LM5A 4F6UA 1PMEA 2AYPA 3ENHA 5ANGA 1YDSE 5AWMA 2WHBA 3EN5A 2XA4A 5GZAA 2PUUA 4YLLA 3RHXA 4F7JA 5GIOE 1H4LA 4O21A 3NW6A 5IUHA 2JKQA 4PTGA 2C5VA 4TYHB 2BKZA 4CFNA 3RM7A 5E8TA 2QLUA 4C4IA 3FXZA 2VWVA 3F7WA 3BEAA 4GW8A 3VN9A 4JBPA 3GGFA 2PE2A 2REIA 4ZSEA 3WYXA 4AACA 5AV0A 5KNJA 1PYXA 3I79A 4APCA 2X9FA 2OIDA 4R7IA 4XP3A 3ZO4A 4L3LA 1UU7A 3WE8A 3DQXA 5KMKA 4ENYA 3DLZA 3FL4A 5JQ8A 1GIJA 2HZIA 2I0HA 3PJCA 4EH6A 3GI3A 4NCTA 4C2VA 5J9YA 3KRLA 4PRJA 4IVDA 5IA1A 4QTEA 3LCSA 2VWUA 3K3JA 3MA6A 4MNEA 3F5GA 2W1CA 4I93A 5DA3A 3W8LA 4G3FA 5HIDA 4AGWA 4BCMA 2P55A 5GHVA 2C3KA 2JFLA 4O7RA 1XH4A 3ZHPC 5JGBA 4C02A 1O6KA 3TZ9A 3KF7A 4O83A 4AP7A 1HOWA 4BRXA 1Q61A 2BCJA 3KULB 1ATPE 3GCSA 3PVWA 3BBTB 3RALA 4Y85A 3R73A 3KC3A 1URCA 4I5HA 4B0GA 4OTQA 1H1QA 2XKCA 3IONA 3PJ8A 4WG3A 4Y5QA 2YZAA 3WARA 1R1WA 2OO8X 3EYGA 3ORKA 4JJRA 4XNEA 3ZUUA 3FMHA 3AOXA 1WCCA 3W2QA 4EK8A 4I94A 3K5UA 4I92A 3OFMA 4BTKA 5M57A 2HK5A 4HYSA 1ZLTA 1JQHA 2QCSA 2XK6A 3FMDA 3QU0A 4FV4A 4WRSA 3SX9A 4DGOA 4CYJA 2CKOA 5C9CA 5F1ZA 4DE4A 4DFXE 1OBGA 4YJOA 3R7GA 2E2BA 3EQRA 4YJUA 3EOCA 4IB5A 4C38A 2XK3A 3D14A 4WBOA 3UIMA 3VHEA 4A9RA 5M07A 3BLQA 4R1YA 1LPUA 3QZGA 1YHWA 2WO6A 4XRLA 2QOLA 4YSMA 2VO6A 4LRMA 3R0TA 4UWYA 3PA4A 3PVGA 4FVPA 2EB3A 2ETMA 3H10A 5CYIA 4BBEA 4ZY4A 3FE3A 4C36A 3FQSA 2WMQA 4CFFA 3CCNA 4FIGA 3L9NA 2VTJA 3BELA 4WA9A 4CFWA 5KCVA 3PRIA 3WE4A 4E3CA 5D7VA 3SOCA 1IA8A 4XHKB 3LQ8A 2VWXA 1VR2A 4J7BA 5HI2A 3DNDA 2BRMA 2OI4X 4X3JA 3SG8A 3D2IA 5DOSA 5D9HA 5L3AA 5BPYA 4IWPA 1IEPA 3BV3A 3HDMA 4G3DA 4QNAA 2OXYA 1FBNA 3MPTA 4W4WA 5HG5A 3V6RA 4O0TA 1KV2A 1R0PA 3QF9A 4RJ5A 5IU2A 2XKFA 4PPCA 4YLKA 4D1XA 5GIPE 3HV4A 3C4FA 4PDSA 5BQ0A 3I0QA 5BUEA 2XRWA 3P1AA 4QTBA 4F7LA 4O1PA 4BBFA 1UWHA 3BIZA 4ZTNA 3CD8A 4XV3A 1UKHA 4Y95A 1GOLA 3GFEA 3HLLA 4JDJA 3H0YA 5I5ZA 4BCJA 4GL9A 4FGBA 5CLPA 3EFKA 2W17A 2PHKA 4KIQA 3VUIA 1V0PA 2WNTA 3ORPA 4H58A 2VTLA 2XNEA 2CCIA 1FGKA 3GENA 2UVZA 4RIXB 4F63A 3I5ZA 2R3QA 4BVUA 2X4FA 3BX5A 4PPBA 4O7WA 2CLXA 3KXMA 3QLFA 2W1EA 4TNBA 3W55A 2IVTA 4QYFA 4ZP5A 5K3YA 4N0SA 4TWNA 2W06A 3DCVA 4RA5A 5TR6A 1T46A 3NRMA 4HVDA 4UZHA 2ITUA 5IQHA 3VS4A 5IQCA 2JLDA 5AAFA 3QC4A 5H9BA 4WNKA 4R8QA 3GQIA 4DG0E 5IQDA 1XKKA 2ZV7A 4D2PA 5DVRA 1F5QA 3FI3A 3SRVB 4AA4A 4UXQA 1NA7A 5L2TA 3E3BX 5LWMA 5HCZA 1JKKA 3FHRA 4FEVA 3FY2A 4AU8A 2W96B 4KS7A 4CD0A 1ERKA 3PY0A 4D28A 2DQ7X 4OTPA 3F2NA 3V51A 4JBVA 2C68A 1V1KA 3DK6A 4WD5A 2GU8A 3Q4TA 3S2PA 4FT3A 4Z3VA 4O7YA 4H1JA 3PLAE 2BALA 3DNEA 4IM3A 4HPTE 2QU5A 2BHHA 1BYGA 4M84A 5AP0A 4DHFA 4FV9A 4JX7A 3D15A 1OPLA 4DT8A 4JX3A 1H27A 2V7AA 3N51A 2NPQA 4NCTC 1UA2A 2VTMA 4KD1A 1IAJA 4UWCA 2A0CX 2HZ4A 2F49A 3PUPA 4FI1A 3NUAA 1S9IA 2PVYA 4OTDA 2WQEA 4U43A 3BE2A 4USFA 1LP4A 4O0RA 3NVKI 4MXZA 3VHKA 5EI8A 4L9IA 2R3NA 4RT7A 1ZY4A 1W98A 2Z7LA 3LOKA 3GCUA 1ZZ2A 3G0FA 1J91A 2ZM4A 1EH4A 2QD9A 4NM3A 3EN6A 4O0VA 4HZSA 4HJOA 1KE6A 4W4YA 5HZNA 5DWRA 2PMNX 5EW8A 3VF8A 4ZJJA 2ERZE 5AAGA 2OFVA 2YAAA 5HHWA 4FTJA 4RJ8A 3JVRA 4K8AA 4BL1A 5HVYA 1PKGA 3WZJA 5HIEA 5ICPA 3D83A 5DE2A 5H8EA 3EQIA 5K4IA 3ZXZA 1R3CA 5JMSA 4ITHA 4OBOA 5CEKA 4ALUA 2C6TA 2W4KA 3AMBA 4IX4A 4FYNA 3UBDA 3GVUA 3ZTXA 2X6EA 2R0IA 4P7EA 5HBEA 1XBBA 1PKDA 3HVCA 2WMSA 5CWZA 5HBJA 3P9JA 1ZYDA 1GIHA 1GZNA 2I7QA 3DPKA 2B9JA 3V5TA 3R1YA 2XF0A 3MESA 1W83A 2WXVA 3RPVA 3FMJA 3MVJA 4RFZA 3BRBA 4QMNA 4LMNA 2WTKB 3A4OX 3WYYA 1ZARA 2OU7A 2G2FA 2HCKA 2ITOA 4IZ7A 2PZIA 4L7FA 5KMMA 2XNPA 3FZTA 3QRIA 4RMZA 5I9UA 4C37A 4I4FA 2PUIA 3FPQA 4UX9A 3F66A 4AOJA 3MTLA 4CVAA 4FKIA 2WKMA 4PDYA 1APME 4EH4A 5AM7A 3QUDA 3Q32A 3OCSA 4BYJA 1Q8UA 4JBOA 4M66A 4D1ZA 2O8YA 3A61A 3Q53A 5JN2A 5AV3A 2P2HA 4L43A 5JT2A 2J51A 2V62A 1Z9XA 3PE1A 4KSPA 3KCKA 4WOVA 5DFPA 4MXOA 4TXCA 4F4PA 4XV2A 3TKHA 2YJRA 2EXMA 3BGQA 4E4XA 3LFCA 4K6ZA 4QNYA 1J7IA 3A8XA 5GNKA 4E73A 3C51A 4H36A 3CR0A 1MRVA 2X6DA 2E9VA 4QOXA 5FDXA 1U54A 1TQPA 3AD6A 4FTLA 5IMXA 3E8CA 5GJFA 5ANKA 2O2UA 2X8EA 4QYGA 4KB8A 3MVLA 4M97A 4DH5A 4J8NA 4IANA 4D55A 3G33A 5HX6A 1YI4A 3RVGA 5HLPA 2R3GA 1JLUE 2WMBA 5KZ0A 2XEYA 1NXKA 2CGVA 3CXWA 4JQ8A 5CEQA 4V05A 3R7YA 2GNLA 3HMPA 3HYHA 5JFXA 4IHPA 5JEBA 1F3MC 2QKWB 1E9HA 4PY1A 4QP7A 2V7OA 4K33A 5A6OA 2F2UA 4UMPA 5B7VA 5EK7A 2BVAA 3PFQA 4YO6A 2IG7A 5L8KA 3NS9A 4GYGA 5LVPA 4RIOA 1O6LA 1WBOA 3RK9A 2IPXA 3DZOA 3PLSA 2R3KA 1UNGA 3KU2A 5EKNA 4CGAA 3C5IA 2F7XE 5AAEA 4EUUA 3ODZX 2X1NA 1T45A 3HP5A 2BTRA 4R5SA 3ZLSA 4A9YA 3JY9A 2C3JA 4WRGA 1YW2A 1JOWB 5M44A 4O7TA 4OTWA 4LQMA 1Q4LA 3H9RA 4Z9LA 3OVVA 3VBTA 3IGOA 3EN7A 4YO4A 4FEWA 3FLZA 3DDQA 3Q9YA 3P79A 3R7IA 3O8UA 4FKLA 5A4LA 3DAJA 2C6LA 4EOSA 2OIBA 1XH9A 2VWWA 3LZBA 3EQBA 1DI8A 4O0WA 3FZPA 3W2PA 4F7SA 2Y4IC 5KMLA 4I5CA 5AUXA 4YP8A 1ZMWA 3CGOA 3AGMA 4LRJA 4OBQA 3R9NA 2JDOA 3FAAA 1UV5A 3WF7A 4P4CA 4XG2A 3JXWA 4NM7A 4IJPA 4I5MA 3OBJA 4GUBA 5IA2A 5CSXA 4EYMA 5LVLA 5T3QA 4EH7A 4TYGA 3MY0A 4FUYA 1P14A 4WUNA 2OJ9A 3HA6A 2WTJA 1BUHA 3MN3A 3C4CA 5GZ8A 4NJ3A 4D9TA 5AFVA 1NVRA 1H8FA 3MH2A 4RX8A 3EQCA 5JQ5A 5HE0A 3QQKA 4AZEA 2XRUA 5TF9A 2YN8A 2VWIA 3DKCA 3R6XA 4Y8DA 3TNIA 4ZZOA 1Q8ZA 4J98A 3DAKA 5EM5A 1OB3A 5FEDA 2CLQA 1S9JA 3UP2A 3AC5A 2V55A 2IVSA 4MXCA 4C59A 3OW4A 3KF4A 2VTNA 2YA9A 5DT3A 2BPMA 4DLIA 2R3JA 3U87A 4DEBA 3R2BA 4FTRA 5HORA 3ZONA 3FKOA 4G6OA 4I6QA 2V0DA 2AC5A 4G9CA 5E1SA 4D2WA 3TUDA 2QOIA 3OXTA 4CMUA 4BB4A 2VTPA 3G5DA 4RWJA 2EVAA 3A2CA 1K2PA 4NH1A 2VWBA 3E3PA 4F6SA 2BIYA 3PA5A 2WQNA 3HNGA 4WSYA 3F3ZA 3BYMA 1OITA 4MWIA 5EG3A 2CNQA 4IC7A 2X4ZA 3E88A 4YZMA 4CT2A 3AT2A 4D0XA 2OLCA 3UMWA 2YEXA 3CQUA 4DGGA 5CAQA 4GK2A 2R7BA 5EOBA 3TT0A 2HXLA 5B0XA 4FZ6A 3IDPA 2RFNA 2B54A 1E1XA 5D11A 4FZFB 4CLJA 2XIXA 4NFMA 3HECA 5CI7A 3AMYA 2R3RA 4BCHA 3RINA 4UWBA 1E1VA 1MQBA 1VYZA 1UU9A 4JLCA 3R9OA 4C0TA 2OBJA 4CQEA 2CGXA 3DOGA 3GB2A 4AN2A 3GU4A 2H8HA 5EQPA 3GC9A 1Q8YA 2QO7A 5AR7A 2WGJA 2EXEA 4NEUA 4EQUA 2C6MA 5E91A 3GC7A 3O7LD 5CZIA 2Y0AA 2XIZA 4AGDA 3A8WA 3OTUA 4RVKA 1BL6A 4ITJA 4HVHA 3IW5A 3QUPA 4XX9A 3WF6A 2Y7JA 2QNJA 3KXXA 3FHIA 4G9RA 3EN4A 4X6RA 3PYYA 3UVPA 4KRCA 3NZ0A 5TO8A 4NTTA 3OMVA 4P2KA 1JBPE 4YNOA 4O2ZA 3HUBA 4HVSA 1P5EA 3OS3A 1GZKA 3COHA 3KA0A 3KN6A 4IX3A 3G6GA 1Q99A 3OCBA 4X21A 4XV9A 4YHJA 4CTCA 3LE6A 5CAUA 2CKPA 1YXXA 3OHTA 1XH8A 3EZRA 2IVVA 4AGCA 3S0OA 4GKHA 4UYNA 1K9AA 3NUPA 4K1BA 3OCGA 3II5A 2X2KA 4Y83A 5HE3A 2OZAA 4C3FA 5GINE 4ITIA 1Q62A 2PZYA 5CU4A 3ZLXA 4QD6A 4YZ9A 3ZEWA 1WVWA 1OI9A 4WNMA 5A9UA 2VO0A 4C61A 2F57A 4NM0A 5K4JA 2W05A 4FNXA 4H1MA 2XKDA 4C62A 1OUYA 3PE2A 2JITA 5CNOA 3V5WA 4RWLA 3MH3A 3EJ1A 3ULIA 1WVYA 2B9FA 4BHZA 4FMQA 4CTBA 2RL5A 2RFDA 2WOTA 3BHHA 4JG8A 4BZOA 3NUSA 2PWLA 2JC6A 3DJ6A 3GCQA 4CZTA 4Z7GA 3MH0A 2R0UA 1PMVA 1G8SA 3SDJA 3QTXA 3L1SA 5DG5A 1OL7A 3IOPA 4TNDA 5IQBA 4QMUA 3L8SA 4DEEA 3FSKA 3GOKA 4FTCA 1MP8A 5ANDA 3SW7A 3LM0A 3CTHA 1PXLA 2WQMA 4WG5A 3NSZA 4QMWA 3Q96A 3VW8A 3JS2A 1M17A 5I3OA 5L6PA 3EIDA 2A1AB 3OXIA 4IJ9A 1Q8WA 4N6ZA 3E8EA 3I6UA 4DH3A 2WTDA 5FWKK 4O0YA 4RBLA 3C9WA 3QRTA 2O3PA 3AXWA 5FXRA 3RPSA 3O23A 3K54A 5FBNC 1WVXA 4F99A 1YXVA 2E9OA 3GT8A 4DG2E 4FT7A 4J1RA 4JAIA 4NU1A 3DXQA 4E93A 2BDJA 4O38A 3PG3A 2PE0A 5LWNA 4KABA 4IW0A 4PX6A 1SM2A 4JXFA 3PSDA 4F64A 4DGMA 4ANOA 1JVPP 2W1HA 5FTQA 5IMEA 3FDNA 3GU8A 3HV3A 4ALWA 5J79A 5LCKA 3MVMA 4DCEA 4AUAA 3QCXA 3LCOA 5EYDA 3P0MA 4AXAA 4GIHA 3UO4A 4A07A 1H25A 3KEXA 1SVHA 4F0GA 5AUYA 4WT6A 3KVXA 5D7AA 2OF2A 3KVWA 1WMKA 1XHAA 3GP0A 3Q6UA 3DDPA 3HV6A 2XM9A 5HIBA 2BIKB 2ESMA 4G16A 2WMUA 1ZXEA 2JGZA 3C1XA 3QQUA 4FUXA 1O6YA 3NEWA 5H3QA 2F2CB 3P4KA 4DITA 3BQCA 4UMTA 4QPMA 4WNOA 1HCKA 3QXOA 4FVRA 3HRBA 4RX9A 5BX0A 4BCNA 5IG1A 4XG8A 2RF9A 5DLSA 1I44A 1BLXA 3DJ7A 3QCSA 2WAJA 2HZ0A 2RFSA 2OICA 3NNVA 2EXCX 4QMSA 5BMMA 3V8TA 4A06A 2VTHA 3UE4A 5J5TA 1GIIA 4CRLA 3QHWA 3FBVA 4AZWA 1NW1A 5DEYA 4U6RA 4XG7A 2IJMA 2QOFA 5DH3A 2A27A 4ACMA 3ZO3A 4RJ4A 4AG8A 5EM8A 1DI9A 2P3GX 4Q9SA 4FK3A 4DFBA 3BYOA 4UY9A 1URWA 5HICA 4IBMA 4KNBA 5JK3A 5LMKA 2IVUA 1ND4A 2ZJWA 2ZDUA 4V0GB 1WFCA 4O6LA 4X2NA 5FRIA 5AV2A 4BIBA 4E4LA 5M09A 1OBDA 4EL9A 4J53A 4AWIA 2WEIA 5TKDA 4FTOA 4BBMA 4BI1A 4M8TA 2ERKA 4D9UA 1MRYA 2J2IB 3BYUA 3BGPA 4FODA 4DBNA 2UVXA 5HG8A 3CPCA 1HCLA 2J5FA 4V04A 4CNHA 4RIYA 1SZMA 4GT5A 2HOGA 5LJJA 4KBKA 2YM7A 3V5QA 3DTCA 4MXYA 1OIQA 3KXZA 4YU2A 4L45A 5CI6A 4ZSAA 4HW7A 5JFVA 3O17A 2PUNA 3CSVA 4G34A 3I7BA 3LFQA 1B6CB 1KOBA 2YABA 4FV5A 1GZOA 3NCGA 5HE2A 2B4SB 1Q24A 4WNPA 2EUFB 4FKJA 3V5LA 4DYMA 1BX6A 2JAVA 4IE9A 4GMYA 1YRPA 4O2PA 4B9DA 2CNVA 5JGDA 2YAKA 3O8TA 2ITXA 2UZEA 2RG6A 3DU8A 3CIKA 2QONA 4OT5A 2ZV8A 1GAGA 3IS5A 2HYYA 1YHSA 2HY81 2YJSA 3VS1A 1WBVA 4FTKA 3FYKX 1NVSA 2YLEA 3DA6A 1GY3A 3B8RA 3PWDA 3VS6A 3LPBA 4Z16A 5JRQA 3RMFA 4XCUA 3SXRA 4W9XA 3OROA 3OCTA 5KHWA 2X7OA 4PL4A 4ORKA 4IAKA 4K11A 1ZOHA 4CFMA 2YIXA 1DAWA 3TZMA 4UMUA 5BVDA 4FL2A 4ZS0A 4G5PA 3NCZA 4FKQA 2W4JA 4YR8A 3LW0A 3OUNB 4D4RA 4DN5A 4MF1A 3E7OA 3MB7A 1PXOA 3P08A 2DUVA 3LFAA 4ZJVA 4HCVA 2BMCA 2C6KA 4HYIA 5HU3A 4QT1A 4BDKA 4BN1A 3DZQA 3VO3A 2OFUA 3BGZA 3QGWA 2ONLA 2C1AA 2XJ1A 2JIUA 3NUYA 3QZFA 3E87A 3TNPC 4YZNA 1M14A 3EFWA 3O8PA 3PPJA 4AZVA 2VGPA 3AD4A 5AP2A 4H39A 4B8LA 4HYHA 5B2MA 3EFJA 4ZZMA 4ASZA 4RQVA 5DI1A 4DG3E 5I9ZA 4FK6A 3R9HA 4YTIA 2RFEA 3R30A 3GU5A 4IADA 5DPVA 2WMAA 5FG8A 4F0FA 2I1MA 2P0CA 5KHXA 3KXGA 2C4GA 3PXFA 5GJDA 4D4YA 3LFBA 4RC2A 4WIHA 4CZYB 5LOHA 1UKIA 3UO5A 4BTMA 4X2GA 2OF4A 2FSTX 4DT9A 2NNWB 2LGCA 4Z55A 3CPBA 4I41A 3QUEA 4S2ZA 3FMKA 4KBAA 5AP1A 4GK4A 4YMJA 5I9YA 3AQVA 4AA0A 3PG1A 2Z8CA 5JFWA 2OXDA 1IR3A 2VTSA 4LG4A 1H26A 2WTWA 4DTKA 2XNNA 3NUXA 1LEZA 1LUFA 2C1BA 2JBPA 3QTQA 3ZMMA 4FEQA 3ATSA 5D10A 1WZYA 5AR8A 3W16A 3MY5A 4UMQA 4AA5A 3ZZEA 2YITA 4FTNA 3OEFX 4R77A 3PA3A 2OW3A 3QTUA 4XOYA 5CU6A 4ZMFA 5IQAA 3MWUA 1J3HA 1L3RE 2SRCA 3LAUA 2C5XA 5T68A 1A48A 3TDWA 1K3AA 3PIXA 1KUTA 1ZYLA 3RPYA 2YM4A 4QP3A 3FKNA 3TM0A 3B2WA 4C4JA 3ZFYA 3NAYA 4FSUA 3W2SA 2GSFA 3MIAA 2R64A 4EKLA 1QPEA 5C4LA 4GVJA 4FV8A 5IEVA 2IWIA 3I5NA 3QZIA 2UW8A 3E8NA 3N9XA 4O0SA 3RTPA 4LGHA 3TKIA 5J1WA 2BRNA 4LM5A 2ZYBA 4HYUA 3VBYA 5C01A
chains in the Genus database with same CATH superfamily
3NW5A 3I81A 4BIEA 3R7EA 3U6HA 3ZEPA 3ZO2A 2XYNA 4RA4A 1JSVA 4O7ZA 3IKAA 2J9MA 3FWQA 4UXLA 4EBVA 1AQ1A 2HAKA 2WQOA 4G3EA 3Q04A 4FOCA 4JR3A 4M67A 1ZOGA 4BFMA 5LMAA 2C3LA 3MV5A 5C1QB 1ZY5A 5LMKC 3M11A 1FGIA 1I09A 5E9EA 4I24A 5AIKA 4A4LA 3G2FA 3E64A 4F1MA 2YWVA 3DJ5A 3EL7A 2UZWE 3OF0A 4GK3A 5HOAA 4C58A 4IAIA 4RQKA 3I6WA 3LKMA 4FF8A 4EZ5A 1P4FA 5FD2A 3V3VA 3POOA 4CLIA 4EQCA 4QMPA 3VAPA 3D7TA 4MNEB 2R9SA 4UALA 4U41A 3QTWA 3SQQA 2A19B 4LL5A 5CT7A 3EZVA 2ITNA 1WAKA 2EB2A 5ETFA 4ANMA 4JQ7A 5L8LA 5CU3A 5HLNA 4IDTA 1ZRZA 4DEDA 4ZEGA 3O51A 5J7HA 3NIEA 4C8BA 5KKRC 4U97A 4Y46A 2X81A 2EU9A 3FZOA 1M7NA 4EK5A 2UW5A 3C50A 4FSNA 5DN3A 3QA0A 5K5XA 1ZYJA 4MUQA 3R8LA 5HGIA 4AS0A 4FZ7A 3TXOA 5J9ZA 5G1XA 1OL1A 4J71A 4H3BA 1VYWA 4IWDA 4RPVA 4X2JA 2W1DA 2O63A 4U40A 4UV0A 2PMIA 5DIAA 4OTFA 4BDDA 4FSMA 4NIFA 5DHJA 3AC8A 4KIKA 4JDKA 3KY2A 5LVMA 5FEEA 3EQFA 3OOGA 4O7NA 3TYKA 3ORTA 5HO8A 4DH8A 3QHRA 3QBNA 4FKWA 2W4OA 2YIRA 4GVAA 5HKMA 5IQIA 2QOOA 4L42A 4TYIA 4OBPA 4IIRA 5FTOA 4FVQA 3K2LA 1ZAOA 4FV1A 4FICA 5A6NA 4BWXA 3UJGA 4DEIA 1H08A 4GV1A 4PTCA 5LVOA 2X2LA 2W1ZA 1Y8GA 4U81A 4W8EA 5JKGA 3EYHA 2HELA 3TZ7A 4KBCA 2E9NA 3HRCA 3NX8A 4FKGA 4GCJA 4CZUA 3BWFA 3FZSA 2QQ7A 4TW9A 3PSBA 4RJ7A 1JPAA 5CSHA 4QMTA 1OIRA 5L6WL 2WPAA 2PMOX 5ANIA 2ONLC 2YWPA 3WZUA 3R83A 2XIYA 3MA3A 4XRJA 3L9LA 1REJA 5M08A 1Q8TA 4S33A 3SA0A 3MSSA 3E63A 1VZOA 2G2HA 4D5HA 4EOPA 4ERKA 3LQ3A 5C8MA 3TJDA 2XNBA 3TIZA 2WTCA 4X2KA 4IVAA 5K5NA 3S00A 2W5AA 4YTCA 1OKWA 3OY1A 4EEVA 4I1ZA 1U4DA 4ANLA 3HDNA 3NYOA 5CVFA 3I7CA 4IZAA 1H1RA 4QMLA 4DLJA 3QRJA 2W99B 3ITZA 4TKSA 4EH2A 3ORZA 4F9AA 5EFQA 5E8SA 1BKXA 3ZU7A 2XALA 4E26A 4J99A 4BGHA 5BVKA 3R8UA 3A7FA 2B53A 1DM2A 4ANSA 2BFXA 1TQMA 3AC1A 4FSQA 3F2RA 1H1SA 4QO9A 4E20A 3LFEA 5J9LA 1CKPA 2YIQA 4K0YA 3GU6A 1U46A 4ZTRA 5EW3A 4BTJA 1YQJA 5EH0A 4MBLA 5AR5A 2CPKE 3P7CA 4QMXA 4YHTA 3QLGA 1IASA 4OTRA 1FPUA 4QP4A 2VN9A 2YCQA 3D5VA 3QX4A 3G9LX 3O2MA 1ZYCA 2ACXA 1YWNA 3EHAA 3KMMA 4IB3A 3HGKA 5EQYA 1BI8A 4G5JA 5AP3A 4HVGA 3WI6A 4ID7A 3CGFA 4C3PA 3RNIA 1M2QA 4M3QA 4EK3A 4FKOA 2UVYA 4MQ1A 4ZSJA 4TYEA 1X8BA 4QP8A 2BRGA 4FE2A 3P86A 3MGYA 4FIJA 3ALOA 4Y72A 2W1IA 4L3JA 1QL6A 5CENA 3OT8A 3KRJA 2FVDA 3VS3A 4E6CA 3MFRA 2UZUE 3L8VA 3FI4A 3RNYA 3LCDA 3VUKA 4JS8A 5A46A 4NT4A 3VC4A 4J97A 1VEBA 3BPRA 4ZIMA 1KE8A 3KGAA 3QX2A 3B8QA 2JDRA 3K3IA 4UB7A 5AJQA 2F7EE 4NZWB 5AUVA 4EJNA 4F08A 5CF5A 2Y4IB 4JDIA 4NJDA 3HAVA 2ZDTA 4GG5A 4NL0A 4BGGA 1KSWA 3SVVA 4AFEA 2VX3A 3IW4A 3UVRA 3DY7A 4FG8A 1PF8A 2XB7A 4JG6A 3EKKA 3FMLA 1FMOE 5BVWA 2VD5A 4EHGA 5CTPA 3BYVA 5AEPA 3VRYA 5F94A 4IACA 3VS7A 4BZDA 5EW9A 4ONAA 4AE6A 2VAGA 4XP2A 3OOMA 5M4UA 5A4CA 5EHLA 1H01A 4RC4A 2Y9QA 3FMMA 3QALE 4R7HA 3EN9A 1NVQA 3R7UA 1PYEA 4HGTA 2GS7A 1LEWA 2W9FB 3PJ1A 2A4LA 1W7HA 3ANRA 3TG1A 5FGKA 4O6EA 4D2VA 4EC9A 5AA8A 5F4NA 4IVBA 4CV9A 3VS0A 2HW6A 3H3CA 3FI8A 5IF1A 2OG8A 4QQCA 3UOKA 5FUTA 1SNUA 4FV0A 3ZSHA 4JR7A 4M14A 2C0OA 2R3LA 4XYFA 2O0UA 5CS6A 1NY3A 5AP5A 5HVJA 3VBQA 4GIIA 4IX6A 3CJGA 5J8IA 3RAHA 5ACBC 2QKRA 2IF8A 2JIIA 4P90A 2WEVA 2HWPA 2XBAA 3Q9ZA 4E5AX 2JD5A 2NO3A 4L7SA 3A7IA 3QRUA 4J96A 5DNRA 4ZMEA 2GNGA 2IW6A 3U6IA 3QYWA 4JBQA 3H30A 3I0OA 3QZHA 2CMWA 3H4JA 4X3FB 2RIOA 3HV5A 4R1VA 3ZRKA 4IB1A 4FNWA 4JRVA 4MYGA 4FSWA 2R5TA 4HPUE 3TTIA 3UMXA 3MFTA 2PK9A 3IQ7A 4FIFA 5BYLA 4M69A 3SW4A 2B55A 3ERKA 3A7JA 5HD4A 4CG9A 2CKQA 2WTKC 3FZRA 3L9PA 5KMJA 4C4HA 4QDVA 2WD1A 2UZOA 3QCYA 3D5WA 3VRZA 2J0KA 4U3ZA 2IN6A 5EI2A 2FSMX 4YJQA 3RWQA 3TNHA 3DKFA 4IB0A 1KWPA 3PTGA 3GC0A 5KUPA 4BKZA 3COIA 2QVSE 4MEDA 4QPSA 2NP8A 4ACGA 4B7TA 5I3RA 3C4XA 3TV6A 3JPVA 3U9NA 4OAVB 4O7VA 1XJDA 3UIUA 3BHVA 4R6VA 3Q3BA 3ETAA 1W82A 2XVDA 3CY3A 4DFNA 3SD0A 2I6LA 1QMZA 1R78A 2GS2A 4BCOA 5KMNA 2F9GA 4OR5A 2LAVA 3U54A 3DBDA 3FPMA 3OWPA 4G6NA 4FKTA 4H3PA 3F3VA 3FC1X 2F4JA 3HV7A 4F9YA 3S1HA 2YM8A 1V0BA 1OIYA 1Y57A 2B1PA 4IMYA 2GNHA 3ELJA 2VO3A 5CZHA 5H8GA 4FG7A 3T8OA 3TV7A 5KBQA 2NYAA 4DFZE 2ETKA 4CRSA 1W8CA 5KZIA 3V04A 2QO2A 3Q60A 3TWJA 4IC8A 3CQEA 2QG5A 2JBOA 4I5PA 4PMTA 4WO5A 3VUMA 3QTIA 4EI4A 5DGZA 1U54B 3GC8A 4I4EA 2FUMA 4EOQA 2C6OA 3O71A 3WZEA 3D0EA 2YIYA 3DFAA 3IG7A 1WBPA 4FSRA 5CAVA 3FI2A 2Z7QA 4R3CA 1XBCA 4E4NA 2GHLA 3HMNA 2OGVA 4JMQA 3NNUA 3ROCA 3W8QA 2O5KA 3FMEA 2PVKA 4HNIA 2Z7SA 4AE9A 1ZYSA 2PSQA 1TQIA 3U6JA 4XH6A 3QQHA 4EK4A 2UZVA 2JFMA 4M68A 2VTAA 1H1PA 2QURA 4JOAA 5I0BA 2XH5A 4EH3A 4BJJA 1W2CA 1W0XC 3PXKA 5EHYA 2G1TA 4F9WA 3F6XA 2UW0A 5ANJA 2ZM3A 4Y5HA 3GUBA 1FMKA 3ZM4A 3KRWA 3OWJA 3NFFB 4EQMA 5ETAA 4U8ZA 2H34A 2GQSA 3G6HA 1W84A 3PP0A 5EDRA 3RCDA 3U4WA 4TL0A 5JSMA 5H8BA 2R3PA 4AF3A 3Q5IA 4F65A 3DB6A 4EH9A 3GEQA 1RDQE 3OP5A 5CVGA 1FVTA 4O7LA 1SVGA 1WBWA 3W33A 3A4PA 2VWYA 4MXXA 2AEGA 4YJRA 2ZOQA 2XMYA 4DFYA 5AUZA 3UC4A 4EHEA 3W1FA 1XBAA 4AT5A 4ACHA 3O0GA 2XK4A 2BZJA 2FB8A 1A06A 1JNKA 2PULA 4BWKA 3ROYA 2XAOA 3GOPA 2HZNA 4XG9A 3E7VA 3W18A 2BAQA 3W2RA 5CY3A 1PXNA 3DAEA 3DKGA 4TY1A 4Q9ZA 4DF3A 2BZHB 3E92A 4FYOA 4E4MA 3FLYA 3U4UA 5GJGA 2JDTA 5M4IA 4L00A 2VTRA 5BYYA 3IO7A 4PUZA 3ZFXA 4AOIA 1ST4A 2R3HA 3DGKA 2QI8A 2XZSA 3ZYAA 3TZ8A 4EK6A 3EWHA 3OD6X 3PIZA 2J6MA 3AC4A 1Q5KA 3ZUVA 4JRNA 5J1VA 3MTFA 3QD0A 1CDKA 4F7NA 3WF9A 3BBWA 5I9WA 4RIWA 1YVJA 4PDOA 5C4KA 2I40A 2W0JA 4PL3A 4ZLYA 5HU9A 3LLTA 3ORMA 5K0XA 3NDMA 2ZM1A 2CHLA 4ZLZA 5M4CA 3R71A 2YISA 4LUDA 1REKA 3WZKA 3W0OA 1OL5A 2IZUA 5KE0A 1OM1A 1YOLA 2BFYA 3R8MA 3RJCA 4N6YA 2I0YA 1OPJA 4FIIA 3W32A 2ZMCA 5IH6A 4KUJA 4ZTSA 3GNIB 4Z7HA 4USEA 3NGAA 4F1TA 3ACJA 3FLQA 5HTCA 5F95A 3BYSA 3DXNA 5CX9A 1LR4A 4G3CA 4L67A 3EQHA 4PMSA 2Q0BA 2UW3A 4ANNA 4WHZA 5A4EA 1QPDA 3U9CA 3RHKA 4CSVA 4PWNA 3R02A 1SYKA 3FL5A 4C33A 4RJ6A 3QC9A 3W0QA 3HMIA 4MVFA 1OKVA 2XBJA 2C69A 5CEIA 1ZWSA 3UQFA 2EWAA 4FG9A 2JAMA 4HCTA 2YCSA 4C35A 3P5KA 3I1AA 4KIPA 3G9NA 4MF0A 5EYCA 4NTSA 4FTIA 5EI6A 3ZRLA 3NUNA 4BGQA 4BKYA 2RGPA 3W0MA 5LXMA 4W4XA 5AP6A 2R7IA 5CQWA 3R7VA 4GEOA 4K9YA 2RSVA 4FT0A 4BI2A 4AZSA 2YDJA 3DKOA 4ZAUA 4DDIA 3FMNA 1SVEA 2XNOA 3DK7A 3OC1A 2QU6A 4GSBA 1OL2A 3RPRA 5BNJA 2OXXA 2WTVA 3KK8A 4QMMA 4D5KA 3M2WA 4EZ7A 4WBBB 4HCUA 1YDRE 4W8DA 3ZFMA 2XARA 3FXWA 3W0NA 2QOQA 3EQPA 4ZS4A 4RSSA 3RBWA 3VNTA 4E5BA 3ODYX 4YBJA 3RK7A 3BHTA 5IA0A 1CTPE 4C57A 4L46A 1AD5A 1KE9A 4FL1A 4N70A 4EOKA 4H05A 2KULA 1CKIA 4M12A 2PMLX 3JR1A 4YTHA 3ZOSA 3BHUA 4ACCA 3MJ2A 3BL9A 2NRUA 5AMNA 2C6EA 4M0ZA 1OL6A 2HIWA 1SMHA 4IDVA 4I0RA 4IAZA 4PV0A 5FXSA 4BDHA 1YI3A 3VJOA 3RK5A 5BV3A 4L6QA 2AQXA 2B9HA 3LVPA 4RVTA 5CALA 4RWKA 3S95A 4DFLA 4XG4A 3COKA 3UPXA 4BC6A 3HAMA 1PXKA 4L53A 3O50A 5T6KA 2BUJA 2Q0NA 4TWPA 4TYHA 1IA9A 2BKKA 2WOUA 4S34A 4AZFA 5DR9A 2GFCA 3LXNA 3PP1A 4HGSA 3Q4ZA 5AX9A 1J7LA 2AUHA 4NW5A 1ZOEA 2J50A 2C5OA 2Y6MA 1U5RA 5ACKA 1OKZA 4RGJA 5JH6A 3PSCA 5AP7A 5CAPA 2XUUA 4RX7A 5AR2A 1G8KA 1IG1A 3H0ZA 4RZWA 5HCYA 2OZAB 3GQLA 4A9TA 5FM2A 2X8DA 3QWJA 5A14A 2H6DA 5IH5A 1OECA 3C0GA 4N4SA 5CAOA 2QR7A 5L2WA 4FGRA 4FOBA 4YJVA 4BDIA 5AUTA 4PNKA 2GTMA 3ZS5A 4D4SA 3LCTA 2C47A 4GS6A 1JSUA 2H96A 4W4VA 4A9UA 3N4VA 2XYUA 3FLSA 3UQCA 2GDOA 3N4UA 2XJ2A 5H2UA 3D94A 4EORA 2J0LA 2QLQA 4QMQA 1OZ1A 4IQ6A 4ASEA 3OBGA 4N57A 4BIDA 1XWSA 3P7AA 2E9PA 4U42A 1Y6BA 3OWLA 5EM6A 3KULA 3KRRA 1KE7A 4ALVA 1FQ1B 3RGFA 5HO7A 2QC6A 4XMOA 2XIRA 4PMPA 4FZDB 4BDFA 3IPHA 1WBTA 3F69A 4IFCA 2VTQA 4U44A 4MQ2A 5AV1A 3EFLA 4C34A 4CV8A 5L2IA 4CCUA 4DBXA 1R39A 1L8TA 4FKPA 4ENXA 3SHEA 2BRHA 3ZO1A 1GZ8A 3CLYA 5HG9A 4XG6A 4RFYA 5LARA 5CSWA 3W0PA 4L01A 4DEGA 3VF9A 4AW0A 4V01A 3UOJA 2UZTA 5BUJA 3AGLA 3MY1A 4I0TA 2Z2WA 3BWJA 4BHNA 3R22A 3R2YA 3KK9A 4YUQA 1G8JA 4Y73A 4OUCA 3ZC5A 2ETRA 3KRXA 3REPA 2VGOA 3F2AA 1KE5A 2BILB 2R3FA 4MD7E 3UNJA 4YSJA 4F9CA 5FLFA 2UV2A 5EYKA 4ACDA 3LMHA 5JZJA 1YWVA 2B52A 4AT3A 2BAJA 1FOTA 4HGLA 2UW9A 4I6HA 2XEZA 3ZC6A 3NLBA 2WIPA 4LRKA 2JKKA 2Z60A 3PZHA 4FC0A 2ITZA 1OUKA 3LQ5A 3CS9A 2PTKA 3Q6WA 3FQHA 4K18A 4F78A 2I0EA 5C03A 1MRUA 4C2WA 3BLRA 4PQNA 5K0KA 5IH4A 4WKQA 3S4QA 2J7TA 2JDVA 5DT4A 5E8VA 5LVNA 4G1WA 4HZRA 4YJPA 5E8YA 1H28A 3IW7A 3MH1A 4O4DA 2RKUA 4I6BA 1STCE 3QYZA 3QKLA 2B7AA 3C0IA 5A4QA 4M13A 4IAAA 4QQ5A 4FA2A 4RC3A 3BU5A 4DA5A 5HBHA 2XP2A 4BCPA 2J0MB 2C30A 2R3OA 4RFMA 4I22A 2JEDA 3F82A 4YTFA 4XUFA 3UOLA 5FM3A 3FJQE 3SXFA 4FNZA 3THBA 4BDBA 3PXQA 3QQLA 5CQUA 3KIOC 4O96A 1U59A 4QTAA 3PJ3A 4DH1A 4MH7A 3BV2A 3W10A 3NFGB 2YCFA 2IO6A 3KXNA 4O82A 2YLFA 5HCXA 1B38A 4D0WA 3RWPA 4R3RA 2FA2A 3ET7A 4JVGA 2ZB1A 3LIJA 5DBXA 3CBLA 4ZK5A 4PP7A 1IRKA 2OJJA 3GCPA 4MXAA 4ARKA 3DXPA 1ZMUA 3AT3A 5E8ZA 3PPKA 4ZY6A 2XNGA 1Q41A 2GNJA 4LMUA 1H1WA 2GNFA 3LXKA 4EOLA 3P78A 1OGUA 2NRYA 5IISA 4DFUA 4E7WA 2UZLA 1YDTE 4RIXA 5E7RA 4FV3A 4IM2A 4BDAA 4RIYB 4NK9A 5JRSA 4DINA 5BVFA 4CKJA 3KQ7A 2VNYA 4MD9E 5AR4A 4EKKA 2VTOA 2XK8A 5TT7A 3UZRA 4FTUA 4EC8A 4S31A 1JAMA 4O27B 3UP7A 4QMOA 3NYNA 4FL3A 3UG1A 5KKRB 5AP4A 1JKSA 4II5A 3F9NA 4NYEA 2GHMA 4JIKA 1OVEA 2VX0A 1RJBA 4I3ZA 1KOAA 2JIVA 2UW7A 4RZVA 2CJMA 4JQEA 2IW8A 5JGAA 4S30A 4KAOA 1MQ4A 1JSTA 2B9IA 4WSQA 3TMOA 3QD2B 2P4IA 3RZFA 1YWRA 2ITPA 4O91A 4QP1A 3NAXA 4FV6A 5D12A 4ZSGA 3SRVA 3VIDA 2QOCA 3F5PA 3IDCA 4FV2A 3TV4A 2XK7A 5FDPA 3MFUA 4FR4A 2WTIA 4KRDA 3WF8A 4NUSA 3FLWA 4TZRA 3TL8A 3LFFA 2G15A 4BDCA 4LV5A 4DH7A 3D2KA 1M52A 2CKEA 3R7OA 2IW9A 2CNUA 5DT0A 3UYTA 5TOZA 4ZY5A 3PFYA 4A4OA 3DLSA 4RJ3A 3OG7A 3DK3A 3DBCA 5AUUA 4LFIA 2XJ0A 3T9TA 5IQFA 4FKUA 3MIYA 1Q3DA 3OXZA 4NSTA 4D1SA 3CE3A 4ZTLA 4R3PA 3WIKA 4ASDA 2GS6A 1Z57A 3C13A 2J0IA 2ZV9A 1P2AA 4QMZA 4EOMA 5CF6A 3ZM9A 3ANQA 2A2AA 4O4BB 2ZFYA 3D5XA 3HX4A 2I0VA 2OSCA 3KB7A 2XCHA 3DQWA 2O65A 4LOQA 3CD3A 5ETCA 4CMOA 5CEOA 2PZRA 2B0QA 2YIWA 3VQUA 4EOOA 4RLLA 5CANA 3PUFC 3UTOA 3NYXA 4FSYA 3R01A 5HG7A 4UN0C 1A9UA 5BUIA 2BROA 4MK0A 4I23A 1UWJA 3DTWA 4GU9A 3F5UA 1VJYA 2BZIB 2GMXA 5A4TA 3PWYA 4OTHA 4G2FA 3P7BA 5EKOA 4IX5A 2BR1A 4L8MA 4ZXTA 2BZKB 4MTAA 3UODA 1RE8A 3VS2A 3PPZA 4QRCA 4B8MA 3PZEA 4MX9A 4QYEA 3VULA 4AW2A 4LGGA 3K5VA 4ZZNA 4J8MA 5DYJA 4YPDA 5FTGA 4XV1A 3MYGA 3V6SA 2GCDA 2Z02A 4MCVA 2OWBA 1UNHA 3KMUA 2VWZA 1BI7A 4D4VA 2OKRA 3V5PA 2UZNA 5IPJA 4AQCA 4JNWA 3R9DA 3VWAA 2FGIA 3HA8A 4U5JA 3ORIA 3NIZA 3U51A 2PVMA 5J95A 1PJKA 4QTCA 3TUBA 4CCBA 3ZBFA 1JKLA 4AAAA 3S3IA 3E93A 4M7IA 4QTDA 4AW5A 3Q2MA 1Y6AA 2AC3A 4FZAB 2ITQA 2W1FA 4KKGA 3U8WA 3SC1A 4QPAA 4XLVA 4U7ZA 4O1OA 5HO6A 4DHIB 3QAME 4EZ3A 2FH9A 3M1SA 2IZSA 2WZJA 5E90A 3OWKA 3ZBXA 2C0TA 2WMWA 3H9OA 4BWPA 3AC3A 1QPCA 2OZOA 3FSFA 3PVUA 4FTQA 2PVJA 4JDHA 1M2RA 4E6QA 1PXMA 2P33A 5C8NA 5CF8A 3BEGA 1PRYA 2X39A 3UIBA 3LLAA 4R78A 4BF2A 2HENA 4CEGA 3V01A 4O7SA 3CQWA 4TPTA 3WIGA 2VTIA 3CC6A 5AV4A 5IUIA 3HZTA 1UU8A 3AT4A 4AN3A 4C4EA 2GQRA 5E8UA 3R63A 2GFSA 2W7XA 4QYYA 4FEUA 3CTJA 5F9EA 4RWIA 5L2QA 2R4BA 5KBRA 4GT3A 3GCVA 5HNGA 3ZXTA 3Q4UA 4XBRA 2WMTA 3D9VA 4EBWA 1KV1A 3ID6C 4BR3A 4NW6A 5EDPA 2O64A 2XKEA 2UZBA 4GYIA 2PVRA 4XEYA 4PF4A 1H0VA 3FV8A 3GXLA 3KMWA 4E6AA 3NMUF 3KXHA 3F3WA 1PMNA 3LXPA 4L44A 3CEKA 4CMTA 2CSNA 4HGEA 4GJ3A 4DC2A 1FINA 4FKSA 3DBQA 3BKBA 1YXSA 5BMSA 4QEBA 2G01A 3WF5A 4DEHA 3RAWA 3C4WA 1M2PA 3QRKA 4QMVA 4EWQA 4DTBA 2X7FA 2BDWA 3C4ZA 3ULZA 2X9EA 3G51A 3ZZWA 5FQDC 3E62A 3D7TB 5J87A 2P2IA 3HKOA 2VUWA 2R3MA 1TKIA 4GFMA 1MUOA 4BZNA 1M7QA 3Q4CA 4P5ZA 3SV0A 1CM8A 2PVLA 3R9RA 2PY3A 2YDIA 2XAMA 3ZH8A 4AX8A 4GU6A 4LOOA 5AR3A 4D58A 3PXZA 3R1QA 4I6FA 1H24A 4BCFA 4CFVA 4MBJA 1YXTA 4X3FA 4G6LA 4NKAA 2R2PA 1B39A 2GHGA 3OTVA 4JG7A 3VVHA 4W9WA 3NNWA 3UQGA 2J5EA 3CKXA 4YLJA 3TTJA 2PUPA 3EQGA 5IA4A 2CGUA 4MD8E 5CVHA 4IM0A 3DT1A 2YZLA 2WMRA 3FQEA 3KFAA 3BLHA 3EB0A 4OAUC 2HWOA 4K2RA 1U5QA 4FKVA 4NIFB 1TZDA 2C0IA 4KIKB 5A54A 5M06A 2YM5A 4K77A 1OKYA 5I9VA 3RM6A 3LFSA 4ZTQA 3A60A 5LQFA 3GU7A 3F5XA 2ITVA 1YI6A 4FT5A 4KWPA 4ZTHA 4F6WA 3ZLWA 3QA8A 5BVEA 5IKWA 5CT0A 4A9SA 3Q2JA 3LJ2A 4BTFA 2YERA 5BYZA 1RW8A 2JDSA 3F7ZA 5IQEA 4LI5A 4QMYA 2GTNA 4ZJIA 4F70A 3OZ6A 3QL8A 3RCJA 4TTHB 4U3YA 3VBWA 1H07A 2UZDA 4IEBA 1P4OA 2YCRA 3FEGA 3A7HA 5KMIA 3F61A 4ZTMA 3U55A 2W5HA 3BI6A 4RLKA 5DRDA 3VBXA 3UDTA 3QQJA 4UYAA 4OW8A 4MNFA 1OMWA 3EQDA 5EHOA 2W1GA 3TEIA 2F7ZE 4XS2A 3W2OA 2ZV2A 2JKOA 3VW6A 4XOZA 3VUDA 3EL8A 4G31A 4KA3A 2WMVA 4EJ7A 3VUGA 4JI9A 3IECA 1UVRA 2X0GA 4IWOA 5AX3A 5EYMA 1XH7A 1ZMVA 4EYJA 4FKRA 2C5NA 2WU7A 2QOHA 4X0MA 3HRFA 3BE9A 5FEQA 5DR6A 3M42A 3Q9WA 1AGWA 3SLSA 5LMBA 3BCEA 3Q52A 3HP2A 4TN6A 5EOLA 4QYHA 3O96A 4ERWA 3V5JA 3LHJA 4D2RA 3EKNA 1O9UA 5D41A 4TRLA 3UG2A 5CASA 5EQEA 3HL7A 4AZTA 3SXSA 3NWWA 4X6QC 1ZZLA 4IAFA 2BDFA 3VQHA 2PVNA 3BHYA 3TI1A 1H00A 4E1ZA 5HQ0A 4CYIA 4AXEA 3F3TA 3V8WA 3T3UA 3RAIA 1YKRA 3WBLA 5F20A 5IA5A 2FO0A 5E4HA 4U79A 1Y91A 2C6IA 2ITTA 1PHKA 4FIHA 3AD5A 4GH2A 4F09A 3Q5ZA 3R8PA 4Q5EA 1OIUA 3MBLA 3BL7A 2YM6A 3UIXA 3PDTA 1QPJA 2X7GA 3G0EA 4IWQA 3SAYA 4BCGA 5KO1A 4O86A 3PY3A 4PPAA 4GKIA 4UMRA 2QHMA 4PMMA 3FXXA 4IZ5A 3SKCA 4AT4A 2IZTA 3LFNA 5HLWA 3MDYA 4IAYA 4MAOA 3MPAA 4UBAA 5B2KA 4EH8A 5IA3A 4YNEA 3C4EA 4BYIA 2RG5A 3ZSGA 1PY5A 4DGNA 4XG3A 4YURA 3WOWA 4I21A 2BRBA 4HOKA 3IW8A 4FTMA 5I4NA 3ALNA 2BHEA 1BL7A 3IW6A 1PW2A 4BDEA 5CXHA 4TWOA 2GQGA 4LOPA 5HEZA 4X2FA 5EDQA 1NT2A 4YZBA 1SNXA 3L8PA 3PRFA 2PL0A 4CQGA 5CEPA 3RZBA 5DMZA 3SOAA 5IDNA 5L4QA 5FP5A 2HW7A 3NVMB 1G5SA 3PVBA 4B4LA 3ORLA 3I4BA 3V8SA 3TNQB 3QGYA 5IEXA 3UO6A 5A3XA 2BTSA 4A7CA 4AW1A 4AOTA 3VONA 4UEUA 2VV9A 4E8AA 1XMMA 4ZOGA 3LJ1A 3UOHA 2J90A 3HMMA 4FV7A 4J52A 3ZLYA 5FP6A 4EOIA 2DWBA 3DV3A 4DTAA 4BICA 4UZDA 4XBUA 4NKSA 2CN8A 4F1OA 2Y8OA 4D2TA 5J7BA 2OJFE 3I60A 5CSVA 2UUEA 2R3IA 1Z5MA 4F9BA 2BAKA 3QXPA 3QTSA 4I20A 4PL5A 3W2CA 3ZDUA 1J7UA 4CFUA 4E5WA 3KREA 3D5UA 3TIYA 5GZ9A 5HNIX 3JVSA 1PMUA 3FUPA 2IZRA 5HTBA 3VS5A 4LL0A 3ZDIA 3PIYA 2PPQA 2YHVA 1Y8YA 1CKJA 2FSLX 1JKTA 3GFWA 2Z7RA 3D4QA 1QCFA 3FYJX 2YFXA 1Q3WA 3C0HA 3LMGA 3QFVA 1FVVA 5E8WA 1GNGA 2GNIA 3VUTA 5TE0A 3QWKA 4C4FA 2OJIA 4FNYA 4BCKA 2OH4A 2QOBA 3UDBA 2WB8A 1BMKA