4QMTA

Mst3 in complex with hesperadin
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
285
structure length
284
Chain Sequence
NLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 284
sequence length 285
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qmtA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qmtA01
5FEQA 2OF2A 4FV9A 4CT1A 1JLUE 4OT5A 4QTCA 4C4EA 3UOKA 3DDPA 5C03A 3CKXA 3EFKA 5EOBA 5KHXA 2PU8A 1OZ1A 5HCZA 4JRNA 2I40A 2X81A 2R3GA 2W1HA 1I44A 3CY2A 4FL3A 1Q61A 3CLYA 3A61A 4BCHA 1E1VA 3ORIA 4OTQA 2YA9A 4QMTA 3KXHA 4X3FB 4DT8A 3VUGA 4XX9A 3GC9A 4XG9A 3QCYA 4XBRA 4RIWB 3PTGA 4CGAA 2EXEA 1QPDA 3D5XA 5HHWA 4IJ9A 4FK6A 1H0WA 2YM7A 5GINE 4Q5EA 2PE1A 1DI8A 2JKKA 2OJ9A 3FY2A 3R2YA 5ACBC 4IC8A 3LIJA 3NNVA 5CQWA 2XS0A 2I6LA 3WOWA 5L6PA 3BLRA 4IW0A 4X6QC 3DY7A 5FBOA 3AT2A 1YRPA 3NUYA 1NT2A 2BAQA 4GT4A 4NUSA 3BU5A 3N4UA 1P14A 4DEAA 2QU5A 3LLAA 3KCFA 2X2LA 4JG7A 4UMRA 2Z60A 3I6WA 2C6LA 3MY0A 3A60A 4S31A 3MFSA 4WA9A 5EYCA 3C1XA 1H0VA 3C4WA 4FSRA 3PLSA 3QUDA 2XKDA 3I6UA 1R39A 5M4IA 5EYDA 3MFRA 1OKVA 4XBUA 3ZFMA 4KBKA 4HOKA 3UYSA 3EYHA 4I23A 2LAVA 4BCMA 4CXAA 1WZYA 4D28A 3ZZEA 4QQTA 2ZV2A 4UYAA 3HKOA 4C02A 4RVLA 4RLKA 5HO6A 1BI8A 4CYIA 4QMZA 4FV6A 2XIZA 1R0EA 5E8XA 3UNKA 1XBAA 4XV1A 2C68A 4RLLA 1TQIA 4DTKA 4LRMA 4H58A 1GZKA 4WBOA 2HZIA 5CENA 5D12A 4FEUA 5IQHA 2UVXA 5IPJA 3JVRA 3F5UA 1H24A 3DAEA 3FLZA 3FYKX 2W5HA 2VTTA 2XBAA 3KRLA 2CHLA 2OF4A 1MRVA 2R5TA 2WMVA 3RZFA 3T9IA 5FDXA 2FUMA 1YDSE 1BUHA 2PMLX 3D0EA 3DU8A 5HLPA 4AGUA 3GC8A 1FPUA 2VWYA 4CFWA 5A6OA 5IISA 3H10A 3DK3A 3FHIA 3VAPA 3UZRA 3ZEPA 1A9UA 2HWPA 2PPQA 4ERWA 2RG5A 3WARA 2ZMDA 3IOPA 3ZTXA 4DFZE 4OAUC 4W4VA 3LJ0A 4FTMA 4O84A 3E93A 3KK8A 3Q6UA 1YHWA 4MAOA 4RFYA 1I09A 3D9VA 4BC6A 1MP8A 5I9ZA 5KKRC 4BHNA 4BVUA 2R3JA 4IFCA 3RPYA 2PTKA 4HVGA 5CY3A 3GP0A 3DBCA 4BI0A 2WU6A 2IO6A 5CU4A 4JDKA 3OXZA 4G31A 4GUBA 3R7GA 3SXRA 1NVRA 3KXGA 4KRDA 4FVQA 1R78A 3EL8A 3OUKA 3W2CA 3HLLA 1V0PA 3ODZX 4USEA 1WVXA 2WTCA 3MA6A 4R7HA 4BDEA 4XLIA 2QOBA 2A2AA 3O71A 4KIKB 3KMWA 5L2TA 1YHSA 2OJIA 1L8TA 5DR9A 4LUDA 4WNMA 4BI1A 1DAYA 4TT7A 4OBQA 5I9XA 4E1ZA 1V1KA 1H1RA 2XK7A 3FMEA 3HUCA 4EOPA 4UX9A 1YVJA 4ZMEA 2HYYA 3QX4A 3HA6A 5GIOE 2IVVA 1YOJA 3PIZA 4ZSAA 4P2KA 4NL0A 4B4LA 1JQHA 5IMXA 3AGLA 3HMIA 3ZUTA 4CTBA 5JZJA 3HVCA 1YXSA 3LJ1A 1APME 1YXUA 4CG8A 3QL8A 4EK3A 2ERKA 5KZ0A 4CLIA 5J7BA 4G1WA 1GZOA 3GU4A 4MYGA 3E64A 2W1CA 1KE7A 2JKQA 4YJOA 1J91A 1P4OA 3QFVA 4I20A 1ND4A 2YHVA 3RWQA 4CZTA 4U5JA 2QOHA 3VQHA 4WUNA 2PUUA 4C3PA 3LXKA 3WBLA 3GT8A 5LOHA 3W33A 2J2IB 1CM8A 4R5SA 3FI2A 2OK1A 1PF8A 2ITTA 4RC2A 3VUTA 4F7LA 3FSKA 2VTHA 1NVQA 4MCVA 5M56A 4ACCA 4NW5A 3Q60A 2QR8A 4C4HA 3VWAA 2B9FA 4II5A 3MJ2A 3U9CA 3ZBXA 2BTSA 4ONAA 1BX6A 5J87A 2X0GA 1ZY5A 2QLUA 4IX6A 3HEGA 2OG8A 2PWLA 3REPA 4F64A 1KE9A 2F57A 2QURA 3P79A 2UZEA 1SVEA 5LCKA 1CKJA 5L2SA 1UNHA 2OBJA 3IDBA 4JDIA 4FTAA 3TNHA 5EQPA 1S9JA 3Q5ZA 4D4RA 3PJCA 1YQJA 3NS9A 3G6GA 3EQFA 4QTBA 4AT5A 4EOIA 3O51A 5ITAA 3KF4A 4Q9SA 2CMWA 4FTNA 3MFTA 2R3RA 3IS5A 4FV1A 4ITHA 1KE6A 1GNGA 4MWHA 4QP8A 4NSTA 5CSXA 4BCNA 4DFYA 2NO3A 1W8CA 4GK4A 3P5KA 1Y8YA 3QCSA 4AA0A 4CFUA 3WF8A 5ICPA 3LPBA 4HYSA 3OOMA 4AFEA 4LM5A 2PVKA 2X4ZA 5D1JA 2W1GA 3HMPA 3EN6A 1YI3A 1PKGA 5FP6A 4RWKA 4ZSJA 4PDYA 4EL9A 5C8KA 3E5AA 3V5PA 2YIXA 5EM8A 4ENYA 2XM9A 3E62A 2E9VA 4EHVA 4B0GA 1A48A 5DE2A 4LRJA 4ANBA 5LMKC 3U54A 3F2NA 1IRKA 4O7SA 2EXCX 3R00A 4JAIA 5C4KA 4ZZNA 3PJ2A 5E8TA 4BDGA 2GNLA 4D2PA 3MJ1A 1KSWA 1PXLA 4HYIA 3RINA 3FXWA 2W5BA 3GEQA 3QWKA 4FODA 2B55A 4NM5A 4A9SA 3Q4ZA 4FIHA 3KVWA 2EU9A 3G6HA 4K11A 4FTUA 2C3KA 5CT7A 2RFNA 3FI4A 3E8EA 2IZUA 2GNFA 3NDMA 4DC2A 4D2SA 4S34A 3VS7A 4QO9A 3P08A 4WKQA 3QRUA 5JFSA 1V0OA 2UZNA 3BELA 5KMLA 5AP5A 3DCVA 3FL4A 5CVFA 2XB7A 3EN7A 2W1FA 3IDPA 4FEXA 3DPKA 3FL5A 3NIZA 3Q9WA 4UBAA 3CXWA 1WVWA 4IIRA 3MVHA 4GYIA 5CVHA 1IEPA 1ZMUA 4E6QA 1VR2A 3QBNA 4JAJA 4I41A 4GJ2A 4E7WA 4KBAA 4DFUA 2A19B 5AR8A 4YR8A 2VWVA 4TY1A 1XH9A 3LQ5A 4F70A 3DZQA 3UGCA 4EKKA 4MWIA 3C50A 4PUZA 4OTIA 3DXNA 3W8LA 5C01A 4E5WA 2VWXA 3QZHA 4IADA 4ZJVA 4O38A 5CZHA 4APPA 1G5SA 3HP5A 2X9EA 4L44A 4M15A 4GIHA 4TWPA 1UKHA 4C36A 4EQMA 1LPUA 4ZEGA 2W5AA 1K9AA 3PE2A 2YDJA 5E91A 3TJDA 3VHEA 3U9NA 5HG7A 1QL6A 2AYPA 2GTNA 2NP8A 3COIA 3K2LA 1EH4A 2WOTA 3A7IA 5DN3A 3F3ZA 2YLEA 3OG7A 1YDRE 4ZS4A 4UMQA 3AC8A 3GQLA 4PY1A 4D5HA 4BY9E 3NGAA 2CGXA 3QD0A 3ZDUA 3FWQA 4BGGA 2BFXA 2QG7A 4YTIA 2WTWA 1H1PA 3TIZA 1KE5A 1FVTA 4BTJA 1PMNA 1GIIA 2B9JA 3VBYA 3ZOSA 1ZAOA 2YZLA 3L8XA 4JR3A 4USDA 1IAJA 3C0HA 2C1BA 2R7IA 5BYYA 3ZC5A 3PIYA 4FIIA 4MKCA 5HE1A 3CE3A 4K0YA 3H9RA 3QQUA 1UA2A 5TE0A 3W2PA 4H3QA 4WG5A 2R0IA 3PY3A 3CS9A 2ZV7A 2WMQA 2PZRA 2C5OA 3QTUA 4U9AA 2WEVA 3FC2A 1OIRA 4O91A 2OICA 4PF4A 2XNGA 2BIYA 5I9UA 4BWKA 2XIYA 4GRBA 4N0SA 3H3CA 3FMHA 4FKWA 3VS3A 4GKIA 2XRWA 5HE2A 3L9MA 4KINA 4AX8A 1O6LA 3F7ZA 4TZRA 4AZSA 4KWPA 4TXCA 1Q3DA 2GS6A 4IVCA 4QYEA 4F7NA 5IEXA 1JOWB 2ZM4A 3A8XA 4W9XA 3NUAA 3IECA 3NYVA 4O7YA 2UZUE 4FSUA 3DNDA 4L68A 3WE8A 3AC5A 3R21A 4EWQA 2GNGA 3EZVA 4L53A 1YKRA 2QOIA 1UU7A 1H27A 2CN8A 4I3ZA 4QPSA 4CEGA 3SXFA 3LXNA 3RK7A 4D5KA 1XR1A 4NIFA 3HL7A 3FMJA 1JSTA 4EH9A 1BI7A 4NT4A 4FKVA 2EXMA 4QP7A 4PDPA 4RG0A 4E6DA 4K9YA 3TNWA 4F0IA 4X7QA 5L3AA 5HBEA 4FKJA 2Y8OA 5E8YA 4EHGA 4CCUA 4I0TA 2XP2A 4ZTMA 2RIOA 5FUTA 1YOMA 5TO8A 4NJ3A 4FE2A 4BR3A 4BZNA 4MXOA 3BYVA 2R3KA 3NZ0A 4F99A 4O7WA 3COMA 4O7LA 3M2WA 3AGMA 2BHHA 2R3FA 3EKNA 5TR6A 1SNUA 3SW7A 3LM0A 3A4OX 4MXCA 2NNWB 3ULIA 2PE2A 4FICA 4X2JA 3VS5A 3CGOA 2GPHA 5AA8A 4AOJA 1RQQA 1YWNA 4EH2A 4C38A 2ERZE 4KBCA 4EJ7A 2ESMA 1R0PA 1FGKA 2GQRA 4U44A 5H8GA 4O0UA 3OF0A 5C26A 5DYJA 3HMOA 2PUPA 1ZYLA 3MY5A 4EK8A 5HTCA 2FB8A 2X2MA 4EOOA 4EZ5A 4KKHA 5D7VA 4CMTA 4H1JA 3GOPA 2QOOA 3FAAA 3UVPA 3ZYAA 4X3FA 3BI6A 4QRCA 1ZWSA 1FOTA 3F88A 4I5PA 4JX7A 3OW4A 5IQDA 3R8MA 3BYOA 3MGYA 4LFIA 2RGPA 4NH1A 2J4ZA 3CD3A 1Y6AA 1M2RA 3BZ3A 4MF1A 2C6IA 4DG3E 2IW8A 4E20A 2IZRA 4GVJA 4FSMA 3LQ8A 4JR7A 4ZSLA 5LWMA 4ORKA 3I5NA 4XV3A 3DK6A 3PWDA 4C59A 3OT3A 2QO2A 3DA6A 4BIEA 4QQJA 5BVEA 3VS1A 4L01A 2HIWA 4QP1A 3LLTA 2QC6A 3QWJA 4BDKA 2YZAA 2XEZA 3JYAA 4HZRA 5KMOA 4FUXA 3TJCA 2YITA 5IA2A 3NVMB 2VTJA 3N4TA 1UKIA 3FMLA 2E9UA 1GOLA 3FLWA 5E8ZA 3FMNA 4BKJA 5EK7A 1PXOA 4OAVB 2FH9A 4YSJA 4MQ1A 3PJ1A 1QPEA 5B2KA 4QYYA 4O83A 2E9PA 2R3NA 3C7QA 4C8BA 1J7IA 4IDTA 5HVJA 3OWJA 2PZPA 4PQNA 2HXQA 1DM2A 2V5QA 5KBQA 5CYIA 2WB8A 3UO6A 4FYOA 4ZTQA 2OI4X 3T3VA 3ZM4A 3ZLSA 4LMUA 1XWSA 3P23A 4JQ7A 4QP2A 3UQGA 4ALWA 4C4IA 4FTQA 4OTWA 1YXTA 4GH2A 3V51A 3W10A 1WBWA 4KIPA 3UDBA 1XH6A 4ASXA 4UZHA 2B54A 2QQ7A 4CZUA 5M51A 4BDDA 4ZLOA 3UIUA 4DTAA 3BCEA 3NUUA 4FT9A 2WTJA 4IBMA 4RJ7A 4CFNA 2FSMX 4XNEA 5EM5A 4IAKA 1CTPE 2UUEA 2YJSA 3KB7A 1U5RA 4I1ZA 4Z7HA 4TWNA 5GZ9A 3DBQA 3MDYA 5AJQA 2PK9A 3OFMA 4F0GA 3FMDA 4RWJA 3QD2B 3SW4A 5EW3A 4I5CA 5HX6A 3HRBA 1IA9A 2XKFA 3TZ7A 3TTIA 3F3VA 3EFJA 5AAEA 3LMGA 1FGIA 2ITZA 3EQCA 5BPYA 1WVYA 3MB7A 2WQMA 3AC2A 4XP0A 3ET7A 2RG6A 4J96A 4P4CA 2C6KA 4L67A 3UC3A 5CF5A 4O96A 4BYJA 3HDNA 3WF5A 2PVYA 1LR4A 4G6NA 4BBFA 2G01A 3C4XA 4RJ8A 3LFCA 1OIYA 4NWMA 3R04A 3SLSA 3TZMA 5HLWA 1Y8GA 2ZM1A 2Y4IC 3IDCA 1W7HA 3MB6A 3NW6A 3Q53A 5A4TA 4DTBA 3HAVA 4DN5A 3LKMA 2R3PA 5EHLA 3UE4A 4GKHA 3C13A 4KIKA 2JEDA 2IZSA 1A06A 3NYNA 4FC0A 4XOZA 3IG7A 5DH3A 4BIBA 2ZDUA 3MBLA 2PSQA 4QMSA 1YHVA 2JDRA 3Q2JA 2VN9A 4U43A 5HBHA 5TKDA 3JR1A 3OVVA 4BCIA 1OB3A 3QD4A 1WBPA 2BCJA 3I60A 4IFGA 3PG1A 5KZIA 4L3JA 3TXOA 4A7CA 3IW8A 4K18A 4XMOA 5CF6A 4I5HA 1KUTA 3LXLA 3OUNB 4CKRA 4F9YA 2FVDA 4G9CA 1CKPA 4CV8A 4R77A 5BUJA 2Y4PA 3BX5A 3ZFXA 3LVPA 2Z7SA 2UZDA 4FKOA 2F4JA 1WBOA 3NCGA 1H26A 5AV1A 3S4QA 4C4GA 3PWYA 5LVNA 1J7UA 3MESA 2RFEA 3IW7A 2W4KA 3BIZA 3R30A 4LQMA 4O22A 2GFCA 4OW8A 4MD8E 5E92A 4O7NA 3EQRA 4HZSA 3BHYA 2XNOA 1TQMA 3CJGA 5EI2A 2J0KA 3TACA 1OPJA 3OWKA 4TYJA 4YNOA 4PNKA 4JL9A 2ZM3A 5JGBA 3O23A 2VGPA 3D94A 4LI5A 4L42A 3ZBFA 3VBWA 3Q4UA 3PXQA 4ARKA 2FSTX 2WMBA 1MUOA 4ZS0A 2VNWA 3TNPC 2AUHA 4LYNA 5CT0A 3CPBA 4BCJA 1P2AA 1Y6BA 2J6MA 1PXIA 4R78A 2EB2A 4AGDA 2GFSA 4XH6A 4NM0A 3O7LD 1REKA 4C58A 4PDSA 5M07A 3M42A 4MH7A 3LFAA 3NCZA 5CAQA 3PXFA 4BZOA 2QU6A 5E9EA 4RMZA 3GU5A 5GNKA 1ATPE 3MH1A 1JNKA 4JIAA 4LGDA 4UMTA 4F1OA 3CSVA 4QPMA 1JVPP 5FLFA 4H05A 4MK0A 1LEZA 3UNZA 3K5VA 2IPXA 4RSSA 3PPJA 3A4PA 3EFLA 4YGAA 3W18A 2O0UA 1Q99A 1VZOA 4A9RA 4TYHB 2ZAZA 4NK9A 3ZFYA 3BRBA 2ITOA 2V0DA 3FLQA 5EYMA 4ZK5A 4L9IA 4O86A 4HVSA 5HU9A 3U55A 1OECA 3G2FA 4IH8A 4CCBA 4ZLYA 1E1XA 1KWPA 4FR4A 4FKIA 5HD7A 5A6NA 4FEVA 3ORLA 2BZJA 1PXMA 2C6MA 1YW2A 4XP2A 5DWRA 4FZFB 4ZTRA 2CSNA 2YM3A 3ORPA 3QCQA 5IF1A 4QMYA 4RZVA 4RFZA 5DRBA 5AFVA 1GIHA 4YC8A 4C2WA 3V8TA 4ANNA 1WBVA 4GUEA 4S2ZA 3VUDA 2H34A 4FX3A 3AMYA 2WMAA 4UV0A 4EORA 1NA7A 3R63A 3HV3A 3ETAA 3IGOA 2JKOA 4U41A 1VYZA 3KF7A 2J51A 1ERKA 3R2BA 3HV4A 4CNHA 3HDMA 3EL7A 1HOWA 2E9OA 3DOGA 2OFVA 2X7FA 4TNBA 4X2FA 5J1WA 4BN1A 5CF8A 4H39A 4X2GA 4C35A 3KRRA 2UZBA 3MH2A 4IZ5A 4I4FA 4GIIA 4FOBA 5E7RA 4FEQA 2YIRA 3ZCLA 4U3YA 4B8MA 1TVOA 5D10A 2R7BA 3LE6A 1STCE 3WF6A 4MF0A 3F3WA 2ZDTA 5DT3A 4C4JA 2PVNA 2XK3A 3F5PA 3UOJA 4WUAA 3RKBA 4ENXA 4O1PA 3SHEA 4XP3A 3UP2A 2OW3A 4I0SA 3LMHA 3TV7A 4BIDA 4X0MA 1Z9XA 3ITZA 5H3QA 4EQUA 1UNLA 4EK6A 3ENMA 2BKKA 4MVFA 3I7CA 3E87A 2PULA 4L8MA 2QR7A 1KV1A 4D58A 2QODA 1B38A 4FSZA 4GK2A 3U6IA 3TL8A 2R4BA 3TZ9A 5T68A 2OZOA 5AIRA 2BAJA 4MQ2A 1XO2B 3ZLXA 4FT7A 4E4LA 3QALE 4YJVA 5EKNA 2BPMA 3WIGA 3L8PA 2WPAA 1NVSA 4IJPA 3TDVA 3EN5A 5L2QA 3DTCA 4ITJA 5E90A 3VUIA 5JN2A 4BCGA 4IX3A 5L8LA 3CY3A 4EK4A 2HK5A 4QMPA 5FTGA 3FZPA 3QA8A 1YXXA 2OJJA 4JDHA 3UQCA 4XG3A 5LMAA 4DEEA 2B9HA 3QQLA 3D5VA 3G5DA 1M2PA 3DV3A 5ETIA 4QQCA 4TWCA 2WMXA 1YWRA 4I22A 5CU2A 4YLKA 3BV3A 4BDAA 3UO5A 1JKLA 5HCYA 2J7TA 3FBVA 3QCXA 4FSTA 4JQEA 3IPHA 2YCQA 4F65A 3GC0A 4U3ZA 5AV4A 5BVKA 3PVUA 3HV7A 3H9FA 4NJDA 3NNXA 4X6RA 4RX9A 1YXVA 3OP5A 5CEIA 2A1AB 4J71A 5DT0A 4BBEA 2V7AA 3CQUA 4QP3A 3RBWA 1Q97A 3IW5A 2C47A 4U42A 4F1TA 3R1YA 2VZ6A 4PDOA 4MXXA 5HG8A 4QMQA 3A7FA 1OIQA 4D4SA 2ZV9A 3KXXA 3V5WA 3MH3A 4GEOA 1H28A 4FKGA 4MXYA 4ZTHA 1W98A 3NAXA 3OMVA 5AV3A 3UYTA 2C0TA 3HRCA 4C3FA 2UW0A 3MYGA 3R8LA 3BYMA 3DBEA 4BDJA 3NR9A 1FINA 2VNYA 3TKUA 3F5GA 3LFSA 4Z55A 4UEUA 4BWPA 4IC7A 2QHMA 4O6LA 2FSLX 2WTKC 4F7JA 2G1TA 2J0MB 2WQEA 1XBCA 3PXZA 2WTDA 4CSVA 3O96A 4ZZOA 1XH5A 3WZKA 2XZSA 2A27A 3QA0A 3VIDA 4J8NA 3THBA 4N4SA 4WSQA 4AA5A 3OXIA 2R0UA 4RT7A 3VJNA 3R7EA 3VUMA 5KMNA 4F0FA 3CR0A 4UN0C 2UW9A 4AS0A 4O82A 4RC3A 3PZHA 1PYEA 2JAMA 4DBNA 3ZSGA 2OXDA 2QCSA 3GOKA 4AGCA 1AGWA 4EQCA 4F9CA 5M53A 2E2BA 5JSMA 2ETMA 3D5WA 2HENA 2CN5A 2GU8A 5AP2A 2VV9A 4U6RA 4PRJA 5IA4A 1UWJA 5CNNA 3MWUA 3NRMA 4IHPA 4MHAA 4YJTA 5CX9A 5M4UA 2YM4A 4M69B 1WAKA 4R1VA 3TUCA 5BYLA 4V01A 2QOCA 2XUUA 4LV8A 3T9TA 4FA2A 4DCAA 1GIJA 4RX7A 2RFSA 3R9OA 3TKHA 5FG8A 2C5VA 2CPKE 3KMMA 3OZ6A 4M66A 5AAFA 2VX0A 4XJ0A 2CCHA 5AUVA 1OBGA 4MD9E 2R3IA 5J9LA 4DFBA 5FBNC 2UW4A 1Q5KA 3BEGA 5EDQA 4O0TA 4YTHA 4IANA 1G8SA 4WSYA 4Y83A 4EOLA 1ZYCA 2QOKA 3UVQA 2DWBA 4DAWA 4IX4A 5AUYA 2QONA 3R8VA 2RL5A 3ZRMA 5AADA 4DG2E 4F9WA 2H96A 4LOPA 5EFQA 3KXZA 5L6OA 2P0CA 2PYWA 4R3RA 5CSHA 3PP0A 1WBSA 4QP4A 4BBMA 2ZJWA 3O8UA 4EJNA 2J50A 3HP2A 3PZEA 3RZBA 4ANQA 5CEKA 1PKDA 4FF8A 2JKMA 3EHAA 4PX6A 5DMZA 2JGZA 3Q9ZA 4I6FA 3NMUF 3B8RA 4OLIA 2IN6A 4D2VA 1S9IA 2IVSA 4AT4A 1BL6A 4BDFA 3GC7A 1LUFA 5HORA 4PMMA 1B6CB 3FY0A 4IWQA 2ITVA 5E8SA 3NNWA 3C4FA 3PPZA 3MSSA 4O0RA 1JSUA 3ACKA 5AWMA 5DG5A 4GG7A 3OTUA 4QMXA 3BPRA 4FMQA 4BRXA 5KMKA 3DK7A 4JBPA 3CP9A 2XVDA 4YNEA 3UBDA 2YN8A 4QYFA 3HZTA 2GQGA 2HW7A 3HMNA 4QMVA 4EZ7A 1JPAA 3LFNA 4RVMA 3V3VA 1URWA 3LW0A 3P7AA 2O8YA 4MBJA 4WOVA 4I6BA 3GBZA 2IJMA 2BRGA 2O2UA 3FZSA 2XH5A 1H4LA 2XNNA 4P5QA 1TKIA 4CFVA 5HQ0A 3IONA 3C4CA 3PXYA 3QTZA 2BIKB 2PUNA 3BQCA 4AQCA 5IQFA 2UV2A 3KXNA 4U97A 3NUSA 4IWPA 5DBXA 5E4HA 2W17A 4AXAA 4IM0A 4ERKA 1ZXEA 2BAKA 4ZAUA 5ANIA 4CD0A 2X7GA 2LGCA 3RPVA 2VX3A 3QXOA 4J7BA 3QAME 4FSQA 4IWOA 3C51A 1SVHA 5KE0A 3QRKA 2XNMA 4FSYA 4IM3A 4C4FA 4CG9A 1REJA 3E7OA 2P3GX 2G9XA 2UW3A 4EOMA 4O2ZA 4E4XA 1ZZLA 4NFMA 3DQXA 1KV2A 4R1YA 5IH6A 2PZYA 3MI9A 4XG2A 4NTTA 2E9NA 4AU8A 1X8BA 4FGRA 3PP1A 3CBLA 1YOLA 4DT9A 5AUTA 2IW9A 4QMMA 2WO6A 1YWVA 2VTMA 2OKRA 4TYGA 3RAWA 5HNGA 5B2LA 3BHVA 2UW5A 1PW2A 3CQEA 5IUGA 3WZJA 4A4XA 3T3UA 4QQ5A 2QO7A 3BHUA 2WKMA 3FDNA 4FT0A 4UY9A 3FMKA 4M13A 3PA3A 3RGFA 3F69A 3G9LX 4FKTA 4J95A 3ZRLA 3E88A 4LRKA 4TL0A 5AR3A 1OI9A 2R3HA 5CALA 4UZDA 5J9ZA 2YCSA 3KULB 3GU7A 2HCKA 4N6YA 1DAWA 1Q8ZA 3A62A 3DAKA 5HD4A 2HWOA 5CXZA 4QD6A 2BVAA 3OS3A 4FV4A 3QTQA 3Q9XA 2QO9A 2X8DA 5LJJA 3UG1A 5K5NA 5E8WA 3CKWA 3GCVA 5IEYA 4W9WA 5AR2A 3LFEA 3UO4A 4AG8A 1G3NA 4QP6A 4Y95A 3CPCA 5ANOA 1XJDA 2JBPA 3PY0A 4J98A 2QG5A 4U80A 3DXQA 3O8PA 4L6QA 5CEOA 4BGQA 3NPCA 4AOTA 5EDRA 3VF8A 5HG5A 5CAUA 3EYGA 4K6ZA 4JLCA 2GHMA 4GVAA 5H8EA 3FZRA 4IXPA 3TDWA 3WZEA 2H9VA 2IVUA 2P2HA 2BFYA 5CEMA 5DLSA 4P7EA 4FVPA 4PV0A 4BKZA 3NUNA 3QUPA 2VX1A 4MNEB 4UYNA 1CKIA 4NM3A 5K4JA 2CGVA 2GDOA 3DGKA 3EQPA 3GGFA 4J8MA 4RGJA 3VBXA 3PXKA 4RZWA 5JMSA 4CVAA 4RX8A 4IM2A 4F9BA 4GV1A 2WMSA 3F2AA 3B8QA 3PXRA 2OLCA 2WD1A 4QYGA 5CEPA 3E8CA 5HE0A 2OSCA 4WNOA 4DEBA 3TV6A 2XEYA 5JFXA 4UMPA 4QMUA 3PDTA 5HI2A 4YO4A 4B6LA 4B9DA 3Q3BA 3MTFA 3Q4TA 1OITA 4V0GB 2GNHA 2UZWE 4EH4A 3GFWA 3OWPA 3W1FA 2BZKB 3BWJA 3MVMA 4CZYB 2WMWA 5JEBA 3II5A 3NSZA 5IA1A 4FG7A 2OZAB 2V7OA 5HTBA 5I9VA 1OL6A 2WQBA 5AX3A 4FSWA 4CRLA 3SQQA 3OXTA 1H01A 3FQSA 2ETKA 3RTPA 4S32A 3TWJA 3KCKA 4FTJA 1IAHA 3G51A 5FP5A 2O3PA 4KKGA 4M14A 4FV3A 5HESA 3ZO1A 5KMMA 4IZAA 4AFJA 3L9LA 3ZRKA 4HNIA 1SMHA 2ETRA 3QF9A 4H3PA 3ALNA 5C9CA 3EN9A 2XRUA 3HX4A 4OR5A 3V5LA 2VTOA 2XNEA 5I5ZA 5GHVA 4JX3A 4ZLZA 5IQAA 5CQUA 3Q52A 3FZOA 4O2PA 4XG8A 2ITXA 3GU8A 4DGLC 2NPQA 4I4EA 4EH7A 2AC3A 4KS8A 2R64A 4YUQA 3K54A 3LCTA 3ORTA 2W0JA 3EQGA 3VHKA 3R1SA 4ALUA 4X3FC 1OPKA 2F7ZE 4DH5A 2Z7QA 3F2RA 3AC4A 1IR3A 4YHTA 3I79A 4RJ5A 3PY1A 4OTPA 3AT3A 2PHKA 2F9GA 2YWPA 2BKZA 2YIQA 5ETAA 4ZP5A 4WIHA 4XV9A 4B99A 4Z3VA 2IG7A 4KAOA 4HNFA 3ELJA 4EYJA 2C3IB 2ITUA 2ZB0A 4RA4A 5I9WA 3P4KA 3BQRA 2ZOQA 4FTIA 4E4NA 3QTXA 3ZSIA 3RNIA 5HBJA 3OC1A 2PZ5A 4FL2A 3R9HA 2WQOA 4MBLA 4PP9A 5IA3A 2DS1A 2KTYA 1Y57A 2VWUA 2ITWA 3TCPA 2B7AA 2XM8A 4RPVA 4C33A 3A7HA 2FYSA 4KIOA 1ZYJA 4OBOA 4EUUA 3TUDA 5DOSA 3GU6A 4PWNA 4O0WA 2GNJA 5TT7A 3VC4A 2ZYBA 4J53A 4MTAA 4RIWA 3VJOA 2GS7A 3AT4A 4RJ6A 4XYFA 4YU2A 5J1VA 3W2OA 3UJGA 2JD5A 2HOGA 4H36A 4YJQA 4AA4A 3UIBA 5IDPA 3LFQA 3OCTA 5BVDA 5H2UA 4FYNA 4C34A 3RMFA 3RNYA 5CAPA 3RPRA 3WZUA 4G5PA 3NYXA 3RM6A 4FNXA 2P2IA 2I0HA 3ZO2A 3DJ5A 3VBQA 3TM0A 2C3LA 2FO0A 4BL1A 1KOBA 4AW0A 2BRMA 5ANGA 5DI1A 2Z2WA 3MTLA 2Y0AA 4AN2A 3OBGA 4CQGA 5LVOA 2YERA 5HG9A 2RSVA 5ANKA 2CKPA 2CKQA 4XEYA 4EONA 5KKRB 2WGJA 5J79A 4GK3A 4FOCA 5FQDC 5L6WL 4C2VA 5AAGA 3ROCA 3FYJX 3KL8A 4DINA 3E8DA 3R1QA 4JOAA 3TV4A 3U87A 4PPCA 4JG8A 1BMKA 1O6YA 4CMUA 4AE6A 4BF2A 1FVVA 5EOLA 3QRJA 2QKRA 3D7TB 3QQJA 2OH0E 4FVRA 4D0XA 5CANA 1MRYA 2HXLA 5G6VA 3VO3A 4YC3A 4OTRA 3GQIA 5IA5A 4WO5A 3AD6A 3DKOA 2X1NA 5AP3A 1RW8A 1JSVA 2QOFA 3MY1A 3OHTA 4JIKA 4ZY5A 3L8SA 4K2RA 5BQ0A 5BUIA 5IH4A 4IAZA 2CLQA 3F9NA 3F66A 3PPKA 4OT6A 4F6WA 4J97A 2OO8X 3ZLWA 2Z7LA 3C9WA 4DA5A 4OTDA 4PTEA 4O0VA 4RQVA 3A8WA 3R7VA 3PE1A 1M7NA 2BROA 5HU3A 4ASZA 2OIBA 3E3PA 3BGQA 3PFQA 4RX5A 4G6LA 3I5ZA 2YJRA 5EI8A 4E6CA 3FI3A 3P9JA 5D7AA 2EWAA 2B9IA 2YAAA 2UVZA 4QTAA 4WG4A 5AM7A 3GCSA 5HX8A 5HVKA 4KSQA 5LARA 3R9DA 3DFAA 3KA0A 1F3MC 4FTOA 3V04A 4K8AA 5A4LA 2PMOX 3LM5A 4OGRA 5EDPA 2W96B 1U54B 3VF9A 1W82A 4M69A 5DHJA 4ZSGA 1ZMWA 5M08A 2XIKA 4OTHA 4CMOA 4WBBB 5I4NA 3LCDA 1XH7A 3QKLA 5M4FA 4U8ZA 2F49A 4DF3A 4G2FA 3VUKA 4KS7A 2WAJA 3QTSA 3R0TA 5JT2A 3U6HA 4EBVA 1ZYDA 2WU7A 4N57A 4TYEA 3CD8A 1U5QA 4YTFA 3OW3A 3SXSA 4CFXA 4GU9A 3ALOA 4FTCA 4I6QA 2JIIA 4O21A 4UWCA 3WF7A 5DIAA 3JY9A 3W55A 4EOKA 4KA3A 2HZ0A 4PPAA 3GUBA 4EBWA 2C6DA 4YLLA 3NLBA 4FV8A 2UZLA 3JPVA 3G33A 4IVAA 5E1EA 2IWIA 4MX9A 2CNUA 2PVLA 1PXNA 2J90A 3DNEA 5K9IA 5L8JA 2YLFA 4IB0A 1WFCA 1AD5A 2O65A 4R5YA 3FZTA 4FV0A 1MQBA 5HOAA 4M84A 5F94A 3BU6A 3SD0A 1IG1A 3P7CA 3PVBA 4HYUA 3LFBA 3GFEA 4IB5A 1U46A 2C4GA 2QD9A 4RWLA 2H6DA 4EH8A 1BKXA 5DA3A 4D1XA 4EC8A 2YIYA 3FXZA 3QTIA 2WEIA 5CI6A 5EG3A 5I3OA 5K3YA 4ACHA 2W99B 3NUXA 2QOLA 2WIHA 4YC6A 3DKFA 5B7VA 2YWVA 2VTQA 3S3IA 1UV5A 3KXMA 2B4SB 3R1NA 2QOQA 3DKGA 2JIVA 4LV5A 3KN5A 3KGAA 4W8DA 4C61A 4DYMA 3ZZWA 2JDVA 4ACMA 2W1DA 1XHAA 4BDIA 1F5QA 5AP7A 3R8PA 5L2WA 2XIXA 5BMMA 5CSPA 4FTKA 2IVTA 4Y72A 4QTEA 5IQGA 4LMNA 5KBRA 4W4WA 5LVPA 2GNIA 4HGEA 4QOXA 1M7QA 3DBFA 3EKKA 4XHKB 4GMYA 4AAAA 4YJSA 4WNPA 3D14A 5A46A 2PMNX 4RC4A 2X8IA 5BX0A 4R7IA 4CKJA 1OL2A 2OJFE 4O1OA 2W1IA 4RIYB 4NEUA 5CAVA 5HEZA 4JJRA 4KIQA 4U40A 3QRTA 5CU3A 3VN9A 4PNIA 5CASA 4G3GA 5DNRA 4I5MA 3MN3A 4KABA 5B0XA 4EHEA 5A4EA 2W9FB 1P5EA 4FZDB 4NCTC 3UIMA 5HZNA 1QCFA 1OKYA 2ONLA 4NKAA 2HW6A 4BWXA 3UG2A 4BDHA 2YDKA 2X6DA 5KNJA 2X7OA 4IDVA 3R9RA 3DQWA 3A2CA 3HAMA 3EJ1A 4I93A 3COKA 4G17A 2P55A 4D4VA 3OCBA 2X9FA 1ZMVA 3DB8A 3ROYA 3EZRA 4RVTA 4AGWA 2W4OA 4A07A 3FXXA 5KMJA 2DUVA 3PLAE 4WNKA 2IZTA 3UIXA 5JH6A 1OKWA 1KOAA 4DE4A 5J5SA 2QVSE 4S33A 3ULZA 2XNBA 3EOCA 2EVAA 2VTRA 4FG9A 2WIPA 2JLDA 3O50A 4D9UA 1JKTA 4O27B 5KX8A 5HLNA 4TNDA 5A4CA 4O7ZA 1VJYA 2R3OA 5AMNA 3SOCA 5BNJA 5GZ8A 5M06A 4PL3A 5G1XA 3Q9YA 5K0KA 4EH3A 3QX2A 4AW5A 4W4XA 4FG8A 5J8IA 3OY3A 3IW4A 2V55A 4NCTA 4PMSA 3NNUA 3ODYX 3CC6A 1HCKA 1WBNA 3GNIB 4ANSA 2BRBA 5D9HA 2YM5A 5EQYA 2F2UA 4M68A 4PPBA 3W8QA 3QZGA 5DGZA 2SRCA 3UPZA 4AN3A 4HCVA 3DJ6A 3QZFA 3MH0A 3KULA 3DXPA 3N4VA 4ITIA 5KO1A 4ZTNA 5BVOA 3ZDIA 4L00A 2J0IA 3NUPA 3OROA 4G9RA 3B2TA 1T45A 4Y85A 3QC9A 4FI1A 3BLQA 4BHZA 4CFFA 1BL7A 2YM8A 3D15A 4PTCA 3R7YA 2BMCA 3PUPA 3COHA 5CU6A 5ANJA 3VQUA 1MQ4A 2QI8A 1BYGA 3Q04A 3BWFA 3FEGA 3FZ1A 3SV0A 5BVNA 4ZJJA 2JDTA 3ZMMA 1PMEA 4LG4A 2OGVA 4Y73A 3KN6A 1NXKA 2B53A 1QPJA 2Z7RA 3O8TA 4HPTE 4JS8A 4RBLA 3L1SA 4DH1A 4M0ZA 4RFMA 4GJ3A 2QKWB 2V22A 4BFMA 3IQ7A 1NW1A 1Q62A 3CIKA 3DLSA 1SYKA 3R22A 5CSWA 1H1SA 5ETFA 4L45A 3UOLA 4RIXB 2WMTA 3G9NA 1GY3A 4O7VA 3ORZA 2FGIA 4YJRA 2O63A 5BMSA 1SNXA 3BHHA 3TEIA 4DEIA 3PJ3A 1H8FA 4FT3A 4YZ9A 3ZONA 4IAIA 2CKOA 5LVMA 4UWBA 5IA0A 1OL7A 3DBDA 2HY0A 2RF9A 3QKKA 5F20A 4BCOA 5IZFA 3PSBA 4I94A 3SX9A 2OH4A 3IKAA 3C0GA 3ZUVA 1OKZA 2G15A 5DEWA 3RPOA 4BCQA 4DCEA 4XRJA 4ZOGA 3TIYA 3W2SA 3QYZA 4MNEA 3NVKI 3HYHA 2XMYA 1FMOE 2PZIA 1GJOA 1OL5A 4EHZA 5AR5A 4FUYA 1Z57A 3V01A 2ACXA 2VTSA 5H8BA 2BZHB 2RFDA 3QHRA 4BTKA 5F4NA 3ZXTA 3BU3A 3RWPA 4HW7A 1GZNA 4EZ3A 3BBWA 4IMYA 4V0GA 3QHWA 3C4ZA 4Z9LA 3ZXZA 2YDIA 3KC3A 2UW6A 3Q2MA 4DH3A 3K3IA 3VRYA 5J7HA 4AZVA 5A54A 5D41A 2X8EA 1UU8A 4CRSA 2OZAA 2C1AA 4DBXA 3H0YA 4FNZA 4OTFA 2C6EA 4FEWA 1OUKA 4TN6A 1VYWA 4EK5A 1V0BA 4AT3A 1ZOHA 4KUJA 4HPUE 5DPVA 2WQNA 4LGGA 3B2WA 1XBBA 2UZTA 2VO0A 3EQDA 4HGSA 5DFPA 4HGTA 2AC5A 5M44A 3HGKA 4W8EA 4KB8A 2VD5A 3TT0A 4GU6A 2VWBA 4AWIA 3TUBA 4F9AA 5I0BA 4R8QA 3TKIA 4IAAA 4FKRA 4ZTSA 4XG7A 4A9UA 2BDJA 5C1QB 2OXYA 3D2KA 3R01A 3RP9A 2CNVA 2G2FA 3JY0A 3QTRA 3H30A 5DRDA 4ZZMA 5K5XA 4FNYA 4E3CA 2C5YA 2O5KA 2REIA 3MVJA 4ZY4A 2GTMA 4GG5A 5M55A 1R3CA 4IVBA 4A06A 3ZUUA 4QMWA 4I24A 3QGWA 4O6EA 4NYEA 3ID6C 3LCKA 1MRUA 2PVHA 4X2KA 4V05A 3EN4A 5HKMA 1PY5A 2P33A 5JGDA 3SA0A 2JDOA 2X6EA 1SM2A 5AUUA 5M4CA 3G90X 4JI9A 3UMXA 3VRZA 2JBOA 3I81A 4HCUA 3R8ZA 5FM2A 2W06A 1FBNA 1ZLTA 3IO7A 2WOUA 5EKOA 2YEXA 4DGOA 3T8OA 4PL5A 5EM7A 3I7BA 4YZDA 4GYGA 4IZYA 3BE9A 4KD1A 3C0IA 3MPAA 5HCXA 5GIPE 2VTNA 2VO6A 4YZBA 5JQ8A 3QZIA 2C5NA 4F09A 1HCLA 4E73A 3VS6A 3P86A 5ACKA 3LJ2A 2PUIA 2OJGA 5EI6A 3UNJA 3AMBA 3D7ZA 3POZA 3NEWA 4KRCA 3ZO3A 1F0QA 3FI8A 3E92A 3WILA 2WMRA 2KULA 5IU2A 3NW7A 4GS6A 2Q0NA 3AD5A 3WYYA 2UZOA 4YPSA 5B2MA 4Q2AA 3F3UA 3PRIA 3U51A 2GMXA 2VWIA 3ZM9A 2F2CB 2PE0A 4RA5A 4WT6A 5EHOA 4KKEA 3G0EA 3RAHA 3PIXA 3D5UA 4XLVA 2FSOX 4OTGA 1U59A 5AUXA 2C69A 4Y46A 1OPLA 1GAGA 2YAKA 3PSDA 5EW8A 4EH6A 3P78A 4FTRA 4FBXA 4RVKA 1JAMA 3DAJA 4MEDA 3FV8A 5CNOA 1WBTA 4ZIMA 5F95A 1GZ8A 3OCSA 3MA3A 4WRSA 4HGLA 1Q8WA 4NU1A 5DR6A 4ALVA 3ZH8A 4BYIA 4RQKA 2JDSA 3N51A 4P5ZA 3VS0A 1E9HA 2I1MA 5L8KA 4XS2A 5JQ5A 5HNBA 5IDNA 2C5XA 3O0GA 5D11A 3LCSA 4A4OA 4A4LA 2Y4IB 4DGGA 4R6VA 3D7TA 3F7WA 4FKQA 2YCRA 3KMUA 3R71A 3KRJA 5JRSA 2ZB1A 3FJQE 3R83A 1O9UA 3MW1A 3EQIA 4MXZA 1AQ1A 5JK3A 3U4WA 4CTCA 1G8AA 1UVRA 4G34A 4IACA 5F1ZA 3EMGA 4HJOA 3W2RA 5AV2A 1JKKA 5EW9A 4ANLA 4AZWA 2CCIA 4UXLA 4Q5HA 3BYUA 3LQ3A 4N70A 3LXPA 5HO7A 4BCKA 2XK4A 4S30A 2BZIB 1H1QA 3ZC6A 4GT3A 4AN9A 4BTFA 3NYOA 3AXWA 4GT5A 3D2IA 4QPAA 2ZVAA 3FC1X 3Q32A 3QU0A 5ANEA 1LEWA 2XA4A 4E5BA 4IX5A 5A14A 5CAOA 1U4DA 2BRNA 5AUWA 3PVGA 5FXQA 3VW6A 2BDFA 2XCKA 3MS9A 5C27A 5T6KA 3L9NA 2W4JA 2ITNA 2I0YA 4DFNA 3S95A 3S00A 2FA2A 5KCVA 3AC3A 4G5JA 3VUHA 4R7BA 2UVYA 4DITA 4DG0E 3QTWA 4D1ZA 3OBJA 3JXWA 3DDQA 3QGYA 4YTCA 4O7RA 2YISA 3GENA 5CLPA 1U54A 1H1WA 5ETCA 3R7UA 3RALA 1Q4LA 2OXXA 2XCHA 3FE3A 4RWIA 4O0YA 4DH8A 2CJMA 5JRQA 1FVRA 4A9TA 3VS4A 4ACDA 2NRUA 3ZLYA 4DEDA 4YO6A 5JFWA 3QQKA 2J5FA 3L9PA 4AW1A 3SRVB 3KRWA 4FZ7A 5CXHA 5IEVA 2I0VA 4LOQA 5IQCA 2YCFA 2GHLA 3SOAA 2XF0A 4L7FA 3W32A 1Q41A 4LL0A 3UC4A 3HV5A 3OTVA 1PXJA 2DQ7X 3LFDA 2G2HA 4FK3A 4DFLA 3V5QA 3EWHA 2VU3A 3DZOA 4FTTA 4I92A 3M1SA 3MPTA 3TZ8A 3BEAA 3WZDA 4M8TA 4BI2A 1OMWA 4N6ZA 3DT1A 2HELA 4FZAB 1UU3A 5EH0A 3FQEA 3KU2A 4XG4A 2B52A 2BTRA 3V6RA 3WYXA 3MFUA 2VWWA 2BALA 1PRYA 2CDZA 1QMZA 1RDQE 2W05A 2Y6OA 1SZMA 1TQPA 2XYUA 4M3QA 4JXFA 3NX8A 3CCNA 5KUPA 3UP7A 3R28A 3R7OA 3Q4CA 4JNWA 1RJBA 5DVRA 3SDJA 4F6UA 3FSFA 4FT5A 4GFMA 3RCJA 1PJKA 4YHFA 3FMMA 3FLNC 3LAUA 1H07A 3ENHA 5LMKA 4H3BA 4YZNA 3HMMA 4Y8DA 4RIOA 5FGKA 2F7EE 5HO8A 3PJ8A 3ZSHA 4CT2A 3NWWA 4FIEA 3ERKA 4FIGA 2EUFB 3O17A 4G3CA 1R1WA 2ITYA 2UW7A 3BGZA 3BKBA 3RHKA 3A99A 2HAKA 3EH9A 4JBQA 5C4LA 4C7TA 1J7LA 5HNIX 1OVEA 4D1SA 1M14A 2R3LA 3IW6A 3VS2A 2XBJA 3LCOA 3V5JA 4D9TA 4G3FA 4YJPA 5EQEA 3LZBA 4L46A 4CV9A 3CTJA 2QLQA 3G0FA 2ITQA 4GCJA 4QYHA 5EHYA 4E93A 4TYHA 4ID7A 5CF4A 2CGUA 3CGFA 4IVDA 4AZFA 4WRGA 5AUZA 1IA8A 3TTJA 3MVLA 2B0QA 4RIYA 5AP0A 4FV5A 3W16A 3C5IA 4UXQA 3F5XA 2WNTA 4G3DA 1FMKA 1LP4A 4B8LA 3FPQA 3Q6WA 4M12A 3I1AA 2J9MA 5C8NA 3PYYA 5GJFA 3SC1A 3FLYA 4U0IA 4YZCA 4C62A 1UNGA 3JS2A 4I6HA 4O0XA 3OT8A 1Q8YA 5BVFA 3OCGA 4CLJA 4P90A 5E1SA 4XG6A 4D4YA 2CGWA 2BHEA 2XJ0A 3KEXA 5BVWA 2PVJA 3UVRA 5CTPA 5K0XA 5LXMA 3MPMA 3E8NA 5CVGA 2PVMA 5F9EA 2GCDA 2XJ2A 2JFLA 3KQ7A 2YACA 3E63A 4AE9A 4EYMA 2ZMCA 3H4JA 4AZTA 4I0RA 4PTGA 3G15A 3LMIA 2Y7JA 3P7BA 2Q83A 3E7VA 1PMVA 3ANQA 3F6XA 4FIFA 3O2MA 2R2PA 3V8WA 1ZYSA 1J3HA 4LUEA 4TW9A 5A3XA 5M09A 1O6KA 4YLJA 5AX9A 5IMEA 3U8WA 5FD2A 5IUIA 3RM7A 4X2NA 1UU9A 4ZXTA 5HIDA 2RKUA 4C57A 4MBIA 5M57A 1OUYA 1H00A 3LOKA 3DTWA 1PXKA 4L52A 2X2KA 4AZEA 4CKIA 3CEKA 2VTIA 3VVHA 5K4IA 5TOZA 3VNTA 5EYKA 2HZNA 3H9OA 4QP9A 5IQEA 3RAIA 3SG8A 3Q96A 3SG9A 2X39A 1Q3WA 3QC4A 2P4IA 1PMUA 4U45A 4C37A 2C6TA 4DGMA 3QXPA 3DS6A 4TWOA 4YMJA 3JUHA 3GCUA 3DB6A 4E4MA 4EEVA 4EUTA 4PL4A 4QMNA 4YP8A 4J99A 3R73A 3OEFX 5A4QA 3QQFA 1PYXA 4O0SA 5J5TA 4GL9A 4IEBA 4U79A 5AR7A 4I21A 1KE8A 4NTSA 3KFAA 3UOHA 3KK9A 3PA4A 4D0WA 3BHTA 2JIUA 4RIXA 2XYNA 4XCUA 5AP4A 4JBOA 3RK9A 4GFOA 3CTQA 4HVIA 3O7LB 4YBKA 1YDTE 2W1EA 1Q8TA 2WXVA 3FUPA 2WMUA 3IK3A 4FSNA 4R3PA 4GW8A 3ORNA 3DKCA 4FGBA 4IZ7A 5J95A 1M17A 3BE2A 3AC1A 3CTHA 3VULA 4LGHA 3TNIA 3WF9A 4EWHA 5KHWA 3BBTB 4L3LA 4FTLA 4L43A 4F6SA 3FPMA 5BYZA 4XV2A 5AV0A 4F08A 5IUHA 3SVVA 4ANMA 3RHXA 5FTOA 3S0OA 1DI9A 5HIEA 3QQGA 4CQEA 2WTKB 3DFCB 4C3RA 2I7QA 5LMBA 2CKEA 4TYIA 3ATSA 3ZU7A 4NFNA 2YABA 1H25A 4UB7A 4F4PA 1OGUA 3RK5A 3U4UA 3A7JA 1M2QA 1J1BA 1H08A 4K77A 5EM6A 1CDKA 4E5AX 4YZMA 4EC9A 4NW6A 1XKKA 2X4FA 3C5UA 3D4QA 3F82A 4FKUA 4O81A 4DEGA 4YBJA 5L2IA 5FM3A 3RCDA 2WFYA 2XK9A 1IASA 4U81A 3OD6X 4JG6A 5C8MA 5GZAA 2W9ZB 5KMIA 4X3JA 3HA8A 1WMKA 2Y9QA 1ZZ2A 1PXPA 2VWZA 2XIRA 3BV2A 3I0QA 4KNBA 3V5TA 3SAYA 5L4QA 2YM6A 3HV6A 2R3MA 4IAYA 1P4FA 4JQ8A 3R8UA 4HVDA 4QT1A 3OWLA 5CZIA 1ZOEA 1ZOGA 2C3JA 3ZEWA 4DLJA 2R9SA 4NZWB 4Q9ZA 1J1CA 3N9XA 3WI6A 1JWHA 3DJ7A 4F63A 3LFFA 5FEDA 4OBPA 5FXRA 4IB3A 3AQVA 2VRXA 1W0XC 4GSBA 5E8VA 2WTIA 3QYWA 3BLHA 3KY2A 4K1BA 2QNJA 3DLZA 4IWDA 3UODA 4GFGA 2OWBA 3HECA 3RJCA 5GJGA 3WIKA 3GCPA 2QHNA 4HCTA 3NAYA 3WE4A 5FXSA 1OIUA 2PVRA 5CWZA 3R7IA 3TG1A 4AUAA 2V62A 4HYHA 3TN8A 2PMIA 1W83A 3NIEA 3F3TA 4BZDA 1URCA 4BB4A 1JKSA 3GB2A 3ORKA 5GJDA 2W1ZA 4QMLA 3GXLA 3P1AA 4YJNA 2VO7A 2WZJA 4E8AA 3AG9A 4DFXE 4BCFA 3M11A 1OM1A 4TRLA 3PG3A 1ZARA 4YSMA 1Z5MA 5I9YA 3IGGA 4ZSEA 2GHGA 4ZMFA 3I0OA 3CQWA 3ORXA 3ATTA 3OOGA 4Z7GA 3VW8A 4FL1A 3FQHA 3KRXA 2J5EA 4F7SA 3BYSA 4WHZA 4YJUA 2OIQA 4E6AA 3IOKA 2Q0BA 3EB0A 4DHFA 3R9NA 2XKEA 3C4EA 5ANDA 5JZNA 3RI1A 3QKMA 3UPXA 5J9YA 3ORMA 2CLXA 4FIJA 1XH4A 5AR4A 3F61A 4DEHA 3OY1A 4E26A 3AD4A 3D83A 3JVSA 5JKGA 2XK6A 5AEPA 1Q8UA 2HZ4A 4R3CA 4JBVA 5FTQA 4ZY6A 3GVUA 5LCJA 2WTVA 3MV5A 3CJFA 2PL0A 4L7SA 2Z02A 4AW2A 3PSCA 4AP7A 4BKYA 2BILB 5HICA 1JBPE 3EQBA 4FV7A 1UWHA 3ZO4A 2VTLA 1OL1A 5DT4A 3FHRA 3RVGA 4RJ3A 4D2WA 3ANRA 3OEZA 3R02A 1PHKA 4EH5A 3EQHA 4BCPA 5DEYA 1CSNA 2XJ1A 1CMKE 4ANOA 3Q5IA 3TNQB 2VAGA 2O64A 2OU7A 3RPSA 4U7ZA 1XH8A 2DYLA 5HTIA 4TPTA 5IG1A 4J1RA 4FNWA 2XK8A 2BDWA 3BGPA 3GI3A 5HGIA 3SGCA 4JVGA 4OUCA 4UALA 2IW6A 4AOIA 3QLGA 3L8VA 4V04A 2C0OA 4JT3A 4APCA 5IH5A 3R6XA 1L3RE 2ONLC 2UZVA 4X21A 3S2PA 3NW5A 2H8HA 2JITA 4M97A 1SVGA 4JDJA 3HNGA 5A9UA 2C6OA 3AMAA 1RE8A 2B1PA 2BRHA 1XQZA 3QQHA 5LQFA 2CNQA 1T46A 2XKCA 3LHJA 1WCCA 2GSFA 3PA5A 5IQBA 1FQ1B 5CSVA 5TF9A 4CYJA 2VUWA 4PP7A 3QUEA 1K2PA 2WELA 4QMOA 2WHBA 2PVFA 2PY3A 4QNYA 4B7TA 2HY81 2A0CX 5T3QA 2C0IA 2I0EA 3UMWA 1VEBA 4G3EA 3TI1A 2JC6A 4DH7A 4EI4A 3FKNA 2GQSA 4IQ6A 4BTMA 4K33A 2ZV8A 4IAFA 4PMTA 3PVWA 3QRIA 3ZS5A 2BR1A 3V8SA 1NY3A 2ITPA 4WG3A 4Y5QA 4TKSA 1DS5A 4ACGA 4D2TA 3H0ZA 3A7GA 4NM7A 4NKSA 4FKPA 2G2IA 3V6SA 5AA9A 2Y6MA 5I3RA 3HRFA 5AM6A 5FDPA 2YFXA 4M67A 2J0LA 4EKLA 4EOQA 4MD7E 3QD3A 4G16A 4BDBA 3K3JA 5CU0A 4USFA 5JFVA 3I4BA 1Y91A 3SRVA 4DLIA 4L3PA 1B39A 3FLSA 4Z16A 5CEQA 5H9BA 2OIDA 4XOYA 4FZ6A 3UTOA 4FKLA 4LL5A 4ZJIA 4YPDA 3VBVA 2BUJA 3VBTA 4BICA 3ACJA 5AIKA 2VTPA 4JRVA 4A9YA 4EOSA 3UZTA 4XUFA 4WD5A 5HVYA 4AACA 4LOOA 4W4YA 3HUBA 5FEEA 4H1MA 4CFMA 2R3QA 4MNFA 3UZPA 3U6JA 4J52A 5LWNA 3UQFA 5FRIA 4M0YA 2VTAA 3P0MA 5IKWA 4YHJA 4ASDA 4F1MA 4O7TA 2EB3A 4IB1A 3W2QA 2XNPA 3FKOA 2C30A 3E3BX 3K5UA 4TTHB 4D55A 1BLXA 4UMUA 2F7XE 3FKLA 4KSPA 5CS6A 1W84A 4MXAA 4C0TA 1ZY4A 3KKVA 4D2RA 3RAKA 3EIDA 5HE3A 4YURA 5JGAA 5E8UA 4FKSA 2GS2A 4NIFB 5DR2A 4BGHA 2A4LA 4PMPA 5FWKK 4Y5HA 4QTDA 4ZTLA 2J0JA 4IE9A 5AP6A 3AOXA 1YI4A 3ZHPC 2JFMA 4ASEA 3QLFA 2JAVA 4M7IA 5BUEA 5HIBA 1YI6A 4FV2A 4QNAA 1M52A 2Z8CA 4AF3A 4RRVA 4HVHA 1OBDA 3KREA 3MIAA 1Q24A 2VO3A 3SKCA 1K3AA 2OFUA 3PRFA 5IQIA 3GCQA 3MIYA 3POOA 4BDCA 1QPCA 4G6OA 4XRLA 4UWYA 1ZRZA 5LVLA 2YIWA 3S1HA 5CI7A 2VGOA 2W7XA 2NRYA 3KVXA 4RJ4A 3EFWA 4EOJA 5AP1A 4DGNA 2UW8A
chains in the Genus database with same CATH superfamily
5FEQA 2OF2A 4FV9A 4CT1A 1JLUE 4OT5A 4QTCA 4C4EA 3UOKA 3DDPA 5C03A 3CKXA 3EFKA 5EOBA 5KHXA 2PU8A 1OZ1A 5HCZA 4JRNA 2I40A 2X81A 2R3GA 2W1HA 1I44A 3CY2A 4FL3A 1Q61A 3CLYA 3A61A 4BCHA 1E1VA 3ORIA 4OTQA 2YA9A 4QMTA 3KXHA 4X3FB 2XAOA 3VUGA 4XX9A 3GC9A 4DT8A 3AKLA 4XG9A 3QCYA 4XBRA 4RIWB 3PTGA 4CGAA 2EXEA 1QPDA 3D5XA 5HHWA 4IJ9A 4FK6A 1H0WA 2YM7A 5GINE 4Q5EA 2PE1A 1DI8A 2JKKA 2OJ9A 3FY2A 3R2YA 5ACBC 4IC8A 3LIJA 3NNVA 5CQWA 2XS0A 1TZDA 2I6LA 3WOWA 5L6PA 3BLRA 4IW0A 4X6QC 3DY7A 5FBOA 3AT2A 1YRPA 3NUYA 1NT2A 2BAQA 2X0PA 4GT4A 4NUSA 3BU5A 3N4UA 1P14A 4DEAA 2QU5A 3LLAA 3KCFA 2X2LA 4JG7A 4UMRA 2Z60A 3I6WA 2C6LA 3MY0A 3A60A 4S31A 3MFSA 4WA9A 5EYCA 3C1XA 1H0VA 3C4WA 4FSRA 3PLSA 3QUDA 2XKDA 3I6UA 1R39A 5M4IA 5EYDA 1G8JA 3MFRA 1OKVA 4XBUA 3ZFMA 4KBKA 4HOKA 3UYSA 3EYHA 4I23A 2LAVA 4BCMA 4CXAA 1WZYA 4D28A 3ZZEA 4QQTA 2ZV2A 4UYAA 3HKOA 4C02A 4RVLA 4RLKA 5HO6A 1BI8A 4CYIA 4QMZA 4FV6A 2XIZA 1R0EA 5E8XA 3UNKA 1XBAA 4XV1A 2C68A 4RLLA 1TQIA 4DTKA 4LRMA 4H58A 1GZKA 4WBOA 2HZIA 5CENA 5D12A 4FEUA 5IQHA 2UVXA 5IPJA 3JVRA 3F5UA 1H24A 3DAEA 3FLZA 3FYKX 2W5HA 2VTTA 2XBAA 3KRLA 2CHLA 2OF4A 1MRVA 2R5TA 2WMVA 3RZFA 3T9IA 5FDXA 2FUMA 1YDSE 1BUHA 2PMLX 3D0EA 3DU8A 5HLPA 4AGUA 3GC8A 1FPUA 2VWYA 4CFWA 5A6OA 5IISA 3H10A 3DK3A 3FHIA 3VAPA 3UZRA 3ZEPA 1A9UA 2HWPA 2PPQA 4ERWA 2RG5A 3WARA 2ZMDA 3IOPA 3ZTXA 4DFZE 4OAUC 4W4VA 3LJ0A 4FTMA 4O84A 3E93A 3KK8A 3Q6UA 1YHWA 4MAOA 4RFYA 1I09A 3D9VA 4BC6A 1MP8A 5I9ZA 5KKRC 4BHNA 4BVUA 2R3JA 4IFCA 3RPYA 2PTKA 4HVGA 5CY3A 3GP0A 3DBCA 4BI0A 2WU6A 2IO6A 5CU4A 4JDKA 3OXZA 4G31A 4GUBA 3R7GA 3SXRA 1NVRA 3W0MA 3KXGA 4KRDA 4FVQA 1R78A 3EL8A 3OUKA 3W2CA 3HLLA 1V0PA 3ODZX 4USEA 1WVXA 2WTCA 3MA6A 4R7HA 4BDEA 4XLIA 2QOBA 2A2AA 3O71A 4KIKB 3KMWA 5L2TA 1YHSA 2OJIA 1L8TA 5DR9A 4LUDA 4WNMA 4BI1A 1DAYA 4TT7A 4OBQA 5I9XA 4E1ZA 1V1KA 1H1RA 2XK7A 3FMEA 3HUCA 4EOPA 4UX9A 1YVJA 4ZMEA 2HYYA 3QX4A 3HA6A 5GIOE 2IVVA 1YOJA 3PIZA 4ZSAA 4P2KA 4NL0A 4B4LA 1JQHA 5IMXA 3AGLA 3HMIA 3ZUTA 4CTBA 5JZJA 3HVCA 1YXSA 3LJ1A 1APME 1YXUA 4CG8A 3QL8A 4EK3A 2ERKA 5KZ0A 4CLIA 5J7BA 4G1WA 1GZOA 3GU4A 4MYGA 3E64A 2W1CA 1KE7A 2JKQA 4YJOA 1J91A 1P4OA 3QFVA 4I20A 1ND4A 2YHVA 3RWQA 4CZTA 4U5JA 2QOHA 3VQHA 4WUNA 2PUUA 4C3PA 3LXKA 3WBLA 3GT8A 5LOHA 3W33A 2J2IB 1CM8A 4R5SA 3FI2A 2OK1A 1PF8A 2ITTA 4RC2A 3VUTA 4F7LA 3FSKA 2VTHA 1NVQA 4MCVA 5M56A 4ACCA 4NW5A 3Q60A 2QR8A 4C4HA 3VWAA 2B9FA 4II5A 3MJ2A 3U9CA 3ZBXA 2BTSA 4ONAA 1BX6A 5J87A 2X0GA 1ZY5A 2QLUA 4IX6A 3HEGA 2OG8A 2PWLA 3REPA 4F64A 1KE9A 2F57A 2QURA 3P79A 2UZEA 1SVEA 5LCKA 1CKJA 5L2SA 1UNHA 2OBJA 3IDBA 4JDIA 4FTAA 3TNHA 5EQPA 1S9JA 3Q5ZA 4D4RA 3PJCA 1YQJA 3NS9A 3G6GA 3EQFA 4QTBA 4AT5A 4EOIA 3O51A 5ITAA 3KF4A 4Q9SA 2CMWA 4FTNA 3MFTA 2R3RA 3IS5A 4FV1A 4ITHA 1KE6A 1GNGA 4MWHA 4QP8A 4NSTA 5CSXA 4BCNA 4DFYA 2NO3A 1W8CA 4GK4A 3P5KA 1Y8YA 3QCSA 4AA0A 4CFUA 3WF8A 5ICPA 3LPBA 4HYSA 3OOMA 4AFEA 4LM5A 2PVKA 2X4ZA 5D1JA 2W1GA 3HMPA 3EN6A 1YI3A 1PKGA 5FP6A 4RWKA 4ZSJA 4PDYA 4EL9A 5C8KA 3E5AA 3V5PA 2YIXA 5EM8A 4ENYA 2XM9A 3E62A 2E9VA 4EHVA 4B0GA 1A48A 5DE2A 4LRJA 4ANBA 5LMKC 3U54A 3F2NA 1IRKA 4O7SA 2EXCX 3R00A 4JAIA 5C4KA 4ZZNA 3PJ2A 5E8TA 4BDGA 2GNLA 4D2PA 3MJ1A 1KSWA 1PXLA 4HYIA 3RINA 3FXWA 2W5BA 3GEQA 3QWKA 4FODA 2B55A 3UDTA 4NM5A 4A9SA 3Q4ZA 4FIHA 3KVWA 2EU9A 3G6HA 4K11A 4FTUA 2C3KA 5CT7A 2RFNA 3FI4A 3E8EA 2IZUA 2GNFA 3NDMA 4DC2A 4D2SA 4S34A 3VS7A 4QO9A 3P08A 4WKQA 3QRUA 5JFSA 1V0OA 2XALA 2UZNA 3BELA 5KMLA 5AP5A 3DCVA 3FL4A 5CVFA 2XB7A 3EN7A 2W1FA 3IDPA 4FEXA 3DPKA 3FL5A 3NIZA 3Q9WA 4UBAA 3W0SA 3CXWA 1WVWA 4IIRA 3MVHA 4GYIA 5CVHA 1IEPA 1ZMUA 4E6QA 1VR2A 3QBNA 4JAJA 4I41A 4GJ2A 4E7WA 4KBAA 4DFUA 2A19B 5AR8A 4YR8A 2VWVA 4TY1A 1XH9A 3LQ5A 4F70A 3DZQA 3UGCA 4EKKA 4MWIA 3C50A 4PUZA 4OTIA 3DXNA 3W8LA 5C01A 4E5WA 2VWXA 3QZHA 4IADA 4ZJVA 4O38A 5CZHA 4APPA 1G5SA 3HP5A 2X9EA 4L44A 4M15A 4GIHA 4TWPA 1UKHA 4C36A 4EQMA 1LPUA 4ZEGA 2W5AA 1K9AA 3PE2A 2YDJA 5E91A 3TJDA 3VHEA 3U9NA 5HG7A 1QL6A 2AYPA 2GTNA 2NP8A 3COIA 3K2LA 1EH4A 2WOTA 3A7IA 5DN3A 3F3ZA 2YLEA 3OG7A 1YDRE 4ZS4A 4UMQA 3AC8A 3GQLA 4PY1A 4D5HA 4BY9E 3NGAA 4DDIA 2CGXA 3QD0A 3ZDUA 3FWQA 4BGGA 2BFXA 2QG7A 4YTIA 2WTWA 1H1PA 3TIZA 1KE5A 1FVTA 4BTJA 1PMNA 1GIIA 2B9JA 3VBYA 3ZOSA 1ZAOA 2YZLA 3L8XA 4JR3A 4USDA 1IAJA 3C0HA 2C1BA 2R7IA 5BYYA 3ZC5A 3PIYA 4FIIA 4MKCA 5HE1A 3CE3A 4K0YA 3H9RA 3QQUA 1UA2A 5TE0A 3W2PA 4H3QA 4WG5A 2R0IA 3PY3A 2ZV7A 2PZRA 2WMQA 3CS9A 2C5OA 3QTUA 4U9AA 2WEVA 3FC2A 1OIRA 4O91A 2OICA 4PF4A 2XNGA 2BIYA 5I9UA 4BWKA 2XIYA 4GRBA 4N0SA 3H3CA 3FMHA 4FKWA 3VS3A 3NFGB 4GKIA 2XRWA 5HE2A 3L9MA 4KINA 4AX8A 1O6LA 3F7ZA 4TZRA 4AZSA 4KWPA 4TXCA 1Q3DA 2GS6A 4IVCA 4QYEA 4F7NA 5IEXA 1JOWB 2ZM4A 3A8XA 4W9XA 3NUAA 3IECA 3NYVA 4O7YA 2UZUE 4FSUA 3DNDA 4L68A 3WE8A 3AC5A 3KIOC 3R21A 4EWQA 2GNGA 3EZVA 4L53A 1YKRA 2QOIA 1UU7A 1H27A 2CN8A 4I3ZA 4QPSA 4CEGA 1G8KA 3SXFA 3LXNA 3RK7A 4D5KA 1XR1A 4NIFA 3HL7A 3FMJA 1JSTA 4EH9A 1BI7A 4NT4A 4FKVA 2EXMA 4QP7A 4PDPA 4RG0A 4E6DA 4K9YA 3TNWA 4F0IA 4X7QA 5L3AA 5HBEA 4FKJA 2Y8OA 5E8YA 4EHGA 4CCUA 4I0TA 2XP2A 4DHJA 4ZTMA 2RIOA 5FUTA 1YOMA 5TO8A 4NJ3A 4FE2A 4BR3A 4BZNA 4MXOA 3BYVA 2R3KA 3NZ0A 4F99A 4O7WA 3COMA 4O7LA 3M2WA 3AGMA 2BHHA 2R3FA 3EKNA 5TR6A 1SNUA 3SW7A 3LM0A 3A4OX 4MXCA 2NNWB 3ULIA 2PE2A 4FICA 4X2JA 3VS5A 3CGOA 2GPHA 5AA8A 4AOJA 1RQQA 1YWNA 4EH2A 4C38A 2ERZE 4KBCA 4EJ7A 2ESMA 1R0PA 1FGKA 2GQRA 4U44A 5H8GA 4O0UA 3OF0A 5C26A 5DYJA 3HMOA 2PUPA 1ZYLA 3MY5A 4EK8A 5HTCA 2FB8A 2X2MA 4EOOA 4EZ5A 4KKHA 5D7VA 4CMTA 4H1JA 3GOPA 2QOOA 3FAAA 3UVPA 3ZYAA 4X3FA 3BI6A 4QRCA 1ZWSA 1FOTA 3F88A 4I5PA 4JX7A 3OW4A 4O4BB 5IQDA 3R8MA 3BYOA 3MGYA 4LFIA 2RGPA 3PFYA 4BJJB 3UDSA 4NH1A 2J4ZA 3CD3A 1Y6AA 1M2RA 3BZ3A 4MF1A 2C6IA 4DG3E 2IW8A 4E20A 2IZRA 4GVJA 4FSMA 3LQ8A 4JR7A 4ZSLA 5LWMA 4ORKA 3I5NA 4XV3A 3DK6A 3PWDA 4C59A 3OT3A 2QO2A 3DA6A 4BIEA 4QQJA 5BVEA 3VS1A 4L01A 2HIWA 4QP1A 3LLTA 2QC6A 3QWJA 4BDKA 2YZAA 2XEZA 3JYAA 4HZRA 5KMOA 4FUXA 3TJCA 2YITA 5IA2A 3NVMB 2VTJA 3N4TA 1UKIA 3FMLA 2E9UA 1GOLA 3FLWA 5E8ZA 3FMNA 4BKJA 5EK7A 1PXOA 4OAVB 2FH9A 4YSJA 4MQ1A 3PJ1A 1QPEA 5B2KA 4QYYA 4O83A 2E9PA 2R3NA 3C7QA 4C8BA 1J7IA 4AXEA 4IDTA 5HVJA 3OWJA 2PZPA 4PQNA 2HXQA 1DM2A 2V5QA 5KBQA 5CYIA 2WB8A 3UO6A 4FYOA 4ZTQA 2OI4X 3T3VA 3ZM4A 3ZLSA 4LMUA 1XWSA 3P23A 4JQ7A 4QP2A 3UQGA 4ALWA 4AXCA 4C4IA 4FTQA 4OTWA 1YXTA 4GH2A 3V51A 3W10A 1WBWA 4KIPA 3UDBA 1XH6A 4ASXA 4UZHA 2B54A 2QQ7A 4CZUA 5M51A 4BDDA 4ZLOA 3UIUA 4DTAA 3BCEA 3NUUA 4FT9A 2WTJA 4IBMA 4RJ7A 4CFNA 2FSMX 4XNEA 5EM5A 4IAKA 1CTPE 2UUEA 2YJSA 2IEWA 1U5RA 3KB7A 4I1ZA 4Z7HA 4TWNA 5GZ9A 3DBQA 3MDYA 5AJQA 2PK9A 3OFMA 4F0GA 3FMDA 4RWJA 3QD2B 3SW4A 5EW3A 4I5CA 5HX6A 3HRBA 1IA9A 2XKFA 3TZ7A 3TTIA 3F3VA 3EFJA 5AAEA 3LMGA 1FGIA 2ITZA 3EQCA 5BPYA 1WVYA 3MB7A 2WQMA 3AC2A 4XP0A 3ET7A 2RG6A 4J96A 4P4CA 2C6KA 4L67A 3UC3A 5CF5A 4O96A 4BYJA 3HDNA 3WF5A 2PVYA 1LR4A 4G6NA 4BBFA 2G01A 3C4XA 4RJ8A 3LFCA 1OIYA 4NWMA 3R04A 3SLSA 3TZMA 5HLWA 1Y8GA 2ZM1A 2Y4IC 3IDCA 1W7HA 3MB6A 3NW6A 3Q53A 5A4TA 4DTBA 3HAVA 4DN5A 3LKMA 2R3PA 5EHLA 3UE4A 4GKHA 3C13A 4KIKA 2JEDA 2IZSA 1A06A 3NYNA 4FC0A 4XOZA 3IG7A 5DH3A 4BIBA 2ZDUA 3MBLA 2PSQA 4QMSA 1YHVA 2JDRA 3Q2JA 2VN9A 4U43A 5HBHA 5TKDA 3JR1A 3OVVA 4BCIA 1OB3A 3QD4A 1WBPA 2BCJA 3I60A 4IFGA 3PG1A 5KZIA 4L3JA 3TXOA 4A7CA 3IW8A 4K18A 4XMOA 5CF6A 4I5HA 1KUTA 3LXLA 3OUNB 4CKRA 4F9YA 4I6LA 2FVDA 4G9CA 1CKPA 4CV8A 4R77A 5BUJA 2Y4PA 3BX5A 3ZFXA 3LVPA 2Z7SA 2UZDA 4FKOA 2F4JA 1WBOA 3NCGA 1H26A 5AV1A 3S4QA 4C4GA 3PWYA 5LVNA 1J7UA 3MESA 2RFEA 3IW7A 2W4KA 3BIZA 3R30A 4LQMA 4O22A 2GFCA 1XMMA 4OW8A 4MD8E 5E92A 4O7NA 3EQRA 4HZSA 3BHYA 2XNOA 1TQMA 3CJGA 5EI2A 2J0KA 3TACA 1OPJA 3OWKA 4TYJA 4YNOA 4PNKA 4JL9A 2ZM3A 5JGBA 3O23A 2VGPA 3D94A 4LI5A 4L42A 3ZBFA 3VBWA 3Q4UA 3PXQA 4ARKA 2FSTX 2WMBA 1MUOA 4ZS0A 2VNWA 3TNPC 2AUHA 4LYNA 5CT0A 3CPBA 4BCJA 1P2AA 1Y6BA 2J6MA 1PXIA 4R78A 2EB2A 4AGDA 2GFSA 4XH6A 4NM0A 3O7LD 1REKA 4C58A 4PDSA 5M07A 3M42A 4MH7A 3LFAA 3NCZA 5CAQA 3PXFA 4BZOA 2QU6A 5E9EA 4RMZA 3GU5A 5GNKA 1ATPE 3MH1A 1JNKA 4JIAA 4LGDA 4UMTA 4F1OA 3CSVA 4QPMA 1JVPP 5FLFA 4H05A 4MK0A 1LEZA 3UNZA 3K5VA 2IPXA 4RSSA 3PPJA 3A4PA 3EFLA 4YGAA 3W18A 2O0UA 1Q99A 1VZOA 4A9RA 4TYHB 2ZAZA 4NK9A 3ZFYA 3BRBA 2ITOA 2V0DA 3FLQA 5EYMA 4ZK5A 4L9IA 4O86A 4HVSA 5HU9A 3U55A 1OECA 3G2FA 4IH8A 1ST0A 4CCBA 4ZLYA 4QDEA 1E1XA 1KWPA 4FR4A 4FKIA 5HD7A 3W0QA 5A6NA 4FEVA 3ORLA 2BZJA 1PXMA 2C6MA 1YW2A 4XP2A 5DWRA 4FZFB 4ZTRA 2CSNA 2YM3A 3ORPA 3QCQA 5IF1A 4QMYA 4RZVA 4RFZA 5DRBA 5AFVA 1GIHA 4YC8A 4C2WA 3V8TA 4ANNA 1WBVA 4GUEA 4S2ZA 3VUDA 1W2DA 2H34A 4FX3A 3AMYA 2WMAA 4UV0A 4EORA 1NA7A 3R63A 3HV3A 3ETAA 3IGOA 2JKOA 4U41A 1VYZA 3KF7A 2J51A 1ERKA 3R2BA 3HV4A 4CNHA 3HDMA 3EL7A 1HOWA 2E9OA 3DOGA 2OFVA 2X7FA 4TNBA 4X2FA 5J1WA 4BN1A 5CF8A 4H39A 4X2GA 4C35A 3KRRA 2UZBA 3MH2A 4IZ5A 4I4FA 4GIIA 4FOBA 5E7RA 4FEQA 2YIRA 3ZCLA 4U3YA 4B8MA 1TVOA 5D10A 2R7BA 3LE6A 1STCE 3WF6A 4MF0A 3F3WA 2ZDTA 5DT3A 4C4JA 2PVNA 2XK3A 3F5PA 3UOJA 4WUAA 3RKBA 4ENXA 4O1PA 3SHEA 4XP3A 3UP2A 2OW3A 4I0SA 3LMHA 3TV7A 4BIDA 4X0MA 1Z9XA 3ITZA 5H3QA 4EQUA 1UNLA 4EK6A 3ENMA 4MUQA 2BKKA 4MVFA 3I7CA 3E87A 2PULA 4L8MA 2QR7A 1KV1A 2XARA 4D58A 2QODA 1B38A 4FSZA 4GK2A 3U6IA 3TL8A 2R4BA 3TZ9A 5T68A 2OZOA 5AIRA 2BAJA 4MQ2A 1XO2B 3ZLXA 4FT7A 4E4LA 3QALE 4YJVA 5EKNA 2BPMA 3WIGA 3L8PA 2WPAA 1NVSA 4IJPA 3TDVA 3EN5A 5L2QA 3DTCA 4ITJA 5E90A 3VUIA 5JN2A 4BCGA 4IX3A 5L8LA 3CY3A 4EK4A 1OGYA 2HK5A 4QMPA 5FTGA 3FZPA 3QA8A 1YXXA 2OJJA 4JDHA 3UQCA 4XG3A 5LMAA 4DEEA 2B9HA 4DHIB 3QQLA 3D5VA 3G5DA 1M2PA 3DV3A 5ETIA 4QQCA 4TWCA 2WMXA 1YWRA 4I22A 5CU2A 4YLKA 3BV3A 4BDAA 3UO5A 1JKLA 5HCYA 2J7TA 3FBVA 3QCXA 4FSTA 4JQEA 3IPHA 2YCQA 4F65A 3GC0A 4U3ZA 5AV4A 5BVKA 3PVUA 3HV7A 3H9FA 4NJDA 3NNXA 4X6RA 4RX9A 1YXVA 3OP5A 5CEIA 2A1AB 4J71A 5DT0A 4BBEA 2V7AA 3CQUA 4QP3A 3RBWA 1Q97A 3IW5A 2C47A 4U42A 4F1TA 3R1YA 2VZ6A 4PDOA 4MXXA 5HG8A 4QMQA 3A7FA 1OIQA 4D4SA 2ZV9A 3KXXA 3V5WA 3MH3A 4GEOA 1H28A 4FKGA 4MXYA 4ZTHA 1W98A 3NAXA 3OMVA 5AV3A 3UYTA 2C0TA 3HRCA 4C3FA 2UW0A 3MYGA 3W0PA 3R8LA 3BYMA 3DBEA 4BDJA 3NR9A 1FINA 2VNYA 3TKUA 3F5GA 3LFSA 4Z55A 4F78A 4UEUA 4BWPA 4IC7A 2QHMA 4O6LA 2FSLX 2WTKC 4F7JA 2G1TA 2J0MB 2WQEA 1XBCA 3PXZA 2WTDA 4CSVA 3O96A 4ZZOA 1XH5A 3WZKA 2XZSA 2A27A 3QA0A 3VIDA 4J8NA 3THBA 4N4SA 4WSQA 4AA5A 3OXIA 2R0UA 4RT7A 3VJNA 3R7EA 3VUMA 5KMNA 4F0FA 3CR0A 4UN0C 2UW9A 4AS0A 4O82A 4RC3A 3PZHA 1PYEA 2JAMA 4DBNA 3ZSGA 2OXDA 2QCSA 3GOKA 4LV7A 4AGCA 1AGWA 4EQCA 4F9CA 5M53A 2E2BA 5JSMA 2ETMA 3D5WA 2HENA 2CN5A 2GU8A 5AP2A 2VV9A 4U6RA 4PRJA 5IA4A 1UWJA 5CNNA 3MWUA 3NRMA 4IHPA 4MHAA 4YJTA 5CX9A 5M4UA 2YM4A 4M69B 1WAKA 4R1VA 3TUCA 5BYLA 4V01A 2QOCA 2XUUA 4LV8A 3T9TA 4FA2A 4DCAA 1GIJA 4RX7A 2RFSA 3R9OA 3TKHA 5FG8A 2C5VA 2CPKE 3KMMA 3OZ6A 4M66A 5AAFA 2VX0A 4XJ0A 2CCHA 5AUVA 1OBGA 4MD9E 2R3IA 5J9LA 4BJJA 4DFBA 5FBNC 2UW4A 1Q5KA 3BEGA 5EDQA 4O0TA 4YTHA 4IANA 1G8SA 4WSYA 4Y83A 4EOLA 1ZYCA 2QOKA 3UVQA 2DWBA 4DAWA 4IX4A 5AUYA 2QONA 3R8VA 2RL5A 3ZRMA 5AADA 4DG2E 4F9WA 2H96A 4LOPA 5EFQA 3KXZA 5L6OA 2P0CA 2PYWA 4R3RA 5CSHA 3PP0A 1WBSA 4QP4A 4BBMA 2ZJWA 3O8UA 4EJNA 2J50A 3HP2A 3PZEA 3RZBA 4ANQA 5CEKA 1PKDA 4FF8A 2JKMA 3EHAA 4PX6A 5DMZA 2JGZA 3Q9ZA 4I6FA 3NMUF 3B8RA 4OLIA 2IN6A 4D2VA 1S9IA 2IVSA 4AT4A 1BL6A 4BDFA 3GC7A 1LUFA 5HORA 4PMMA 1B6CB 3FY0A 4IWQA 2ITVA 5E8SA 3NNWA 3C4FA 3PPZA 3MSSA 4O0RA 1JSUA 3ACKA 5AWMA 5DG5A 4GG7A 3OTUA 4QMXA 3BPRA 4FMQA 4BRXA 5KMKA 2AQXA 3DK7A 4O4FA 4JBPA 3CP9A 2XVDA 4YNEA 3UBDA 2YN8A 4QYFA 3HZTA 2GQGA 2HW7A 3HMNA 4QMVA 4EZ7A 1JPAA 3LFNA 4RVMA 3V3VA 1URWA 3LW0A 3P7AA 2O8YA 4MBJA 4WOVA 4I6BA 3GBZA 2IJMA 2BRGA 2O2UA 3FZSA 2XH5A 1H4LA 2XNNA 4P5QA 1TKIA 4CFVA 5HQ0A 3IONA 3C4CA 3PXYA 3QTZA 2BIKB 2PUNA 3BQCA 4AQCA 5IQFA 2UV2A 3KXNA 4U97A 3NUSA 4IWPA 5DBXA 5E4HA 2W17A 4AXAA 4IM0A 4ERKA 1ZXEA 2BAKA 4ZAUA 5ANIA 4CD0A 2X7GA 2LGCA 3RPVA 2VX3A 3QXOA 4J7BA 3QAME 4FSQA 4IWOA 3C51A 1SVHA 5KE0A 3QRKA 2XNMA 4FSYA 4IM3A 4C4FA 4CG9A 1REJA 3E7OA 2P3GX 2G9XA 2UW3A 4EOMA 4O2ZA 4E4XA 1ZZLA 4NFMA 3DQXA 1KV2A 4R1YA 5IH6A 2PZYA 3MI9A 4XG2A 4NTTA 2E9NA 4AU8A 1X8BA 4FGRA 3PP1A 3CBLA 1YOLA 4DT9A 5AUTA 2IW9A 4QMMA 2WO6A 1YWVA 2VTMA 2OKRA 4TYGA 3RAWA 5HNGA 5B2LA 3BHVA 2UW5A 1PW2A 3CQEA 5IUGA 3WZJA 4A4XA 3T3UA 4QQ5A 2QO7A 3BHUA 2WKMA 3FDNA 4FT0A 4UY9A 3FMKA 4M13A 3PA3A 3RGFA 3F69A 3G9LX 4FKTA 4J95A 3ZRLA 3E88A 4LRKA 4TL0A 5AR3A 1OI9A 2R3HA 5CALA 4UZDA 5J9ZA 2YCSA 3KULB 3GU7A 2HCKA 4N6YA 1DAWA 1Q8ZA 3A62A 3DAKA 5HD4A 2HWOA 5CXZA 4QD6A 2BVAA 3OS3A 4FV4A 3QTQA 3Q9XA 2QO9A 2X8DA 5LJJA 3UG1A 5K5NA 5E8WA 3CKWA 3GCVA 5IEYA 4W9WA 5AR2A 3LFEA 3UO4A 4AG8A 1G3NA 4QP6A 4Y95A 3CPCA 5ANOA 1XJDA 2JBPA 3PY0A 4J98A 2QG5A 4U80A 3DXQA 3O8PA 4L6QA 5CEOA 4BGQA 3NPCA 4AOTA 5EDRA 3VF8A 5HG5A 5CAUA 3EYGA 4K6ZA 4JLCA 2GHMA 4GVAA 5H8EA 3FZRA 4IXPA 3TDWA 3WZEA 2H9VA 2IVUA 2P2HA 2BFYA 5CEMA 5DLSA 4P7EA 4FVPA 4PV0A 4BKZA 3NUNA 3W0OA 3QUPA 2VX1A 2X0QA 4MNEB 4UYNA 1CKIA 4NM3A 3W0NA 5K4JA 2CGVA 2GDOA 3DGKA 3EQPA 3GGFA 4J8MA 4RGJA 3VBXA 3PXKA 4RZWA 5JMSA 4CVAA 4RX8A 4IM2A 4F9BA 4GV1A 5BV3A 2WMSA 3F2AA 3B8QA 3PXRA 2OLCA 2WD1A 4QYGA 5CEPA 3E8CA 5HE0A 2OSCA 4WNOA 4DEBA 3TV6A 2XEYA 5JFXA 4UMPA 4QMUA 3PDTA 5HI2A 4YO4A 4B6LA 4B9DA 3Q3BA 3MTFA 3Q4TA 1OITA 4V0GB 2GNHA 2UZWE 4EH4A 3GFWA 3OWPA 3W1FA 2BZKB 3BWJA 3MVMA 4CZYB 2WMWA 5JEBA 3II5A 3NSZA 5IA1A 4FG7A 2OZAB 2V7OA 5HTBA 5I9VA 1OL6A 2WQBA 5AX3A 4FSWA 4CRLA 3SQQA 3OXTA 1H01A 3FQSA 2ETKA 3RTPA 4S32A 3TWJA 3KCKA 4FTJA 1IAHA 3G51A 5FP5A 2O3PA 4KKGA 4M14A 4FV3A 5HESA 3ZO1A 5KMMA 4IZAA 4AFJA 3L9LA 3ZRKA 4HNIA 1SMHA 2ETRA 3QF9A 4H3PA 3ALNA 5C9CA 3EN9A 2XRUA 3HX4A 4OR5A 1W2CA 3V5LA 2VTOA 2XNEA 5I5ZA 5GHVA 4JX3A 4ZLZA 5IQAA 5CQUA 3Q52A 3FZOA 4O2PA 4XG8A 2ITXA 3GU8A 4DGLC 2NPQA 4I4EA 4EH7A 2AC3A 4KS8A 2R64A 4YUQA 3K54A 3LCTA 3ORTA 2W0JA 3EQGA 4DDGA 3VHKA 3R1SA 4ALUA 4X3FC