4WA9A

The crystal structure of human abl1 wild type kinase domain in complex with axitinib
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
269
structure length
246
Chain Sequence
EMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKEIKHPNLVQLLGVCTREPIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase ABL1
publication title Axitinib effectively inhibits BCR-ABL1(T315I) with a distinct binding conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 77
structure length 246
sequence length 269
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4wa9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4wa9A01
3CTQA 2JITA 4S32A 3NIZA 4GKHA 3Q3BA 1Y91A 3QWKA 2C6DA 4ITHA 2VGOA 5AUYA 5CU2A 4C3FA 4FTOA 4AG8A 3VBQA 3QQJA 5EYDA 2C1AA 3F3TA 3FHRA 3QZFA 2R3IA 3DKFA 2CJMA 3SDJA 4FL3A 5AP6A 3OZ6A 4IX4A 4JQEA 3QTIA 4GCJA 4O0XA 3CEKA 1OI9A 3LFNA 3PSBA 3EWHA 4HYHA 4QMOA 5AR7A 1Y8YA 3ZUVA 4FKJA 3W2CA 4HGEA 3D94A 4PMSA 4RLLA 4ZSJA 1BMKA 2C3KA 2YN8A 4IC8A 3THBA 4X2GA 5HTIA 2YLEA 4UXQA 3W2OA 4JX3A 4X6QC 2C69A 5DRBA 4CFVA 4RQVA 4YTIA 4XG2A 4PF4A 2HK5A 3FMNA 4CLIA 4YHJA 3RKBA 3PZEA 3U4WA 5J95A 3SOAA 4C58A 4XBRA 1PXIA 5KMNA 2QURA 4RIYB 3BGZA 3VRYA 3WF5A 4FGRA 3SA0A 4I94A 4UMPA 4GU6A 4Y8DA 5KE0A 4EOLA 3TCPA 1JLUE 2YM3A 3R0TA 4W9XA 1BL7A 4FL1A 5FQDC 2G2FA 5L8KA 2Q83A 3RI1A 1M7NA 4OR5A 4TWOA 4XEYA 2KTYA 1U5QA 2QODA 4XOYA 3MWUA 1BUHA 4NT4A 4O0UA 4QMPA 5GJFA 4E6DA 4WD5A 4IAFA 4RA4A 1PXOA 4PWNA 4L42A 4QRCA 4EKKA 2J2IB 5K9IA 3GU5A 4II5A 2JGZA 4WUNA 4CTBA 4D4RA 5M09A 4PY1A 4ANBA 1IRKA 3ODYX 4EYJA 4QO9A 4IB5A 3UNZA 4L7SA 4TYIA 3VS5A 2YA9A 4XP2A 4CFWA 1MRVA 3TDVA 4MNEA 3WZKA 1P5EA 4BCPA 3D2IA 4QTDA 4ZZOA 5JK3A 2YWVA 1WMKA 3AD6A 2WQBA 3F66A 3AD5A 4NCTA 4NH1A 4YNOA 5CXHA 3S95A 2E2BA 1MP8A 5AEPA 3E92A 2Z7RA 5EI6A 4YZDA 2I40A 3JXWA 4CMOA 2WQNA 2R3LA 5DR6A 4FIJA 4F09A 2IO6A 4OTHA 1WVXA 4EHEA 5HLNA 4MH7A 3A62A 2W5AA 4U44A 4DYMA 5I9XA 1KUTA 4JIKA 5AP5A 2IN6A 3F3ZA 4R5YA 5LVOA 3QALE 1O9UA 2OJGA 1GZKA 3KMWA 5EI8A 4FEVA 3PIYA 2OF4A 3GEQA 3LJ0A 4X2NA 2R7BA 3ANQA 3ZOSA 1JSUA 4AFEA 3OBGA 2QR7A 4F70A 4KS8A 2X0GA 4CKIA 2YAAA 3VAPA 4OLIA 4JBPA 5AP0A 3ZCLA 2EUFB 4EJNA 1XHAA 3T8OA 2FSOX 2HAKA 2WTKB 4I6FA 3P7CA 2YZAA 3QQUA 3GB2A 4G31A 4NIFA 2PVMA 3TWJA 2RFDA 4GG5A 4DFUA 2JAVA 3PE1A 1RJBA 2WMQA 5D7AA 4YHTA 4RFMA 5KNJA 1W82A 2DYLA 2A1AB 2XYNA 4E6AA 2VO3A 5ACBC 4TYEA 2YDJA 5CU6A 4UWCA 2PVRA 2E9NA 3GBZA 5CASA 4Y95A 4FOCA 1JKLA 3MESA 4BDFA 3G33A 1L3RE 3ORXA 4CMUA 5JH6A 2O0UA 4FZAB 4LMNA 3E5AA 4JQ8A 4CFMA 2PZ5A 3FMEA 4WT6A 3GU4A 3SLSA 3EKNA 5HIDA 2OZAB 3FEGA 1OL1A 2PVYA 3FMLA 3VHKA 1PYXA 4Y5QA 5HLPA 3C9WA 2JD5A 5CS6A 3G5DA 4KKEA 2RKUA 4GS6A 2J0IA 3DQXA 3K3IA 4UALA 5L2IA 2QOQA 4PMMA 1IAJA 4TKSA 3P7AA 4FL2A 1UA2A 1AQ1A 4B0GA 2B54A 1P14A 2QOCA 3CGOA 4DGLC 1Q97A 4GFOA 4DFZE 3PY0A 3OP5A 5HX6A 1W83A 4AW5A 4FK6A 4MCVA 4MTAA 3DU8A 5HNIX 1OECA 2FA2A 3PFQA 4K18A 3GU6A 4YNEA 4USEA 4TRLA 4FV6A 4BTMA 2X7OA 2VX3A 4WUAA 1H1SA 3GCQA 4XV3A 3G0FA 5I9WA 1OVEA 3PXYA 5IG1A 3PG3A 3MV5A 1CSNA 2ACXA 3IG7A 2BRNA 4W4VA 1G8SA 3H0ZA 4OTIA 2Y6OA 4CZTA 4FNWA 2OIQA 2YERA 5M51A 4IAAA 2F4JA 1UU9A 3M11A 2VAGA 4YUQA 3EN6A 1NW1A 4I20A 2V7OA 4ZS4A 1YXVA 2FSTX 4S2ZA 2HOGA 3EIDA 4JRVA 5CLPA 5EKOA 4ANQA 5CSWA 4ZSLA 4BDAA 3R00A 4ZLOA 4NKAA 3Q60A 3FI2A 5AX3A 3OW4A 4R8QA 5LQFA 5CY3A 3HZTA 5HVKA 5B2LA 5L4QA 3LZBA 3DV3A 5FP5A 3SAYA 5AJQA 5EM6A 4ZMFA 3FL4A 5CZHA 3L9PA 3QZHA 4IMYA 5LXMA 3MB7A 2BMCA 4Q2AA 4FSQA 4U41A 1AGWA 3FBVA 1A06A 3PWDA 3OHTA 2YWPA 4KS7A 4BDBA 4B7TA 4DH5A 2VWIA 3ORKA 5FEDA 3B2TA 3GC9A 4EUTA 5GJDA 3KRRA 3FQHA 4JG8A 3W18A 3ZDIA 4EOQA 4WOVA 3KULB 4DTKA 3VUDA 4WNKA 3OF0A 1JSTA 4X21A 2CGXA 5C9CA 4OAVB 1FMKA 3SHEA 4O7SA 3SV0A 4GJ3A 4M67A 5FBOA 4MD8E 2UW7A 2EXEA 4C4FA 3QHRA 4MXZA 3RBWA 4BI2A 4ZEGA 2R7IA 3UBDA 3VRZA 5JKGA 3LCTA 3W2QA 3VNTA 3HA6A 1IASA 2HZ4A 4GG7A 5IQBA 4OGRA 4DEHA 4PPCA 4C4JA 3I0QA 4F9YA 1OBGA 4LFIA 2VZ6A 4A06A 4NSTA 1Y6AA 2PVNA 3E62A 3IGOA 4K0YA 4ZTRA 2F57A 2ZM3A 3BI6A 4BDGA 3EOCA 4EZ7A 3CQUA 3O7LD 1JKKA 4TY1A 5CVFA 5E8UA 4BDKA 5JQ8A 5KKRB 3R8MA 4RJ5A 2WQEA 3MJ2A 4E4MA 2X8IA 2X8EA 3TTJA 3EYHA 1YDRE 2R0IA 2UVXA 2CN5A 4IB1A 4ZP5A 2A0CX 3V8SA 1K3AA 4FTJA 1V1KA 4BC6A 2XNPA 3F5PA 4GYGA 3MJ1A 5AR4A 4AZWA 1WBSA 3BEAA 3SXFA 3E93A 4F6SA 2VTTA 5JGAA 1R0PA 3RM6A 3KMUA 3VVHA 4Q9ZA 2BILB 3OCBA 4A9UA 3H3CA 3QQGA 3W55A 4CNHA 5HBHA 1XO2B 4L68A 4L7FA 1YRPA 3LFBA 5AIRA 5G1XA 2EWAA 4YJSA 4C38A 5AADA 5FXSA 5J5SA 3QTSA 2V7AA 3NEWA 1R3CA 4QP1A 3TN8A 1U59A 4ZY4A 3UPXA 4D4SA 2PL0A 4CXAA 5KZ0A 5B2MA 3FKLA 2ZB0A 1GY3A 3WYXA 4ZTNA 3RZFA 2GNFA 1OL5A 3WE8A 3HV6A 5AFVA 4YLJA 2WELA 1ZYSA 2W9ZB 3NCZA 3QQHA 3R1NA 3DT1A 3VW8A 4JG7A 4UV0A 2IG7A 2HW6A 3HVCA 4YSMA 3TI1A 1HOWA 4R7IA 5M4IA 2JDTA 1FBNA 4RVLA 5IQGA 5AP4A 4DH1A 3HA8A 4P90A 3RTPA 4K9YA 3SQQA 3KF7A 4EK5A 2GNIA 1Q4LA 3HMMA 1JWHA 5DIAA 3RHKA 4GVJA 3FV8A 4IZ5A 3EJ1A 3BBTB 4HYSA 3PXFA 4EZ3A 3QGYA 4PMTA 4QMWA 5AM6A 2GDOA 4OTRA 5HORA 5CQWA 5E8XA 1I44A 4G9RA 5JQ5A 3P08A 1UU8A 3OROA 2Z7QA 3FSFA 4U3ZA 3RCDA 3R2YA 4RWIA 3RVGA 3QX2A 1RE8A 3S1HA 3ORMA 5CSVA 5ITAA 2C5XA 3R7OA 5HNBA 4ACMA 1Q8ZA 5I3RA 1VZOA 2IWIA 2X1NA 3AMYA 1PF8A 2JDRA 4FT0A 4S34A 3MVHA 4Y5HA 2XIYA 5E8TA 3ATTA 4P4CA 3OMVA 3I5ZA 1IR3A 3TZ9A 2GQGA 2IPXA 3FY2A 4RMZA 2JAMA 2C1BA 2ZV7A 3ITZA 1ZAOA 2XB7A 3UG1A 1BI8A 2CSNA 2FB8A 4DG0E 3ZM9A 2XMYA 4D55A 2CN8A 5KO1A 5FG8A 5M53A 4RJ4A 4FIEA 4N70A 4ZJJA 4ASZA 2PULA 3HUBA 3QKKA 3F61A 3LCSA 3QF9A 2OZOA 3FLSA 3QBNA 5JFSA 1GZNA 1FINA 2IVUA 2F2UA 2Z7SA 3LFCA 5C8MA 5EQEA 3NMUF 3BKBA 3CKXA 5C03A 4DGOA 3FI3A 1QPEA 3UO4A 4OBPA 1XH4A 4IAZA 2YLFA 3JUHA 5IH4A 5BVOA 1J7LA 3EQRA 3RPOA 4O82A 2PVHA 2C0TA 3F3UA 1PRYA 4AP7A 3Q53A 1O6YA 4CG9A 4L46A 5HOAA 4HCVA 1FVVA 2EXMA 5A14A 4GK4A 4RFYA 4WKQA 1U54A 2BKZA 3RZBA 3ZLSA 2GCDA 5B7VA 3PUPA 3PVGA 3LCOA 3WF8A 3KB7A 3ZBXA 3GXLA 3C4FA 3U51A 3KXHA 1SNXA 2J5EA 2UW8A 4HZSA 4PDSA 2W96B 5EDQA 5JZJA 4FMQA 4O1PA 4E6CA 2PVJA 4O0TA 3KXZA 3QHWA 1G5SA 2WOTA 4DBXA 1DS5A 5KZIA 3A7IA 3LM0A 3MIYA 3NAYA 1IAHA 1FOTA 4CT1A 2R9SA 1JAMA 4EK8A 3DS6A 3F7WA 3L9NA 1OKWA 4G34A 4QNYA 3PXQA 4FSYA 2PMLX 2PVLA 2UZEA 2VWUA 3MH1A 3QD4A 4NWMA 5E8VA 4BF2A 3PSCA 3RJCA 4TYHB 4L6QA 3OWJA 3MPTA 2ITVA 4Z55A 2CMWA 3KU2A 3FZSA 3QFVA 1G3NA 1DI8A 1TQPA 4EWHA 5IA1A 4HVGA 5IH5A 3U55A 1YHSA 2B4SB 4QQTA 3DXPA 2WEIA 5HEZA 2QG7A 2QONA 4JS8A 2VWVA 5HESA 4LRMA 4MBJA 3G2FA 3AMBA 3BYSA 3G9NA 4O84A 3BYVA 3EN5A 4Z7HA 3O71A 4V05A 4I5CA 5DR2A 3T3VA 3DNEA 3UPZA 3VS4A 2XUUA 5JZNA 3VW6A 5ANOA 2G9XA 3GCVA 3MY5A 5HHWA 5FWKK 4HW7A 1YXTA 3A7JA 2WTJA 5DNRA 4EK6A 4AW1A 4D4YA 2FUMA 2OIDA 3TV4A 3V5JA 3KVWA 4Z9LA 4I6QA 3OWPA 2X4FA 2A2AA 3GC0A 4FEUA 4FE2A 5D10A 2GFSA 4O7RA 3MS9A 2OXXA 2WMTA 3TT0A 4FKGA 4FTUA 5DR9A 5DVRA 4GUEA 5J5TA 2WMXA 4IANA 5CAPA 2HENA 1JKSA 1YDTE 5HG7A 3VBYA 1J7UA 2Q0NA 5AUTA 2BPMA 4O7WA 3BE9A 3H9OA 3EN4A 5EW3A 4C0TA 3QRUA 3NWWA 4IX6A 4QP2A 4WG3A 4YSJA 3NUAA 4F1MA 4RT7A 5CALA 5CEIA 5DN3A 3FYKX 1PMEA 3LQ8A 4I92A 3DBQA 1F5QA 4PL4A 4F9AA 4NYEA 5HCXA 4GK3A 2RGPA 3DK6A 5T3QA 4RPVA 4C35A 4KINA 5LCJA 3QCQA 2BAJA 4QMUA 3ZRLA 3E87A 2NP8A 2R3PA 4PX6A 2JIUA 2C6EA 3ZDUA 4E4LA 4BWXA 4CLJA 3R63A 3VC4A 4DEGA 5M06A 3FY0A 5A4QA 2C6KA 1KWPA 4Y72A 5EW8A 4JG6A 2BCJA 4HYUA 4FTAA 3JVSA 3SD0A 3SXSA 4U80A 5M56A 2PMIA 1J1BA 5A9UA 3I7CA 4NEUA 4ANSA 4G3FA 2ONLA 1LP4A 3BE2A 4EUUA 4G17A 2O5KA 3HDNA 4NZWB 2AC3A 2IW8A 2VO0A 3VBXA 2ZDTA 3FLWA 4H58A 4M84A 1Q8YA 3F5XA 4FVPA 3QLFA 4ACGA 1URWA 2C6TA 4G2FA 3BV3A 3B8RA 3FMMA 5TT7A 3KK9A 4FKIA 1ERKA 3REPA 4D1SA 3AC4A 4H3BA 5CU4A 3KXNA 5CEQA 3WF6A 4IHPA 4O0VA 3EN7A 2EB3A 2W05A 2BUJA 3PXRA 4O91A 3FPQA 4IZYA 3CXWA 2C6OA 3SXRA 3FUPA 2WB8A 4HCTA 2IW6A 4YPSA 3VN9A 2R3MA 5CEKA 1STCE 4ACCA 3OBJA 4BCIA 1H0WA 4KBCA 3COHA 1Q99A 1PY5A 2CHLA 4WRGA 3NW6A 5AR2A 4ZTQA 1UVRA 4PPAA 3VF8A 4IM3A 2PUPA 1UV5A 3OTUA 5C01A 1M14A 4GFMA 2X81A 4M68A 5EM8A 3QGWA 1RQQA 3ZXZA 4AOJA 3N51A 2B9JA 4JAIA 1WBNA 1WBVA 3HNGA 5A3XA 5KMLA 4PV0A 2UW0A 4EL9A 2BALA 3FZTA 3DFAA 3D14A 4G3CA 5E4HA 1R0EA 4QQCA 4F99A 5HGIA 3HP5A 4AF3A 4JAJA 4CD0A 4Z16A 4PDYA 4NKSA 3SRVA 2VWZA 3CY3A 2RF9A 2P2HA 4A4XA 4AZFA 5I9VA 4QMLA 1YQJA 3A7GA 3R2BA 3R71A 3PY1A 2GHMA 3VHEA 4RC4A 4CQEA 1B6CB 4FV4A 1IA9A 1Z57A 5ANJA 2VD5A 1L8TA 2R0UA 4EOPA 1XWSA 3O8TA 3W32A 3Q04A 4XYFA 5K5XA 4ZZMA 1ZRZA 1OKZA 1H1RA 3O50A 4FTIA 4IWDA 3IW4A 4XRJA 3UP2A 4EQCA 3IQ7A 3MFRA 1H8FA 4A9RA 2QOKA 2JC6A 3PLSA 4IH8A 4YJNA 5J7BA 3TUBA 4F0FA 4AE9A 2C6LA 2UW9A 2Y0AA 3VJNA 4BCKA 1W98A 2F7XE 4NFNA 2R4BA 4QPMA 5JFVA 4FKSA 2GQSA 5IQCA 2WOUA 5IA3A 3TJCA 5C8KA 1REJA 2PUUA 4J98A 4LMUA 5AX9A 3RCJA 3UIMA 2GNGA 2VTHA 3NSZA 4N4SA 5FEEA 5HIEA 2OGVA 2VTMA 4XP0A 3P0MA 4QQ5A 4XG4A 3DAKA 2I1MA 2YEXA 3HRBA 3FKNA 4QP3A 4XV9A 3DB8A 4LUEA 4E8AA 1SYKA 3E88A 4EH5A 4FV7A 4BYIA 4EOKA 4FNYA 4R77A 3FAAA 3F5GA 4YJUA 3DXNA 4RJ8A 3ZLWA 4E7WA 5IQEA 4X3FB 4WBBB 3R9OA 4RZWA 4U6RA 5M4FA 3F2RA 5AP3A 1H0VA 1PKGA 2ETKA 4U45A 2UZBA 5DBXA 2WMUA 3HMOA 3UVQA 4F1OA 3FQSA 1QL6A 3MFUA 1O6LA 3P4KA 4IWOA 2JKMA 1UWJA 5EQYA 5IQFA 3DKOA 2C6IA 3BU5A 3DK3A 5GHVA 2OLCA 3KGAA 3FLYA 4IFCA 1IG1A 3QTWA 5CENA 3MSSA 4MEDA 4C37A 3PA4A 3KRXA 5KMOA 4B99A 2X9EA 4BIDA 4EI4A 5IMEA 5JSMA 2EVAA 2QOFA 4RZVA 3RAIA 3C0HA 4FTCA 4F64A 3RWPA 5EDRA 5EDPA 2WTVA 4FT9A 4YC3A 2GNHA 3VWAA 3MVLA 5BUIA 4M14A 4ANMA 4EH4A 4CZUA 5AIKA 5LMAA 4IE9A 3D5UA 5IEVA 3R22A 5A46A 4CYJA 3QXPA 4FGBA 4CYIA 2UZDA 1YHVA 2W4OA 2YM5A 2PE2A 2XNEA 5HI2A 3OT3A 1T46A 2ZAZA 4AS0A 4WBOA 4BCFA 2XK7A 3B8QA 4UYNA 3SRVB 4BN1A 4C4HA 4J8NA 5L2QA 3L9MA 2CNQA 4YZNA 1WBOA 4NL0A 2OJ9A 4APCA 2CCHA 1UNGA 4QMZA 4DA5A 4OTFA 5BYLA 2P0CA 2G2IA 1GZ8A 4QP7A 3UIUA 4BCJA 3GVUA 3RAKA 2PMOX 3D5XA 4NW6A 4Y83A 3NCGA 4BYJA 4TL0A 3D5WA 4S31A 2WFYA 4BDCA 3COMA 4RIXA 3A7HA 4U42A 3R7IA 4QMMA 3ZEWA 4IAKA 1OPKA 2PWLA 2RFSA 3UO6A 2WTDA 3FWQA 4QYYA 3V5WA 3LHJA 2XK6A 2W1IA 2XP2A 3D2KA 4I0SA 4BIEA 3NGAA 5LVMA 4E4NA 4EHVA 4O1OA 4IWPA 4RRVA 4FKUA 5HO8A 5JT2A 3PJ3A 5EHYA 4FT7A 4X2FA 3ORIA 2X39A 2JEDA 3PSDA 4FTKA 4I1ZA 4QTCA 4F7JA 2PU8A 4TZRA 3W1FA 1ZMWA 3KN5A 3P5KA 3OFMA 2H9VA 4JXFA 4HGLA 3QTQA 4FIHA 4AN2A 3TEIA 4J71A 4IM2A 4JBOA 5A4LA 2Z7LA 3O17A 2B55A 1V0BA 2XBAA 3KXMA 3CSVA 1VYWA 1PHKA 1XR1A 3A60A 5D11A 5FGKA 5BVFA 3VF9A 5M08A 3MA3A 1P4FA 4MBLA 2QG5A 2X6EA 4RGJA 3NUXA 3U8WA 1UWHA 4FKTA 4EEVA 4MD9E 2CKPA 1M7QA 4HNIA 3BGPA 3GCSA 1JPAA 5CT0A 1R1WA 4IXPA 4QP9A 2QOLA 3ZZWA 3WARA 2CNVA 2XK3A 2C5OA 2GHGA 5EH0A 3G9LX 2F9GA 4IX5A 4A7CA 1PXKA 4MQ1A 5CT7A 3UOLA 4V0GB 1H4LA 3GCUA 1MQBA 2QHNA 2F49A 3JY9A 4GW8A 1FQ1B 2R3QA 4ZSGA 3GC8A 5EYMA 4LOOA 2IVSA 4F1TA 5K0XA 2QC6A 4UWBA 3VO3A 2ITUA 1H26A 4TTHB 4BFMA 1FGIA 4RX7A 2XK4A 4PL3A 2UUEA 3KN6A 3CR0A 3QTUA 1Y8GA 2YZLA 2JIVA 3BWFA 4F0IA 3AGMA 4USFA 2YM6A 2QLQA 3FJQE 5FRIA 3F2NA 3ELJA 2OICA 3COIA 5KCVA 4BWPA 4EWQA 4EJ7A 4EHZA 4ONAA 4G6LA 4CV9A 5BVEA 2UZVA 3F82A 2CDZA 4AGUA 3D7TB 3I5NA 1SVHA 4NJDA 2ZOQA 5CVGA 3LLTA 2OJIA 4LI5A 4BGQA 4AA4A 5IQAA 4KWPA 2Y8OA 3QA8A 1VR2A 3R1SA 1JSVA 3ZSGA 1WFCA 2Y4IB 3DA6A 3KKVA 3CTHA 4TNDA 3ZMMA 5I4NA 5M55A 5LWNA 2VRXA 4BRXA 5CWZA 5L2TA 3C7QA 5TE0A 5HE1A 4M13A 1H1QA 3PXKA 2XKDA 3V8TA 2FSLX 5J9LA 3C4CA 2P33A 2JBOA 3SVVA 5HO6A 4K1BA 5EW9A 4ZTLA 3FXWA 4BCGA 4BBMA 3RK7A 4D0WA 2QU5A 2GSFA 5DE2A 3BLHA 4XP3A 4AGCA 1HCLA 2XJ0A 3HV4A 2HYYA 3P9JA 3KA0A 4OUCA 5AAEA 5FUTA 4O22A 5D7VA 3LXKA 1H1PA 2UVYA 4R6VA 4YZ9A 4DINA 1U5RA 5J9YA 3UZTA 2ITTA 4GL9A 4TPTA 4FSNA 5EFQA 2IZSA 4ZJIA 3R9DA 3QQKA 4ZY6A 2VTAA 4RVMA 4IW0A 2C3JA 4XRLA 5GZAA 3MN3A 5FTOA 2WQOA 3UNJA 3CD8A 5DGZA 4AAAA 2G01A 3Q6WA 3UQCA 1GIHA 3BHUA 1MRYA 3E7OA 3WE4A 3NYNA 3VBWA 4BZDA 5CAQA 3GCPA 3UC3A 4RLKA 4G5PA 3CE3A 3NAXA 5E91A 5KMKA 2X2KA 2YISA 4Z7GA 1SVGA 3GP0A 4KKGA 4QMNA 2F7EE 4EH3A 2GTMA 2VX1A 3II5A 4CG8A 1JNKA 3FLZA 3COKA 1H28A 1WZYA 2QOHA 5EYCA 3HECA 4JDIA 4C7TA 4ZZNA 3W2SA 2OF2A 5E8WA 3CBLA 4I6HA 4O86A 5K3YA 2NRYA 2YCFA 2HZIA 5E1SA 1Y57A 4YLLA 3NNUA 3E8DA 5IQIA 1PXJA 1J3HA 4QQJA 4AWIA 3BYMA 4APPA 5C26A 1ZY5A 5LMBA 5IKWA 4L8MA 3RMFA 1H07A 3QAME 2J9MA 3NUSA 4PTGA 4BIBA 4YZCA 4HVSA 4IQ6A 2V22A 1YWNA 1DM2A 2PZPA 2VO6A 4J99A 4M7IA 3UVRA 5KKRC 4MNEB 1M17A 3DOGA 4E5BA 4AW0A 3OY1A 5HG9A 2RG5A 3BYUA 4EH8A 3Q2MA 4UYAA 4FKOA 3I6WA 2GPHA 3LAUA 4U40A 2ITYA 4AZVA 4ZSAA 4DAWA 4I21A 4J95A 4CSVA 3BX5A 3BGQA 5JN2A 3O23A 3EQCA 4FV5A 3C51A 4K33A 4C4EA 2QU6A 5IPJA 1PJKA 1YKRA 1J91A 2P4IA 3QU0A 4GK2A 4O81A 2WQMA 2BZKB 4I22A 4RJ7A 4UMRA 4E93A 2Y4PA 2W5BA 5CI6A 3WZUA 3PY3A 4JIAA 4QYFA 4DEIA 3AT2A 3PJ1A 2C0OA 3P79A 4KRCA 2GFCA 1VYZA 3W10A 5KMMA 1FPUA 3FI8A 2W1FA 2PMNX 1ZMUA 3Q5IA 5FM2A 2QVSE 2R3OA 4NIFB 5ETIA 5D12A 4FOBA 3N4VA 4PL5A 4A4LA 2FVDA 3FZOA 3R30A 5AWMA 4CGAA 3R01A 2GHLA 2WTCA 2YABA 1YVJA 3KK8A 4XG6A 3VULA 3TUCA 4KSPA 5EYKA 3U6HA 2J0MB 5HZNA 1YI3A 3DDQA 1OB3A 3MVJA 3G90X 3Q6UA 2IW9A 3UE4A 1OZ1A 4KIPA 4CVAA 3UQFA 1BX6A 5FXQA 2CCIA 3W8LA 1UU3A 1ND4A 4EBWA 4AQCA 2PZRA 3MY0A 3EL8A 3RK5A 4H1MA 4IB0A 1X8BA 3PWYA 5A6NA 2R3GA 2RFNA 2VTIA 4I5HA 2O64A 5CF6A 3SG8A 4FTTA 3CTJA 4NFMA 4R5SA 4ENXA 1YDSE 3Q9XA 5AUZA 3LXLA 4BB4A 4XCUA 4B6LA 3F88A 2PYWA 1QPJA 4C59A 1CKJA 3NNVA 2B9IA 4D5HA 2B53A 1J7IA 5DFPA 1YXXA 3FXZA 4X2KA 2GMXA 1R78A 1XBAA 3OXTA 4QMSA 1GIJA 3EQPA 3NS9A 3OEFX 1BKXA 1NVQA 4GFGA 3GENA 4L67A 3H30A 4BKYA 5C4LA 5E90A 2BRHA 4BHZA 2W4JA 3Q9ZA 3ODZX 4KRDA 4QTEA 2CKQA 3TNIA 4GKIA 3SX9A 4GYIA 4IX3A 3F9NA 4M3QA 3ZSHA 2OKRA 4PQNA 1WAKA 3HX4A 5AR5A 1AD5A 1H24A 2PZYA 4EHGA 1CDKA 4FKPA 3ZUUA 4KIQA 5LMKC 3ANRA 3QD2B 2C47A 3RPYA 3TV7A 4H39A 3EFLA 3UODA 3E64A 1A9UA 1KE9A 3EKKA 2PHKA 4CTCA 5KHXA 3DXQA 4R78A 4FV1A 3LIJA 4LG4A 4L01A 5HE3A 5ANEA 4DGGA 3MYGA 3KXXA 4YURA 4CKRA 4GT3A 3WF9A 1Q5KA 1V0PA 2W1HA 3R9HA 2WGJA 1XH9A 3H9FA 5IUIA 3MIAA 5L8LA 4XOZA 4QTBA 4JX7A 3QD3A 3DGKA 3K3JA 4FTRA 1BLXA 3OXZA 4MXXA 5D9HA 4L43A 2UZNA 2UV2A 5EK7A 5J87A 1NVRA 4I41A 3GT8A 1E9HA 3WYYA 3ORPA 4F7SA 2HXLA 2XK9A 3KRWA 2JFMA 3NLBA 4YZBA 3EQFA 1Z5MA 3Q4ZA 1MUOA 4KAOA 4OT6A 5BVKA 4AE6A 5BMSA 2OIBA 1KE6A 4QD6A 1ZYLA 1OIRA 5HD7A 4DFXE 3IGGA 5EI2A 5CAVA 4TWPA 4MYGA 3AC5A 2Z60A 3TJDA 1FVTA 3ZRMA 4AZTA 5HTBA 3DNDA 3HL7A 3HMIA 4Y73A 3FE3A 1YOJA 3Q9WA 4FG9A 3HEGA 4MF0A 3HV5A 3I79A 4FZ7A 4NJ3A 4O27B 5HBEA 2VTSA 5AP1A 4R3PA 4YZMA 3CIKA 3LXPA 4Y46A 2XVDA 2DWBA 4YJRA 3RNIA 4QPAA 2VV9A 2H96A 4AT5A 4R3RA 4RWLA 5TKDA 4W4WA 5BQ0A 3W16A 4EBVA 3UOJA 5AP7A 1Q62A 4KIKA 4U9AA 4XG3A 4KUJA 4IWQA 1W7HA 1JVPP 5IMXA 3NUPA 5CYIA 2Z2WA 1LEWA 3ZC5A 1UKIA 3VS1A 3PRIA 5HU3A 5DEWA 1XQZA 2HWPA 2YITA 3R8PA 2XBJA 5HNGA 3HYHA 4TW9A 2WU6A 1TQIA 2AYPA 2LAVA 4DCAA 2QOOA 2WMRA 4UMQA 3V6SA 4AZSA 4D2RA 2GQRA 3UJGA 3VS0A 3ALNA 2HIWA 3F3WA 1ZYDA 4IJ9A 1M2PA 1PMVA 3FDNA 3VUTA 5M44A 4IADA 3VS6A 4X6RA 3UDBA 5DA3A 3VIDA 2W7XA 4RWKA 3ACKA 4MNFA 4JDJA 3OWKA 4XH6A 4LQMA 2ITXA 3NYOA 1SNUA 3ZLXA 4FUYA 1S9IA 4YTFA 4U7ZA 5LOHA 4I5PA 4C4GA 5IF1A 3FMJA 3KEXA 2B52A 2XIKA 3DZQA 3WOWA 4FEQA 2BRBA 2C6MA 3HV3A 1OL6A 4L44A 4Q5EA 3PG1A 4AACA 5BVDA 3O7LB 3ZZEA 2PVFA 3TZ7A 3ZO2A 4FNZA 1GAGA 2VO7A 3M2WA 3ERKA 4ANLA 2UW3A 4E1ZA 2DUVA 5J79A 2ZV2A 4YJTA 1NVSA 1OUKA 4DFYA 4KB8A 3AT4A 4FX3A 4YMJA 3Q4TA 4I3ZA 4QMVA 4QTAA 2ETMA 5HQ0A 1XBCA 3OC1A 4O0WA 4WRSA 3UYSA 2JFLA 4PP9A 5I3OA 4BDHA 4N57A 2VNWA 1ZYJA 4DG3E 5IISA 4LUDA 1Y6BA 2PPQA 4W4XA 5GZ8A 1SZMA 2E9OA 1Q8WA 2GS6A 4GT4A 4JDKA 4YBKA 3MFTA 4DG2E 1JKTA 4NM5A 2NNWB 4R7BA 1YWRA 4D9TA 3BU3A 3V5QA 5KBQA 3TZMA 1H27A 5CEPA 3ZO4A 2XKCA 5D1JA 5L2SA 2E9PA 3L8VA 1LR4A 2BAQA 1WVWA 4DGMA 3BHVA 3T9TA 4BR3A 5AR3A 1E1XA 4UWYA 5HG5A 4YTCA 5L3AA 4HVIA 2XEZA 3ZH8A 4J53A 4FTQA 2WIHA 5EHOA 5CAOA 4BZNA 4WSQA 4F7LA 4FODA 5J1VA 1SMHA 3A4PA 3F6XA 4QYEA 2WMSA 3KRJA 3PPKA 2Z8CA 2X8DA 4FNXA 4LYNA 2YIXA 5AM7A 3ID6C 4YO4A 2UZWE 1YHWA 3HMPA 4MHAA 3TACA 4K11A 5CXZA 5LARA 4HCUA 2VWXA 3U6IA 3GUBA 4ZLYA 4DITA 4XV2A 1KOAA 3D9VA 4F9CA 1CTPE 3GOKA 4IVBA 3CGFA 4P7EA 4TWCA 5I5ZA 2BDWA 5LVPA 2ESMA 3CY2A 2R3NA 2WEVA 1U46A 2P55A 1KV1A 4USDA 3C4XA 4WHZA 1BYGA 1U54B 3HV7A 4RIWA 1TVOA 5IDNA 3NUNA 4QMTA 1JQHA 2WMWA 4IAIA 2IZUA 3PTGA 4IC7A 5I9ZA 4IZAA 1ZOHA 4FYOA 3RM7A 4C33A 5IZFA 2PE0A 1OIYA 3QXOA 4XUFA 3U6JA 3KFAA 4JQ7A 3ROYA 5M57A 4C2VA 3C13A 4L53A 3BELA 2VTRA 3JVRA 4FSRA 5BVNA 4ANNA 4M8TA 3BHHA 4OTWA 4MQ2A 2C0IA 1SVEA 2J90A 1F0QA 3O51A 2W1EA 3UTOA 5FLFA 4RG0A 2CKEA 3I60A 3FI4A 4YBJA 1PXLA 5I9UA 4BHNA 4CEGA 2BVAA 4HJOA 4IVDA 2ITOA 4R1VA 5LWMA 5CEMA 2ZDUA 3MVMA 4IB3A 3CKWA 3VBVA 4X3FC 5H9BA 4E5AX 4DTAA 3MPMA 3WI6A 3EFWA 2BDJA 1ZYCA 4ZIMA 1OPLA 4ALUA 3L8PA 3SOCA 1WVYA 4PTEA 4X7QA 2BKKA 4YLKA 4ZTSA 3PA5A 1FMOE 2OK1A 1OPJA 3AMAA 5HO7A 3JPVA 4PDPA 3NYVA 3CJFA 2GTNA 5IEXA 5AUVA 5ANGA 2G15A 3ZC6A 2ZM1A 3CD3A 3ROCA 4ALVA 3B2WA 4IFGA 1O6KA 4W8DA 4BBFA 2RG6A 1JBPE 1GNGA 3Q32A 4KIOA 5G6VA 3KXGA 2J0KA 2WMAA 4AGDA 4MXYA 4FEXA 3ET7A 4LV8A 3LCKA 2I6LA 2WTWA 3QTZA 2CLXA 3CC6A 4IVCA 4XLIA 1YWVA 3GI3A 2WAJA 1PXNA 2AC5A 4C4IA 5I0BA 3R6XA 1TKIA 3LFEA 3FKOA 3RINA 4AT3A 4BCNA 3Q96A 4IBMA 1UU7A 3IONA 4D0XA 2OFVA 4F9BA 5EOLA 5HVYA 3IS5A 4EORA 5ICPA 2V62A 4EOSA 5M4CA 1DAWA 3V5LA 4AT4A 2XS0A 4Q9SA 4EZ5A 3GQIA 4EOJA 4N6ZA 4R1YA 1ZMVA 3FMDA 4BCHA 3E8EA 2YIRA 3HRCA 3GFWA 4KSQA 2BZJA 2XEYA 4I24A 5HE2A 4O0YA 4JDHA 4DGNA 2BR1A 2Y7JA 3FSKA 2UW5A 2JBPA 2C4GA 3FYJX 3L8SA 4H36A 5EQPA 3SGCA 5GINE 2R3FA 4ITJA 5CX9A 2CLQA 4E4XA 2VGPA 4M69A 2XCKA 1NA7A 4K8AA 3DKGA 4L45A 3VS7A 5FDPA 3LFFA 1M2RA 3E8CA 3OUKA 2W1ZA 2XM9A 4MXOA 3ZM4A 4ZLZA 3LFSA 3R83A 4JL9A 4UXLA 4C61A 4FA2A 4ZY5A 4FTMA 5DT0A 5CU0A 5DLSA 1YI4A 2PVKA 5CQUA 1I09A 4O6LA 5JGBA 4DBNA 3AQVA 4ALWA 2VUWA 1APME 2R64A 4I0RA 5CZIA 4ID7A 2JLDA 1ATPE 3DTWA 3POZA 2XIZA 5ANDA 4XG9A 4D2TA 4PMPA 2GS2A 5AMNA 3ORTA 3R9RA 2EB2A 4O7VA 4QNAA 3ULIA 4LM5A 2VWBA 2HCKA 3MI9A 5IA2A 3TV6A 2O8YA 2QHMA 2ITZA 2QNJA 3QYWA 2IZTA 3QUEA 3R9NA 3RWQA 4JNWA 3R7YA 5BUJA 3AT3A 4RIYA 4L3JA 1XH7A 1XH5A 3S4QA 5DYJA 3HKOA 4MF1A 4EK4A 4CCBA 3OVVA 2R3JA 3I7BA 4QYGA 2UW6A 3ZONA 3R04A 4FSZA 5AP2A 1QMZA 2W1CA 3R02A 1RW8A 4I4FA 5DRDA 3OY3A 1HCKA 4JVGA 1OIQA 4TYJA 3BQCA 3TNWA 4D9UA 3U4UA 1QPDA 5TOZA 3BIZA 4QPSA 4X3JA 3IW8A 5TF9A 2FO0A 4ASDA 4BWKA 2OI4X 4OTGA 3BEGA 1WBTA 4IM0A 5HKMA 4BICA 3VQHA 4G3GA 5K5NA 1B38A 2KULA 3NRMA 1H1WA 3CP9A 3PXZA 4FT3A 4J52A 3ZBFA 1CKIA 5K0KA 5T68A 5L2WA 2B7AA 4UMUA 2I0EA 2ITNA 4ERWA 5A4EA 3EL7A 4FIGA 2DS1A 3QL8A 4QYHA 4ACHA 2HW7A 3RK9A 5HE0A 3G15A 4DCEA 2VTOA 2XNBA 2V5QA 3BPRA 2C5YA 3IW7A 2OO8X 3UMWA 5B0XA 4AZEA 3BZ3A 2Y4IC 4RWJA 1JOWB 4YJPA 3ORLA 4XX9A 3OXIA 3ZUTA 5IDPA 4WNMA 2CPKE 4U5JA 3FL5A 4LRKA 4FSUA 5JGDA 3EFJA 3UIXA 5I9YA 1ZARA 1REKA 3NUYA 1PXMA 5IA4A 2W4KA 3QTXA 3OOGA 4YJQA 2OWBA 2WTKC 4I4EA 3R8LA 5FTGA 3PE2A 2X7FA 2WZJA 3I0OA 3QZGA 4QMYA 4XG7A 3OCGA 4I5MA 4F63A 3JR1A 3EB0A 3OW3A 3T3UA 2X6DA 4QP4A 3H10A 3A99A 3LKMA 4K2RA 2ZVAA 2I0YA 3NNXA 3BV2A 4O0SA 4RIOA 4EH7A 2LGCA 3HMNA 3EZVA 4J96A 4Q5HA 1Q3WA 3OD6X 4LOPA 4O7YA 5BYZA 3EYGA 3JY0A 4TXCA 2ZV8A 1OGUA 3OCSA 5CF4A 3E8NA 1YXUA 2ZMCA 4P5QA 2XIXA 3UYTA 3W2RA 5FBNC 3QWJA 4ASXA 3KMMA 4EOOA 4E73A 1J1CA 4C3PA 4HOKA 4S30A 4OTQA 2CKOA 3NW7A 1KE7A 4TYGA 4UMTA 3UZPA 2OZAA 4AX8A 2R3HA 3KQ7A 3ZFXA 1PMNA 4FV8A 3CLYA 3HP2A 3L9LA 1K2PA 4RBLA 3SW7A 1B39A 4D5KA 4XNEA 3C5IA 2X4ZA 4M15A 5M4UA 2YM7A 5FTQA 4YC6A 4GUBA 2WMVA 3V6RA 2VU3A 4NU1A 2PE1A 3GQLA 3EQDA 4G9CA 3DJ5A 4JRNA 4G16A 2YCSA 4WSYA 5E1EA 3PJ8A 2W1GA 5FP6A 3FC1X 2V55A 4I93A 4FSWA 5K4IA 4BI0A 4FG7A 3C5UA 2EXCX 4DLIA 5CANA 2HZNA 4ZOGA 5GZ9A 3FPMA 4FKRA 4OW8A 3GU8A 4BDEA 4F0GA 2G2HA 1KV2A 5FD2A 3RPVA 4WIHA 4JT3A 5JEBA 4GEOA 3QC9A 4NW5A 1KE5A 5LJJA 4GIIA 5C27A 4PP7A 1Q24A 2QLUA 3SW4A 4O38A 4ORKA 3NR9A 5LVLA 2PUIA 3P86A 4GSBA 4NCTC 3O8PA 4PNIA 2VN9A 3UVPA 5BUEA 3I4BA 3V04A 4ZJVA 4G6OA 4RIXB 3TNQB 3EFKA 5DHJA 1OL7A 4DH7A 3G0EA 4EC8A 3Q5ZA 2OH4A 2BIYA 5LCKA 3JYAA 5AUXA 3QCYA 4B8MA 4PRJA 4M66A 3QRTA 3RAHA 1FGKA 1YW2A 4DEAA 5M07A 3O2MA 3MPAA 2FSMX 4U3YA 4FV3A 4BCMA 4F4PA 2G1TA 3L8XA 4FUXA 1Q3DA 4HNFA 3TIYA 4C2WA 4DFBA 5F20A 2REIA 2Z02A 4O2PA 3CPBA 4BGHA 5AV4A 3LJ1A 3LFQA 3UIBA 5J7HA 2ITPA 2YIWA 3QQLA 4ZMEA 2HWOA 4PPBA 4IDVA 4YTHA 5ETFA 3TNHA 4LOQA 3UZRA 5BYYA 2GS7A 2X7GA 4JR3A 3D0EA 4FC0A 4D2SA 4P2KA 1UKHA 2W0JA 1XJDA 5IEYA 1M2QA 3KULA 5TO8A 4FBXA 3ULZA 5DT3A 4XMOA 5BX0A 3LE6A 4HYIA 2PY3A 4QP8A 4E20A 3AC3A 2QOIA 4KD1A 3UNKA 4DLJA 5EG3A 4D2VA 3P1AA 3V5TA 2QI8A 1XH6A 3TIZA 3K5VA 4KNBA 4O2ZA 2W99B 3NUUA 2YAKA 4IAYA 3IPHA 1K9AA 3M42A 4IDTA 5DG5A 3Q52A 2XJ1A 4LL5A 2BHEA 4KBAA 5DPVA 2WMBA 3WIGA 1WBWA 5K4JA 5AAGA 4X2JA 5HU9A 3H4JA 5CSXA 4MVFA 4BY9E 3C1XA 3VBTA 2QOBA 3WZEA 1MRUA 3OG7A 2J4ZA 4RX9A 4J8MA 3ZYAA 5HVJA 2PUNA 3FMHA 3VUHA 3FZ1A 1YOLA 3TZ8A 2JDOA 3ZRKA 2YIQA 4FTNA 3PDTA 1Q41A 4K77A 4D28A 4LL0A 1YOMA 4RX5A 1M52A 3PIZA 2VTLA 4FKVA 3LQ3A 3BWJA 5AV3A 4AW2A 3BRBA 4NM0A 1PYEA 4L00A 3AXWA 3DTCA 2OBJA 4XBUA 3S2PA 1WCCA 2JDSA 5DH3A 3AG9A 2YDIA 4X0MA 3V01A 3G51A 4WO5A 4BGGA 1Q8TA 4ZSEA 4UB7A 2C5NA 4XHKB 5FDXA 4AGWA 2OW3A 3MDYA 2VTJA 4D2PA 5E8YA 3EQBA 5DT4A 4AN9A 3NX8A 4FKQA 5E9EA 4PDOA 2A4LA 2VNYA 1P2AA 4V01A 4E3CA 2XH5A 4EC9A 1ZY4A 4DFLA 4ZS0A 2WU7A 4CQGA 4Y85A 2QKWB 3DBFA 4FK3A 2IZRA 3UG2A 3D83A 4IIRA 3IDPA 4NM7A 5HLWA 4D58A 2YJSA 4EH9A 1CMKE 3ORNA 2R2PA 3MTLA 1OKVA 3R28A 4QP6A 3S3IA 3CS9A 5AUWA 5H8EA 4QMQA 4CZYB 3VS2A 4DEDA 5JRQA 2RL5A 3F7ZA 3PVUA 4QOXA 3NPCA 3IK3A 4U79A 5HBJA 2HY81 4EK3A 4JJRA 2ITWA 5CU3A 4MXAA 5E8ZA 1XH8A 4C3RA 2QO7A 4L3PA 4WNPA 2C68A 3R7UA 4ITIA 5KMIA 1NY3A 5KUPA 3FQEA 4UZHA 1WBPA 1LPUA 2QQ7A 4P5ZA 4ZAUA 3ZU7A 4U0IA 3TL8A 4RJ6A 3VUGA 4KKHA 4OT5A 5CTPA 5CF8A 3EHAA 4GVAA 3DBCA 1GIIA 4HVDA 4LGDA 2YJRA 1EH4A 4OAUC 2J7TA 2ZJWA 4J97A 4W9WA 1ZZLA 1P4OA 5HTCA 4FEWA 1SM2A 4FTLA 4BVUA 5JFWA 2CGUA 3I6UA 4FICA 4MXCA 5HX8A 4YHFA 4JI9A 2A27A 2F7ZE 4KABA 2CNUA 5HG8A 4FIIA 4BZOA 3EQHA 3FLQA 2QO2A 3NVKI 1LEZA 3DDPA 4EOIA 3UQGA 4MWIA 4DEBA 4XS2A 3E63A 4M0YA 4FVQA 3QCXA 4O21A 2GU8A 4B8LA 2WTIA 3KCKA 2XCHA 4HPUE 4A4OA 4YPDA 2WKMA 2R5TA 2HXQA 3O96A 3DB6A 3ORZA 5CSHA 4O7TA 1VJYA 4GJ2A 2YCQA 1W0XC 3QLGA 4V04A 4CKJA 3DAEA 1OM1A 2BFXA 2C30A 2B1PA 5LMKA 3PLAE 3F3VA 4G5JA 4A9TA 3ETAA 4JR7A 5JMSA 4RJ3A 3MBLA 1OKYA 3DFCB 3A4OX 2R3KA 4J1RA 2QKRA 3TUDA 1OMWA 3DJ7A 1YXSA 3BHYA 3ZFMA 3P7BA 4U81A 5EM5A 2OG8A 2XF0A 3U9CA 2XRUA 3LCDA 4BDIA 3I81A 3P78A 1OIUA 3PZHA 5BNJA 2WIPA 3GNIB 3IW6A 4YJVA 5H3QA 4MK0A 3KF4A 4FSTA 2XM8A 1GOLA 4O6EA 2A19B 2UZOA 2RSVA 3ACJA 5B2KA 4HGTA 2R3RA 5AV2A 3WILA 3E3BX 4AOIA 5BPYA 3FZPA 1LUFA 3KCFA 3CJGA 4H05A 4NUSA 1XKKA 2NPQA 1Q61A 1TQMA 3C4WA 3H9RA 3PRFA 4XLVA 3N9XA 4JBQA 2RIOA 5ETCA 2I0HA 2B9FA 1GJOA 2X2MA 4BCQA 2BDFA 4DH3A 3M1SA 5EM7A 1OBDA 2HELA 3QYZA 2J50A 4M97A 4N0SA 4DC2A 2WNTA 3N4UA 3Q4UA 5C1QB 4A9SA 4TYHA 5D41A 4IVAA 3WZJA 4L52A 3TXOA 2YIYA 5A4CA 2I0VA 2Q0BA 3C50A 3MGYA 5EHLA 3ZS5A 3BBWA 5CNOA 2OH0E 2E9UA 2BROA 3F5UA 2WXVA 3W33A 2XRWA 3HAMA 4ARKA 4CMTA 4W8EA 2W06A 3DLZA 3LW0A 4GT5A 2C5VA 3PPJA 5F4NA 3DBEA 3QD0A 3QC4A 3HAVA 4DF3A 1V0OA 4DN5A 4HZRA 4C8BA 3D4QA 3L1SA 5HIBA 4H3PA 5DOSA 1RDQE 2XKEA 2BIKB 3R1YA 3SC1A 3S00A 3LMIA 4EQUA 3AC1A 4M12A 3WIKA 2W5HA 3ENMA 2BZHB 3UC4A 3MY1A 3LXNA 2ETRA 5H8BA 2ZV9A 4RVKA 4EH2A 4ENYA 2CGWA 3LOKA 1Q8UA 4IJPA 3FHIA 3V51A 3ZO3A 4U97A 4AUAA 3FLNC 5KHWA 4FIFA 2O2UA 3AC2A 3NNWA 3R8UA 4A07A 3NVMB 2PZIA 3SG9A 1OUYA 2YDKA 3HUCA 5IQDA 4EQMA 3LFAA 2XNMA 2YCRA 3PIXA 3R8VA 4BCOA 2QR8A 3IECA 2PK9A 4UY9A 5AUUA 1GZOA 3ZLYA 1PXPA 1DI9A 2C3LA 4UZDA 4F08A 3E3PA 3QX4A 5F9EA 3DCVA 3IW5A 3RGFA 1PKDA 4FZFB 5J9ZA 2P3GX 4XJ0A 3TM0A 3VJOA 2OJJA 2QO9A 3BU6A 3QRIA 3W2PA 1ZOEA 3DY7A 5A4TA 2BTSA 3TKHA 4LGGA 4OTPA 1DAYA 2PTKA 4MX9A 3LLAA 4CFUA 3POOA 4BKZA 3OOMA 4GIHA 3PJCA 1H08A 5HCYA 3EMGA 3QKMA 3V5PA 2XIRA 4XG8A 4AFJA 2OXDA 5AV0A 4EKLA 4MBIA 5KX8A 5ANIA 3WF7A 4QT1A 4RVTA 3AC8A 3OUNB 4DT8A 5T6KA 1E1VA 4K6ZA 2OFUA 2BAKA 4FV9A 3PVBA 4WA9A 5AA9A 3W8QA 3BLQA 3V8WA 4I0TA 5FEQA 1Z9XA 5KMJA 4EOMA 2QCSA 2DQ7X 3DJ6A 3T9IA 3A7FA 3U87A 2QD9A 2HY0A 2BFYA 4NM3A 2WPAA 4B9DA 2ZB1A 4AU8A 4NK9A 4OBOA 2PSQA 3BHTA 2NRUA 3S0OA 1H25A 3QRKA 2XJ2A 5KBRA 5L6OA 3RPSA 1KOBA 4NTTA 5CI7A 4DE4A 1H00A 1QCFA 4DHFA 2J0JA 4R3CA 3ZSIA 4MD7E 3HDMA 4N6YA 2XKFA 3GC7A 2HZ0A 4O96A 2E9VA 5F95A 5ANKA 3C4ZA 4G3DA 3EN9A 2C3IB 2XA4A 3LQ5A 3PJ2A 4NTSA 3UP7A 5IH6A 4PTCA 1UNHA 2W1DA 5DWRA 3ZXTA 4FKWA 2YM8A 4C36A 4RSSA 4KIKB 3OT8A 3VS3A 3ZFYA 4E5WA 4M0ZA 4DEEA 3LJ2A 4HVHA 3OWLA 3CQWA 4MAOA 3KL8A 3OTVA 1PW2A 4TWNA 4ANOA 3NW5A 4U8ZA 3K2LA 2ITQA 3GU7A 3PYYA 4BDJA 2JKKA 3HLLA 3VQUA 2XNGA 4UBAA 1CM8A 4DT9A 1ZOGA 4CT2A 5C4KA 3R7VA 4FYNA 3BYOA 5LVNA 3EQIA 1ZZ2A 2FYSA 5IU2A 4G6NA 2VWYA 4PNKA 2VTPA 5BMMA 3IOKA 3FXXA 5HICA 2YFXA 1UNLA 2JKOA 3P23A 4RX8A 1R39A 3OS3A 3KY2A 3LFDA 3RP9A 2X2LA 1KSWA 2BRMA 3KC3A 4L9IA 5J1WA 3IKAA 3PA3A 2ZM4A 5L8JA 1MQ4A 1URCA 5DI1A 4G1WA 4OBQA 5JRSA 4D2WA 3MW1A 1FVRA 3JS2A 4KBKA 1BL6A 1PMUA 1QPCA 1OL2A 5BVWA 2ZMDA 3KRLA 4H1JA 5ACKA 3VUIA 4BBEA 5E92A 4F9WA 3NDMA 3O0GA 2ONLC 4QMXA 3DBDA 1XBBA 4IACA 4RFZA 4C62A 3DKCA 3F2AA 4O0RA 2OSCA 3ZO1A 4C02A 4O7LA 2UZTA 2OJFE 4ZTMA 5HCZA 3IDBA 4WNOA 3A2CA 4X3FA 5DEYA 3RHXA 3SKCA 2WO6A 4BTFA 2GNLA 4CFXA 4L3LA 3FZRA 4JBVA 3R1QA 3MB6A 3TG1A 4B4LA 5C8NA 5GJGA 3Q2JA 5CF5A 3ZTXA 2F2CB 3FMKA 2EU9A 4CV8A 2YM4A 3DZOA 4PUZA 4MKCA 5E7RA 3A8WA 4TN6A 4CRSA 3K54A 2P2IA 4YGAA 3O8UA 3BLRA 3RNYA 4LRJA 3MH2A 3C4EA 2BTRA 1VEBA 4FSMA 5F94A 5AA8A 3G6GA 5DMZA 5JFXA 4A9YA 2Y6MA 3EZRA 3IOPA 3IDCA 2IVVA 5EOBA 4S33A 3QUPA 4RC2A 2VX0A 2UVZA 3QCSA 2VWWA 2W17A 4YC8A 2WHBA 5F1ZA 2OU7A 3NZ0A 5CSPA 3IO7A 4IEBA 4DH8A 5L6PA 2BHHA 4LV5A 3UO5A 4O7ZA 5GNKA 4FV0A 4D4VA 4FI1A 4F6UA 2OXYA 3RALA 2UW4A 2V0DA 3U54A 2FH9A 4YO6A 4KA3A 3MFSA 3E7VA 4EH6A 4F65A 5FM3A 2YACA 3MH0A 3RAWA 2XNOA 2JIIA 4AA5A 4ERKA 3BQRA 2X9FA 2ZYBA 3EQGA 2XNNA 4BI1A 5IA0A 5IUHA 2NO3A 2RFEA 3AD4A 1NT2A 3MTFA 1ZWSA 3PVWA 4GMYA 4FVRA 3LPBA 4O7NA 4G3EA 5H8GA 3QA0A 4DTBA 4AOTA 2YHVA 3ZHPC 4W4YA 3CPCA 3F69A 4UN0C 3H0YA 3QZIA 1NXKA 3A61A 1W8CA 3VUKA 4ASEA 3KREA 2UZLA 3WBLA 5CVHA 5GIOE 3Q9YA 4GU9A 4RIWB 3UOKA 3R7GA 3V3VA 1S9JA 3OEZA 3TTIA 4BDDA 1U4DA 2AUHA 2O3PA 3NIEA 4FV2A 3TKIA 4C57A 2BRGA 5CNNA 4YR8A 3ENHA 5CAUA 3Q4CA 3CCNA 3QQFA 5L6WL 5CEOA 5GIPE 4DFNA 3D5VA 2FGIA 3N4TA 4YP8A 5IUGA 3TNPC 4HGSA 4F7NA 1ZXEA 4RC3A 3D15A 2J0LA 2J6MA 4JLCA 2B0QA 4OTDA 4BTKA 5IQHA 4BKJA 2UZUE 4IZ7A 3LM5A 4TNBA 2J51A 3R21A 4J7BA 3ATSA 3DAJA 3ZEPA 2GNJA 2H8HA 4FKLA 3HGKA 4FZDB 4FZ6A 2O63A 4UEUA 5TR6A 4AXAA 3AOXA 4BTJA 4CFFA 2XZSA 3RPRA 1IA8A 3GFEA 4ZTHA 3PP0A 3HRFA 3LVPA 2BZIB 2IVTA 2XK8A 4GH2A 3U9NA 3AGLA 3DPKA 2VTNA 5IA5A 3K5UA 3LMGA 3MH3A 4CCUA 4GV1A 5H2UA 1BI7A 1OITA 4RQKA 2W9FB 2XYUA 3QTRA 4FG8A 3GGFA 3GOPA 3TKUA 3NYXA 3PP1A 5AAFA 2H6DA 4E26A 1T45A 4V0GA 2ERKA 3UMXA 4BL1A 3I1AA 4E6QA 1ZLTA 4F6WA 3DK7A 3C0IA 2J5FA 4H3QA 4I23A 4O83A 5A54A 3BCEA 3G6HA 4R7HA 3QRJA 4D1XA 2O65A 4FT5A 2IJMA 5AV1A 4RA5A 4EYMA 3D7ZA 2WD1A 2Y9QA 4XV1A 2VTQA 5HD4A 1W84A 4YJOA 3QUDA 2I7QA 3C0GA 4Z3VA 1A48A 3FC2A 3UGCA 3TDWA 3MA6A 4U43A 4FF8A 4ZXTA 4CFNA 2ERZE 4EONA 3OCTA 3A8XA 4WG4A 4CRLA 3D7TA 2JKQA 3WZDA 2CGVA 4FR4A 1F3MC 3KVXA 4UX9A 3EH9A 5E8SA 3DLSA 3QKLA 3R73A 4WG5A 5A6OA 4GRBA 3LMHA 5ETAA 4LGHA 2JDVA 1KE8A 2H34A 4HPTE 3R8ZA 3UOHA 4C34A 3ALOA 1IEPA 3CQEA 4YU2A 3VUMA 4AN3A 1G8AA 4AA0A 1CKPA 1YI6A 5AR8A 5FXRA 5J8IA 5EKNA 3PPZA 4ZK5A 4TT7A 3R7EA 2B9HA 4M69B 3DQWA 4D1ZA 2SRCA 4MWHA 4JOAA 4ACDA 4I6BA 1H01A
chains in the Genus database with same CATH superfamily
3CTQA 2JITA 4S32A 3NIZA 4GKHA 3Q3BA 4AXDA 1Y91A 3QWKA 2C6DA 4ITHA 2VGOA 5AUYA 5CU2A 4C3FA 4FTOA 4AG8A 3VBQA 3QQJA 5EYDA 2C1AA 3F3TA 3FHRA 3QZFA 2R3IA 3DKFA 2CJMA 3SDJA 4FL3A 5AP6A 3OZ6A 4IX4A 4JQEA 3QTIA 4GCJA 4O0XA 3CEKA 1OI9A 3LFNA 3PSBA 3EWHA 4HYHA 4QMOA 5AR7A 1Y8YA 3ZUVA 4FKJA 3W2CA 4HGEA 3D94A 4PMSA 4RLLA 4ZSJA 1BMKA 2C3KA 2YN8A 4IC8A 3THBA 4X2GA 5HTIA 2YLEA 4UXQA 3W2OA 4JX3A 4X6QC 2C69A 5DRBA 4CFVA 4RQVA 4YTIA 4XG2A 4PF4A 2HK5A 3FMNA 4CLIA 4YHJA 3RKBA 3PZEA 3U4WA 5J95A 3SOAA 4C58A 4XBRA 1PXIA 4O4CA 5KMNA 2QURA 4RIYB 3BGZA 3VRYA 3WF5A 4FGRA 3SA0A 4I94A 4UMPA 4GU6A 4Y8DA 5KE0A 4EOLA 3TCPA 1JLUE 2YM3A 3R0TA 4W9XA 1BL7A 4FL1A 5FQDC 2G2FA 5L8KA 2Q83A 3RI1A 1M7NA 4OR5A 4TWOA 4XEYA 2KTYA 1U5QA 2QODA 4XOYA 3MWUA 1BUHA 4NT4A 4O0UA 4QMPA 5GJFA 4E6DA 4WD5A 4IAFA 4RA4A 1PXOA 4PWNA 4L42A 4QRCA 4EKKA 2J2IB 5K9IA 3GU5A 4II5A 2JGZA 4WUNA 4CTBA 4D4RA 5M09A 4PY1A 4ANBA 1IRKA 3ODYX 4EYJA 4QO9A 4IB5A 3UNZA 4FJVA 4L7SA 4TYIA 3VS5A 2YA9A 4XP2A 4CFWA 1MRVA 3TDVA 4MNEA 3WZKA 1P5EA 4BCPA 3D2IA 4QTDA 4ZZOA 5JK3A 2YWVA 1WMKA 3AD6A 2WQBA 3F66A 3AD5A 4NCTA 4NH1A 4YNOA 5CXHA 3S95A 2E2BA 1MP8A 5AEPA 3E92A 2Z7RA 5EI6A 4YZDA 2I40A 3JXWA 4CMOA 2WQNA 2R3LA 5DR6A 4FIJA 4F09A 2IO6A 4OTHA 1WVXA 4EHEA 5HLNA 4MH7A 3A62A 2W5AA 4U44A 4DYMA 5I9XA 1KUTA 4JIKA 5AP5A 2IN6A 3F3ZA 4R5YA 5LVOA 3QALE 4LV7A 1O9UA 2OJGA 1GZKA 3KMWA 5EI8A 4FEVA 3PIYA 2OF4A 3GEQA 3LJ0A 4X2NA 2R7BA 3ANQA 3ZOSA 1JSUA 4AFEA 3OBGA 2QR7A 4F70A 4KS8A 2X0GA 2IF8A 4CKIA 2YAAA 3VAPA 4OLIA 4JBPA 5AP0A 3ZCLA 2EUFB 4EJNA 1XHAA 3T8OA 2FSOX 2HAKA 2WTKB 4I6FA 3P7CA 2YZAA 3QQUA 3GB2A 4G31A 4NIFA 2PVMA 3TWJA 2RFDA 4GG5A 4DFUA 2JAVA 3PE1A 1RJBA 2WMQA 5D7AA 4YHTA 4RFMA 5KNJA 1W82A 2DYLA 2A1AB 2XYNA 4E6AA 2VO3A 5ACBC 4TYEA 2YDJA 5CU6A 4UWCA 2PVRA 2E9NA 3GBZA 5CASA 4Y95A 4FOCA 1JKLA 3MESA 4BDFA 3G33A 1L3RE 3ORXA 4CMUA 5JH6A 2O0UA 4FZAB 4LMNA 3E5AA 4JQ8A 4CFMA 2PZ5A 3FMEA 4WT6A 4AXEA 3GU4A 3SLSA 3EKNA 5HIDA 2OZAB 3FEGA 1OL1A 2PVYA 3FMLA 3VHKA 1PYXA 4Y5QA 5HLPA 3C9WA 2JD5A 5CS6A 3G5DA 4KKEA 2RKUA 4GS6A 2J0IA 3DQXA 3K3IA 4UALA 5L2IA 2QOQA 4PMMA 1IAJA 4TKSA 3P7AA 4FL2A 1UA2A 1AQ1A 4B0GA 2B54A 1P14A 2QOCA 3CGOA 4DGLC 1Q97A 3UDTA 4GFOA 4DFZE 3PY0A 3OP5A 5HX6A 1W83A 4AW5A 4FK6A 4MCVA 4MTAA 3DU8A 5HNIX 1OECA 2FA2A 3PFQA 4K18A 3GU6A 4YNEA 4USEA 4TRLA 4DDIA 4FV6A 4BTMA 2X7OA 2VX3A 4WUAA 1H1SA 3GCQA 4XV3A 3G0FA 5I9WA 1OVEA 3PXYA 5IG1A 3PG3A 3MV5A 1CSNA 2ACXA 3IG7A 2BRNA 4W4VA 1G8SA 3H0ZA 4OTIA 2Y6OA 4CZTA 4FNWA 2OIQA 2YERA 5M51A 4IAAA 2F4JA 1UU9A 3M11A 2VAGA 4YUQA 3EN6A 1NW1A 4I20A 2V7OA 4ZS4A 1YXVA 2FSTX 4S2ZA 2HOGA 3EIDA 4JRVA 5CLPA 5EKOA 4ANQA 5CSWA 4ZSLA 4BDAA 3R00A 4ZLOA 4NKAA 3Q60A 3FI2A 5AX3A 3OW4A 4R8QA 5LQFA 5CY3A 3HZTA 5HVKA 5B2LA 5L4QA 3LZBA 3DV3A 5FP5A 3SAYA 5AJQA 5EM6A 4ZMFA 3FL4A 5CZHA 3L9PA 3QZHA 4IMYA 5LXMA 3MB7A 2BMCA 4BJJA 4Q2AA 4FSQA 4U41A 1AGWA 3FBVA 1A06A 3PWDA 3OHTA 2YWPA 4KS7A 4BDBA 4B7TA 4DH5A 2VWIA 3ORKA 5FEDA 3B2TA 3GC9A 4EUTA 5GJDA 3KRRA 3FQHA 4JG8A 3W18A 3ZDIA 4EOQA 4WOVA 3KULB 4DTKA 3VUDA 4WNKA 3OF0A 3NFFB 1JSTA 4X21A 2CGXA 5C9CA 4OAVB 1FMKA 3SHEA 4O7SA 3SV0A 4GJ3A 4M67A 5FBOA 4MD8E 2UW7A 2EXEA 4C4FA 3QHRA 4MXZA 3RBWA 4BI2A 4ZEGA 2R7IA 3UBDA 3VRZA 5JKGA 3LCTA 3W2QA 3VNTA 3HA6A 1IASA 2HZ4A 4GG7A 5IQBA 4OGRA 4DEHA 4PPCA 4C4JA 3I0QA 4F9YA 1OBGA 4LFIA 2VZ6A 4A06A 4NSTA 1Y6AA 2PVNA 3E62A 3IGOA 4K0YA 4ZTRA 2F57A 2ZM3A 3BI6A 4BDGA 3EOCA 4EZ7A 3CQUA 3O7LD 1JKKA 4TY1A 4MUQA 5CVFA 5E8UA 4BDKA 5JQ8A 5KKRB 3R8MA 4RJ5A 2WQEA 3MJ2A 4E4MA 2X8IA 2X8EA 3TTJA 3EYHA 1YDRE 2R0IA 2UVXA 2CN5A 4IB1A 4ZP5A 2A0CX 3V8SA 1K3AA 4FTJA 1V1KA 4BC6A 2XNPA 3F5PA 4GYGA 3MJ1A 5AR4A 4AZWA 1WBSA 3BEAA 3SXFA 3E93A 4F6SA 2VTTA 5JGAA 1R0PA 3RM6A 3KMUA 3VVHA 4Q9ZA 2BILB 3OCBA 4A9UA 3H3CA 3QQGA 3W55A 4CNHA 5HBHA 1XO2B 4L68A 4L7FA 1YRPA 3LFBA 5AIRA 5G1XA 2EWAA 4YJSA 4C38A 5AADA 5FXSA 5J5SA 3QTSA 2V7AA 3NEWA 1R3CA 4QP1A 3TN8A 1U59A 4ZY4A 3UPXA 4D4SA 2PL0A 4CXAA 5KZ0A 5B2MA 3FKLA 2ZB0A 1GY3A 3WYXA 4ZTNA 3RZFA 2GNFA 1OL5A 3WE8A 3HV6A 5AFVA 4YLJA 2WELA 1ZYSA 2W9ZB 3NCZA 3QQHA 3R1NA 3DT1A 3VW8A 4JG7A 4UV0A 2IG7A 2HW6A 3HVCA 4YSMA 3TI1A 1HOWA 4R7IA 5M4IA 2JDTA 1FBNA 4RVLA 5IQGA 5AP4A 4DH1A 3HA8A 4P90A 3RTPA 4K9YA 3SQQA 3KF7A 4EK5A 2GNIA 1Q4LA 3HMMA 1JWHA 5DIAA 3RHKA 4GVJA 3FV8A 4IZ5A 3EJ1A 3BBTB 4HYSA 3PXFA 4EZ3A 3QGYA 4PMTA 4QMWA 5AM6A 2GDOA 4OTRA 5HORA 5CQWA 5E8XA 1I44A 4G9RA 5JQ5A 3P08A 1UU8A 3OROA 2Z7QA 3FSFA 4U3ZA 3RCDA 3R2YA 4RWIA 3RVGA 3QX2A 1RE8A 3S1HA 3ORMA 5CSVA 5ITAA 2C5XA 3R7OA 5HNBA 4ACMA 1Q8ZA 5I3RA 1VZOA 2IWIA 2X1NA 3AMYA 1PF8A 2JDRA 4FT0A 4S34A 3MVHA 4Y5HA 2XIYA 5E8TA 3ATTA 4P4CA 3OMVA 3I5ZA 1IR3A 3TZ9A 2GQGA 2IPXA 3FY2A 4RMZA 2JAMA 2C1BA 2ZV7A 3ITZA 1ZAOA 2XB7A 3UG1A 1BI8A 2CSNA 2FB8A 4FRFA 4DG0E 3ZM9A 2XMYA 4D55A 2CN8A 5KO1A 5FG8A 5M53A 4RJ4A 4FIEA 4N70A 4ZJJA 4ASZA 2PULA 3HUBA 1G8JA 3QKKA 3F61A 3LCSA 3QF9A 2OZOA 4LDTA 3FLSA 3QBNA 5JFSA 1GZNA 1FINA 2IVUA 2F2UA 2Z7SA 3LFCA 5C8MA 5EQEA 3NMUF 3BKBA 3CKXA 5C03A 4DGOA 3FI3A 1QPEA 3UO4A 4OBPA 1XH4A 4IAZA 2YLFA 3JUHA 5IH4A 5BVOA 1J7LA 3EQRA 3RPOA 4O82A 2PVHA 2C0TA 3F3UA 1PRYA 4AP7A 3Q53A 1O6YA 4CG9A 4L46A 5HOAA 4HCVA 1FVVA 2EXMA 5A14A 4GK4A 4RFYA 4WKQA 1U54A 2BKZA 3RZBA 3ZLSA 2GCDA 5B7VA 3PUPA 3PVGA 3LCOA 3WF8A 3KB7A 3ZBXA 1W2CA 3C4FA 3GXLA 3U51A 3KXHA 1SNXA 2J5EA 2UW8A 4HZSA 4PDSA 2W96B 5EDQA 5JZJA 4FMQA 4O1PA 4E6CA 2PVJA 4O0TA 3KXZA 3QHWA 1G5SA 2WOTA 4DBXA 1DS5A 5KZIA 3A7IA 3LM0A 3MIYA 3NAYA 1IAHA 1FOTA 4CT1A 2R9SA 1JAMA 4EK8A 3DS6A 3F7WA 3L9NA 1OKWA 4G34A 4QNYA 1TZDA 3PXQA 4FSYA 2PMLX 2PVLA 2UZEA 2VWUA 3MH1A 3QD4A 4NWMA 5E8VA 4BF2A 3PSCA 3RJCA 4TYHB 4L6QA 3OWJA 3MPTA 2ITVA 4Z55A 2CMWA 3KU2A 3FZSA 3QFVA 1G3NA 1DI8A 1TQPA 4EWHA 5IA1A 4HVGA 5IH5A 3U55A 1YHSA 2B4SB 4QQTA 3DXPA 2WEIA 5HEZA 2QG7A 2QONA 4JS8A 2VWVA 5HESA 4LRMA 4MBJA 3G2FA 3AMBA 3BYSA 3G9NA 4O84A 3BYVA 3EN5A 4Z7HA 3O71A 4V05A 4I5CA 5DR2A 3T3VA 3DNEA 3UPZA 3VS4A 2XUUA 5JZNA 3VW6A 5ANOA 2G9XA 3GCVA 3MY5A 5HHWA 5FWKK 4HW7A 1YXTA 3A7JA 2WTJA 5DNRA 4EK6A 4AW1A 4D4YA 2A98A 2FUMA 2OIDA 3TV4A 3V5JA 2X0OA 3KVWA 4Z9LA 4I6QA 3OWPA 2AQXA 2A2AA 2X4FA 3GC0A 4FEUA 4FE2A 5D10A 2GFSA 4O7RA 3MS9A 2OXXA 2WMTA 3TT0A 4FKGA 4FTUA 5DR9A 5DVRA 4GUEA 5J5TA 2WMXA 4IANA 5CAPA 2HENA 1JKSA 1YDTE 5HG7A 3VBYA 1J7UA 2Q0NA 5AUTA 2BPMA 4O7WA 3BE9A 3H9OA 4DHJA 3EN4A 5EW3A 4C0TA 3QRUA 3NWWA 4IX6A 4QP2A 4WG3A 4YSJA 2X0QA 4F1MA 4RT7A 5CALA 3NUAA 5CEIA 5DN3A 3FYKX 1PMEA 3LQ8A 4I92A 3DBQA 1F5QA 4PL4A 4F9AA 4NYEA 5HCXA 4GK3A 2RGPA 3DK6A 5T3QA 4RPVA 4C35A 4KINA 5LCJA 3QCQA 2BAJA 4QMUA 3ZRLA 3E87A 2NP8A 2R3PA 4PX6A 2JIUA 2C6EA 3ZDUA 4E4LA 4BWXA 4CLJA 3R63A 3VC4A 4DEGA 5M06A 3FY0A 5A4QA 2C6KA 1KWPA 4Y72A 5EW8A 4JG6A 2BCJA 4HYUA 4FTAA 3JVSA 3SD0A 3SXSA 4U80A 5M56A 2PMIA 1J1BA 5A9UA 3I7CA 4NEUA 4ANSA 4G3FA 2ONLA 1LP4A 3BE2A 4EUUA 4G17A 2O5KA 3HDNA 4NZWB 2AC3A 2IW8A 2VO0A 3VBXA 2ZDTA 3FLWA 4H58A 4M84A 1Q8YA 3F5XA 4FVPA 3QLFA 4ACGA 1URWA 2C6TA 4G2FA 3BV3A 3B8RA 3FMMA 5TT7A 3KK9A 4FKIA 1ERKA 3REPA 4D1SA 3AC4A 4H3BA 5CU4A 3KXNA 5CEQA 3WF6A 4IHPA 4O0VA 3EN7A 2EB3A 2W05A 2BUJA 3PXRA 4O91A 3FPQA 4IZYA 3CXWA 2C6OA 3SXRA 3FUPA 2WB8A 4HCTA 2IW6A 4YPSA 3VN9A 2R3MA 5CEKA 1STCE 4ACCA 3OBJA 4BCIA 1H0WA 4KBCA 3COHA 1Q99A 1PY5A 2CHLA 4WRGA 3NW6A 5AR2A 4ZTQA 1UVRA 4PPAA 3VF8A 4IM3A 2PUPA 1UV5A 3OTUA 5C01A 1M14A 4GFMA 2X81A 4M68A 5EM8A 3QGWA 1RQQA 3ZXZA 4AOJA 3N51A 2B9JA 4JAIA 1WBNA 1WBVA 3HNGA 5A3XA 5KMLA 4PV0A 2UW0A 4EL9A 2BALA 3FZTA 3DFAA 3D14A 4G3CA 5E4HA 1R0EA 4QQCA 4F99A 5HGIA 3HP5A 4AF3A 4JAJA 4CD0A 2ZFYA 4Z16A 3KIOC 4PDYA 4NKSA 3SRVA 2VWZA 3CY3A 2RF9A 2P2HA 4A4XA 4AZFA 5I9VA 4QMLA 1YQJA 3A7GA 3R2BA 3R71A 3PY1A 2GHMA 3VHEA 4RC4A 4CQEA 1B6CB 4FV4A 1IA9A 1Z57A 5ANJA 2VD5A 1L8TA 2R0UA 4EOPA 1XWSA 3O8TA 3W32A 3Q04A 4XYFA 5K5XA 4ZZMA 1ZRZA 1OKZA 1H1RA 3O50A 4FTIA 4IWDA 3IW4A 4XRJA 3UP2A 4EQCA 3IQ7A 3MFRA 1H8FA 4A9RA 2QOKA 2JC6A 3PLSA 4IH8A 4YJNA 5J7BA 3TUBA 4F0FA 4AE9A 2C6LA 2UW9A 2Y0AA 3VJNA 4BCKA 1W98A 2F7XE 4NFNA 2R4BA 4QPMA 5JFVA 4FKSA 2GQSA 5IQCA 2WOUA 5IA3A 3TJCA 5C8KA 1REJA 2PUUA 4J98A 4LMUA 5AX9A 3RCJA 3UIMA 2GNGA 2VTHA 3NSZA 4N4SA 5FEEA 5HIEA 2OGVA 2VTMA 4XP0A 3P0MA 4QQ5A 4XG4A 3DAKA 2I1MA 2YEXA 3HRBA 3FKNA 4QP3A 4XV9A 3DB8A 4LUEA 4E8AA 1SYKA 3E88A 4EH5A 4FV7A 4BYIA 4EOKA 4FNYA 4R77A 3FAAA 3F5GA 4YJUA 3DXNA 4RJ8A 3ZLWA 4E7WA 5IQEA 4X3FB 4WBBB 3R9OA 4RZWA 4U6RA 5M4FA 3F2RA 5AP3A 1H0VA 1PKGA 2ETKA 4U45A 3W0SA 2UZBA 5DBXA 2WMUA 3HMOA 3UVQA 4F1OA 3FQSA 1QL6A 3MFUA 4QDVA 1O6LA 3P4KA 4IWOA 2JKMA 1UWJA 5EQYA 5IQFA 3DKOA 2C6IA 3BU5A 3DK3A 5GHVA 2OLCA 3KGAA 3FLYA 4IFCA 1IG1A 3QTWA 5CENA 3MSSA 4MEDA 4C37A 3PA4A 3KRXA 5KMOA 4B99A 2X9EA 4BIDA 4EI4A 5IMEA 5JSMA 2EVAA 2QOFA 4RZVA 3RAIA 3C0HA 4FTCA 4F64A 3RWPA 5EDRA 4JOAA 2WTVA 5EDPA 4FT9A 4YC3A 2GNHA 3VWAA 3MVLA 5BUIA 4M14A 4ANMA 4EH4A 4CZUA 5AIKA 4DDGA 5LMAA 4IE9A 3D5UA 5IEVA 3R22A 5A46A 4CYJA 3QXPA 4FGBA 4CYIA 2UZDA 1YHVA 2W4OA 2YM5A 2PE2A 2XNEA 5HI2A 3OT3A 1T46A 2ZAZA 4AS0A 4WBOA 4BCFA 2XK7A 3B8QA 4UYNA 3SRVB 4BN1A 4C4HA 4J8NA 5L2QA 3L9MA 2CNQA 4YZNA 1WBOA 4NL0A 2OJ9A 4APCA 2CCHA 1UNGA 4QMZA 4DA5A 4OTFA 5BYLA 2P0CA 2G2IA 1GZ8A 4QP7A 3UIUA 4BCJA 3GVUA 3RAKA 2PMOX 3D5XA 4NW6A 4Y83A 3NCGA 4BYJA 4TL0A 3D5WA 4S31A 2WFYA 4BDCA 3COMA 4RIXA 3A7HA 4U42A 3R7IA 4QMMA 3ZEWA 4IAKA 1OPKA 2PWLA 2RFSA 3UO6A 2WTDA 3FWQA 4QYYA 3V5WA 3LHJA 2XK6A 2W1IA 2XP2A 3D2KA 4I0SA 4BIEA 3NGAA 5LVMA 4E4NA 4EHVA 4O1OA 4IWPA 4RRVA 4FKUA 5HO8A 5JT2A 3PJ3A 5EHYA 4FT7A 4X2FA 3ORIA 2X39A 2JEDA 3PSDA 4FTKA 4I1ZA 4QTCA 4F7JA 2PU8A 4TZRA 3W1FA 1ZMWA 3KN5A 3P5KA 3OFMA 2H9VA 4JXFA 4HGLA 3QTQA 4FIHA 4AN2A 3TEIA 4J71A 4IM2A 3PUFC 4JBOA 5A4LA 2Z7LA 3O17A 2B55A 1V0BA 2XBAA 3KXMA 3CSVA 1VYWA 1PHKA 1XR1A 3A60A 5D11A 5FGKA 5BVFA 3VF9A 2XAOA 5M08A 3MA3A 1P4FA 4MBLA 2QG5A 2X6EA 4RGJA 3NUXA 3U8WA 1UWHA 4FKTA 4EEVA 4MD9E 2CKPA 1M7QA 4HNIA 3BGPA 3GCSA 1JPAA 5CT0A 1R1WA 4IXPA 4QP9A 2QOLA 3ZZWA 3WARA 4UX9A 2CNVA 2XK3A 3AKKA 2C5OA 2GHGA 5EH0A 3G9LX 2F9GA 4IX5A 4A7CA 1PXKA 4MQ1A 5CT7A 3UOLA 4V0GB 1H4LA 3GCUA 1MQBA 2QHNA 2F49A 3JY9A 4GW8A 1FQ1B 2R3QA 4ZSGA 3GC8A 5EYMA 4LOOA 2IVSA 4F1TA 5K0XA 2QC6A 4UWBA 3VO3A 2ITUA 1H26A 4TTHB 4BFMA 1FGIA 4RX7A 2XK4A 4PL3A 2UUEA 3KN6A 3CR0A 3QTUA 1Y8GA 2YZLA 2JIVA 3BWFA 4F0IA 3AGMA 4USFA 2YM6A 2QLQA 3FJQE 5FRIA 3F2NA 3ELJA 2OICA 3COIA 5KCVA 4BWPA 4EWQA 4EJ7A 4EHZA 4ONAA 4G6LA 4CV9A 5BVEA 2UZVA 3F82A 2CDZA 4AGUA 3D7TB 3I5NA 1SVHA 4NJDA 2ZOQA 5CVGA 3LLTA 2OJIA 4LI5A 4BGQA 4AA4A 5IQAA 4KWPA 2Y8OA 3QA8A 1VR2A 3R1SA 1JSVA 3ZSGA 1WFCA 2Y4IB 3DA6A 3KKVA 3CTHA 4TNDA 3ZMMA 5I4NA 5M55A 5LWNA 2VRXA 4BRXA 5CWZA 5L2TA 3C7QA 5TE0A 2XAMA 5HE1A 4M13A 1H1QA 3PXKA 2XKDA 3V8TA 2FSLX 5J9LA 3C4CA 2P33A 2JBOA 3SVVA 5HO6A 4K1BA 5EW9A 4ZTLA 3FXWA 4BCGA 4BBMA 3RK7A 4D0WA 2QU5A 2GSFA 5DE2A 3BLHA 4XP3A 4AGCA 1HCLA 2XJ0A 3HV4A 3PFYA 2HYYA 3P9JA 3KA0A 4OUCA 5AAEA 5FUTA 4O22A 5D7VA 3LXKA 1H1PA 2UVYA 4R6VA 4YZ9A 4DINA 1U5RA 5J9YA 3UZTA 2ITTA 4GL9A 4TPTA 4FSNA 5EFQA 2IZSA 4ZJIA 3R9DA 3QQKA 4ZY6A 2VTAA 4RVMA 4IW0A 2C3JA 4XRLA 5GZAA 3MN3A 5FTOA 2WQOA 3UNJA 3CD8A 5DGZA 4AAAA 2G01A 3Q6WA 3UQCA 1GIHA 3BHUA 1MRYA 3E7OA 3WE4A 3NYNA 3VBWA 4BZDA 5CAQA 3GCPA 3UC3A 4RLKA 4G5PA 3CE3A 3NAXA 5E91A 5KMKA 2X2KA 2YISA 4Z7GA 1SVGA 3GP0A 4KKGA 4QMNA 2F7EE 4EH3A 2GTMA 2VX1A 3II5A 4CG8A 1JNKA 3FLZA 3COKA 1H28A 1WZYA 2QOHA 5EYCA 3HECA 4JDIA 4C7TA 4ZZNA 3W2SA 2OF2A 5E8WA 3CBLA 4I6HA 4O86A 5K3YA 2NRYA 2YCFA 2HZIA 5E1SA 1Y57A 4YLLA 3NNUA 3E8DA 5IQIA 1PXJA 1J3HA 4QQJA 4AWIA 3BYMA 4APPA 5C26A 1ZY5A 5LMBA 5IKWA 4L8MA 3RMFA 1H07A 3QAME 2J9MA 3NUSA 4PTGA 4BIBA 4YZCA 4HVSA 4IQ6A 2V22A 1YWNA 1DM2A 2PZPA 2VO6A 4J99A 4M7IA 3UVRA 5KKRC 4MNEB 1M17A 3DOGA 4E5BA 4AW0A 3OY1A 5HG9A 2RG5A 3BYUA 4EH8A 4JMQA 3Q2MA 4UYAA 4FKOA 3I6WA 2GPHA 3LAUA 4U40A 2ITYA 4AZVA 4ZSAA 4DAWA 4I21A 4J95A 4CSVA 3BX5A 3BGQA 5JN2A 3O23A 3EQCA 4FV5A 3C51A 4K33A 4C4EA 2QU6A 5IPJA 1PJKA 1YKRA 1J91A 2P4IA 3QU0A 4GK2A 4O81A 2WQMA 2BZKB 4I22A 4RJ7A 4UMRA 3W0NA 4E93A 2Y4PA 2W5BA 5CI6A 3WZUA 3PY3A 4JIAA 4QYFA 4DEIA 3AT2A 3PJ1A 2C0OA 3P79A 4KRCA 2GFCA 1VYZA 3W10A 5KMMA 1FPUA 3FI8A 2W1FA 2PMNX 1ZMUA 3Q5IA 5FM2A 2QVSE 2R3OA 4NIFB 5ETIA 5D12A 4FOBA 3N4VA 4PL5A 4A4LA 2FVDA 3FZOA 3R30A 5AWMA 4CGAA 3R01A 2GHLA 2WTCA 2YABA 1YVJA 3KK8A 4XG6A 3VULA 3TUCA 4KSPA 5EYKA 3U6HA 2J0MB 5HZNA 1YI3A 3DDQA 1OB3A 3MVJA 3G90X 3Q6UA 2IW9A 3UE4A 1OZ1A 4KIPA 4CVAA 3UQFA 1BX6A 5FXQA 2CCIA 3W8LA 1UU3A 1ND4A 4EBWA 4AQCA 2PZRA 3MY0A 3ML1A 3EL8A 3RK5A 4H1MA 4IB0A 1X8BA 3PWYA 5A6NA 2R3GA 2RFNA 2VTIA 4I5HA 2O64A 5CF6A 3SG8A 4FTTA 3CTJA 4NFMA 4R5SA 4ENXA 1YDSE 3Q9XA 5AUZA 3LXLA 4BB4A 4XCUA 4B6LA 3F88A 2PYWA 1QPJA 4C59A 1CKJA 3NNVA 2B9IA 4D5HA 2B53A 1J7IA 5DFPA 1YXXA 3FXZA 4X2KA 2GMXA 1R78A 1XBAA 3OXTA 4QMSA 1GIJA 3EQPA 3NS9A 3OEFX 1BKXA 1NVQA 4GFGA 3GENA 4L67A 3H30A 4BKYA 5C4LA 5E90A 2BRHA 4BHZA 2W4JA 3Q9ZA 3ODZX 4KRDA 4QTEA 2CKQA 3TNIA 4GKIA 3SX9A 4GYIA 4IX3A 3F9NA 4M3QA 3ZSHA 2OKRA 4PQNA 1WAKA 3HX4A 5AR5A 1AD5A 1H24A 2PZYA 4EHGA 1CDKA 4FKPA 3ZUUA 4KIQA 5LMKC 3ANRA 3QD2B 2C47A 3RPYA 3TV7A 4H39A 3EFLA 3UODA 3E64A 1A9UA 1KE9A 3EKKA 2PHKA 4CTCA 5KHXA 3BL7A 3DXQA 4R78A 4FV1A 3LIJA 4LG4A 4L01A 5HE3A 5ANEA 4DGGA 3MYGA 3KXXA 4YURA 4CKRA 4GT3A 3WF9A 1Q5KA 1V0PA 2W1HA 3R9HA 2WGJA 1XH9A 3H9FA 5IUIA 3MIAA 5L8LA 3UDSA 4XOZA 4QTBA 4BJJB 4JX7A 3QD3A 3DGKA 3K3JA 4FTRA 1BLXA 3OXZA 4MXXA 5D9HA 4L43A 2UZNA 2UV2A 5EK7A 5J87A 2XALA 1NVRA 4I41A 3GT8A 1E9HA 3WYYA 3ORPA 4F7SA 2HXLA 2XK9A 3KRWA 2JFMA 3NLBA 4YZBA 3EQFA 1Z5MA 3Q4ZA 1MUOA 4KAOA 4OT6A 5BVKA 4AE6A 5BMSA 3BLAA 2OIBA 1KE6A 4QD6A 1ZYLA 1OIRA 5HD7A 4DFXE 3IGGA 5EI2A 5CAVA 4TWPA 4MYGA 3AC5A 2Z60A 3TJDA 1FVTA 3ZRMA 4AZTA 5HTBA 3DNDA 3HL7A 3HMIA 4Y73A 3FE3A 1YOJA 3Q9WA 4FG9A 3HEGA 4MF0A 3HV5A 3I79A 4FZ7A 4NJ3A 4O27B 5HBEA 2VTSA 5AP1A 4R3PA 4YZMA 3CIKA 3LXPA