2P55A

X-ray structure of the human mitogen-activated protein kinase kinase 1 (mek1) in a complex with ligand and mgatp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
322
structure length
289
Chain Sequence
MELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title 4-anilino-5-carboxamido-2-pyridone derivatives as noncompetitive inhibitors of mitogen-activated protein kinase kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 289
sequence length 322
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2p55A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2p55A01
4L01A 4YR8A 3DV3A 1K3AA 3MVMA 5LMBA 4O82A 2JIUA 1PMVA 1QPCA 5HBEA 2X9EA 4Y8DA 3DZQA 2E9PA 3TV4A 3LE6A 2VV9A 4KINA 3GFWA 1P5EA 4QPAA 4Y85A 1HCKA 2WFYA 1P4OA 2BFYA 2R3RA 4FIEA 5KHXA 3MW1A 3OS3A 3KKVA 1H00A 3DBQA 3QC9A 2PK9A 4FZ7A 4J52A 2GDOA 5AUWA 4NIFA 3VWAA 4QPSA 4BDHA 4MWHA 3LFQA 1UV5A 2HAKA 4GK4A 4RT7A 5TKDA 4PNIA 4B4LA 4DBXA 3H0YA 4HYSA 3BV3A 4OAUC 4B9DA 4PV0A 4RZWA 5HG8A 2J50A 4FTMA 5CU0A 5EM8A 2PUUA 5HVKA 3OVVA 4J96A 4TYIA 1PXNA 3VIDA 4CV8A 3I1AA 3DFCB 3AC3A 4FIFA 3BEGA 3C4EA 3HL7A 4F7JA 3QAME 3AC5A 5J7BA 2C5OA 4AOIA 2EU9A 2C1BA 3C4FA 3R7OA 3EN9A 3IDBA 3P4KA 2VN9A 2YIQA 3QWKA 4FUXA 4FTJA 5FBOA 4ASXA 4O22A 4FTNA 2WQEA 3AGLA 4JR3A 5IA5A 4CFWA 3MJ2A 2O64A 3FKOA 4KBCA 1KE8A 4U79A 1OIYA 3ID6C 3CPCA 4O7NA 4DT9A 2CLQA 3U6IA 2NP8A 4IACA 1WZYA 5HQ0A 3PE1A 5HG5A 4QQCA 5HNGA 2VX1A 1A9UA 2QODA 4I6QA 3WZUA 3GCUA 4AW1A 2OJGA 2A2AA 3GQLA 2RSVA 3RAHA 4CV9A 3F3ZA 3C50A 5EM7A 4I5PA 4IX4A 3DK6A 3RK7A 2WQMA 3FPQA 3S2PA 5HG7A 4P5ZA 2XNBA 4QMOA 4OTWA 5KCVA 2GQGA 5J7HA 2C47A 4PPAA 3R8UA 2CKOA 1JKKA 3WYYA 4FV4A 5DYJA 2J90A 3OF0A 1LR4A 5CF8A 2VTQA 4BY9E 3QTZA 1PMUA 2UW3A 1OB3A 4FODA 3FDNA 4RSSA 3MY5A 3NAXA 3LQ8A 4MD9E 4DA5A 2J0KA 1UWJA 5CY3A 4AE6A 4YC3A 4E5AX 3FZSA 3KCFA 2WELA 4ASZA 5LWNA 4FTCA 2ZB1A 1WAKA 3HMIA 4P90A 3DJ6A 2Y8OA 3L8SA 3Q9XA 4GYIA 4FKPA 4H39A 4QP9A 4NYEA 3NNUA 3R7YA 2AUHA 4XBRA 3ZMMA 3OROA 2GNJA 3QTQA 5CF4A 3W55A 5D1JA 4Y83A 3IOPA 4PTEA 2WHBA 4O0YA 3GI3A 3AXWA 1H08A 2VNYA 3R01A 3ORMA 1BLXA 1BX6A 3KRWA 4XUFA 5GJFA 3ZO2A 5JQ8A 2RIOA 3ZUUA 4M8TA 3V8TA 4XX9A 3TZ9A 1JLUE 1UNLA 2EXCX 2XJ0A 5I5ZA 2Q0BA 3DBCA 4GVAA 1ZOEA 2WTVA 4NL0A 5FUTA 3KXHA 2C6KA 2FSOX 3VUHA 1SVGA 3BGPA 3TZ7A 3QKKA 2DS1A 4WBBB 4YZBA 4L42A 2YWPA 4QYGA 1O6YA 5EW3A 3R8VA 3DLSA 4BF2A 3I7BA 3LKMA 4M3QA 4MXCA 3RWPA 4WNPA 5IH5A 5B7VA 2SRCA 3DQWA 4F6SA 4C36A 3MH3A 5I3RA 2WAJA 2I0HA 4P7EA 2XS0A 4PWNA 1JSVA 1OVEA 5FXQA 4E3CA 2CKQA 4EK5A 4LM5A 5A4QA 5E92A 3T8OA 1FINA 1WBVA 4IZAA 4YLLA 1OGUA 3OFMA 4DGOA 2VTLA 4RGJA 4D9TA 4PDYA 2E9NA 1BMKA 4D2RA 5LVOA 4QYYA 4BHNA 5JRSA 3PJ2A 3D7TA 3BU5A 5CXHA 3EN4A 1B6CB 2J0LA 2XIKA 3PVBA 2RFDA 4CT1A 2BZIB 3VBTA 4IWOA 3W8QA 3D9VA 2IZSA 2PVYA 2VO6A 3UOHA 3OZ6A 4JOAA 2JAVA 4G17A 1W8CA 4XLVA 3LFDA 3CIKA 2BHEA 3I5ZA 1OKZA 3SXRA 1J3HA 1K9AA 4EHVA 4YLKA 4ANSA 2BDWA 4O1OA 2Y6OA 2VO3A 1T45A 3GUBA 3ZOSA 4CQGA 3S0OA 2GS7A 4O96A 4AZWA 4TYHB 4MD7E 3G15A 5HLPA 2XJ1A 1OUYA 4IZYA 2W1CA 4WNOA 3L8PA 5TOZA 3EQRA 4U0IA 1U4DA 4BDAA 5JFXA 5IUGA 5DR2A 3UZRA 3IO7A 3E8NA 3PE2A 3HZTA 2H96A 1OL6A 4FA2A 5KMOA 1B38A 4BTKA 4WT6A 2X8DA 4EC8A 1AD5A 4OTDA 3E8EA 4FTLA 5BUEA 3OWLA 3ZLYA 3EMGA 5GHVA 4EOSA 3BHUA 3QXOA 2JKKA 2FUMA 5DNRA 2HELA 2XNMA 1XBAA 4HPTE 4BDIA 5AEPA 5CU3A 1R0PA 1TKIA 2W1EA 5TF9A 1MRUA 4DTBA 3P79A 3Q4ZA 4LRMA 3EIDA 1L3RE 3R7EA 3FMHA 5K0XA 4E6DA 4BL1A 4EHZA 4IZ7A 3E3PA 3QD0A 3WF6A 4CTBA 2JD5A 4XG4A 2PUIA 2XM9A 5KNJA 3IKAA 4QMLA 1Z5MA 4R6VA 5HTBA 4RC2A 3GENA 3TDWA 3UPXA 3KN5A 3ANRA 4AN2A 4DFXE 4ERKA 4F64A 4WKQA 5C4LA 3FMJA 3PXZA 4D2WA 5IA2A 3QRIA 4HCTA 3FXWA 5KHWA 4BCNA 3VS0A 4UBAA 3KC3A 4HNIA 3W2OA 3NCGA 2BRHA 2QOQA 3LCTA 3ORLA 4FTIA 1BL7A 3OHTA 4G6NA 4BBEA 4JR7A 1H24A 3F2AA 5HX6A 4LGHA 1WVYA 4A9YA 2WMUA 4ZSAA 2GTNA 3ORIA 3BGZA 2V7AA 5ETAA 4CKIA 2B4SB 2PU8A 2YIWA 4R5SA 5ANKA 5DEYA 1E1VA 3TT0A 1YQJA 3WI6A 3NUPA 1ATPE 2RFNA 3NUYA 3QTRA 4DFZE 3IOKA 3QZGA 4G3CA 2OF2A 2WTKB 4AZFA 4WD5A 4CZUA 4E4NA 4YUQA 5BNJA 4GJ2A 4IHPA 3DKCA 2ITZA 3UZTA 1NT2A 2OW3A 3UO6A 3OY3A 3MA3A 4FKLA 2OICA 4LUDA 2W1HA 3VF8A 3PG3A 5E8XA 4D2SA 4DH5A 5KMNA 4BDEA 3FI2A 3TEIA 3K3JA 5BYYA 2VWVA 3C4XA 1ZMUA 2FSTX 3QQLA 5ETIA 2GNGA 4EUUA 3QXPA 3UYSA 4G3GA 2ZJWA 3FAAA 4EK6A 1G8SA 1KUTA 4O27B 2UW4A 3SRVB 4Q9SA 3ROCA 3EQFA 4X3FB 3VVHA 4M69B 5CU6A 4ZTNA 3DJ5A 4UY9A 2YZLA 3CTJA 3WF8A 2XKEA 3TDVA 3LPBA 4RFZA 2OJFE 3SGCA 5HCXA 5AUXA 4C62A 2VU3A 3MH2A 3MPTA 4DAWA 3TIYA 4GH2A 3EFKA 1FVRA 3DOGA 1JKSA 1PRYA 3C51A 2V5QA 4EC9A 3DCVA 2VWWA 3HA6A 3HV4A 3KXMA 3SOCA 4PY1A 4I6FA 3M42A 3F3VA 4IX6A 4BBFA 2RFEA 1PHKA 3HECA 3FQHA 4TYEA 1IAJA 2QHMA 3O8UA 3GU5A 4QMQA 1JSTA 3QRKA 4S30A 4TYGA 1M14A 2LGCA 5FP5A 3PSCA 4S31A 4D2VA 4AG8A 5LXMA 5HHWA 2X8EA 4CVAA 3FZOA 3QA0A 3D0EA 2PMLX 5E8UA 4ZJVA 5EDQA 4D5HA 2XK8A 4FT3A 1YHSA 4IX3A 4GMYA 2YM8A 2PZ5A 4GT3A 5LJJA 3BQCA 4KBAA 2WTKC 4RBLA 1R3CA 4JBQA 3VUDA 3QGWA 3CD3A 4EH7A 5DGZA 4AGWA 1CSNA 5BQ0A 5CASA 3F2RA 5CZIA 4O81A 4DGMA 4W9WA 4HYUA 5L8KA 5CENA 4CCBA 3KCKA 4KKHA 1KE9A 2YERA 4E7WA 2G2FA 5ITAA 1FPUA 4JDKA 2UZNA 4W8EA 3L9NA 5CSPA 2QLQA 3OEFX 3NMUF 3KB7A 3N9XA 2OGVA 3A7JA 3FMKA 3WE4A 4ANBA 5DT4A 2W5BA 2WD1A 2YISA 3EJ1A 4BTMA 4I0RA 5K3YA 2CGXA 3KF7A 3OCTA 2C0TA 2VD5A 2CGVA 1UA2A 4X3FC 5AR7A 4A4XA 5BMSA 4ZJIA 1ZXEA 3KREA 4M15A 4IB0A 2KTYA 2EB3A 3R22A 4FMQA 1JKTA 5A4TA 5CANA 3LVPA 3BLQA 4LUEA 2CLXA 3FQSA 2W4OA 1W0XC 2IVSA 4AS0A 2C69A 4R1YA 2C6EA 4IXPA 4U3YA 4XP3A 2R0UA 4J99A 4ANOA 4MXAA 5AFVA 1KE5A 4UYAA 1IA9A 3G9NA 1Q8ZA 2BFXA 3F5PA 4EBVA 4K18A 4USDA 2G01A 4C61A 5BX0A 2VX3A 3LLTA 2WMRA 2V7OA 2GU8A 2XBJA 4U81A 5ANIA 2GHGA 2WEIA 5HIDA 4EH4A 3CBLA 3H4JA 3Q52A 4IX5A 5ANEA 3SXFA 3VRYA 2XNOA 2O63A 4BZDA 2ITQA 4C4EA 3LM5A 5AP4A 5IQHA 3OCGA 4KD1A 4K8AA 3WILA 3HUBA 1M2RA 4GRBA 4ZZOA 4AFEA 4YZNA 4CEGA 4EH8A 2BTRA 3LCKA 3R9HA 3KGAA 2B55A 2AC3A 3CY3A 5AX3A 3S3IA 1V0OA 2B9IA 4U6RA 5CEPA 5E1EA 3VBXA 1J1CA 3EOCA 4FEXA 5M08A 1OPLA 5LVPA 1BL6A 3L1SA 5HE0A 3JVRA 2QQ7A 3A7FA 3O0GA 4ZIMA 4BDKA 5JQ5A 4BCPA 2WOUA 3DU8A 5KMKA 2OZAB 2ZVAA 5EM6A 4C33A 5I9YA 4U43A 5HEZA 3LCDA 4O7YA 1YDRE 4DFNA 3DB8A 5HCYA 2OBJA 3LHJA 3FKNA 3U4UA 5HNBA 4O7SA 2X6EA 2RG6A 2XK7A 3WE8A 5FEEA 3LXKA 2ZDTA 2ZV2A 4QYEA 1KE7A 2BMCA 5HESA 2Z2WA 3LXPA 5FG8A 3O71A 1IA8A 4MF1A 4M12A 4DITA 1MUOA 3O8PA 5DN3A 3GNIB 2C6MA 4OAVB 3ZONA 1KOBA 4EBWA 2B0QA 4JX3A 4BBMA 4B99A 4CMTA 4PPBA 4OBOA 3VS6A 4N70A 4F9BA 3KN6A 3UNKA 3W32A 5AUVA 4GKIA 5IQIA 2GHLA 3R04A 3Q2MA 1LEZA 3EQIA 4I94A 4YJRA 2CNVA 2WTIA 3NR9A 2PWLA 4QP1A 1B39A 5HU9A 3VUIA 4Y5HA 3FUPA 3QTWA 1P2AA 2QKRA 4U9AA 5FWKK 3V6RA 3IW5A 3U6HA 3D5XA 2KULA 2AYPA 4RRVA 4UZHA 4O0VA 4F1MA 4AUAA 3W33A 4F6WA 3TKUA 4Y46A 4BCKA 1MP8A 3GCQA 2PVFA 2UZLA 4KIOA 3BHHA 3RM7A 1U54B 2YCRA 2YM5A 3EQCA 4JL9A 4G16A 2BTSA 3OUNB 4FSYA 4H1MA 4N6ZA 3LFEA 2HENA 4QPMA 3OWPA 4K1BA 3VNTA 5JFSA 3T3UA 3JS2A 3FYKX 3UQFA 4DLIA 3CXWA 1PKGA 4IB5A 4YJOA 4YHJA 4JQ7A 4L3PA 3QZFA 4EONA 2VAGA 3DLZA 3OG7A 3ATTA 4PL5A 2R7IA 1ZMWA 2IVUA 4U3ZA 3FLSA 4O2PA 2B1PA 5DLSA 4BWPA 3P0MA 4S2ZA 3VHKA 4QP4A 1OI9A 4BKZA 3O96A 2DWBA 4FV0A 4XG6A 3UG2A 3ZEWA 4BCHA 2V0DA 4QMZA 4QOXA 2H8HA 3WARA 3UC3A 1H1RA 3COMA 3O50A 1Y8GA 3B2TA 4IWDA 1Q3WA 1XKKA 4KIKB 1XBBA 3QGYA 1GJOA 4IDTA 4E5BA 3NWWA 3U9CA 3D7ZA 4YBJA 4GFOA 4FC0A 3H9FA 4L52A 3AT2A 4ZTLA 4GVJA 2O8YA 4FSMA 4CYIA 3WF5A 4FSZA 4D5KA 3RM6A 4CMUA 3COIA 3KVXA 3MVLA 4LOOA 4NFMA 3MY0A 3R7UA 4ACGA 3ORTA 1OL2A 4FKSA 3DPKA 1JVPP 1YXVA 2J51A 3IONA 3KMWA 3R7GA 4RA4A 2IZTA 5A14A 2WQNA 3ORNA 4EWQA 1QPDA 1T46A 2OH4A 5AP1A 4IWPA 3A4PA 2XBAA 5A4CA 1RDQE 1TQMA 3F9NA 3GOPA 3BELA 1YOMA 2ONLC 3DAJA 3E7OA 4RIYB 3BQRA 5D10A 4RWKA 5IEYA 3HMNA 4FKJA 4ASDA 3BRBA 1GIIA 3ZZEA 3ZM9A 3BHTA 4ACDA 3IW4A 3OCSA 5AWMA 3ZO4A 4QMNA 4HJOA 2YA9A 2PVJA 3NIEA 3DNDA 5DRBA 3BX5A 4DN5A 5IH6A 4FE2A 3RHXA 2OK1A 3MS9A 4G5JA 3FY2A 4ONAA 4TWCA 3R1QA 5CSXA 4TL0A 3DDPA 5IA1A 1OL1A 3Q9ZA 3F3UA 3RCDA 3TJDA 3UP7A 4AX8A 3MFUA 2BRMA 4G3DA 4FG8A 3OOMA 2JFLA 1H1QA 1OKVA 2YAKA 3TNQB 3AD4A 3ELJA 3WIGA 5CALA 4RJ7A 2QI8A 3DA6A 3LFNA 3U8WA 1OL5A 1CMKE 4F9YA 1SM2A 3QLGA 5CAUA 4QTEA 4O83A 3O8TA 4YNEA 4Y95A 4ANNA 2BROA 2ZV7A 4BDGA 3NYOA 4QMWA 3WZJA 3NNWA 2XMYA 4PL3A 3S1HA 4RG0A 4JIKA 3Q32A 5D7VA 5DVRA 4WOVA 1Q5KA 1U59A 1QMZA 5AUTA 3CR0A 3CGOA 3OCBA 3VRZA 3Q9YA 4AZVA 2BRBA 3HMPA 3O51A 2R3NA 5F94A 4AFJA 2C3KA 2ESMA 2Q0NA 2XUUA 4XOZA 2RGPA 3DXPA 5HTCA 1H1PA 3HP2A 3ZLSA 4FOBA 2PE0A 3CS9A 5CVHA 3DS6A 2Z7QA 3HV6A 3HKOA 1UU3A 2X2KA 5CYIA 5I9XA 3UBDA 4FVQA 3G2FA 1Q4LA 2PE1A 4U41A 2O65A 4O0WA 1R39A 2YN8A 3RKBA 3LCSA 5E8TA 5AM6A 4RIWA 1W83A 2QU5A 3C4CA 5E8SA 2W9FB 2ETMA 2PHKA 2W4JA 3EZRA 3VF9A 4E6QA 5C26A 2ITPA 1YXUA 4ITJA 3DTCA 3F61A 5LOHA 3JY9A 4L46A 3UIXA 4LFIA 4ZSGA 1PMEA 3RAIA 2WB8A 4F1TA 5L8LA 4FKTA 4IFGA 4X3JA 3G6HA 4J8MA 3MIAA 1KOAA 4U44A 3W1FA 2C5NA 3VS3A 2F7XE 3ENHA 1MQ4A 3POOA 4NTTA 4V0GA 3S00A 5HTIA 2C6LA 2XCKA 3QKLA 4DH7A 3GP0A 4RQKA 2ZMCA 3TZ8A 4OTFA 4YPSA 5FM2A 5JK3A 3KVWA 3NVMB 4OW8A 4C35A 3KULB 3GT8A 4TY1A 4U42A 5M09A 4TTHB 2RF9A 4LGGA 3PSBA 2GS2A 4RIXB 3F5GA 3P86A 3QCSA 3UDBA 2WOTA 3BE9A 1UVRA 4JIAA 4JI9A 5CLPA 3I4BA 5BVKA 4RVLA 3EN7A 2VWBA 3OBJA 2WGJA 2XKCA 4OBPA 3ODYX 5IQCA 4AP7A 1DI8A 4BHZA 1OKYA 2G2IA 4IVBA 3SW4A 3G5DA 4D28A 4GIHA 2UZEA 3E62A 4ASEA 2A19B 5AUZA 3HAVA 1OECA 4FT5A 2PMOX 4GEOA 4GT4A 4GT5A 3E64A 1IRKA 3ZZWA 4IBMA 3QBNA 4ZJJA 2Z7RA 1QCFA 3PY0A 2LAVA 1O9UA 2QOHA 4RWLA 5FP6A 2C0OA 4FNWA 5HICA 3W8LA 1WBWA 2UW0A 5JRQA 4E1ZA 2OU7A 4GG7A 4YJPA 5EI6A 1JQHA 4IJ9A 2XKDA 4BRXA 4FVPA 4ITHA 2WQOA 4JDHA 5HLWA 3QC4A 4FOCA 2J0IA 4C4JA 4PMMA 4RLKA 5FM3A 5GIPE 2CSNA 3KRXA 4CFVA 3PPKA 4V05A 5J1VA 1LEWA 3LOKA 2I40A 3VO3A 3HGKA 2O5KA 2PE2A 4FGBA 4MX9A 5IQEA 3NVKI 5FTGA 1NA7A 2X2MA 1UNGA 4TNDA 5CEOA 4J8NA 3R02A 4ALWA 1OPJA 1VEBA 1H1SA 3MESA 4O7LA 5CT0A 4BDJA 4DH3A 4G3FA 2YM4A 3R1SA 2R3HA 3Q04A 3SA0A 4DCEA 4H05A 1CKIA 1M17A 3WBLA 5TO8A 3HRCA 4R5YA 3LMHA 4QD6A 3UMWA 3QQGA 4FKUA 5IEVA 4BCFA 1REJA 4I20A 2UVZA 4WG4A 4MD8E 4FSRA 4E4XA 3M11A 4QTBA 4MWIA 5J1WA 3NYXA 1H4LA 2QOIA 4BB4A 2W1DA 1FVVA 4F0IA 2W9ZB 3CCNA 1YXXA 2NNWB 3B8QA 4K33A 4RQVA 2CKEA 5F4NA 3FI4A 5A4LA 4TWPA 5FGKA 5M4CA 3EKNA 3F6XA 3G90X 4IH8A 1H26A 4K77A 5B0XA 3KRJA 2VO0A 4X2GA 4EH3A 4UB7A 3JYAA 2W1GA 1H28A 2JDVA 2JAMA 3F2NA 4MAOA 4O0XA 4BDDA 3ENMA 1DAWA 3IGGA 4CFUA 4IAZA 3RWQA 1DAYA 3NIZA 3F7ZA 3W2SA 1J7IA 1BUHA 3TUBA 2YM6A 3EFLA 1BYGA 5K0KA 1UWHA 4ZY5A 3WZDA 3LAUA 1KV1A 2JIIA 2VO7A 3F66A 5H9BA 3TI1A 2J6MA 2XK9A 4L6QA 5DR9A 2IJMA 3PA5A 3CGFA 3ZTXA 3C13A 5M07A 3ALOA 3IDCA 5I9ZA 4YJVA 4FKQA 3VHEA 4EOLA 1K2PA 3GU6A 1ZYJA 5CNOA 4S34A 2VTMA 3TXOA 2ZOQA 5H8EA 2ETKA 5AAGA 1U5RA 4JQEA 3NUNA 3IPHA 2C68A 3BZ3A 3UP2A 2HCKA 4XG2A 5JKGA 3FSKA 4YNOA 5A6OA 4KWPA 4R77A 4OTHA 2YJRA 3H9RA 3QYZA 5EYKA 5GNKA 1H1WA 5AIRA 3V3VA 3FL5A 4MQ2A 5AR8A 3V5QA 3ZDUA 4MHAA 4ENYA 5FRIA 3R00A 3Q60A 3F69A 3DTWA 3OY1A 2IW6A 5ETFA 3E87A 4B0GA 4P2KA 5AV0A 4LGDA 4ZTSA 2GNIA 3FJQE 3KFAA 4V04A 2XRWA 4XRJA 4HGSA 4EOKA 2VTIA 4ACMA 5IPJA 2JGZA 3E63A 4ZZNA 2WTCA 3Q5ZA 4L3JA 4EQUA 3ZUTA 4NK9A 2XK4A 2PMNX 4FEUA 3LCOA 3QQHA 4XG3A 3O7LD 4N0SA 3NCZA 3PJCA 4AE9A 2CCIA 3BCEA 3CJGA 1H01A 4I5HA 4X6RA 3RAWA 2ERKA 4J7BA 1J1BA 3TKIA 3NX8A 3ZSIA 4DGLC 2B9FA 4FR4A 4FVRA 4AW0A 3ZYAA 4EZ3A 4HPUE 3DB6A 2BDJA 2XIZA 5HE1A 3ULZA 4BWKA 4LG4A 3Q4TA 3UQCA 2OJIA 3DGKA 1ZY4A 4WG5A 5CT7A 1V1KA 4L7FA 3BYVA 4CNHA 4WNKA 2VWYA 5DPVA 1KWPA 4ZK5A 2WMXA 1XWSA 4EH9A 1FMOE 4NCTC 2QOKA 4MQ1A 4YTHA 3MYGA 4YJSA 4TXCA 2OF4A 3ZHPC 5KMJA 4A07A 4IVDA 4MXOA 2FO0A 4R3PA 3RMFA 2F2UA 4F0FA 5HGIA 4DG2E 3EQGA 5D9HA 3VS4A 3F3TA 4BTFA 1FQ1B 3A7HA 5EHYA 2UZTA 4QTDA 5K9IA 4DEHA 2WMQA 4I24A 3CPBA 2UW9A 4K9YA 4TWNA 5BUIA 5FQDC 4FK3A 3R7IA 4EOPA 4CSVA 4M68A 5IMXA 5J9YA 4W8DA 3A2CA 5IUIA 4LQMA 3MIYA 4NEUA 5E8YA 3ORXA 3PIYA 4FF8A 3ZUVA 2QO7A 4BGQA 2C6TA 3HA8A 3TV6A 4GW8A 2PVRA 3P78A 3NDMA 3KK9A 3PG1A 3A99A 2JDTA 2YCFA 3D4QA 4FG9A 3ORPA 1Q8TA 2ITYA 2X0GA 4FZ6A 4N6YA 3HDNA 4JX7A 4C4IA 2W17A 2IVTA 4JXFA 2OZOA 2BR1A 4L3LA 4DEBA 5KX8A 3II5A 4UMPA 4S33A 2VZ6A 2C5XA 4IAKA 5CZHA 3EWHA 4H3BA 3GFEA 1W7HA 2QOCA 2WMAA 4DYMA 4IZ5A 4KIQA 4O7TA 1S9JA 2ETRA 2FB8A 2GFCA 3ERKA 1E9HA 4AACA 4AZTA 4GUBA 3QUDA 4QP6A 4ZEGA 4U80A 3Q53A 4YU2A 1SVEA 3LFAA 2NRUA 3VULA 4EJ7A 3H0ZA 3R73A 2GFSA 2ITNA 3KK8A 3PWDA 4XV1A 4HW7A 5FTOA 4DBNA 2OH0E 3PPJA 2EUFB 4C8BA 3MTLA 4NM0A 3R7VA 3ATSA 4EQCA 2ZV8A 3DJ7A 4C4FA 4II5A 3NW5A 4XG7A 3UODA 2GQSA 4O0RA 4FV3A 3R28A 2UZDA 2OSCA 4FL3A 4ZY6A 4YMJA 4LYNA 5CSWA 5HVJA 2QOOA 2C6OA 2WMVA 4JDJA 2WMWA 5F20A 1Q61A 4FSWA 1PXOA 4TRLA 4O86A 4FSUA 3VBYA 4ZXTA 4FV9A 5D11A 5AV3A 4BCJA 5AR2A 3RHKA 3L9MA 2CNUA 2DUVA 2VTTA 3R1NA 2HOGA 4YO4A 3V51A 3QFVA 2ACXA 3G51A 4RIOA 3EHAA 4L67A 3VC4A 4JJRA 2F7ZE 3F3WA 3FLWA 1KV2A 4W4YA 4Z9LA 2CN5A 4NTSA 4XYFA 2BKKA 1WBNA 4AOJA 1GZNA 5LCJA 3VUMA 4EEVA 4CFXA 1F0QA 4BDBA 4I0TA 5DOSA 4R7IA 3UC4A 4EOIA 5GIOE 2GSFA 3TTIA 4APPA 4D58A 2R3LA 1P4FA 2I0VA 1FOTA 3GCVA 4TW9A 5BVNA 1REKA 4CZTA 4FYNA 4UYNA 1WBOA 2YM3A 3EYGA 4U45A 4PDOA 5LCKA 4C3RA 4XV2A 4NM3A 4OTQA 3DK3A 3DNEA 4G1WA 1P14A 3RPYA 2UW6A 2XB7A 2JKQA 4JS8A 4BTJA 2XZSA 4GUEA 4BWXA 4EK8A 4IJPA 3GQIA 2IWIA 2NRYA 2ZM1A 5AP0A 3POZA 1YWRA 4BI2A 4LRKA 4JVGA 5M56A 4PX6A 5DWRA 5EKNA 2IO6A 2ZB0A 1WVXA 3NGAA 4A4LA 2ITOA 3QQUA 4J71A 4ZSLA 5LQFA 2PY3A 3U55A 4TN6A 2QD9A 2Z7LA 3KA0A 4YTFA 1CKJA 4Q5HA 4ZTRA 4FV5A 2ITUA 2WU6A 3W2RA 4ENXA 3C4WA 2G9XA 3R6XA 5IF1A 3FMDA 2WZJA 3ZBXA 3OXTA 3WZEA 3V5PA 3A62A 3GC7A 1GOLA 3QCYA 3SV0A 3MFRA 3R9DA 5BUJA 2OLCA 4KRDA 3PXKA 2Y0AA 4P5QA 5M53A 3SXSA 5E8WA 5IZFA 1NW1A 3QD2B 5EDRA 1XBCA 3L9PA 5HG9A 5CVFA 3VW6A 2I0YA 4C34A 4R78A 3HUCA 4JLCA 3VS1A 2XA4A 3ET7A 2W1FA 4WUNA 5CAVA 4JRNA 3PA3A 3CQWA 4I5MA 5C8MA 3TNPC 4DTKA 1W98A 4QMVA 1YDSE 2VTOA 4I3ZA 4O7RA 1UU9A 2BAKA 4AT3A 5HO7A 3CEKA 3GVUA 4O0TA 5FEDA 4RLLA 3H9OA 3QYWA 5GZ9A 4RWJA 3WYXA 4RWIA 4D9UA 2QURA 2Y4IB 3BPRA 3CQUA 4RX9A 4QMUA 3FZRA 3U6JA 2HZ0A 4L8MA 2C4GA 5I9WA 4IMYA 3BEAA 3MB6A 3O7LB 5KMLA 4K0YA 2YDIA 3HMMA 3VQHA 5IG1A 4RVKA 3HMOA 2QCSA 4NJ3A 5GZAA 1H27A 2QVSE 4PQNA 5H8GA 1Q41A 5C9CA 2EXMA 4HVIA 3CQEA 4I1ZA 4IVAA 3SD0A 4FIIA 5ACBC 4FK6A 3PPZA 1HOWA 4CRLA 2PYWA 4UWBA 1YVJA 5TE0A 3I81A 4GKHA 4LMUA 3RK9A 3TCPA 4F7SA 4ZY4A 4E5WA 2R9SA 3F5XA 2JKMA 5HZNA 5IQBA 4PRJA 3I79A 3UIBA 3V5TA 3QCXA 4KIPA 4JG7A 4L7SA 4KUJA 2CNQA 3R8ZA 2QG5A 1IG1A 1URCA 3TZMA 4HCUA 4TYHA 4ZAUA 4UXLA 4WUAA 3UMXA 4O6LA 2YABA 4QTAA 4QMMA 4P4CA 2HWOA 4QQJA 4E6AA 3GCPA 2CPKE 3BU6A 2QNJA 4ZTQA 5KZ0A 4IC8A 2R3FA 4J53A 4HGTA 5FD2A 3OXZA 4W4XA 4YO6A 4QMSA 3VS5A 3HRBA 4LOPA 3QQJA 5ANGA 5EOLA 4FBXA 3D83A 4WRGA 3UO4A 4UX9A 4PPCA 4RFMA 1XR1A 2B52A 3C5UA 3PLSA 5JT2A 1OL7A 1RW8A 3GC0A 2XCHA 3BYSA 4FSQA 4UZDA 5L2QA 2R3KA 4AGCA 3OOGA 5CSHA 4QTCA 5KMMA 2CGUA 3BV2A 4I22A 4UMQA 2CCHA 2WMTA 1A48A 4ANMA 1XJDA 2QO9A 2Y4IC 4IANA 3UTOA 1Z57A 4QNYA 2C6DA 3NRMA 4R3RA 3UOLA 5J79A 4DG0E 4EJNA 4XMOA 4ZS4A 4MXZA 4FV1A 4KSPA 4WIHA 4DFLA 3UVQA 3RJCA 3OWJA 5T3QA 1ZYDA 3VS7A 4FKOA 4ORKA 2F57A 4EWHA 5L8JA 2V55A 3NAYA 2F49A 4FTTA 2YITA 4QYFA 3S4QA 4UEUA 2CJMA 4AGDA 4TKSA 3AGMA 1JOWB 2OG8A 3FC2A 4GFGA 1J7LA 1PXJA 3DBEA 4GK2A 4FYOA 4PUZA 4L00A 4IAAA 4L68A 5AM7A 4YJQA 5CVGA 5JH6A 4H36A 1BI8A 3V6SA 1WBSA 1H25A 5H3QA 4YSJA 4MH7A 2PUNA 4AN3A 3AMYA 5A54A 3Q6UA 2E9VA 5HIBA 3W2CA 4IFCA 4XG9A 3FE3A 5K5NA 3AD5A 3C9WA 2P2HA 1AQ1A 2YJSA 4YGAA 5CF6A 1PJKA 1Q24A 3G0EA 3G33A 5GZ8A 3VN9A 5GJGA 5IQAA 1TQIA 1SVHA 5AAEA 4UN0C 4JG8A 4CRSA 4KRCA 4A9SA 4IAIA 4BCIA 4I41A 5DR6A 3NNXA 4FT0A 4O38A 3ZS5A 3UPZA 4IIRA 3I5NA 5DG5A 4RC4A 3OMVA 4XLIA 2GQRA 4FIHA 2G1TA 5BMMA 2QG7A 4DC2A 4AZSA 3R1YA 3AC1A 2Y6MA 4WG3A 5DE2A 1YI6A 5E1SA 4DH8A 4AA5A 4X7QA 3HV3A 3AC4A 3SRVA 3DAEA 4X3FA 5EDPA 4MXXA 2XIXA 4M69A 3TL8A 5BYZA 2HWPA 4EUTA 3GXLA 1S9IA 5IDPA 3PZHA 3R8MA 3TJCA 4EKLA 3ROYA 2X7OA 4X6QC 3PY1A 2W1IA 5KBQA 5EI2A 1NY3A 4RJ8A 4X2KA 5DH3A 4FEVA 3BWJA 3IW7A 3WZKA 4IW0A 3F88A 4IDVA 3A7IA 4H3PA 4YBKA 5CQUA 3FXXA 3HNGA 3SG8A 5HD4A 2R3OA 3PA4A 4A06A 4IC7A 4JG6A 2QKWB 1YWNA 5L4QA 1R1WA 5IA3A 4AAAA 1YRPA 2R2PA 5CEMA 4HGLA 4FI1A 4NM7A 5BVDA 4BI0A 1GZKA 3PRFA 5M4UA 2WU7A 4ZSEA 1STCE 4K2RA 1OZ1A 1YOLA 4IB3A 3FMLA 2HXLA 1DI9A 3L8VA 2PUPA 1YI4A 2QOBA 4XP2A 5J87A 4RC3A 3VQUA 2VRXA 1YDTE 2VTPA 4GYGA 4EH6A 5JZNA 5HORA 3NEWA 1GIHA 1VJYA 4FT9A 4NIFB 2VNWA 1J91A 1QPJA 5I0BA 1LPUA 1JWHA 1NVQA 1OMWA 4EKKA 2XF0A 4QQTA 3PXFA 1YXTA 4JAIA 4JRVA 3M1SA 3AC2A 3RZBA 4FTOA 3FHIA 5AJQA 4DTAA 5ICPA 5IISA 2YZAA 2G2HA 4HZRA 2FA2A 5E90A 2XP2A 4G9RA 4BGHA 1ZARA 3N51A 3NNVA 5AP7A 4Q9ZA 4YSMA 5AR3A 5CEIA 3IQ7A 4Q5EA 5GINE 4AT5A 3HAMA 3EL8A 2VTHA 2OKRA 3VUGA 3GCSA 2IZUA 2BUJA 1JSUA 2W0JA 4C58A 3UOKA 3GC9A 2BIKB 4AA4A 4USFA 2B9HA 1XH7A 3PUPA 4TYJA 5IQDA 2BCJA 3QHWA 2B7AA 4PF4A 3WF7A 2FSMX 3VBVA 4GCJA 1ZZ2A 3KMUA 4CLIA 3R2BA 5KBRA 2I7QA 3BLRA 1XH9A 1WBTA 4FKVA 3PJ3A 4BKJA 3UYTA 4V01A 4X2JA 2UVXA 3ZC5A 4C57A 2BDFA 3DKFA 4H58A 3MPMA 3WF9A 2C0IA 4MYGA 2GTMA 2X39A 2OIDA 2X4ZA 3D2IA 2WIHA 4H3QA 1I09A 4F08A 4F09A 2ZYBA 3NYVA 4ALUA 3D15A 3P7CA 2W1ZA 5AIKA 5FXSA 4F1OA 3DXQA 5M06A 3I6UA 2OIQA 5CS6A 2XH5A 3ZC6A 5EQYA 4GFMA 5EFQA 2OZAA 2XJ2A 5LMKC 1ERKA 2ERZE 4OTIA 3MGYA 3LJ0A 4MTAA 1R78A 1ZMVA 2VGPA 4NU1A 4XH6A 2VWZA 1GNGA 3PP1A 3RPOA 4AGUA 5IQFA 1WVWA 2B9JA 2H34A 4ZTMA 4USEA 4IB1A 4U5JA 2WQBA 3TG1A 5M4IA 3DAKA 3C0IA 4UALA 3AT4A 5CEQA 1UKHA 3BWFA 3H3CA 1AGWA 2IZRA 1CM8A 4AU8A 4CZYB 3NUAA 4MKCA 1OIQA 4BZOA 1U5QA 1M7QA 4UWYA 5EQEA 3LJ1A 3ZCLA 3PVUA 5IEXA 3G9LX 4MVFA 3E7VA 2XEZA 4C3PA 4DHFA 3FWQA 3IG7A 4RMZA 5AX9A 5FEQA 2PVMA 4G31A 4OLIA 3ANQA 2X9FA 4LOQA 2R0IA 5HE2A 2J5EA 2J9MA 3LQ5A 3LXNA 1ZAOA 2Z60A 3DQXA 4BC6A 4ZLZA 4I6HA 3DFAA 5EYCA 3V8SA 2HY0A 4BDCA 1YI3A 2F9GA 1BKXA 2PMIA 2X8IA 4CMOA 5E9EA 4NH1A 1YHVA 4FTAA 3FC1X 3U4WA 4XHKB 1U54A 2VGOA 2VTJA 4MCVA 2R4BA 2BRGA 2ONLA 3PYYA 4PTCA 4O7ZA 3KQ7A 4L9IA 3B8RA 4J97A 3UVPA 3UNZA 2ZAZA 1Q62A 4EK4A 4MNEA 3MV5A 3REPA 3E92A 4RVTA 1OIUA 5AV2A 4EH5A 4M97A 3KU2A 5AP2A 4ZLYA 1WMKA 1Q3DA 3D7TB 1W82A 4PTGA 2OXYA 4O2ZA 5J5SA 2YACA 3ORZA 4JBPA 4QO9A 3EH9A 4FKGA 1APME 3TUCA 5FXRA 1J7UA 3L8XA 3A7GA 3V01A 4C7TA 2JITA 3UIMA 5K4JA 3QALE 5JZJA 2DYLA 4F0GA 1U46A 3DY7A 4RVMA 3Q4UA 3RPRA 1RQQA 3FLZA 4DEDA 4I5CA 1ND4A 1PY5A 3BE2A 3BGQA 3KMMA 4BYIA 4CT2A 4CGAA 2VUWA 5DRDA 4DG3E 3QUEA 4D2TA 4L45A 4W4WA 3PXQA 4R3CA 5AMNA 2X4FA 3PXYA 4XG8A 4YTCA 3RZFA 4XOYA 4YZCA 3UJGA 2WMBA 3LXLA 4Y72A 5HI2A 1UKIA 4U8ZA 1UU7A 3AC8A 5TR6A 3PFQA 1M7NA 5EG3A 3T9IA 4AW2A 2QC6A 3HDMA 3RALA 2OI4X 5E91A 3QWJA 4FL1A 4YTIA 5DBXA 3QD4A 3T3VA 2CN8A 3FMNA 3ZBFA 4A7CA 2JC6A 3MFSA 5JN2A 2IN6A 4EHEA 4NUSA 3AMBA 2QR8A 2Y7JA 3UE4A 4O91A 4U97A 2BIYA 3Q2JA 2O3PA 3MSSA 2XM8A 3TV7A 3R21A 1NVRA 3ACJA 4XNEA 4B7TA 4CYJA 1OBDA 3D5WA 3ZXTA 2JKOA 5HE3A 1NVSA 3LM0A 5JGAA 4MNFA 5IMEA 2PVNA 4Y5QA 4RIYA 3QD3A 4WO5A 2F4JA 5EHLA 3QTUA 3ZSGA 5C27A 4EORA 5IH4A 2VWUA 2JDOA 2BZHB 3OD6X 4QQ5A 4KB8A 3QA8A 1Q8UA 3PJ8A 2R3PA 4LRJA 3U9NA 1E1XA 2WNTA 3FQEA 2C3IB 4KABA 5HLNA 5LMKA 3FHRA 1PF8A 3TNIA 5KMIA 4U7ZA 4BDFA 2BPMA 4OTRA 4MXYA 5AP3A 2PZYA 4TZRA 4G2FA 4BIBA 5L3AA 4F65A 5EI8A 4O7VA 4QNAA 2FSLX 3MVHA 3B2WA 2WTWA 2OWBA 4TWOA 4XCUA 3S95A 2XNNA 4N57A 3BI6A 3EN5A 3FYJX 5E8ZA 3ZM4A 2P2IA 4DE4A 4W4VA 3PTGA 4QP2A 4RA5A 4OR5A 2NO3A 3D14A 3MB7A 3OUKA 5HNIX 4C2VA 5FLFA 5HCZA 1XO2B 3NPCA 4FV8A 4CCUA 1YWVA 1I44A 2X7GA 4MF0A 4O6EA 4WA9A 3W16A 5HIEA 1XHAA 4L44A 3KXZA 4I21A 4OUCA 3MPAA 5DT0A 5C8KA 2PZRA 2PZIA 3R71A 2QHNA 5CAQA 3ZXZA 5AR5A 5L2TA 3VJOA 3R9NA 2R64A 2FGIA 4LMNA 4OTGA 4EHGA 1H0WA 3UNJA 5H8BA 4XV3A 2VTAA 2X81A 3EB0A 3QX4A 1ZRZA 5IA4A 1IR3A 4PMSA 1L8TA 4DCAA 4IAFA 3CLYA 5LARA 1WBPA 2GNFA 4FTRA 1H0VA 3CKWA 5HBHA 4QMTA 1PXIA 1QPEA 4GK3A 2PVLA 5L2IA 4K6ZA 4EYJA 4WSYA 5CU4A 5F95A 4BCMA 4OTPA 4NM5A 4FNZA 4A9RA 3N4UA 4S32A 3P08A 3ZRKA 3PVWA 2YLFA 4PDSA 5HO6A 2HY81 3R8LA 4ID7A 3SG9A 1H8FA 3FLNC 2CKPA 2ZM3A 1YHWA 3FV8A 3R9RA 4O1PA 2CHLA 3NW6A 4ZP5A 1Q97A 4IQ6A 4GS6A 3IW6A 3IGOA 2UW5A 3F7WA 4XEYA 1PXMA 1PXPA 2OO8X 2Y4PA 4IVCA 4EL9A 5LVMA 4FIJA 4ZLOA 5AP5A 3TACA 4GU6A 1YW2A 2JIVA 2XNPA 3SVVA 1G8AA 3LMGA 3R9OA 4MK0A 4F7LA 4C4GA 4G6OA 5EKOA 5FTQA 3TKHA 3GU8A 3KULA 5E7RA 1A06A 2YM7A 3KF4A 2GHMA 4EZ5A 3KRLA 3BYOA 4FGRA 4RIXA 3RNIA 3N4TA 2HW7A 2BHHA 2OXXA 3LFBA 3G6GA 2PSQA 2QO2A 1KSWA 4I23A 3LLAA 3NS9A 3FL4A 1UNHA 5DMZA 4FG7A 1G5SA 3LIJA 2HYYA 2Z02A 4G34A 2Q83A 2IPXA 3MVJA 4JBOA 4HVSA 2XNGA 2WTJA 3R0TA 2J0JA 3QLFA 2A4LA 5L6WL 1CKPA 3KXNA 4YJUA 5ANDA 1Y91A 2UZBA 2P0CA 2VWXA 3NUXA 1X8BA 5C4KA 2OFVA 2ITXA 5FDXA 3SHEA 4PNKA 3CSVA 3UVRA 2C3LA 5TT7A 3SQQA 5FDPA 4QP8A 2EXEA 2F2CB 2UZWE 3DT1A 1Y8YA 2EB2A 3JY0A 3MH0A 5EM5A 2YDJA 3THBA 4BVUA 4F4PA 3UO5A 3FI8A 3ZRMA 5L6OA 3ORKA 4NFNA 5CAPA 4GV1A 3TNHA 5F1ZA 4C2WA 2F7EE 4FZFB 5BVWA 5JEBA 5JFVA 3O17A 3DXNA 4LV8A 1EH4A 4KS7A 2JBPA 5IUHA 2XIRA 3IS5A 2BAQA 3PWYA 3P9JA 1ZOGA 3NW7A 3QHRA 4RJ3A 5A9UA 4ZOGA 4U40A 2W96B 4C4HA 1SZMA 4EK3A 4CFNA 4UV0A 5J9ZA 2P55A 3HEGA 5A3XA 2O2UA 1BI7A 4FEWA 2XIYA 5DA3A 5HX8A 3QCQA 2AC5A 1TQPA 3QZHA 3R8PA 4X2FA 5I4NA 5G1XA 4PP7A 1ZZLA 2GNLA 4DGNA 2XNEA 1XH5A 3CY2A 5C03A 2R3JA 3IDPA 4E4LA 3FEGA 3ZFMA 3OT3A 4M7IA 3AMAA 3BYUA 4CG8A 2A27A 4O0SA 2W4KA 4IAYA 3K5UA 4DEIA 3COHA 3UGCA 3P1AA 3A8XA 4PMPA 4B8LA 3LFFA 4DLJA 5ACKA 4E4MA 4IADA 4MBJA 3MY1A 2C6IA 3PRIA 5CNNA 2VTSA 3SC1A 4D2PA 4QMXA 4I92A 3JVSA 1FMKA 4FV6A 3SW7A 4BR3A 4NW5A 1YOJA 5DIAA 1PYXA 5JFWA 4YHTA 3EKKA 4ITIA 4E26A 4OGRA 5KE0A 5M57A 2BALA 3RPSA 4DH1A 5JMSA 5AUYA 5ANOA 3DKOA 5L2SA 4ZS0A 4EOOA 4ZMEA 5T6KA 2REIA 4FEQA 2YAAA 4XS2A 3RVGA 4UMTA 4DGGA 3A61A 5AV1A 5A4EA 5EK7A 4QT1A 2C5VA 3K2LA 4IM0A 5M4FA 2OXDA 4AN9A 4BKYA 3K5VA 2XYUA 4LL0A 3W18A 4HVGA 1GAGA 3RP9A 1LUFA 2Z7SA 3ULIA 4M0YA 3ZFXA 3C0HA 4NCTA 1CTPE 1DS5A 2JEDA 4EOMA 3EQDA 3RPVA 5BVOA 3FI3A 3TTJA 3QRJA 5H2UA 3BYMA 4D4VA 2VTNA 3OTVA 4X2NA 4DFUA 2P4IA 2RFSA 1WCCA 3IK3A 3VBQA 2HZNA 3E8DA 4FICA 1XH8A 2OJ9A 4I6BA 4B6LA 5CAOA 5LMAA 3I60A 3ZLWA 5D12A 3O23A 4ZMFA 3KRRA 4AT4A 4JDIA 3GBZA 4BICA 2BAJA 5BYLA 2BILB 2QOLA 1UU8A 3GU4A 1YXSA 4YZMA 3NUSA 2CDZA 5CX9A 5AR4A 1HCLA 4PP9A 3L9LA 2HXQA 3K54A 4CG9A 1ZOHA 1Y6BA 3EFJA 3QTXA 4F6UA 4X21A 4ERWA 4D1SA 3HX4A 2UW7A 3QTSA 3ZSHA 1YKRA 4ARKA 4E6CA 3LMIA 3AQVA 2W05A 2YIYA 3A8WA 2XK6A 2WIPA 3U51A 4OT6A 1GY3A 3CTQA 3FPMA 4HYHA 2H6DA 4L53A 4C38A 3FMMA 5EYMA 4YJTA 3BLHA 4OT5A 4CD0A 5J5TA 1F5QA 3O2MA 3D2KA 2WMSA 1V0BA 3A4OX 4YLJA 4J1RA 3LFSA 4NWMA 5LWMA 5B2MA 1Q8WA 4JAJA 2RG5A 4F99A 4CKJA 3MA6A 4JNWA 2R3IA 5B2LA 3RK5A 1SNXA 2JFMA 4NW6A 2UZVA 3RCJA 3D5UA 3NUUA 2PTKA 3SKCA 5IA0A 3PIXA 4Q2AA 1OIRA 3R83A 1V0PA 4FV2A 3PLAE 4I4EA 4DINA 5T68A 4IWQA 1SNUA 5I9VA 2XRUA 3BKBA 4R8QA 3EL7A 3ITZA 4E20A 3Q3BA 3U87A 4KA3A 4IM2A 5K5XA 3GB2A 4UWCA 3T9TA 4A4OA 3Q5IA 3E93A 4BIEA 3FZTA 1FGKA 4NJDA 2QONA 3D94A 1M52A 4M66A 1ZYCA 5L6PA 3SDJA 2V62A 3HV5A 4YC8A 3LFCA 3HP5A 1VYZA 2JDSA 4F9CA 4YC6A 5HU3A 2ITWA 4AZEA 1ZLTA 2BVAA 4DF3A 4J95A 1CDKA 4AW5A 3E88A 3MN3A 4NSTA 4F7NA 2XK3A 2P33A 4X0MA 5DI1A 2BZJA 4XP0A 3BHYA 4ZSJA 3FSFA 2C3JA 3HV7A 5BVFA 1Y57A 4PL4A 1QL6A 4FZAB 4K11A 5EHOA 3P7AA 3NZ0A 4EZ7A 2PZPA 2R3QA 4PDPA 5CQWA 5C8NA 1VR2A 3RINA 2YIRA 4EOQA 2BKZA 3ACKA 5EOBA 4ALVA 4O84A 5JSMA 3W2QA 2OJJA 4Z55A 4M84A 3VAPA 5EQPA 3D5VA 3P23A 3KL8A 4FZDB 5AP6A 1ZYLA 3PVGA 4HZSA 3K3IA 4ZTHA 3FLYA 2YIXA 1IEPA 4M13A 4O7WA 4CFFA 4D4SA 5M44A 3AOXA 4FUYA 4D1ZA 4M14A 5DFPA 3OT8A 2UZOA 4MEDA 4ANQA 4ACHA 4Y73A 4AF3A 4RX5A 2J5FA 2UVYA 4H1JA 2OFUA 4FTQA 2H9VA 1FGIA 3KY2A 4N4SA 3UG1A 5KO1A 2E9UA 3MFTA 1KE6A 5J9LA 3PZEA 1URWA 5IDNA 3CE3A 4XBUA 3F82A 3QL8A 4PMTA 4WNMA 1ZWSA 5DT3A 3CD8A 5AADA 2J2IB 4D55A 3VS2A 5GJDA 4RIWB 4QP3A 4QP7A 2HIWA 3VUKA 2VX0A 2B53A 4WHZA 3ETAA 3H10A 4IEBA 4RJ6A 5LVLA 3JXWA 2I0EA 2VWIA 2ZM4A 1NXKA 2HK5A 3BBTB 1RE8A 3MJ1A 4YHFA 3ZU7A 3C0GA 4TNBA 5M51A 2JLDA 3UQGA 5J95A 3NYNA 3COKA 4M67A 1OM1A 3QQFA 4QMYA 5HD7A 2JDRA 3V5LA 4C02A 1O6KA 1G3NA 3M2WA 1GZOA 3BHVA 2QR7A 4V0GB 4L43A 3OXIA 4YPDA 4KBKA 4DEAA 4UMRA 1OBGA 4KSQA 3UZPA 3VUTA 2O0UA 3RNYA 3V04A 4BGGA 3PJ1A 3VBWA 4C0TA 1O6LA 2QLUA 2V22A 3QX2A 4GIIA 3W10A 2WKMA 4DEGA 4EI4A 3C4ZA 2W5HA 3ZH8A 5A6NA 5ETCA 5C1QB 2GPHA 4BI1A 1JPAA 3FKLA 3SOAA 3QUPA 3QRTA 1PMNA 3KXXA 3R30A 4DFBA 3G0FA 3OWKA 1Q8YA 2X1NA 4FV7A 5CU2A 2PPQA 5E4HA 2R3MA 3LJ2A 5K4IA 2X6DA 3E8CA 4HNFA 4MNEB 4YZDA 4D1XA 3U54A 5AUUA 4RX7A 3JPVA 4FIGA 3V5WA 4WBOA 4DEEA 3C5IA 4AQCA 5KKRB 1PXKA 4HOKA 4YZ9A 3OP5A 1ZY5A 3QF9A 3DKGA 4QYHA 2XVDA 2IW9A 4R7BA 2ZV9A 3JUHA 5JGBA 3V5JA 3TWJA 3I0OA 3RI1A 4EYMA 2ZMDA 4GSBA 4BYJA 2WXVA 2IVVA 3EFWA 4FKIA 4E93A 4BCQA 2J0MB 1OPKA 4KKGA 2WO6A 3C7QA 3DBDA 4WRSA 2WEVA 1OUKA 5CWZA 4Z7HA 4Z3VA 4F9AA 1IAHA 1WFCA 5I9UA 5AA8A 3R2YA 4RFYA 4MBIA 3W2PA 3Q6WA 4NKAA 3P5KA 2QU6A 3E3BX 3KXGA 1SMHA 4R7HA 1IASA 3GEQA 3I6WA 2XYNA 3EQHA 3QQKA 2A1AB 3EQPA 4GU9A 4RPVA 3GOKA 3NLBA 3QRUA 4ZZMA 4G6LA 4HVDA 4LV5A 1M2PA 3GGFA 3GC8A 3WOWA 1Z9XA 2C5YA 3OBGA 4JQ8A 4D0WA 5JGDA 3RGFA 2IG7A 3TIZA 3C1XA 3PP0A 2DQ7X 2WPAA 5B2KA 5D41A 2R5TA 4QMPA 4FNXA 4BFMA 4EQMA 3IECA 5IKWA 3PSDA 5CF5A 3LW0A 3ALNA 4LL5A 2YWVA 4KKEA 2EVAA 4MBLA 4FNYA 4D4RA 3OC1A 5CI7A 5HOAA 4RZVA 3R63A 5J8IA 2FH9A 4FSTA 4JT3A 2FYSA 1Q99A 2ITVA 3Q96A 3EZVA 2GMXA 3LZBA 3PXRA 2UW8A 4OBQA 4TPTA 4A9TA 5IU2A 1OKWA 3MI9A 2CMWA 3CP9A 4NZWB 3V8WA 3I0QA 3OTUA 2RKUA 3HRFA 3PIZA 3DBFA 4BCGA 4CKRA 4B8MA 2ITTA 4FT7A 1JNKA 5F9EA 3PDTA 1PYEA 2E9OA 4ACCA 3MWUA 3F5UA 5AV4A 1H07A 4XV9A 4HYIA 4BIDA 2X2LA 4CTCA 3DK7A 3Q9WA 4IM3A 4NKSA 5KKRC 5CSVA 1DM2A 3TM0A 4CXAA 4I93A 3ODZX 4UMUA 2PULA 2YLEA 1ZYSA 4JBVA 2YDKA 4O21A 3SX9A 2YHVA 3ZO3A 1FBNA 2BZKB 4FKRA 1MRVA 4CFMA 3VW8A 4Z16A 4HVHA 3IW8A 3SAYA 4C37A 4C3FA 2W99B 4WSQA 3ZRLA 5EH0A 1R0EA 3JR1A 3FMEA 4FL2A 2PVKA 4AA0A 4ANLA 3OEZA 4F70A 2PVHA 4GG5A 4E8AA 5CTPA 1XH4A 2Y9QA 2IW8A 1VZOA 5DEWA 3EQBA 3TN8A 2YCQA 3TNWA 3CJFA 3ZO1A 3N4VA 3QU0A 3FBVA 2GCDA 2J7TA 3I7CA 5ANJA 3A60A 3FZPA 3QTIA 4AWIA 1GZ8A 3QZIA 2C30A 2C1AA 2UV2A 3BU3A 4AXAA 2E2BA 4Z7GA 2UZUE 4GJ3A 4KAOA 3AG9A 2W06A 2VTRA 3ZEPA 3CKXA 3KEXA 3GU7A 2XKFA 4FX3A 4KNBA 3AD6A 4EOJA 4RJ5A 3ZDIA 3ZFYA 4BN1A 1MRYA 2CGWA 3HVCA 3OW3A 3Q4CA 4RX8A 3OW4A 3QKMA 1LP4A 2J4ZA 3FY0A 5CXZA 2QOFA 4FKWA 3WIKA 3SLSA 4XJ0A 1F3MC 2XEYA 5G6VA 4O0UA 5AA9A 5BPYA 1TVOA 5CI6A 4YURA 2YEXA 5FBNC 2YCSA 4XRLA 4BZNA 1M2QA 3E5AA 1RJBA 5D7AA 3RBWA 2HW6A 4W9XA 4A9UA 4G9CA 3RAKA 1JKLA 4D0XA 2OIBA 4CQEA 1PXLA 2EWAA 4R1VA 4F63A 4J98A 5IQGA 1VYWA 2W7XA 5BVEA 3FXZA 5HVYA 1MQBA 2HZIA 2GNHA 2FVDA 5AAFA 2NPQA 5I3OA 1W84A 3FZ1A 2W5AA 3FLQA 2RL5A 4I4FA 4G3EA 2I1MA 3EN6A 4RJ4A 3ZLXA 4DFYA 1XQZA 1SYKA 5DHJA 4C59A 5HBJA 4FTKA 5HO8A 4E73A 4KS8A 4FSNA 4TT7A 2BRNA 2Z8CA 4APCA 2GS6A 4EH2A 4G5PA 4HCVA 4M0ZA 3MDYA 2P3GX 5LVNA 4DT8A 3RTPA 4QRCA 4YJNA 1GIJA 2HZ4A 3PY3A 4F9WA 5C01A 3UIUA 5A46A 3VJNA 2YFXA 5EW9A 4LI5A 4D4YA 1PKDA 2I6LA 2R3GA 3EYHA 3H30A 4HGEA 4YP8A 2X7FA 3UOJA 5KUPA 1FVTA 2R7BA 5M55A 3AT3A 5CEKA 1Y6AA 5KZIA 2ZDUA 3DZOA 4IE9A 2UUEA 1XH6A 1PW2A 4AOTA 3LQ3A 4KIKA 5E8VA 3MBLA 3NSZA 3BIZA 3P7BA 4GL9A 2WTDA 2B54A 4BCOA 2A0CX 2G15A 2JBOA 3DDQA 3BBWA 4UXQA 1JAMA 4NT4A 3MH1A 3TUDA 2PL0A 3MTFA 1OITA 4FTUA 4I0SA 1JBPE 3CTHA 5EW8A 3HLLA 4CLJA 5EYDA 3HYHA 5L2WA 3CC6A 5HKMA
chains in the Genus database with same CATH superfamily
4L01A 4YR8A 3DV3A 1K3AA 3MVMA 5LMBA 4O82A 2JIUA 1PMVA 1QPCA 5HBEA 2X9EA 4Y8DA 3DZQA 2E9PA 3TV4A 3LE6A 2VV9A 4KINA 4FJVA 3GFWA 1P5EA 4QPAA 4Y85A 1HCKA 2WFYA 1P4OA 2BFYA 2R3RA 4FIEA 5KHXA 3MW1A 3OS3A 3KKVA 1H00A 3DBQA 3QC9A 2PK9A 4FZ7A 4J52A 2GDOA 5AUWA 4NIFA 3VWAA 4QPSA 4BDHA 4MWHA 3LFQA 1UV5A 2HAKA 4GK4A 4RT7A 5TKDA 4PNIA 4B4LA 4DBXA 3H0YA 4HYSA 3BV3A 4OAUC 4B9DA 4PV0A 4RZWA 5HG8A 2J50A 4FTMA 5CU0A 5EM8A 2PUUA 5HVKA 3OVVA 4J96A 4TYIA 1PXNA 3VIDA 4CV8A 3I1AA 3DFCB 3AC3A 4FIFA 3BEGA 3C4EA 3HL7A 4F7JA 2AEGA 3QAME 3AC5A 5J7BA 2C5OA 4AOIA 2EU9A 2C1BA 3C4FA 3R7OA 3EN9A 3IDBA 3P4KA 2VN9A 2YIQA 3QWKA 4FUXA 4FTJA 5FBOA 4ASXA 4O22A 4FTNA 2WQEA 3AGLA 4JR3A 5IA5A 4CFWA 3MJ2A 2O64A 3FKOA 4KBCA 1KE8A 4U79A 1OIYA 3ID6C 3CPCA 4O7NA 4DT9A 2CLQA 3U6IA 2NP8A 4IACA 1WZYA 5HQ0A 3PE1A 5HG5A 4QQCA 5HNGA 2VX1A 1A9UA 2QODA 4I6QA 3WZUA 3GCUA 4AW1A 2OJGA 2A2AA 3GQLA 3BLAA 2RSVA 3RAHA 4CV9A 3F3ZA 3C50A 5EM7A 4I5PA 4IX4A 3DK6A 3RK7A 2WQMA 3FPQA 3S2PA 5HG7A 4P5ZA 2XNBA 4QMOA 4OTWA 5KCVA 2GQGA 5J7HA 2C47A 3VONA 4PPAA 3R8UA 2CKOA 3NFFB 1JKKA 3WYYA 4FV4A 5DYJA 2J90A 3OF0A 1LR4A 5CF8A 2XAOA 2VTQA 4BY9E 3QTZA 1PMUA 2UW3A 1OB3A 4FODA 3FDNA 4RSSA 3MY5A 3NAXA 3LQ8A 4MD9E 4DA5A 2J0KA 1UWJA 5CY3A 4AE6A 4YC3A 4E5AX 3FZSA 3KCFA 2WELA 4ASZA 5LWNA 4FTCA 2ZB1A 1WAKA 3HMIA 4P90A 3DJ6A 2Y8OA 3L8SA 3Q9XA 4GYIA 4FKPA 4H39A 4QP9A 4NYEA 3NNUA 3R7YA 2AUHA 4XBRA 3ZMMA 3OROA 2GNJA 3QTQA 5CF4A 3W55A 5D1JA 4Y83A 3IOPA 4PTEA 2WHBA 4O0YA 3GI3A 3AXWA 1H08A 2VNYA 3R01A 3ORMA 1BLXA 1BX6A 3KRWA 4XUFA 5GJFA 3ZO2A 5JQ8A 2RIOA 3ZUUA 1G8KA 2IF8A 4M8TA 3V8TA 4XX9A 3TZ9A 1JLUE 1UNLA 2EXCX 2XJ0A 5I5ZA 2Q0BA 3DBCA 4GVAA 1ZOEA 2WTVA 4NL0A 5FUTA 3KXHA 2C6KA 2FSOX 3VUHA 1SVGA 3BGPA 3TZ7A 3QKKA 2DS1A 4WBBB 4YZBA 4L42A 2YWPA 4QYGA 1O6YA 5EW3A 3R8VA 3DLSA 4BF2A 3I7BA 3LKMA 4M3QA 4MXCA 3RWPA 4WNPA 5IH5A 5B7VA 2SRCA 3DQWA 4F6SA 4C36A 3MH3A 5I3RA 2WAJA 2I0HA 4P7EA 2XS0A 4PWNA 1JSVA 1OVEA 5FXQA 4E3CA 2CKQA 4EK5A 4LM5A 5A4QA 5E92A 3T8OA 1FINA 1WBVA 4IZAA 4YLLA 1OGUA 3OFMA 4DGOA 2VTLA 4RGJA 4D9TA 4PDYA 2E9NA 1BMKA 4D2RA 5LVOA 4QYYA 4BHNA 5JRSA 3PJ2A 3D7TA 3BU5A 5CXHA 3EN4A 1B6CB 2J0LA 2XIKA 3PVBA 2RFDA 4CT1A 2BZIB 3BL7A 3VBTA 4IWOA 3W8QA 3D9VA 2IZSA 2PVYA 2VO6A 3UOHA 3OZ6A 4JOAA 2JAVA 4G17A 1W8CA 4XLVA 3LFDA 3CIKA 2BHEA 3I5ZA 1OKZA 3SXRA 1J3HA 1K9AA 4EHVA 4YLKA 4ANSA 2BDWA 4O1OA 2Y6OA 2VO3A 1T45A 3GUBA 3ZOSA 4CQGA 3S0OA 2GS7A 4O96A 4AZWA 4TYHB 4MD7E 3G15A 5HLPA 2XJ1A 1OUYA 4IZYA 2W1CA 4WNOA 3L8PA 5TOZA 3EQRA 4U0IA 1U4DA 4BDAA 5JFXA 5IUGA 5DR2A 3UZRA 3IO7A 3E8NA 3PE2A 3HZTA 2H96A 1OL6A 4FA2A 5KMOA 1B38A 4BTKA 4WT6A 2X8DA 4EC8A 1AD5A 4OTDA 3E8EA 4FTLA 5BUEA 3OWLA 3ZLYA 3EMGA 5GHVA 4EOSA 3BHUA 3QXOA 2JKKA 2FUMA 5DNRA 2HELA 2XNMA 1XBAA 4HPTE 4BDIA 5AEPA 5CU3A 1R0PA 1TKIA 2W1EA 5TF9A 1MRUA 4DTBA 3P79A 3Q4ZA 4LRMA 3EIDA 1L3RE 3R7EA 3FMHA 5K0XA 4E6DA 4BL1A 4EHZA 4IZ7A 3E3PA 3QD0A 3WF6A 4CTBA 2JD5A 4XG4A 2PUIA 2XM9A 5KNJA 3IKAA 4QMLA 1Z5MA 4R6VA 5HTBA 4RC2A 3GENA 3TDWA 3UPXA 3KN5A 3ANRA 4AN2A 4DFXE 4ERKA 4F64A 4WKQA 5C4LA 3FMJA 3PXZA 4D2WA 5IA2A 3QRIA 4HCTA 3FXWA 5KHWA 4BCNA 3VS0A 4UBAA 4BJJB 3KC3A 4HNIA 3W2OA 3NCGA 2BRHA 2QOQA 3LCTA 3ORLA 4FTIA 1BL7A 3OHTA 4G6NA 4BBEA 4JR7A 1H24A 3F2AA 5HX6A 4LGHA 1WVYA 4A9YA 2WMUA 4ZSAA 2GTNA 3ORIA 3BGZA 2V7AA 5ETAA 4CKIA 2B4SB 2PU8A 2YIWA 4R5SA 5ANKA 5DEYA 1E1VA 3TT0A 1YQJA 3WI6A 3NUPA 1ATPE 2RFNA 3NUYA 3QTRA 4DFZE 3IOKA 3QZGA 4G3CA 2OF2A 2WTKB 4AZFA 4WD5A 4CZUA 4E4NA 4YUQA 5BNJA 4GJ2A 4IHPA 3DKCA 2ITZA 3UZTA 1NT2A 2OW3A 3UO6A 3OY3A 3MA3A 4FKLA 2OICA 4LUDA 2W1HA 3VF8A 3PG3A 5E8XA 4D2SA 4DH5A 5KMNA 4BDEA 3FI2A 3TEIA 3K3JA 5BYYA 2VWVA 3C4XA 1ZMUA 2FSTX 3QQLA 5ETIA 2GNGA 4EUUA 3QXPA 3UYSA 4G3GA 2ZJWA 3FAAA 4EK6A 1G8SA 1KUTA 4O27B 2UW4A 3SRVB 4Q9SA 3ROCA 3EQFA 4X3FB 3VVHA 4M69B 5CU6A 4ZTNA 3DJ5A 4UY9A 2YZLA 3CTJA 3WF8A 2XKEA 3TDVA 3LPBA 4RFZA 2OJFE 3SGCA 5HCXA 5AUXA 4C62A 2VU3A 3MH2A 3MPTA 4DAWA 3TIYA 4GH2A 3EFKA 1FVRA 3DOGA 1JKSA 1PRYA 3C51A 2V5QA 4EC9A 3DCVA 2VWWA 3HA6A 3HV4A 3KXMA 3SOCA 4PY1A 4I6FA 3M42A 3F3VA 4IX6A 4BBFA 2RFEA 1PHKA 3HECA 3FQHA 4TYEA 1IAJA 2QHMA 3O8UA 3GU5A 4QMQA 1JSTA 3QRKA 4S30A 4TYGA 1M14A 2LGCA 5FP5A 3PSCA 4S31A 4D2VA 4AG8A 5LXMA 5HHWA 2X8EA 4CVAA 3FZOA 3QA0A 3D0EA 2PMLX 5E8UA 4ZJVA 5EDQA 4D5HA 2XK8A 4FT3A 1YHSA 4IX3A 4GMYA 2YM8A 2PZ5A 4GT3A 5LJJA 3BQCA 2X0OA 4KBAA 2WTKC 4RBLA 1R3CA 4JBQA 3AKLA 3VUDA 2NYAA 3QGWA 3CD3A 4EH7A 5DGZA 4AGWA 1CSNA 5BQ0A 5CASA 3F2RA 5CZIA 4O81A 4DGMA 4W9WA 4HYUA 5L8KA 5CENA 4CCBA 3KCKA 4KKHA 1KE9A 2YERA 4E7WA 2G2FA 5ITAA 1FPUA 4JDKA 2UZNA 4W8EA 3L9NA 5CSPA 2QLQA 3OEFX 3NMUF 3KB7A 3N9XA 2OGVA 3A7JA 3FMKA 3WE4A 4ANBA 5DT4A 2W5BA 2WD1A 2YISA 3EJ1A 4BTMA 4I0RA 5K3YA 2CGXA 3KF7A 3OCTA 2C0TA 2VD5A 2CGVA 1UA2A 4X3FC 5AR7A 4A4XA 5BMSA 4ZJIA 1ZXEA 3KREA 4M15A 4QEBA 4IB0A 2KTYA 2EB3A 3R22A 4FMQA 1JKTA 5A4TA 5CANA 3LVPA 3BLQA 4LUEA 2CLXA 3FQSA 2W4OA 1W0XC 2IVSA 4AS0A 2C69A 4R1YA 2C6EA 4IXPA 4U3YA 4XP3A 2R0UA 4J99A 4ANOA 4MXAA 5AFVA 1KE5A 4UYAA 1IA9A 3G9NA 1Q8ZA 2BFXA 3F5PA 4EBVA 4K18A 4USDA 2G01A 4C61A 5BX0A 2VX3A 3LLTA 2WMRA 2V7OA 2GU8A 2XBJA 4U81A 5ANIA 2GHGA 2WEIA 5HIDA 4EH4A 3ML1A 3CBLA 3H4JA 3Q52A 4IX5A 5ANEA 3SXFA 3VRYA 2XNOA 2O63A 4BZDA 2ITQA 4C4EA 3LM5A 5AP4A 5IQHA 3OCGA 4KD1A 4K8AA 3WILA 3HUBA 1M2RA 4GRBA 4ZZOA 4AFEA 4YZNA 4CEGA 4EH8A 2BTRA 3LCKA 3R9HA 3KGAA 2B55A 2AC3A 3CY3A 5AX3A 3S3IA 1V0OA 2B9IA 4U6RA 5CEPA 5E1EA 3VBXA 1J1CA 3EOCA 4FEXA 5M08A 1OPLA 5LVPA 1BL6A 3L1SA 5HE0A 3JVRA 2QQ7A 3A7FA 3O0GA 4ZIMA 4BDKA 5JQ5A 4BCPA 2WOUA 3DU8A 5KMKA 2OZAB 2ZVAA 5EM6A 4C33A 5I9YA 4U43A 5HEZA 3LCDA 4O7YA 1YDRE 4DFNA 3DB8A 5HCYA 2OBJA 3LHJA 3FKNA 3U4UA 5HNBA 4O7SA 2X6EA 2RG6A 2XK7A 3WE8A 5FEEA 3LXKA 2ZDTA 2ZV2A 4QYEA 1KE7A 2BMCA 5HESA 2Z2WA 3LXPA 5FG8A 3O71A 1IA8A 4MF1A 4M12A 4DITA 1MUOA 3O8PA 5DN3A 3GNIB 2C6MA 4OAVB 3ZONA 1KOBA 4EBWA 2B0QA 4JX3A 4BBMA 4B99A 4CMTA 4PPBA 4OBOA 3VS6A 4N70A 4F9BA 3KN6A 3UNKA 3W32A 5AUVA 4GKIA 5IQIA 2GHLA 3R04A 3Q2MA 1LEZA 3EQIA 4I94A 4YJRA 2CNVA 3W0MA 2WTIA 3NR9A 2PWLA 4QP1A 1B39A 5HU9A 3VUIA 4Y5HA 3FUPA 3QTWA 1P2AA 2QKRA 4U9AA 5FWKK 4QDEA 3V6RA 3IW5A 3U6HA 3D5XA 2KULA 2AYPA 4RRVA 4UZHA 4O0VA 4F1MA 4AUAA 3W33A 4F6WA 3TKUA 4Y46A 4BCKA 1MP8A 3GCQA 2PVFA 2UZLA 4KIOA 3BHHA 3RM7A 1U54B 2YCRA 2YM5A 3EQCA 1ST0A 4JL9A 4G16A 2BTSA 3OUNB 4FSYA 4H1MA 4N6ZA 3LFEA 2HENA 4QPMA 3OWPA 4K1BA 3VNTA 5JFSA 3T3UA 3JS2A 3FYKX 3UQFA 4DLIA 3CXWA 1PKGA 4IB5A 4YJOA 4YHJA 4JQ7A 4L3PA 3QZFA 4EONA 2VAGA 3DLZA 3OG7A 3ATTA 4PL5A 2R7IA 1ZMWA 4DHIB 2IVUA 4U3ZA 3FLSA 4O2PA 2B1PA 5DLSA 4BWPA 3P0MA 4S2ZA 3VHKA 4QP4A 1OI9A 4BKZA 3O96A 2DWBA 4FV0A 4XG6A 3UG2A 3ZEWA 4BCHA 2V0DA 4QMZA 4QOXA 2H8HA 3WARA 3UC3A 1H1RA 3COMA 3O50A 3W0RA 1Y8GA 3B2TA 4IWDA 3TMOA 1Q3WA 1XKKA 4KIKB 4AXFA 1XBBA 3QGYA 1GJOA 4IDTA 4E5BA 3NWWA 3U9CA 3D7ZA 4YBJA 4GFOA 4FC0A 3H9FA 4L52A 3AT2A 4ZTLA 4GVJA 2O8YA 4FSMA 4CYIA 3WF5A 4FSZA 4D5KA 3RM6A 4CMUA 3COIA 3KVXA 3MVLA 4FRFA 4LOOA 3MY0A 4NFMA 3R7UA 4ACGA 3ORTA 1OL2A 4FKSA 3DPKA 1JVPP 1YXVA 2J51A 3IONA 3KMWA 3R7GA 4RA4A 2IZTA 5A14A 2WQNA 3ORNA 4EWQA 1QPDA 1T46A 2OH4A 5AP1A 4IWPA 3A4PA 3UDSA 2XBAA 5A4CA 1RDQE 1TQMA 3F9NA 3GOPA 3BELA 1YOMA 2ONLC 3DAJA 3E7OA 4RIYB 3BQRA 5D10A 4RWKA 5IEYA 3HMNA 4FKJA 4ASDA 3BRBA 1TZDA 1GIIA 3ZZEA 3ZM9A 3BHTA 4ACDA 3IW4A 3OCSA 5AWMA 3ZO4A 4QMNA 4HJOA 2YA9A 2PVJA 3NIEA 3DNDA 5DRBA 3BX5A 4DN5A 5IH6A 4FE2A 3RHXA 2OK1A 3MS9A 4G5JA 3FY2A 4ONAA 4TWCA 3R1QA 5CSXA 4TL0A 3DDPA 5IA1A 1OL1A 3Q9ZA 3F3UA 3RCDA 3TJDA 3UP7A 4AX8A 3MFUA 3W0OA 2BRMA 4G3DA 4FG8A 3OOMA 2JFLA 1H1QA 1OKVA 2YAKA 3TNQB 3AD4A 3ELJA 3WIGA 5CALA 4RJ7A 2QI8A 3DA6A 3LFNA 3U8WA 1OL5A 1CMKE 4F9YA 1SM2A 3QLGA 5CAUA 4QTEA 4O83A 3O8TA 2A98A 4YNEA 4Y95A 4ANNA 2BROA 2ZV7A 4BDGA 3NYOA 4QMWA 3WZJA 3NNWA 2XMYA 4PL3A 3S1HA 4RG0A 4JIKA 3Q32A 5D7VA 5DVRA 4WOVA 1Q5KA 1U59A 1QMZA 5AUTA 3CR0A 3CGOA 3OCBA 3VRZA 3Q9YA 4AZVA 2BRBA 3HMPA 3O51A 2R3NA 5F94A 4AFJA 2C3KA 2ESMA 2Q0NA 2XUUA 4XOZA 2RGPA 3DXPA 5HTCA 1H1PA 3HP2A 3ZLSA 4FOBA 2PE0A 3CS9A 5CVHA 3DS6A 2Z7QA 3HV6A 3HKOA 1UU3A 2X2KA 5CYIA 5I9XA 3UBDA 4FVQA 3G2FA 4DHJA 1Q4LA 2PE1A 4U41A 2O65A 4O0WA 1R39A 2YN8A 3RKBA 3LCSA 5E8TA 5AM6A 4RIWA 1W83A 2QU5A 3C4CA 5E8SA 2W9FB 2ETMA 2PHKA 2W4JA 3EZRA 3VF9A 4E6QA 5C26A 2ITPA 1YXUA 4ITJA 3DTCA 3F61A 5LOHA 3JY9A 4L46A 3UIXA 4LFIA 4ZSGA 1PMEA 3RAIA 2WB8A 4F1TA 5L8LA 4FKTA 4IFGA 4X3JA 3G6HA 4J8MA 3MIAA 1KOAA 4U44A 3W1FA 2C5NA 3VS3A 2F7XE 3ENHA 1MQ4A 3POOA 4NTTA 4V0GA 3S00A 5HTIA 2C6LA 2XCKA 3QKLA 4DH7A 3GP0A 4RQKA 2ZMCA 3TZ8A 1XMLA 4OTFA 4YPSA 5FM2A 5JK3A 3KVWA 3NVMB 4OW8A 4C35A 3KULB 3GT8A 4TY1A 4U42A 5M09A 4TTHB 2RF9A 4LGGA 3PSBA 2GS2A 4RIXB 3F5GA 3P86A 3QCSA 3UDBA 2WOTA 3BE9A 1UVRA 4JIAA 4JI9A 5CLPA 3I4BA 5BVKA 4RVLA 3EN7A 2VWBA 3OBJA 2WGJA 2XKCA 4OBPA 3ODYX 5IQCA 4AP7A 1DI8A 4BHZA 1OKYA 2G2IA 4IVBA 3SW4A 3G5DA 4D28A 4GIHA 2UZEA 3E62A 4ASEA 2A19B 5AUZA 3HAVA 1OECA 4FT5A 2PMOX 4GEOA 4GT4A 4GT5A 3E64A 1IRKA 3ZZWA 4IBMA 3QBNA 4ZJJA 2Z7RA 1QCFA 3PY0A 2LAVA 1O9UA 2QOHA 4RWLA 5FP6A 2C0OA 4FNWA 5HICA 3W8LA 1WBWA 2UW0A 5JRQA 4E1ZA 2OU7A 4GG7A 4YJPA 5EI6A 1JQHA 4IJ9A 2XKDA 4BRXA 4FVPA 4ITHA 2WQOA 4JDHA 5HLWA 3QC4A 4FOCA 2J0IA 4C4JA 4PMMA 4RLKA 5FM3A 5GIPE 2CSNA 3KRXA 4CFVA 3PPKA 4V05A 5J1VA 1LEWA 3LOKA 2I40A 3VO3A 3HGKA 2O5KA 2PE2A 4FGBA 4MX9A 5IQEA 3NVKI 5FTGA 1NA7A 2X2MA 1UNGA 4TNDA 5CEOA 4J8NA 3R02A 4ALWA 1OPJA 1VEBA 1H1SA 3MESA 4O7LA 5CT0A 4BDJA 4DH3A 4G3FA 2YM4A 3R1SA 2R3HA 3Q04A 3SA0A 4DCEA 4H05A 1CKIA 1M17A 3WBLA 5TO8A 3HRCA 4R5YA 3LMHA 4QD6A 3UMWA 3QQGA 4FKUA 5IEVA 4BCFA 1REJA 4I20A 2UVZA 4WG4A 4MD8E 4FSRA 4E4XA 3M11A 4QTBA 4MWIA 5J1WA 3NYXA 1H4LA 2QOIA 4BB4A 2W1DA 1FVVA 4F0IA 2W9ZB 3CCNA 1YXXA 2NNWB 3B8QA 4K33A 4RQVA 2CKEA 5F4NA 3FI4A 5A4LA 4TWPA 5FGKA 5M4CA 3EKNA 3F6XA 3G90X 4IH8A 1H26A 4K77A 5B0XA 3KRJA 2VO0A 4X2GA 4EH3A 4UB7A 3JYAA 2W1GA 1H28A 2JDVA 2JAMA 3F2NA 4MAOA 4O0XA 4BDDA 3ENMA 1DAWA 3IGGA 4CFUA 4IAZA 3RWQA 1DAYA 3NIZA 3F7ZA 3W2SA 1J7IA 1BUHA 3TUBA 2YM6A 3EFLA 1BYGA 5K0KA 1UWHA 4ZY5A 3WZDA 3LAUA 1KV1A 2JIIA 2VO7A 3F66A 5H9BA 3TI1A 2J6MA 2XK9A 4L6QA 5DR9A 2IJMA 3PA5A 3CGFA 3ZTXA 3C13A 5M07A 3ALOA 3IDCA 5I9ZA 4YJVA 4FKQA 3VHEA 4EOLA 1K2PA 3GU6A 1ZYJA 5CNOA 4S34A 2VTMA 3TXOA 2ZOQA 5H8EA 2ETKA 5AAGA 1U5RA 4JQEA 3NUNA 3IPHA 2C68A 3BZ3A 3UP2A 2HCKA 4XG2A 5JKGA 3FSKA 4YNOA 5A6OA 4KWPA 4R77A 4OTHA 2YJRA 3H9RA 3QYZA 5EYKA 5GNKA 1H1WA 5AIRA 3V3VA 3FL5A 4MQ2A 5AR8A 3V5QA 3ZDUA 4MHAA 4ENYA 5FRIA 3R00A 3Q60A 3F69A 3DTWA 3OY1A 2IW6A 5ETFA 3E87A 4B0GA 4P2KA 5AV0A 4LGDA 4ZTSA 2GNIA 3FJQE 3KFAA 4V04A 2XRWA 4XRJA 4HGSA 4EOKA 2VTIA 4ACMA 4LV7A 5IPJA 2JGZA 3E63A 4ZZNA 2WTCA 3Q5ZA 4L3JA 4EQUA 3ZUTA 4NK9A 2XK4A 2PMNX 4FEUA 3LCOA 3QQHA 4XG3A 3O7LD 4N0SA 3NCZA 3PJCA 4AE9A 2CCIA 3BCEA 3CJGA 1H01A 4I5HA 4X6RA 3RAWA 2ERKA 4J7BA 1J1BA 3TKIA 3NX8A 3ZSIA 4DGLC 2B9FA 4FR4A 4FVRA 4AW0A 3ZYAA 4EZ3A 4HPUE 3DB6A 2BDJA 2XIZA 2XANA 5HE1A 3ULZA 4BWKA 4LG4A 3Q4TA 3UQCA 2OJIA 3DGKA 1ZY4A 4WG5A 5CT7A 1V1KA 4L7FA 3BYVA 4CNHA 4WNKA 2VWYA 5DPVA 1KWPA 4ZK5A 2WMXA 1XWSA 4EH9A 1FMOE 4NCTC 2QOKA 4MQ1A 4YTHA 3MYGA 4YJSA 4TXCA 2OF4A 3ZHPC 5KMJA 4A07A 4IVDA 4MXOA 4DHZA 2FO0A 4R3PA 3RMFA 2F2UA 4F0FA 5HGIA 4DG2E 3KIOC 3EQGA 5D9HA 3VS4A 3F3TA 4BTFA 1FQ1B 3A7HA 5EHYA 2UZTA 4QTDA 5K9IA 4O4DA 4DEHA 2WMQA 4I24A 3CPBA 2UW9A 4K9YA 4TWNA 5BUIA 5FQDC 4FK3A 3R7IA 4EOPA 4CSVA 4M68A 5IMXA 5J9YA 4W8DA 3A2CA 5IUIA 4LQMA 3MIYA 4NEUA 5E8YA 3ORXA 3PIYA 4FF8A 3ZUVA 2QO7A 4BGQA 2C6TA 3HA8A 3TV6A 4GW8A 2PVRA 3P78A 3NDMA 3KK9A 3PG1A 3A99A 2JDTA 2YCFA 3D4QA 4FG9A 3ORPA 1Q8TA 2ITYA 2X0GA 4FZ6A 4N6YA 3HDNA 4JX7A 4C4IA 2W17A 2IVTA 4JXFA 2OZOA 2BR1A 4L3LA 4DEBA 5KX8A 3II5A 4UMPA 4S33A 2VZ6A 2C5XA 4IAKA 5CZHA 3EWHA 4H3BA 3GFEA 1W7HA 2QOCA 2WMAA 4DYMA 4IZ5A 4KIQA 4O7TA 1S9JA 2ETRA 2FB8A 2GFCA 3ERKA 1E9HA 4AACA 4AZTA 4GUBA 3QUDA 4QP6A 4ZEGA 4U80A 3Q53A 4YU2A 1SVEA 3LFAA 2NRUA 3VULA 4EJ7A 3H0ZA 3R73A 2GFSA 2ITNA 3KK8A 3PWDA 4XV1A 4HW7A 5FTOA 4DBNA 2OH0E 3PPJA 2EUFB 4C8BA 3MTLA 4NM0A 3R7VA 3ATSA 4EQCA 2ZV8A 3DJ7A 4C4FA 4II5A 3NW5A 4XG7A 3UODA 2GQSA 4O0RA 4FV3A 3R28A 2UZDA 2OSCA 4FL3A 4ZY6A 4YMJA 4LYNA 5CSWA 5HVJA 2QOOA 2C6OA 2WMVA 3W0QA 4JDJA 2WMWA 5F20A 1Q61A 4FSWA 1PXOA 4TRLA 4O86A 4FSUA 3VBYA 4ZXTA 4FV9A 5D11A 5AV3A 4BCJA 5AR2A 3RHKA 3L9MA 2CNUA 2DUVA 2VTTA 3R1NA 2HOGA 4YO4A 3V51A 3QFVA 2ACXA 3G51A 4RIOA 3EHAA 4L67A 3VC4A 4JJRA 2F7ZE 3F3WA 3FLWA 1KV2A 4W4YA 4Z9LA 2CN5A 4NTSA 4XYFA 2BKKA 1WBNA 4AOJA 1GZNA 5LCJA 3VUMA 4EEVA 4CFXA 1F0QA 4BDBA 4I0TA 5DOSA 4R7IA 3UC4A 4EOIA 5GIOE 1OGYA 2GSFA 3TTIA 4APPA 4D58A 2R3LA 1P4FA 2I0VA 1FOTA 3GCVA 4TW9A 5BVNA 1REKA 4CZTA 4FYNA 4UYNA 1WBOA 2YM3A 3EYGA 4U45A 4PDOA 5LCKA 4C3RA 4XV2A 4NM3A 4OTQA 3DK3A 3DNEA 4G1WA 1P14A 3RPYA 2UW6A 2XB7A 2JKQA 4JS8A 4BTJA 2XZSA 4GUEA 4BWXA 4EK8A 4IJPA 3GQIA 2IWIA 2NRYA 2ZM1A 5AP0A 3POZA 1YWRA 4BI2A 4LRKA 4JVGA 5M56A 4PX6A 5DWRA 5EKNA 2IO6A 2AQXA 1WVXA 2ZB0A 3NGAA 4A4LA 2ITOA 3QQUA 4J71A 4ZSLA 5LQFA 2PY3A 3U55A 4TN6A 2QD9A 2Z7LA 3KA0A 4YTFA 1CKJA 4Q5HA 4ZTRA 4FV5A 2ITUA 2WU6A 3W2RA 4ENXA 3C4WA 2G9XA 3R6XA 5IF1A 3FMDA 4AXDA 2WZJA 3ZBXA 3OXTA 3WZEA 3V5PA 3A62A 3GC7A 1GOLA 3QCYA 3SV0A 3MFRA 3R9DA 5BUJA 2OLCA 4KRDA 3PXKA 2Y0AA 4P5QA 5M53A 3SXSA 5E8WA 5IZFA 1NW1A 3QD2B 5EDRA 1XBCA 3L9PA 5HG9A 5CVFA 3VW6A 2I0YA 4C34A 4R78A 3HUCA 4JLCA 3VS1A 2XA4A 3ET7A 2W1FA 4WUNA 5CAVA 4JRNA 3PA3A 3CQWA 4I5MA 5C8MA 3TNPC 4DTKA 1W98A 4QMVA 1YDSE 2VTOA 4I3ZA 4O7RA 1UU9A 2BAKA 4AT3A 5HO7A 3CEKA 3GVUA 4O0TA 5FEDA 4RLLA 3H9OA 3QYWA 5GZ9A 4RWJA 3WYXA 4RWIA 4D9UA 2QURA 2Y4IB 3BPRA 3CQUA 4RX9A 4QMUA 3FZRA 3U6JA 2HZ0A 4L8MA 2C4GA 5I9WA 4IMYA 3BEAA 3MB6A 3O7LB 5KMLA 4K0YA 4MUQA 2YDIA 3HMMA 3VQHA 5IG1A 4RVKA 3HMOA 2QCSA 4NJ3A 5GZAA 1H27A 2QVSE 4PQNA 5H8GA 1Q41A 5C9CA 2EXMA 4HVIA 3CQEA 4I1ZA 4IVAA