3OCBA

Akt1 kinase domain with pyrrolopyrimidine inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
335
structure length
315
Chain Sequence
RVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMRPHFPQFDYSASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords v-akt murine thymoma viral oncogene homolog 1 (AKT1)
publication title Discovery of pyrrolopyrimidine inhibitors of Akt.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 315
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ocbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ocbA01
3PVUA 1K3AA 4MF1A 3VNTA 4MXOA 3FLQA 2XYUA 2DQ7X 3KN5A 4DEDA 2ZB1A 4QMVA 3R7IA 5IQBA 3ZO4A 2B54A 4ITHA 4KD1A 3TKUA 4WT6A 3LMIA 2P0CA 2ZVAA 4GS6A 2BRHA 3MFSA 5EW9A 2YCFA 3D7TB 2E9UA 3K5VA 3QZFA 4L43A 1BI8A 5E8ZA 5AFVA 4FTQA 4KIPA 3VHEA 4DFNA 4EL9A 2UZNA 5CF6A 1P4FA 3KXNA 4FVRA 3QQGA 3VVHA 2PE0A 2QOLA 4IB1A 3RTPA 1A06A 2EU9A 4K77A 4MKCA 4QYFA 3QRKA 1IR3A 1IASA 4AE6A 1GIHA 4GVJA 3O71A 3MBLA 3ZFXA 5J1VA 4JJRA 1KUTA 3UZRA 5GINE 1CDKA 3OUKA 4TXCA 1PRYA 3NVKI 3NUUA 5DYJA 1J1CA 2GHGA 4AP7A 4S30A 3AT4A 3F6XA 4MXZA 2QG7A 2A19B 3DNEA 4GU6A 2ONLA 2EWAA 2WTJA 5CS6A 3GFWA 3KULA 1J7IA 3ODYX 4WUNA 2B9JA 4F0IA 5LCJA 4J8MA 3DB8A 2XMYA 3FKLA 4X7QA 4F99A 4IHPA 1JKLA 3GQLA 3R73A 4YJRA 4YZDA 2YCQA 3R04A 5AR7A 3TNQB 3ULIA 4AZTA 4Q9ZA 4UALA 4R7HA 3V8WA 5EYDA 4C0TA 4FTMA 4TY1A 3HDNA 3HGKA 4FT3A 4M67A 1UKHA 1YQJA 5GJGA 1B39A 3LAUA 4EWHA 4MF0A 5LWMA 2VTOA 2UZBA 4IANA 4O84A 2X8IA 1GZNA 3R30A 5BVFA 1PKGA 1XH6A 2QR7A 4AX8A 3EFLA 5IQAA 1E1XA 4QPAA 3OWPA 4MQ2A 3T3VA 5CANA 2IO6A 3IDBA 3K54A 4WNMA 3WYXA 4PV0A 3JY9A 3EYGA 1J1BA 4MXXA 4IVBA 5A6OA 1SNUA 1YI4A 5EKNA 4EH8A 2QOCA 2WQOA 1Q8YA 4JQ8A 4R7IA 5DT3A 5EHOA 3DTWA 4MYGA 3R8VA 4BZDA 5D41A 4FA2A 5BYLA 5AEPA 4E5AX 3UPZA 4ZMEA 3R7EA 4Q5HA 3FMLA 5IQGA 4FX3A 1SYKA 4EH2A 5IG1A 2XIKA 5L6OA 1SM2A 5KMKA 5AWMA 4RC2A 4P5QA 3BWFA 1H27A 5LVNA 2Y4IC 3GCUA 3QCSA 3U6JA 2V62A 2WGJA 3G5DA 3KEXA 3H9FA 3IW7A 4GL9A 4BGHA 5LVPA 4XYFA 4IJPA 4EOMA 3M42A 3DBEA 3GU7A 4QMSA 1NVRA 2BRGA 1ZYLA 4MQ1A 2VWZA 2HWOA 3KK9A 3RP9A 3QUDA 5TT7A 1ZZ2A 3OFMA 5AV4A 4KIOA 3QALE 3DK3A 3ZHPC 4I0TA 4ALUA 2CMWA 3D0EA 3E8CA 4I6FA 5LMAA 3SV0A 5GJFA 1URCA 5AP2A 1IAHA 5KO1A 2QOFA 4NM3A 3U9CA 4FE2A 4J7BA 3A2CA 1ND4A 1MQBA 4LMNA 2BUJA 3EQIA 4C8BA 5M56A 1YDSE 1GIIA 2OH0E 3I6WA 5CNOA 5AAFA 1Q8ZA 3S4QA 4E4LA 5EQYA 5C27A 5CI6A 1KV2A 5A46A 5F20A 2HZNA 1YDTE 1BKXA 2P4IA 4EYJA 2G01A 4GRBA 3FBVA 1B38A 3LIJA 4RJ4A 5DN3A 3G6HA 3CKWA 4HVHA 5CEOA 4MXYA 2JDTA 4PPAA 5DLSA 5J9LA 1ZYDA 2Z2WA 3MH2A 1Q41A 3PIYA 4FL2A 4X6QC 4QMNA 1JPAA 5LVMA 2R3FA 4BDFA 5IH5A 4KIKB 3RAKA 1V0PA 3QX4A 3GNIB 4R78A 2PZPA 1U5RA 3FI3A 4E4MA 3V8TA 4UMRA 4ASZA 5J8IA 5KMLA 2W1IA 4L67A 4ANOA 2WTCA 3MTLA 4YHFA 5D12A 4QMZA 2OZOA 2UVZA 3S95A 1DI8A 4ASXA 4C2WA 4RJ5A 2HENA 4CV8A 2PVJA 4C62A 3UYTA 5HLWA 4XBRA 2GNFA 3E8DA 3MFUA 3RNIA 3SD0A 3ZLWA 4JNWA 1ZLTA 4F9AA 3FLSA 4ITJA 4YGAA 5AP1A 3ITZA 3UG1A 4IM0A 4B7TA 4CCUA 1H26A 4AN2A 2WU6A 5IQCA 4JRVA 5K3YA 2F7EE 1P4OA 3SX9A 1H4LA 4BZOA 2XNMA 4PNKA 3OF0A 4FG7A 4YJOA 5AP0A 3ALOA 3ROCA 1KV1A 4DG0E 4BC6A 4DTBA 4CG8A 2WMAA 3H0ZA 2DWBA 2W4OA 3BWJA 4PF4A 5AIKA 3JS2A 4CT2A 3ORLA 3TKIA 1H08A 3TNHA 3MH3A 4B8MA 1FVRA 1OIQA 3FXZA 4AOJA 1YHSA 1OL6A 2A0CX 2JBPA 3QTUA 3LXKA 4G3DA 4BIEA 1MP8A 3RPVA 3QXOA 3KN6A 2ZMCA 4FKWA 3UIMA 5M44A 3KU2A 4L00A 4O38A 4JBQA 5BNJA 3UOHA 3O8PA 4XOYA 3K2LA 3L9NA 5JH6A 3MYGA 4CD0A 3EKNA 1STCE 4DLJA 3E63A 3OEFX 5B2LA 4HGTA 3FI4A 4C2VA 3E88A 4DGMA 2FSMX 3FAAA 1OUKA 3F61A 3QKKA 4OAUC 4ZTNA 3LFSA 2XM9A 2QLUA 5HCYA 3PPZA 4IACA 1UA2A 2OIBA 2XEZA 1PXKA 2R5TA 4RA5A 2OJ9A 4H58A 4DEGA 4ZAUA 2HZ4A 2CSNA 3QLGA 5CU2A 4MH7A 4Y5QA 3RWPA 4CLJA 3MA6A 4WNKA 3R22A 4RWJA 3UNKA 1M2QA 1NVSA 2VTTA 4WNPA 4FEWA 4YLLA 2JFLA 3OXZA 2F57A 3E87A 3R7OA 4B9DA 4BWKA 4USEA 1JQHA 4GFGA 3V5WA 2UZDA 5JFWA 3HECA 4P90A 1NVQA 1FOTA 3DBDA 4G3EA 5FTOA 1PHKA 1W7HA 4XG9A 4YJNA 3ZUTA 4BCMA 4AGCA 3FJQE 2YEXA 4NM7A 4D28A 2GQSA 2F2CB 3NMUF 4DFLA 5CT7A 1PYEA 3IKAA 4UN0C 4GKHA 2YLEA 3L9MA 3KKVA 4J96A 4FF8A 3FXWA 2W7XA 2VWUA 3DY7A 4O6LA 2PVKA 4R3CA 3ZH8A 4ZLZA 2W1HA 3SDJA 4JBPA 2Z7SA 4BDGA 4BCHA 4RFMA 4CFXA 4EHVA 5AAEA 4I1ZA 5T6KA 1OPJA 2UZOA 5HQ0A 2H8HA 4X2JA 3LFBA 3EN9A 2Y4PA 3PXFA 4Y73A 2ZM1A 2YWPA 4QNAA 5CSVA 4D2RA 3ZO2A 5FTGA 4FZ7A 4OR5A 3O17A 3PVGA 2VNWA 3TACA 4CRLA 3GEQA 3NLBA 1YHVA 2E9VA 1HCKA 4Q5EA 3FZPA 3OEZA 4F9WA 5GIPE 1UU8A 2R3RA 5L2WA 2YDJA 4KIQA 4BCOA 4IEBA 2BAQA 1FGIA 5IISA 4IZ5A 2W4JA 2C4GA 4QMUA 4JR7A 1WVYA 4BRXA 3EN5A 2W99B 4IADA 4L7FA 3BPRA 4EOPA 3WF6A 3KA0A 2VO6A 4YHTA 3F2NA 3QC4A 4BCJA 4JT3A 1PXPA 3GC9A 3UZPA 4ANQA 1O6YA 2C6KA 4MWHA 4GSBA 3RKBA 3CXWA 2HWPA 1G8SA 1U54A 1WBNA 2WU7A 4U41A 5IF1A 3L8XA 1JSTA 3TUBA 3H9RA 3KXGA 3RPSA 3KRLA 4DFYA 2JKKA 5LXMA 1ZMWA 3HRFA 4GVAA 3Q4ZA 4KAOA 4A06A 3QC9A 4A9SA 1A9UA 3LMHA 1DS5A 2ETKA 2OFVA 2VTJA 2WMQA 3AC8A 3OY3A 4GT3A 4HGLA 4PPBA 3DB6A 4F9CA 4MD9E 2YM8A 3BLQA 3FMMA 5HU3A 2A4LA 2PE2A 2J0LA 4NH1A 4EBWA 4XEYA 3IOPA 3WF8A 3VAPA 2E9PA 4M69A 2F2UA 4G1WA 2QG5A 1I09A 2UVYA 3U4WA 1B6CB 3OBGA 4U44A 3UZTA 5ICPA 3A61A 1S9JA 3NUNA 4APCA 2Y0AA 2GNJA 4K2RA 2VAGA 3V5JA 4C35A 4FIFA 1OL7A 3LJ2A 5M55A 1LP4A 4O0YA 3AC2A 5TOZA 4RIWA 4O1PA 4D2PA 1OKWA 3BU6A 5KHXA 3F66A 3PSBA 3FSKA 4RBLA 1XH7A 4U7ZA 4C02A 5F94A 4PTCA 2FUMA 4D58A 3C5UA 4IAYA 4ORKA 4XP3A 4NWMA 3LFDA 5E92A 3C4CA 1I44A 3V01A 4EQMA 4W4XA 4ACHA 4CV9A 4Z7GA 2W17A 4AFEA 2CNVA 5HO6A 4ERWA 5M08A 3R9NA 4RT7A 2R0IA 3Q9ZA 3R28A 4D4SA 5E8YA 5J87A 4YTHA 4G6OA 3C4XA 4DEEA 1V1KA 3BHTA 4U43A 1RDQE 4QQTA 1GAGA 2JKMA 3NX8A 3OOGA 5DT0A 3CQUA 1H28A 3VS2A 2FA2A 5H8EA 3L1SA 4FSQA 2CNQA 4JQ7A 4FEVA 4Y85A 3MI9A 3WF9A 4F7LA 4DT8A 2BALA 1JWHA 3FWQA 4DGOA 3ORNA 3PPJA 3FMHA 4XLVA 3HA6A 5EHLA 4HYUA 2IN6A 3QCYA 1ZY4A 3P86A 4C58A 3PE1A 5DHJA 4D0XA 5IEVA 4FV7A 4TT7A 3VS6A 4DG3E 5CTPA 1YW2A 4DLIA 2IPXA 4PNIA 3EZRA 3D14A 4OTQA 4YHJA 2WMWA 4J53A 4XG4A 1NY3A 2XK9A 3RPOA 3A99A 2QLQA 3UIXA 4RIYA 2RFEA 2WMRA 3GCVA 4BCFA 4ENYA 1IG1A 3E3BX 1JKTA 3FL5A 5EDPA 2OO8X 3VF9A 3SGCA 2VTLA 4OTPA 3UO5A 2P55A 1M17A 4IAZA 3KMMA 4IFCA 2WQEA 4I4EA 4CTCA 1U46A 1XQZA 1W0XC 2X0GA 1REKA 2VNYA 4O0UA 5EM8A 3RJCA 4U79A 5AADA 3FC2A 4FKJA 3OS3A 3FY2A 3AT3A 3JXWA 3LQ3A 3P5KA 4I92A 5BX0A 4QQ5A 2NRUA 3FLZA 3NAYA 1WVWA 4A9TA 3EKKA 5KMOA 2VWXA 3TG1A 5IZFA 1ZRZA 2C0OA 3MS9A 2UZEA 4HVIA 3KVWA 3QKMA 4GYIA 4AE9A 1UNGA 4HW7A 5L2QA 4FTIA 3QZIA 4RC3A 3UDBA 5C03A 5IUIA 1TQMA 4QOXA 2FB8A 1FGKA 5FQDC 4D1XA 1H0VA 1H07A 3ZEWA 5IQIA 3RINA 3NZ0A 2BILB 4G17A 3WOWA 4NZWB 4C3PA 5HIEA 3MA3A 4BDBA 2UZWE 2V55A 1LUFA 5EG3A 2BHHA 5AUZA 2CGUA 3UE4A 3E8NA 4DYMA 2ITXA 5JGBA 4ZK5A 3RI1A 2J5FA 2XNPA 2OBJA 3BZ3A 4OBPA 4KINA 3F82A 3JY0A 3HRCA 4MNEA 2IJMA 4HGEA 1P5EA 3LFQA 3DKFA 2WXVA 4MBJA 5LVLA 1Q3DA 3PXQA 5CVGA 4DCAA 4H36A 4YJVA 3QQFA 2PMIA 3NW7A 4DGNA 2W5HA 4QMMA 4E4NA 4EKLA 3ZC6A 4C4EA 2XRUA 3TCPA 1J7LA 2JAVA 2WQMA 3R00A 4TN6A 4CRSA 2C6MA 5ANDA 5EM5A 3WIGA 2OG8A 3ENHA 5HI2A 5L2IA 2J90A 3P08A 4DBNA 4O96A 5EQPA 1FINA 3U54A 2CCIA 3VS1A 2J7TA 4IVAA 5B2KA 3PG3A 1OECA 4BDCA 1E9HA 2YIYA 2WQNA 2YZLA 4FEQA 4EH9A 3KK8A 4N0SA 3V5TA 4A4XA 3PTGA 2XJ0A 3BQCA 4MVFA 2XKDA 3PJCA 3T9IA 3GU8A 3ZFMA 3KXMA 3FLYA 4XG7A 2VZ6A 3LCOA 4AS0A 2EXCX 2BDFA 4LGDA 5CQUA 3ZFYA 2WFYA 4L01A 4NCTC 3PZHA 3IDCA 4L3PA 3U9NA 5I3RA 3P7CA 1Z5MA 3ZDUA 5DE2A 1H0WA 4ZS4A 3C0IA 4CMUA 4F70A 3ROYA 3GCPA 4JDKA 1ERKA 2GFSA 2PTKA 1MRVA 3BCEA 3BE9A 3CR0A 3RZBA 4CMTA 4FT0A 4V05A 2W1ZA 3LMGA 4BKYA 5FP6A 4H3PA 4X3FA 3WI6A 4FV0A 1XBBA 5CSHA 2EXMA 5KZIA 1GIJA 5HICA 3DK7A 1OKYA 3TZ7A 4I5CA 3LQ8A 4I24A 1YWRA 2WHBA 4QYYA 2P33A 5BQ0A 4BBEA 3BU3A 2X4ZA 4FV3A 3LE6A 3UOKA 3E92A 3UQGA 4AA5A 1ZWSA 4OTGA 5I9UA 5A4EA 5ETIA 4G6LA 4EUTA 4ZEGA 4TNDA 2WMVA 2IVVA 5HBHA 5TR6A 3UTOA 2WIPA 3DS6A 3VBQA 1M2RA 3VJNA 3C4ZA 2X2LA 4WBBB 3VW8A 2XKFA 3CGOA 4IQ6A 4MHAA 4ZS0A 3S3IA 4D9TA 4YTCA 2ERZE 3C0GA 2WELA 5DEYA 5AX9A 1OKZA 5GZ8A 3K3IA 4CZTA 5CU0A 3LM0A 4OLIA 5CSXA 5AP4A 3QQKA 4X2KA 2BHEA 3S00A 4JQEA 5FP5A 1GZKA 4C57A 1XWSA 3F2AA 4FKVA 2VO7A 3LFCA 5DR9A 1UNLA 2C47A 1XJDA 4WSQA 1PXOA 3EWHA 3NUXA 3H0YA 4DITA 3VF8A 3D9VA 3S0OA 3QCQA 5AUYA 3OTVA 5DBXA 5ETAA 3MH1A 4XX9A 5HKMA 2P3GX 3TN8A 2HZ0A 3EL7A 3P78A 3D2KA 3QTRA 4IDTA 4L46A 3WBLA 5IUHA 1NW1A 1RQQA 3GU6A 4PP9A 4ZLYA 5IQHA 3QRJA 3KY2A 3I7BA 5JMSA 4G9CA 4J71A 2R3MA 2R3JA 2WO6A 2R3GA 3AC3A 3ZM4A 4M97A 4PDOA 5IA1A 4IB5A 2QVSE 4YLJA 3FC1X 4JLCA 3CTJA 2F7XE 2OGVA 2XK3A 4G5PA 4U81A 5ACKA 2R3HA 4PRJA 5CXHA 5HE0A 3DXPA 5FLFA 4GH2A 3MVHA 3E7VA 3LKMA 4FV1A 1BL6A 4IMYA 4OAVB 4N57A 3UBDA 4KRDA 2YLFA 5IQEA 5DRBA 2AYPA 4D2TA 2G2HA 4FKIA 3A7FA 3ZYAA 5GJDA 2X6DA 3NUAA 1R1WA 5I3OA 3V04A 2QO7A 4BI2A 4F63A 3AGMA 4O7SA 1F5QA 3C51A 4HCUA 3VRZA 2AUHA 4O2PA 4W4WA 4LV8A 1NXKA 4FMQA 4CXAA 3MFTA 1Q99A 2I0EA 5CAUA 4EOLA 5E1SA 4GK3A 4ERKA 3FV8A 2C3LA 3QZHA 2WPAA 3FKNA 4H1MA 3RM6A 3TV6A 4ZSEA 2JIVA 3F5XA 3QWKA 5KKRB 4ZTRA 4V01A 4HVGA 2DS1A 2OXXA 2WTKC 4KSPA 4NK9A 4BTFA 3MPTA 1JNKA 2Z02A 4BGQA 2XIXA 5HBJA 4OW8A 2CJMA 2W96B 4X21A 3QUEA 1AGWA 1Q62A 4JS8A 1IRKA 2GNIA 3UODA 3ZUVA 1G3NA 3ZUUA 3FY0A 2OI4X 4X0MA 4FTUA 5GHVA 5JGAA 3FI8A 3C1XA 2VGOA 5LARA 4AZVA 4O1OA 1NT2A 4FEXA 4FNZA 2W05A 5AV1A 4UX9A 4A9UA 1PYXA 3CIKA 2PHKA 1H1QA 3DU8A 1UVRA 5DI1A 3VWAA 4BDIA 3EH9A 4GIIA 5AA8A 5IMXA 2W1GA 2ZM3A 3R8ZA 2PZIA 2JAMA 3F69A 4IE9A 4ZOGA 2WAJA 4FV2A 5J79A 4QMQA 1CKJA 3L9LA 3D4QA 5DNRA 5CX9A 2I7QA 2VTMA 3QUPA 4O0RA 4EC9A 1OIUA 4FIIA 3U51A 2W1EA 4QMLA 1WBOA 3A62A 4LYNA 4TNBA 4IVDA 2J6MA 3WARA 3FMEA 5IPJA 1URWA 3Q4TA 4IH8A 3CCNA 4YZBA 2WMTA 2NNWB 4YURA 1CMKE 4WO5A 4UMPA 2QOIA 4F9YA 2GS7A 5BUJA 3O8UA 5DR2A 4K6ZA 3ERKA 1QPCA 5FBOA 3FHIA 4QTEA 3FUPA 5E8VA 4ANMA 3ZZWA 5AA9A 3NCGA 1ZOHA 3LFFA 4IVCA 4UV0A 5ANJA 4YZMA 3BEAA 3QTIA 3RAWA 4O7WA 3LFAA 5FEQA 3ZXTA 4USDA 4S33A 1Y6AA 3GC0A 3I0OA 4WD5A 4QRCA 3P23A 2F7ZE 4XLIA 3MVMA 5JFVA 5HG9A 4R3PA 2ZV7A 3MY0A 4ZLOA 2ITTA 1M7QA 4NM0A 1CKIA 3FQSA 5KX8A 5BPYA 2PMLX 5IA3A 3PUPA 4P4CA 2LAVA 4F1MA 2RIOA 4BTKA 3ACJA 3ZO3A 1KE5A 3UMWA 4FK3A 2C3JA 4EZ3A 3FQEA 3KXXA 4KA3A 4J8NA 1SVGA 5ANGA 2A2AA 4IIRA 5EH0A 4AXAA 2OZAB 5KUPA 2C0TA 4IX6A 4PL3A 3VS0A 2ITYA 4L44A 3DAKA 4E6QA 1JAMA 5IA4A 4TYGA 4ANBA 2GMXA 4I5HA 3PSCA 4E20A 3DQXA 2YCSA 3CBLA 4IWOA 5DH3A 5CSWA 3POZA 2HYYA 3R9DA 3ZS5A 3OCTA 2O65A 1LR4A 4APPA 2HZIA 2DYLA 3VS4A 4JIAA 5AP6A 3VO3A 2QCSA 2YDIA 3MDYA 4YNOA 3MIYA 3ZDIA 4EOSA 1YWNA 3FMDA 3BELA 4G31A 5FGKA 3CD3A 3R6XA 2CN5A 2JBOA 4G2FA 3TV7A 2R7BA 1IA9A 4GT4A 1KE6A 2PZRA 4FVPA 4EK8A 1P14A 1U54B 5D1JA 4C61A 4F7SA 4I6QA 5AUXA 3AOXA 1IEPA 3MY5A 4RX9A 3V5QA 4NW5A 1YXXA 3ZO1A 5HD4A 2W0JA 3TIYA 5J7BA 3P1AA 4WRGA 3JUHA 4DEBA 4X6RA 4QT1A 3F7ZA 3QD0A 3MESA 3VRYA 4A9YA 3ORIA 4O21A 4U9AA 3JPVA 4QP2A 1UKIA 1SNXA 4PX6A 2FO0A 5AV2A 2B9IA 3W16A 3R02A 4TWPA 2X2KA 4O83A 2J0JA 3UPXA 4DC2A 2PUNA 2GFCA 4M69B 4YC6A 1YHWA 4IM3A 2ITPA 1OM1A 1UU3A 4BDKA 5I5ZA 3VBYA 4OBOA 3FYKX 1WZYA 3FMKA 4KABA 2IW6A 4N6ZA 2WB8A 1H1RA 5HEZA 1PMUA 4O91A 3NSZA 3R7VA 3S1HA 3N9XA 2YISA 2VX0A 4FTLA 4U3ZA 4E5WA 4PUZA 3UO6A 4XOZA 4O7ZA 4RIWB 3POOA 3R8UA 4AN3A 2C5YA 3A4OX 1GNGA 4FEUA 1GOLA 3BYUA 3MW1A 5E8UA 2WTVA 5G6VA 3MSSA 3BI6A 4NTSA 4QTCA 5C1QB 3OCGA 2W9FB 2OIDA 4YC8A 4BDHA 2XNEA 2C6TA 4IB0A 2REIA 3LLAA 1W82A 3UG2A 3FXXA 1PKDA 3OUNB 2Z7RA 4ZSAA 3LCTA 5M4UA 2OWBA 2VTIA 3ATTA 4KWPA 3TKHA 4FT7A 1YOJA 4OTRA 2NRYA 4V04A 3UGCA 3ZEPA 2BPMA 4MWIA 4E6CA 4YJUA 1Q3WA 4RJ6A 3BGZA 5C8MA 3QLFA 2GDOA 4TYIA 4DTKA 3MH0A 4PL4A 3OROA 3CQWA 4F0FA 4F65A 5E9EA 1TKIA 5LOHA 5FD2A 4KBAA 3O8TA 2VRXA 1FVVA 4FV8A 5EW8A 3TIZA 3W2RA 5A4LA 4C4HA 2QU6A 2JDOA 3DAJA 2X39A 3WYYA 4QP3A 4FGBA 4A7CA 4CKRA 4U45A 4W9XA 2YFXA 4Z3VA 4RZWA 5CU6A 2RL5A 3DV3A 3G6GA 1PXLA 3I4BA 3R1QA 3SHEA 4YO6A 3ORKA 4U40A 3GB2A 1XO2B 2UZTA 5HNGA 5AR2A 3WZJA 3D5WA 3KFAA 4RWLA 2G15A 4RIYB 4TPTA 3I79A 4XNEA 4YZNA 4E26A 4QMTA 3MVLA 5LCKA 3R71A 3TNIA 3LOKA 4RMZA 4EUUA 3VS7A 2G2IA 3QTZA 1XR1A 4EK3A 4MK0A 5KMNA 4ZTLA 2OICA 2CGXA 2UW5A 2RFSA 2PK9A 3COIA 1JOWB 4ZTHA 3G51A 3KGAA 3QHWA 4O86A 3UVRA 5IUGA 4F08A 2GQRA 3GU5A 3IW6A 5E8XA 4QP9A 5KHWA 4FIEA 3W32A 5JQ8A 3LCKA 2I1MA 2WTIA 2HY0A 1VEBA 2RFDA 5FEEA 4CZUA 4RGJA 3NPCA 4D2SA 2YM6A 3Q9WA 5EYCA 3EQPA 4XG6A 1E1VA 4IC7A 3RVGA 4TYHA 2V22A 1VYWA 1Y8YA 3NEWA 3FQHA 4Y5HA 4YPDA 5HG8A 4C4GA 2PSQA 2VN9A 2XNOA 2ZOQA 1SVEA 3CS9A 1MQ4A 2R3IA 3OHTA 3MJ1A 1Y91A 2GHLA 5D10A 4XG8A 4UMQA 3ZLYA 3A7JA 5HVKA 2OLCA 3AT2A 2ITNA 3MGYA 4XBUA 4CMOA 3SRVA 1BUHA 3A4PA 3C7QA 2R3QA 1XH5A 2PZ5A 3QRTA 4GU9A 4XS2A 3RNYA 4MNEB 5KMMA 2B52A 4I5MA 4NFNA 5EM6A 5HVJA 4RJ3A 2UW6A 5DWRA 2JITA 3DBCA 3FMNA 1Q24A 5AP7A 3VS5A 4E73A 5HLNA 4HPUE 1HCLA 1WBPA 2DUVA 3E3PA 3FPQA 4FSTA 4ANSA 3B2WA 4ZTSA 3BYOA 4RQKA 2OFUA 4RZVA 1OPLA 4XH6A 3AQVA 2QU5A 4NCTA 1OB3A 3BQRA 3VBWA 4ID7A 4GG5A 3W2SA 2WOUA 3D83A 2X1NA 4ZSGA 4ALVA 3BLRA 5EYMA 4HZSA 2C3IB 5EOBA 3OBJA 2NO3A 5DGZA 5HNBA 3EL8A 3FMJA 3VS3A 2R2PA 3R1SA 3U8WA 3F5PA 4YZCA 3WZEA 4R5SA 5IA5A 3W18A 4CYIA 1FVTA 3SXSA 4UMTA 3Q6WA 1HOWA 3FDNA 5LMKC 4JG8A 5C26A 1YDRE 5M4FA 3HP5A 3VQHA 2GTMA 4G9RA 4GIHA 2RG5A 4GUBA 4PMMA 2BZKB 4I41A 3RBWA 5CEMA 1RW8A 2VUWA 2IWIA 4D4RA 4W9WA 4EKKA 2HK5A 3NWWA 3EN6A 4QPMA 3U55A 3EQFA 4LRMA 1MRYA 2PUPA 2OZAA 2NPQA 4MTAA 5A3XA 5ETCA 5FEDA 3RAIA 4AZEA 4L45A 4AGWA 4NSTA 2XJ2A 2VTQA 3CTQA 3HV6A 3IO7A 3DKOA 4LRJA 4QMWA 3H9OA 3UVQA 2CGWA 3OMVA 4FIGA 4HYHA 3KVXA 3QYWA 4RG0A 4X3FB 3W2QA 5CT0A 3EFWA 1PY5A 1OBDA 3PWDA 2NP8A 3KF4A 3PJ3A 4IXPA 2CKOA 3BHUA 2YJSA 4FICA 5B0XA 1R0PA 2WOTA 1YRPA 3E5AA 3RWQA 2YA9A 3F3TA 1SZMA 3HV5A 5CALA 1F0QA 2B9HA 4E5BA 3PG1A 4F6UA 4MD7E 1GY3A 4FTTA 3L8VA 4LOOA 2YABA 3BHHA 5BVOA 4KSQA 1EH4A 2UVXA 2Z7QA 5DPVA 2XRWA 5I0BA 4AZWA 3DPKA 1H00A 3DT1A 3EOCA 2WD1A 2OSCA 4FTCA 4DFXE 2CHLA 3SAYA 5CXZA 3TJDA 4O7YA 3PVBA 3JR1A 5KE0A 4QTDA 4BCGA 2O63A 1K2PA 3SXFA 4ASDA 5IQDA 2YIWA 3NNVA 3GCSA 2YDKA 3PE2A 3I7CA 3ZBFA 4H1JA 2H96A 4IDVA 3DJ6A 3N4UA 3VUIA 2XNGA 4GFMA 3W1FA 5I9ZA 3KXZA 1TQPA 2GS6A 4RRVA 2GCDA 3QYZA 4D1ZA 3DTCA 2QQ7A 4IX3A 5HLPA 2XIYA 1UWHA 3PZEA 3HMMA 3VN9A 2VX3A 5HORA 1QMZA 4HYIA 5M51A 3HAMA 3TJCA 1J3HA 3IQ7A 4EJ7A 2Y6MA 5CY3A 4FKPA 4KS7A 5JN2A 3C50A 3TNPC 2UW9A 3RK9A 3QQLA 4BHZA 3WF7A 2UW0A 4X2NA 4FV9A 2UV2A 4UMUA 4M13A 2IZTA 3IPHA 5A14A 4WNOA 2CGVA 4YNEA 3OTUA 3MFRA 2JDVA 3ZRMA 4J52A 3ORTA 2IZRA 1UWJA 1DI9A 2X8EA 3DOGA 2XB7A 5HNIX 2PZYA 3ZLXA 1WMKA 4CFNA 2I0YA 4AW1A 4BDDA 2CPKE 4F6SA 2OKRA 3AGLA 2VU3A 2XJ1A 3GVUA 4NIFA 4NKSA 4ANLA 4CLIA 4FG9A 5EDQA 2Q0BA 4ZZNA 3FE3A 4G34A 4AQCA 4AW2A 2OJJA 3HLLA 1M2PA 4MEDA 4YO4A 4WG3A 3PY0A 4O2ZA 1QL6A 3NUPA 3WILA 5CF5A 2VWVA 3DXNA 5AR4A 3VUKA 1KE7A 2OU7A 3I60A 5EQEA 4RC4A 2W1FA 5E8WA 3REPA 4E93A 4WKQA 2J0KA 4L3LA 5M06A 5BVKA 1FBNA 2CCHA 4QYHA 4ZJJA 4DH7A 1KE9A 1YKRA 3UNJA 3EYHA 5AP5A 3TTIA 2BTRA 4QMPA 4UZHA 4WUAA 4AAAA 4EOQA 2YCRA 2BZJA 1JKKA 4ACCA 5DG5A 4YJSA 3ODZX 3EN4A 4IWPA 5IKWA 3QGYA 2B1PA 4D0WA 2PPQA 4Y72A 5HG7A 4UBAA 4XJ0A 4ZZMA 5DA3A 5I9YA 3R9RA 2XYNA 3ZSGA 3EZVA 3Q9XA 2YITA 5HG5A 4KRCA 3A60A 3R1NA 1FPUA 3RPRA 4DN5A 3N4TA 3UP7A 1Q61A 4FUXA 5HE1A 2C0IA 2ETRA 5CVHA 1FQ1B 5ANOA 5K0KA 4O0WA 4EK6A 3B8RA 1OITA 4PP7A 3ELJA 3DJ7A 3NYXA 4K8AA 3KF7A 4JXFA 1OIYA 3IONA 2AC5A 4G3CA 2X6EA 3HX4A 3TZ9A 3GENA 3KQ7A 4EH4A 3RCJA 3Q4UA 4M8TA 3R7YA 1H1WA 1ZMVA 1OZ1A 4UWYA 2VO0A 5HE3A 4WRSA 3OCSA 2ZV9A 4JAJA 3MV5A 3SG8A 4O6EA 1PF8A 4HVDA 4OBQA 2OJIA 1CM8A 3BBTB 4FVQA 1H1SA 4FZFB 4HYSA 5H8BA 3F3UA 5JRSA 4CNHA 4G5JA 1P2AA 4JOAA 3CPBA 2B7AA 2I0HA 2G2FA 5L3AA 2QI8A 2R64A 3CGFA 2C69A 4GK2A 5I9VA 2XCHA 2YIRA 3W2CA 4BIDA 4N4SA 4ZMFA 4DE4A 3TT0A 4GW8A 4KB8A 2ITQA 3GU4A 3LXNA 3RK5A 4I93A 3H3CA 4RIXA 3ATSA 3R7GA 5J5TA 4EYMA 3NYNA 4TKSA 2C6OA 5KBRA 4IAIA 3T3UA 4AACA 1VR2A 4RPVA 5T68A 4FGRA 2RF9A 3ET7A 4FYOA 4I21A 5L2TA 3TXOA 1H8FA 4OGRA 3Q96A 2IZUA 5KKRC 4XP2A 2R9SA 5CVFA 2UW3A 3HVCA 2ZAZA 1V0OA 4MXCA 3C9WA 4JRNA 3EJ1A 3A7HA 2W1CA 3AMAA 1VYZA 3HL7A 4XV1A 4EBVA 3OW3A 3UO4A 4KNBA 4D5HA 4FNXA 4G3FA 4YZ9A 4QP4A 3C4WA 3U6IA 3C0HA 3TM0A 3R7UA 2HAKA 3TZMA 4XV9A 2YZAA 5HGIA 4BY9E 5AUWA 4YJQA 4ZXTA 2BAJA 4DCEA 1O6KA 5IH4A 4ANNA 2F4JA 5A4TA 1OBGA 4O81A 2X9FA 3COKA 4IZYA 4B99A 5K9IA 1ZYCA 2PWLA 4QMXA 3PP0A 4FKSA 4FSWA 4IX5A 5AAGA 3DGKA 3PDTA 3OW4A 3QQHA 4C7TA 2PVHA 3K5UA 4U80A 3MY1A 4P2KA 4KKEA 2R3OA 3EQDA 3LPBA 4C4IA 2OJFE 2CNUA 4XP0A 3EFKA 4FSRA 1CTPE 3QF9A 4NUSA 3NUYA 4CFWA 4MCVA 3BKBA 3VBTA 1PMNA 3NAXA 3EIDA 1H1PA 3SC1A 4Y83A 2I6LA 4A07A 3VHKA 1G8AA 3BV2A 4DGGA 3I1AA 3G33A 4FSZA 5F1ZA 3AMYA 3R63A 3DBQA 3IW8A 4HPTE 4FSYA 1WBVA 3F9NA 4OTFA 5FBNC 4YTFA 4W8EA 3CQEA 1BLXA 4E6DA 4JDHA 3AC1A 4F0GA 2W5BA 4BVUA 4TWNA 4J95A 4PDPA 3GT8A 3IDPA 2BCJA 5JFSA 1DAYA 5IEYA 4UWBA 5EOLA 3BBWA 4HJOA 1DAWA 4UEUA 3CY3A 3UQCA 1KOBA 3DAEA 2OXDA 1OKVA 2XIRA 4CZYB 4QP6A 2WTWA 3NUSA 5CZIA 1OL1A 3RM7A 4O7LA 4F6WA 3W10A 2QODA 2ZJWA 5A9UA 2RSVA 2QD9A 2VWWA 2YJRA 4FC0A 4B6LA 5HZNA 3RALA 4BKJA 2BDWA 4R7BA 4F64A 4YP8A 3FKOA 5DRDA 3W55A 3KMWA 4G3GA 4DF3A 3U4UA 2ITZA 5EYKA 3K3JA 2C6LA 3QX2A 2P2HA 4TWOA 4L52A 3IGGA 4DH1A 4EOOA 2CN8A 4U5JA 5E90A 4AN9A 4AU8A 2PUUA 1WCCA 1ZYSA 4OUCA 3NNWA 4DFBA 3FZRA 2WEIA 2G9XA 3E62A 4EONA 1YOLA 4ASEA 2WMXA 5AUUA 3SVVA 4ACDA 4JDJA 1RE8A 2CLQA 2QR8A 3AXWA 2IVSA 3VBVA 3UC3A 3COMA 5E8SA 3Q53A 5KNJA 3QTSA 4J98A 2QC6A 2PE1A 2JC6A 2ACXA 3PJ8A 1Z9XA 3LFNA 4A4OA 3PA4A 3O7LD 1OVEA 3Q32A 4FZ6A 4WHZA 5HD7A 2V0DA 5HOAA 4YTIA 5L6WL 4FT9A 2BKZA 3HMIA 2YHVA 3BYSA 2VTNA 2VV9A 2VWBA 2XS0A 5JT2A 4CG9A 1M14A 2QOBA 4C59A 5CAVA 3G90X 3E7OA 4TYHB 4NW6A 4FYNA 4D1SA 3M2WA 1YI3A 4RA4A 3H10A 3OXTA 5L4QA 2JIIA 3QCXA 3P9JA 5D11A 3ZSIA 4I22A 4M14A 1ZZLA 3SG9A 5CF4A 3Q2JA 1PJKA 1MRUA 3G9LX 4I4FA 4BBMA 3NS9A 4FTOA 4F4PA 4M12A 2GTNA 5CNNA 1JBPE 2UZVA 3NDMA 3QHRA 4MBIA 3O51A 2RGPA 3MN3A 4GMYA 5H3QA 3W2PA 3SRVB 4CFUA 4E7WA 3ZC5A 3F2RA 1QPDA 4NJDA 4DEIA 3LXPA 3MVJA 4A9RA 4FKUA 4AW0A 5JZJA 5HIDA 2AC3A 4YPSA 3D2IA 2J0MB 4JG7A 3PP1A 5E1EA 2BIKB 3VUTA 4QYEA 3PSDA 4LGHA 1V0BA 5KZ0A 3U6HA 2JIUA 2HW6A 5CQWA 1J91A 5CAOA 3MPAA 1XHAA 3UOLA 2BKKA 5HX8A 4LUDA 4M84A 4RX7A 5IDPA 4FOCA 3GUBA 3ORPA 4DH5A 4S34A 3G0EA 3HAVA 4KBCA 4DT9A 4R3RA 4GJ3A 3FSFA 4LFIA 2XM8A 5AJQA 3CD8A 3GOPA 3DJ5A 3Q52A 2X7FA 5AP3A 1OL5A 1G5SA 3ZU7A 2PVMA 4FL1A 3F3WA 1BI7A 4GYGA 4CT1A 4FTNA 4X2GA 2LGCA 3ACKA 4PPCA 4WBOA 4II5A 4PDYA 3ZSHA 2E9OA 1U5QA 2PMNX 3BE2A 3ENMA 4NU1A 4BCPA 2VD5A 4RQVA 4AA4A 5CAQA 3QFVA 4HZRA 1SMHA 4IWDA 5TO8A 5K4IA 3SLSA 4GJ2A 5AR3A 4U0IA 1XBAA 5L6PA 1PXJA 1TVOA 3ZLSA 4C38A 4FK6A 2ZV8A 1LPUA 5EKOA 5BVWA 3EQGA 4IAAA 5JEBA 2Y9QA 2C30A 4OT6A 3HMNA 2QOKA 5E7RA 5EW3A 3THBA 3AD6A 3WIKA 1T46A 3GI3A 3DDPA 4IFGA 2YM5A 3L8SA 3OWKA 4EWQA 3CJFA 5AUTA 2GQGA 3PA5A 1YXUA 4WG5A 3W8QA 4HCVA 3HRBA 3QAME 3QZGA 4LGGA 3Q3BA 4L7SA 1L8TA 3EQHA 4EORA 4NT4A 3DCVA 4R6VA 5DFPA 4JBOA 3ANQA 2R3PA 2WMBA 4LUEA 3P7AA 3U87A 4C4JA 4TYJA 3HUCA 3QQUA 3VUHA 2BROA 4YC3A 1R78A 5A6NA 3DZOA 4MXAA 2IW8A 2Q83A 5BYYA 2B9FA 4QTAA 1YI6A 3NYOA 5GZ9A 3GOKA 3O0GA 1Q8TA 1YXVA 2YACA 1PXNA 4CQGA 5ACBC 3QA0A 1KSWA 2RG6A 4RLLA 4Z55A 3PXKA 1W83A 4CQEA 4EJNA 3PY1A 4UYAA 5EI6A 2H34A 3ZBXA 3E64A 3IECA 3OWJA 5CU4A 4HNIA 3ORMA 3VJOA 1R0EA 1VZOA 4EI4A 3RGFA 5LMBA 2Z7LA 3GC8A 3IW5A 1IAJA 3NW5A 5TE0A 5B7VA 2QNJA 5CEPA 5EI8A 5D7VA 4NEUA 3FI2A 4L68A 4DTAA 4U97A 2C5OA 3KMUA 3H4JA 2X2MA 5DR6A 5TKDA 3M1SA 3BEGA 2B55A 5T3QA 3AD5A 5GZAA 1VJYA 5CENA 4B4LA 4K33A 1GZ8A 1Q97A 1UV5A 2WIHA 4LQMA 4FZAB 4EQCA 4EQUA 4Z16A 5C4KA 1OGUA 1F3MC 3O96A 4FSNA 4AF3A 4YLKA 3UIBA 4RIOA 4BCIA 2HOGA 2J9MA 2YM7A 3VC4A 5A54A 4YUQA 1M52A 5IMEA 4O0SA 2Y6OA 4DH3A 1ZYJA 4PWNA 4M0YA 2WTKB 4HOKA 5HTBA 3PRFA 4I5PA 4H3QA 3Q6UA 3KRXA 3KREA 4CFVA 3PY3A 3OXIA 3SA0A 1AD5A 4RFYA 2XUUA 4QP7A 5KCVA 5AIRA 4GKIA 4L42A 3MWUA 3R8LA 5CAPA 1H25A 2CDZA 3FZSA 2B53A 4NIFB 4XV2A 3C5IA 3QXPA 1OL2A 3NIEA 4EH5A 4AFJA 3O2MA 4QPSA 3S2PA 3MIAA 3TDWA 2EXEA 3ANRA 3UNZA 5HX6A 4E3CA 4BYJA 1XKKA 1ZMUA 3RMFA 5TF9A 4B8LA 4O7RA 5J5SA 4F7JA 2J50A 4F1OA 1QPJA 5IH6A 2WMUA 2EB3A 4JDIA 4YJTA 4O27B 2JDRA 4NTTA 4I6HA 4W4YA 3R01A 4ZY6A 4FTRA 3Q5ZA 3VW6A 2VTSA 4V0GA 1DM2A 4JVGA 2RKUA 3ZTXA 4HGSA 4X3FC 1WBTA 3GGFA 4EOJA 4Z9LA 5C8NA 3ZM9A 2C5XA 3OZ6A 1FMOE 4C34A 4EHZA 5BVNA 1Y6BA 4QQCA 3PRIA 4BCQA 4IX4A 2W1DA 4UZDA 4D4VA 5LQFA 3FPMA 4ZTMA 2PL0A 4AWIA 4ENXA 2VTPA 5A4CA 5CSPA 2JLDA 5E4HA 3EHAA 3IS5A 2JDSA 1GZOA 3H30A 1M7NA 2XK7A 4DBXA 5JK3A 4FUYA 2KULA 3Q9YA 4BL1A 3RZFA 5A4QA 3W8LA 2YAAA 1Q8UA 1WBSA 3QU0A 2R0UA 2BDJA 2SRCA 4TRLA 2YM4A 3PXZA 3ZZEA 3RPYA 4E1ZA 2HELA 4RLKA 3IK3A 2EB2A 3RAHA 5JFXA 3A7IA 4LM5A 5AR5A 4R8QA 3UP2A 4YR8A 4D55A 1OUYA 5J1WA 4NFMA 5L8JA 3P4KA 1XH9A 3PXRA 5IA0A 2ZDUA 4DG2E 4QO9A 4BGGA 2CLXA 5K0XA 4MD8E 3QTWA 3ZXZA 4XG2A 5D7AA 5GIOE 4FKQA 3GXLA 3QWJA 4CVAA 3OT8A 3BGPA 3D5XA 4IAFA 4LI5A 3LQ5A 4ZY5A 4L53A 5K5NA 3ID6C 4GK4A 3TWJA 2QURA 5M09A 4BZNA 2WZJA 2ESMA 5L2SA 3SOAA 4KKGA 2OF2A 4BCKA 4AOTA 1R3CA 4CEGA 3OY1A 5I9WA 4FTKA 2UW7A 3CP9A 5ANEA 2J5EA 2QO9A 4ITIA 5KMJA 4FSMA 4ZIMA 3KC3A 4FT5A 5HU9A 4RWKA 3VQUA 3OOMA 3ZONA 2FSOX 1Z57A 1JLUE 1SVHA 3HKOA 4L6QA 4H05A 4J97A 2JKOA 2X4FA 4RIXB 4D5KA 3QQJA 5EDRA 2YWVA 3NVMB 4GCJA 4C3FA 2IVUA 3CY2A 5FUTA 3DK6A 3FLWA 4IC8A 2PU8A 5AM6A 3Q2MA 3ZOSA 4GEOA 4YBKA 3RK7A 3LM5A 4K18A 4YJPA 5DOSA 4IAKA 2WTDA 2UZUE 2XK8A 3LW0A 4DEHA 4EHEA 5CF8A 1H24A 2XKCA 2XNBA 4PMSA 4RVMA 2ETMA 3DKCA 5AMNA 4HCTA 4FIHA 3BV3A 4QP8A 3R8PA 4C4FA 2FGIA 3P7BA 3GQIA 2Y4IB 3LCSA 3EMGA 4FG8A 4NKAA 4R1VA 3RHKA 3SQQA 4AOIA 2ITUA 5JKGA 4FR4A 4E6AA 1YWVA 1ZXEA 4EZ5A 4BB4A 4E8AA 4FV6A 3DA6A 2VTRA 1ZOEA 3PXYA 5J9YA 3TEIA 3WZKA 1LEZA 3B2TA 4M68A 4CYJA 3QD2B 5LVOA 2C68A 2ZB0A 3BGQA 4BN1A 2QKRA 3ZRKA 2XBJA 4FOBA 3VIDA 5CWZA 4FNWA 2OK1A 4BIBA 4GUEA 1MUOA 3Q60A 5H8GA 4UWCA 2GSFA 3NRMA 3D7TA 4WG4A 2CKEA 2G1TA 3OT3A 4LG4A 4QYGA 4Z7HA 4YBJA 2PULA 4IW0A 1Y57A 3BHVA 2VWYA 5KMIA 3EFJA 5HO8A 2UW8A 3KRWA 4R1YA 2BRMA 4X3JA 4USFA 2O8YA 3KB7A 1Q8WA 2BVAA 4CFFA 3BU5A 4BYIA 3PVWA 3BYVA 3DLSA 2A1AB 1BMKA 1YXSA 4RJ8A 4XUFA 5E8TA 1ATPE 4UXLA 5K5XA 4IM2A 3TUCA 3HUBA 2YN8A 3ORZA 4ZSJA 1PXMA 1WFCA 4JX3A 5F9EA 4L8MA 4I20A 4P5ZA 2A27A 4O0VA 3CTHA 2PVFA 2Z60A 1PXIA 2HXLA 4F9BA 5BVEA 2W4KA 2GNGA 1TQIA 2X8DA 4G6NA 3PWYA 4LL0A 2KTYA 2W06A 3COHA 3M11A 3NYVA 5E91A 2J51A 1Q4LA 3HMOA 2XH5A 2UZLA 3D15A 4XRLA 4GG7A 4AZFA 2ZMDA 3UOJA 4IWQA 5EHYA 3Q5IA 3WE8A 3IGOA 2B0QA 3HV4A 4XRJA 3T8OA 4CCBA 3GFEA 4GV1A 5HCZA 3RCDA 5J9ZA 3WZDA 4G16A 3TV4A 2BFXA 3HV3A 4K11A 3CEKA 3A8XA 4BICA 3V6SA 2GHMA 4M15A 4ONAA 4TYEA 4BI0A 2O3PA 2XEYA 3EB0A 4BCNA 4P7EA 2ITVA 1X8BA 3UVPA 3V8SA 5IDNA 3D7ZA 3VBXA 3UQFA 3KCFA 2R3LA 3GBZA 1W8CA 2GNLA 2ONLC 3F5UA 4D2VA 3AG9A 3TL8A 2RFNA 1IA8A 1L3RE 4JI9A 3R8MA 4KKHA 4FKGA 4FZDB 1CSNA 3PA3A 3UYSA 4IBMA 4ZSLA 5EM7A 3II5A 3B8QA 4FSUA 5J95A 3AC4A 4M66A 5FM2A 4FBXA 3IG7A 3PJ1A 5JSMA 1BX6A 3VUDA 3R0TA 3FZ1A 5B2MA 4FTAA 4J99A 1H01A 3PYYA 5AM7A 3CJGA 3V3VA 3MPMA 3R9HA 3A8WA 5HO7A 2XVDA 4OTHA 5IA2A 4ACGA 3I81A 4O0XA 4X2FA 5IEXA 1Y8GA 5M4CA 3DQWA 3FL4A 5IU2A 4FIJA 2ZM4A 2JFMA 3CE3A 4OT5A 5M53A 1ZARA 2J4ZA 3HNGA 4AT5A 4LV5A 3C4FA 2PMOX 3V51A 4EHGA 5JQ5A 4CKJA 3CLYA 2YAKA 2B4SB 2YIQA 3FZOA 5FXRA 2QOOA 4RFZA 5M57A 4K1BA 2XK6A 1OPKA 3ALNA 3OCBA 4R5YA 4C36A 5EI2A 4CSVA 3QA8A 3R2BA 3ZCLA 5HESA 2WEVA 5CASA 1S9IA 4L9IA 4XG3A 5ANIA 5AUVA 5L8LA 4M3QA 1FMKA 1OIRA 3WE4A 4Y46A 4FI1A 4U8ZA 2WMSA 3C4EA 3OP5A 4DA5A 1BYGA 3KRRA 4AT3A 3F7WA 2Z8CA 2V5QA 2FSLX 2BIYA 4EEVA 3AC5A 1UU9A 2JD5A 2QKWB 4RX8A 2V7AA 2C3KA 4QP1A 1U4DA 2JGZA 3UJGA 4FL3A 4QMOA 5L8KA 3EQRA 3R83A 2XCKA 2VTHA 4LMUA 5JZNA 3ULZA 5CEKA 5BVDA 2V7OA 2BTSA 2VX1A 4I0RA 4LRKA 4KIKA 2GU8A 2OW3A 4OTDA 5HE2A 4BHNA 4MX9A 2X7GA 4XMOA 2R3NA 3QL8A 3R21A 5C9CA 2CKQA 4TZRA 4CTBA 4B0GA 2VWIA 4U6RA 4NM5A 4WOVA 2WKMA 4YSJA 4I94A 3EQCA 5F4NA 4EH7A 3LJ0A 3BHYA 3QD4A 3PFQA 3ORXA 1Q5KA 2QO2A 5ITAA 3T9TA 3FYJX 2IG7A 2I0VA 4R77A 3AD4A 3TDVA 5HVYA 2I40A 2OXYA 4M0ZA 3I5NA 4OTIA 3G0FA 1YVJA 2GNHA 2HXQA 3JYAA 4IJ9A 5KBQA 2W9ZB 1XBCA 2XZSA 3OWLA 3BYMA 3TZ8A 4C37A 2VTAA 2XBAA 4LL5A 4AW5A 1JSUA 3E93A 3LLTA 1O6LA 4FV5A 4J1RA 5AV3A 4AA0A 2QOHA 2WQBA 5HTCA 2ZV2A 4QMYA 2Y7JA 5CZHA 3D94A 4CFMA 2JEDA 2E9NA 4BDAA 3F3ZA 4BDJA 2BZIB 2OF4A 4BBFA 4UXQA 4EK4A 2ERKA 4H39A 1BL7A 2PVLA 2IW9A 4IZAA 3ZMMA 1PMEA 4MNFA 4EH3A 2X9EA 3QTQA 1XH4A 5C4LA 4ALWA 4YU2A 3LCDA 5FWKK 4H3BA 4DGLC 2Q0NA 1WBWA 5FRIA 4EZ7A 1JSVA 2C5NA 2BFYA 1UU7A 4M7IA 3R1YA 4JL9A 1KE8A 4PMPA 3NR9A 4Y8DA 5DIAA 3KCKA 3TTJA 1W98A 1XH8A 4PQNA 3V6RA 4FTJA 5K4JA 4IZ7A 2ITOA 3QKLA 5DEWA 4FKOA 4W8DA 2QHNA 4BF2A 4JBVA 2R7IA 4UY9A 2PVYA 4JR3A 3Q4CA 4HNFA 4PTGA 2C6EA 4Q2AA 3P79A 4K9YA 3F5GA 5CLPA 3O7LB 5I9XA 4WA9A 5H2UA 3G2FA 5FDXA 4I3ZA 5BMSA 2UUEA 4GFOA 5DT4A 4BI1A 4RVTA 4K0YA 4RSSA 2VGPA 4BR3A 3KULB 3P0MA 1PMVA 3QRUA 3N51A 4AT4A 2C6DA 2OJGA 4O7NA 4O22A 3I6UA 4PTEA 2PUIA 4LOQA 3PIXA 4ACMA 4XV3A 1ZAOA 2YIXA 5BUIA 3DXQA 1YXTA 1T45A 3HV7A 4NJ3A 2XIZA 3KXHA 3PLSA 3NCZA 4JIKA 4AUAA 3OD6X 4BDEA 4I0SA 4FKLA 5ANKA 5CEQA 4DFUA 3SW4A 3LVPA 1U59A 3D5UA 1QPEA 3W33A 3QTXA 3RHXA 2R4BA 1CKPA 5BYZA 4EH6A 4UYNA 5FXSA 4D4YA 1W84A 4DH8A 2XP2A 3E8EA 4ARKA 3CKXA 4F1TA 3NGAA 2ITWA 2YM3A 3LXLA 2F49A 2J0IA 2QOQA 3BIZA 3O23A 3V5PA 3WF5A 1KWPA 4S32A 2W5AA 4WSYA 5M4IA 2OIQA 5CYIA 3HP2A 3QRIA 3EQBA 5HIBA 3ZRLA 2H9VA 4I6BA 3SXRA 4D2WA 4KS8A 3JVSA 3F88A 4RVKA 4C33A 3F3VA 3HA8A 2BZHB 1QCFA 2IZSA 3VUMA 3QBNA 2ZDTA 4N6YA 2PY3A 3MJ2A 4S2ZA 4IB3A 4RVLA 4C3RA 4F7NA 3NNUA 4JAIA 3NNXA 3V5LA 4W4VA 4TTHB 5BUEA 2XKEA 5CI7A 4BWPA 4DHFA 4QNYA 4FKRA 2BRBA 5GNKA 4O0TA 4U3YA 4ZTQA 2QHMA 3DNDA 3VULA 3UC4A 1OMWA 2JKQA 3GCQA 2ZYBA 2PVNA 3O50A 1A48A 1ZY5A 4Y95A 5ETFA 4PY1A 3TNWA 3EN7A 3GP0A 2E2BA 5D9HA 5AV0A 3SOCA 2EUFB 2F9GA 4L3JA 2XF0A 5EFQA 5BMMA 4PDSA 4KBKA 5HBEA 1PW2A 2X7OA 4NYEA 1KOAA 3DKGA 4MBLA 3GC7A 1NA7A 3PPKA 4V0GB 1WAKA 4AGDA 5F95A 2CKPA 1LEWA 3DBFA 1K9AA 4LOPA 5HTIA 4F09A 3FEGA 2FVDA 1WVXA 3DZQA 2P2IA 3VUGA 3W2OA 4TL0A 4N70A 3NIZA 2GS2A 4FODA 3D5VA 3QD3A 4GT5A 3N4VA 1OI9A 2QONA 4RX5A 1GJOA 4AGUA 3UMXA 4XCUA 4KUJA 4AZSA 4JX7A 4BWXA 5IQFA 5FM3A 2C6IA 3LFEA 3TUDA 3HYHA 4FKTA 3BRBA 4CGAA 3NW6A 3MB6A 2VO3A 4EOKA 2C1BA 2OH4A 3HEGA 3BX5A 3PLAE 4BKZA 2HW7A 4RWIA 5AX3A 3R2YA 2HCKA 4MAOA 3IOKA 2C5VA 5FXQA 2XK4A 4D9UA 4YMJA 3LZBA 1JKSA 4O7TA 2J2IB 4CKIA 5G1XA 5HCXA 2IVTA 4O7VA 3PIZA 1YOMA 3HZTA 5HHWA 5FDPA 4TWCA 5FTQA 5H9BA 2XA4A 1AQ1A 3L9PA 5C8KA 3LHJA 3TI1A 4PL5A 3LJ1A 3IW4A 4DAWA 4WIHA 2BRNA 3OVVA 4A4LA 2Y8OA 3OC1A 3PJ2A 3JVRA 3G9NA 3WZUA 5FG8A 4EC8A 2FYSA 4OTWA 3FZTA 3UIUA 1R39A 4ZJIA 4ZY4A 1O9UA 3FHRA 3C13A 3Q04A 3DFAA 4RJ7A 3MTFA 2HY81 4BTMA 4JG6A 4YSMA 2XNNA 1JVPP 2O2UA 4UB7A 1REJA 3BLHA 5AR8A 4U42A 4DFZE 1RJBA 2O5KA 3FLNC 3MB7A 2YERA 2UW4A 3I5ZA 4PMTA 5LMKA 3I0QA 5JRQA 4ZJVA 2EVAA 4EOIA 2O64A 4S31A 2BMCA 3L8PA 2O0UA 4QTBA 3A7GA 5LJJA 1J7UA 4I23A 5LWNA 2X81A 1ZOGA 4QD6A 4DINA 3DFCB 5CEIA 2BR1A 3CPCA 2PYWA 4E4XA 3HMPA 3ETAA 5JGDA 4ZZOA 5CU3A 4EK5A 4O82A 5DMZA 4HVSA 3KL8A 3DDQA 2WNTA 4XHKB 4ZP5A 3G15A 4AG8A 5C01A 2R3KA 3DLZA 4NL0A 3R9OA 3CC6A 4BFMA 3QGWA 2C1AA 5I4NA 4TW9A 4QQJA 5EK7A 4Q9SA 2BAKA 3SW7A 4DEAA 2HIWA 4FV4A 2FSTX 3CSVA 3SKCA 2FH9A 2GPHA 2PVRA 2H6DA 5M07A 3HDMA 4FNYA 1APME 1UNHA 3AMBA 5DVRA 4BTJA 5J7HA 3OG7A 3KRJA
chains in the Genus database with same CATH superfamily
3PVUA 1K3AA 4MF1A 3VNTA 4MXOA 2XAMA 3FLQA 2XYUA 2DQ7X 3KN5A 4DEDA 2ZB1A 4QMVA 3R7IA 5IQBA 3ZO4A 2B54A 4ITHA 4KD1A 3TKUA 4WT6A 3LMIA 2P0CA 2ZVAA 4GS6A 2BRHA 3MFSA 5EW9A 2YCFA 3D7TB 2E9UA 3K5VA 3QZFA 4L43A 1BI8A 5E8ZA 5AFVA 4FTQA 4KIPA 3VHEA 4DFNA 4EL9A 2UZNA 5CF6A 1P4FA 3KXNA 4FVRA 3QQGA 3VVHA 2PE0A 2QOLA 4IB1A 3RTPA 1A06A 2EU9A 4K77A 4MKCA 4QYFA 3QRKA 1IR3A 1IASA 4AE6A 1GIHA 4GVJA 3O71A 3MBLA 3ZFXA 5J1VA 4JJRA 1KUTA 3UZRA 5GINE 1CDKA 3OUKA 4TXCA 1PRYA 3NVKI 3NUUA 5DYJA 1J1CA 2GHGA 4AP7A 4S30A 3AT4A 3F6XA 4MXZA 2QG7A 2A19B 3DNEA 4GU6A 2ONLA 2EWAA 2WTJA 5CS6A 3GFWA 3KULA 1J7IA 3ODYX 4WUNA 2B9JA 4F0IA 5LCJA 4J8MA 3DB8A 2XMYA 3FKLA 4X7QA 4F99A 4IHPA 1JKLA 3GQLA 3R73A 4YJRA 4YZDA 2YCQA 3R04A 5AR7A 3TNQB 3ULIA 4AZTA 4Q9ZA 4UALA 4R7HA 3V8WA 5EYDA 4C0TA 4FTMA 4TY1A 3HDNA 3HGKA 4FT3A 4M67A 1UKHA 1YQJA 5GJGA 1B39A 3LAUA 4EWHA 4MF0A 5LWMA 2VTOA 2UZBA 4IANA 4O84A 2X8IA 1GZNA 3R30A 5BVFA 1PKGA 1XH6A 2QR7A 4AX8A 3EFLA 5IQAA 1E1XA 4QPAA 3OWPA 4MQ2A 3T3VA 5CANA 2IO6A 3IDBA 3K54A 4WNMA 3WYXA 4PV0A 3JY9A 3EYGA 1J1BA 4MXXA 4IVBA 5A6OA 3NFGB 1SNUA 1YI4A 5EKNA 4EH8A 2QOCA 2WQOA 1Q8YA 4JQ8A 4R7IA 5DT3A 5EHOA 3DTWA 4MYGA 3R8VA 4BZDA 5D41A 4FA2A 5BYLA 5AEPA 4E5AX 3UPZA 4ZMEA 3R7EA 4Q5HA 3FMLA 5IQGA 4FX3A 1SYKA 4EH2A 5IG1A 2XIKA 5L6OA 1SM2A 5KMKA 5AWMA 4RC2A 4P5QA 3BWFA 1H27A 5LVNA 2Y4IC 3GCUA 3QCSA 3U6JA 2V62A 2WGJA 3G5DA 3KEXA 3H9FA 3IW7A 4GL9A 4BGHA 5LVPA 4XYFA 4IJPA 4EOMA 3M42A 3DBEA 3GU7A 4QMSA 1NVRA 2BRGA 1ZYLA 4O4EA 4MQ1A 2VWZA 2HWOA 3KK9A 3RP9A 3QUDA 5TT7A 1ZZ2A 3OFMA 5AV4A 4KIOA 3QALE 3DK3A 3ZHPC 4I0TA 4ALUA 2CMWA 3D0EA 3E8CA 4I6FA 5LMAA 3SV0A 5GJFA 1URCA 5AP2A 1IAHA 5KO1A 2QOFA 4NM3A 3U9CA 4FE2A 4J7BA 3A2CA 1ND4A 1MQBA 4LMNA 2BUJA 3EQIA 4C8BA 5M56A 1YDSE 1GIIA 2OH0E 3I6WA 5CNOA 5AAFA 1Q8ZA 3S4QA 4E4LA 5EQYA 5C27A 5CI6A 1KV2A 5A46A 5F20A 2HZNA 1YDTE 1BKXA 2P4IA 4EYJA 2G01A 4GRBA 3FBVA 1B38A 3LIJA 4RJ4A 5DN3A 3G6HA 3CKWA 4HVHA 5CEOA 4MXYA 2JDTA 4PPAA 5DLSA 5J9LA 1ZYDA 2Z2WA 3MH2A 1Q41A 3PIYA 4FL2A 4X6QC 4QMNA 1JPAA 5LVMA 2R3FA 4BDFA 5IH5A 4KIKB 3RAKA 1V0PA 3QX4A 3GNIB 4R78A 2PZPA 1U5RA 3FI3A 4E4MA 3V8TA 4UMRA 4ASZA 5J8IA 5KMLA 2W1IA 4L67A 4ANOA 2WTCA 3MTLA 4YHFA 5D12A 4QMZA 2OZOA 2UVZA 3S95A 1DI8A 4ASXA 4C2WA 4RJ5A 2HENA 4CV8A 2PVJA 4C62A 3UYTA 5HLWA 4XBRA 2GNFA 3E8DA 3MFUA 3RNIA 3SD0A 3ZLWA 4JNWA 1ZLTA 4F9AA 3FLSA 4ITJA 4YGAA 5AP1A 3ITZA 3UG1A 4IM0A 4B7TA 4CCUA 1H26A 4AN2A 2WU6A 5IQCA 4JRVA 5K3YA 2F7EE 1P4OA 3SX9A 1H4LA 4BZOA 2XNMA 4PNKA 3OF0A 4FG7A 4YJOA 5AP0A 1G8JA 3ALOA 3ROCA 1KV1A 4DG0E 4BC6A 4DTBA 4CG8A 2WMAA 3H0ZA 2DWBA 2W4OA 3BWJA 4PF4A 5AIKA 3JS2A 4CT2A 3ORLA 3TKIA 1H08A 3TNHA 3MH3A 4B8MA 1FVRA 1OIQA 3FXZA 4AOJA 1YHSA 1OL6A 2A0CX 2JBPA 3QTUA 3LXKA 4G3DA 4BIEA 1MP8A 3RPVA 3QXOA 3KN6A 2ZMCA 4FKWA 3UIMA 5M44A 3KU2A 4L00A 4O38A 4JBQA 5BNJA 3UOHA 3O8PA 4XOYA 3K2LA 3L9NA 5JH6A 3MYGA 4CD0A 3EKNA 1STCE 4DLJA 3E63A 3OEFX 5B2LA 4HGTA 3FI4A 4C2VA 3E88A 4DGMA 2FSMX 3FAAA 1OUKA 3F61A 3QKKA 4OAUC 4ZTNA 3LFSA 2XM9A 2QLUA 5HCYA 3PPZA 4IACA 1UA2A 2OIBA 2XEZA 1PXKA 2R5TA 4RA5A 2OJ9A 4H58A 4DEGA 4ZAUA 2HZ4A 2CSNA 3QLGA 5CU2A 4MH7A 4Y5QA 3RWPA 4CLJA 3MA6A 4WNKA 1ST0A 3R22A 4RWJA 3UNKA 1M2QA 1NVSA 2VTTA 4WNPA 4FEWA 4YLLA 2JFLA 3OXZA 2F57A 3E87A 3R7OA 4B9DA 4BWKA 4USEA 1JQHA 4GFGA 3V5WA 1ST4A 2UZDA 5JFWA 3HECA 4P90A 1NVQA 1FOTA 3DBDA 4G3EA 5FTOA 1PHKA 1W7HA 4XG9A 4YJNA 3ZUTA 4BCMA 4AGCA 3FJQE 2YEXA 4NM7A 4D28A 2GQSA 2F2CB 3NMUF 4DFLA 5CT7A 3UDZA 1PYEA 3IKAA 4UN0C 4GKHA 2YLEA 3L9MA 3KKVA 4J96A 4FF8A 3FXWA 2W7XA 2VWUA 3DY7A 4O6LA 2PVKA 4R3CA 3ZH8A 4ZLZA 2W1HA 2XARA 3SDJA 4JBPA 2Z7SA 4BDGA 4BCHA 4RFMA 4CFXA 4EHVA 5AAEA 4I1ZA 5T6KA 1OPJA 2UZOA 5HQ0A 2H8HA 4X2JA 3LFBA 3EN9A 2Y4PA 4O4BB 3PXFA 4Y73A 2ZM1A 2YWPA 4QNAA 5CSVA 4D2RA 3ZO2A 5FTGA 4FZ7A 4OR5A 3O17A 3PVGA 3BL7A 2VNWA 3TACA 4CRLA 3GEQA 3NLBA 1YHVA 2E9VA 1HCKA 4Q5EA 3FZPA 3OEZA 4F9WA 5GIPE 1UU8A 2R3RA 5L2WA 2YDJA 4KIQA 2AEGA 4BCOA 4IEBA 2BAQA 1FGIA 5IISA 4IZ5A 2W4JA 2C4GA 4QMUA 4JR7A 1WVYA 4BRXA 3EN5A 2W99B 4IADA 4L7FA 3BPRA 4EOPA 3WF6A 3KA0A 2VO6A 4YHTA 3F2NA 3QC4A 4BCJA 4JT3A 1PXPA 3GC9A 3UZPA 4ANQA 1O6YA 2C6KA 4MWHA 4GSBA 3RKBA 3CXWA 2HWPA 1G8SA 1U54A 1WBNA 2WU7A 4U41A 5IF1A 3L8XA 1JSTA 3TUBA 3H9RA 3KXGA 3RPSA 3KRLA 4DFYA 2JKKA 5LXMA 1ZMWA 3HRFA 4GVAA 3Q4ZA 4KAOA 4A06A 3QC9A 4A9SA 1A9UA 3LMHA 1DS5A 2ETKA 2OFVA 2VTJA 2WMQA 3AC8A 3OY3A 4GT3A 4HGLA 4PPBA 3DB6A 4F9CA 4MD9E 2YM8A 3BLQA 3FMMA 5HU3A 2A4LA 2PE2A 2J0LA 4NH1A 4EBWA 4XEYA 3IOPA 3WF8A 3VAPA 2E9PA 1TFFA 4M69A 2F2UA 4G1WA 2QG5A 1I09A 2UVYA 3U4WA 3W0MA 1B6CB 3OBGA 4U44A 3UZTA 5ICPA 4O4DA 3A61A 1S9JA 3NUNA 4APCA 2Y0AA 2GNJA 4K2RA 2VAGA 3V5JA 4C35A 4FIFA 1OL7A 3LJ2A 5M55A 1LP4A 4O0YA 3AC2A 5TOZA 4RIWA 4O1PA 4D2PA 1OKWA 3BU6A 5KHXA 3F66A 3PSBA 3FSKA 4RBLA 1XH7A 4U7ZA 4C02A 5F94A 4PTCA 2FUMA 4D58A 3C5UA 4IAYA 3O5AA 4ORKA 4XP3A 4NWMA 3LFDA 5E92A 3C4CA 1I44A 3V01A 4EQMA 4W4XA 4ACHA 4CV9A 4Z7GA 2W17A 4AFEA 2CNVA 5HO6A 4ERWA 5M08A 3R9NA 4RT7A 2R0IA 3Q9ZA 3R28A 4D4SA 5E8YA 5J87A 4YTHA 4G6OA 3C4XA 4DEEA 1V1KA 3BHTA 4U43A 1RDQE 4QQTA 1GAGA 2JKMA 3NX8A 3OOGA 5DT0A 3CQUA 1H28A 3VS2A 2FA2A 5H8EA 3L1SA 4FSQA 2CNQA 4JQ7A 4FRFA 4Y85A 3MI9A 4O4FA 3WF9A 4F7LA 4FEVA 2BALA 1JWHA 3FWQA 4DGOA 3ORNA 3PPJA 3FMHA 4XLVA 3HA6A 5EHLA 4HYUA 2IN6A 3QCYA 1ZY4A 3P86A 4C58A 3PE1A 5DHJA 4D0XA 5IEVA 4FV7A 4TT7A 3VS6A 4DG3E 5CTPA 1YW2A 4DLIA 2IPXA 4PNIA 3EZRA 3D14A 4OTQA 4YHJA 2WMWA 4J53A 4XG4A 1NY3A 2XK9A 3RPOA 3A99A 2QLQA 3UIXA 4RIYA 2RFEA 2WMRA 3GCVA 4BCFA 4ENYA 1IG1A 3E3BX 1JKTA 3FL5A 5EDPA 2OO8X 3VF9A 3SGCA 2VTLA 4OTPA 3UO5A 2P55A 1M17A 4IAZA 3KMMA 4IFCA 2WQEA 4I4EA 4CTCA 1U46A 1XQZA 1W0XC 2X0GA 1REKA 2VNYA 4O0UA 5EM8A 3RJCA 4U79A 5AADA 3FC2A 4FKJA 3OS3A 3FY2A 3AT3A 3JXWA 3LQ3A 3P5KA 4I92A 5BX0A 4QQ5A 2NRUA 3FLZA 3NAYA 1WVWA 4A9TA 3EKKA 5KMOA 2VWXA 3TG1A 5IZFA 1ZRZA 2C0OA 3MS9A 2UZEA 4HVIA 1TZDA 3KVWA 3QKMA 4GYIA 4AE9A 1UNGA 4HW7A 5L2QA 4FTIA 3QZIA 4RC3A 3UDBA 5C03A 5IUIA 1TQMA 4QOXA 2FB8A 1FGKA 5FQDC 4D1XA 4QDVA 1H0VA 1H07A 3ZEWA 5IQIA 3RINA 3NZ0A 2BILB 4G17A 3WOWA 4NZWB 4C3PA 5HIEA 3MA3A 4BDBA 2UZWE 2V55A 1LUFA 5EG3A 2BHHA 5AUZA 2CGUA 3UE4A 3E8NA 4DYMA 2ITXA 5JGBA 4ZK5A 3RI1A 2J5FA 2XNPA 2OBJA 3BZ3A 4OBPA 4KINA 3F82A 3JY0A 3HRCA 4MNEA 2IJMA 4HGEA 1P5EA 3LFQA 3DKFA 2WXVA 4MBJA 5LVLA 1Q3DA 3PXQA 5CVGA 4DCAA 4H36A 4YJVA 3QQFA 2PMIA 3NW7A 4DGNA 2W5HA 4QMMA 4E4NA 4EKLA 3ZC6A 4C4EA 2XRUA 3TCPA 1J7LA 2JAVA 2WQMA 3R00A 4TN6A 4CRSA 2C6MA 5ANDA 5EM5A 3WIGA 2OG8A 3ENHA 5HI2A 5L2IA 2J90A 3P08A 4DBNA 4O96A 5EQPA 1FINA 3U54A 2CCIA 3VS1A 2J7TA 4IVAA 5B2KA 3PG3A 1OECA 4BDCA 1E9HA 2YIYA 2WQNA 2YZLA 4FEQA 4EH9A 3KK8A 4N0SA 3V5TA 4A4XA 3PTGA 2XJ0A 3BQCA 4MVFA 2XKDA 3PJCA 3T9IA 3GU8A 3ZFMA 3KXMA 3FLYA 4XG7A 2VZ6A 3LCOA 4AS0A 2EXCX 2BDFA 4LGDA 5CQUA 3ZFYA 3W0OA 2WFYA 4L01A 4NCTC 3PZHA 3IDCA 4F78A 4L3PA 3U9NA 5I3RA 3P7CA 1Z5MA 3ZDUA 5DE2A 1H0WA 4ZS4A 3C0IA 4CMUA 4F70A 3ROYA 3GCPA 4JDKA 1ERKA 2GFSA 2PTKA 1MRVA 3BCEA 3BE9A 3CR0A 3RZBA 4CMTA 4FT0A 4V05A 2W1ZA 3LMGA 4BKYA 5FP6A 3AKKA 4H3PA 4X3FA 3WI6A 4FV0A 1XBBA 5CSHA 2EXMA 5KZIA 1GIJA 5HICA 3DK7A 1OKYA 3TZ7A 4I5CA 3LQ8A 4I24A 1YWRA 2WHBA 4QYYA 2P33A 5BQ0A 4BBEA 3BU3A 2X4ZA 4FV3A 3LE6A 3UOKA 3E92A 3UQGA 4AA5A 1ZWSA 4OTGA 5I9UA 5A4EA 5ETIA 4G6LA 4EUTA 4ZEGA 4TNDA 2WMVA 2IVVA 5HBHA 5TR6A 3UTOA 2WIPA 3DS6A 3VBQA 1M2RA 3VJNA 3C4ZA 2X2LA 4WBBB 3VW8A 2XAOA 2XKFA 3CGOA 4IQ6A 4MHAA 4ZS0A 3S3IA 4D9TA 4YTCA 2ERZE 3C0GA 2WELA 5DEYA 5AX9A 1OKZA 5GZ8A 3K3IA 4CZTA 5CU0A 3LM0A 4OLIA 5CSXA 5AP4A 3QQKA 4X2KA 2BHEA 3S00A 4JQEA 5FP5A 1GZKA 4C57A 1XWSA 3F2AA 4FKVA 2VO7A 3LFCA 5DR9A 1UNLA 2C47A 1XJDA 4WSQA 1PXOA 3EWHA 3NUXA 3H0YA 4DITA 3VF8A 3D9VA 3S0OA 3QCQA 5AUYA 3OTVA 5DBXA 5ETAA 3MH1A 4XX9A 5HKMA 2P3GX 3TN8A 2HZ0A 3EL7A 3P78A 3D2KA 3QTRA 4IDTA 4L46A 3WBLA 5IUHA 1NW1A 1RQQA 3GU6A 4PP9A 4ZLYA 5IQHA 3QRJA 3KY2A 3I7BA 5JMSA 4G9CA 3W0RA 4J71A 2R3MA 2R3JA 2WO6A 2R3GA 3AC3A 3ZM4A 4M97A 4PDOA 5IA1A 4IB5A 2QVSE 4YLJA 3FC1X 4JLCA 3CTJA 2F7XE 2OGVA 2XK3A 4G5PA 4U81A 5ACKA 2R3HA 4PRJA 5CXHA 5HE0A 3DXPA 5FLFA 4GH2A 3MVHA 3E7VA 3LKMA 4FV1A 1BL6A 4IMYA 4OAVB 4N57A 3UBDA 4KRDA 2YLFA 5IQEA 5DRBA 2AYPA 4D2TA 3PFYA 2G2HA 4FKIA 3A7FA 3ZYAA 5GJDA 2X6DA 3NUAA 1R1WA 5I3OA 3V04A 2QO7A 4BI2A 4F63A 3AGMA 4O7SA 1F5QA 3C51A 4HCUA 3VRZA 2AUHA 4O2PA 4W4WA 4LV8A 1NXKA 4FMQA 4CXAA 3MFTA 1Q99A 2I0EA 5CAUA 4EOLA 5E1SA 4GK3A 4ERKA 3FV8A 2C3LA 3QZHA 2WPAA 3FKNA 4H1MA 3RM6A 3TV6A 4ZSEA 2JIVA 3F5XA 3QWKA 5KKRB 4ZTRA 4V01A 4HVGA 2DS1A 2OXXA 2WTKC 4KSPA 4NK9A 4BTFA 3MPTA 1JNKA 2Z02A 4BGQA 2XIXA 5HBJA 4OW8A 2CJMA 2W96B 4X21A 3QUEA 1AGWA 1Q62A 4JS8A 1IRKA 2GNIA 3UODA 3ZUVA 1G3NA 4AXEA 3ZUUA 3FY0A 2OI4X 4X0MA 4FTUA 5GHVA 5JGAA 3FI8A 3C1XA 2VGOA 5LARA 4AZVA 4O1OA 1NT2A 4FEXA 4FNZA 2W05A 5AV1A 4UX9A 4A9UA 1PYXA 3CIKA 2PHKA 1H1QA 3DU8A 1UVRA 5DI1A 3VWAA 4BDIA 3EH9A 4GIIA 5AA8A 5IMXA 2W1GA 2ZM3A 3R8ZA 2PZIA 2JAMA 3F69A 4IE9A 4ZOGA 2WAJA 4FV2A 5J79A 4QMQA 1CKJA 3L9LA 3D4QA 5DNRA 5CX9A 2I7QA 3ML1A 2VTMA 3QUPA 4O0RA 4EC9A 1OIUA 4FIIA 3U51A 2W1EA 4QMLA 1WBOA 3A62A 4LYNA 4TNBA 4IVDA 2J6MA 3WARA 3FMEA 5IPJA 1URWA 3Q4TA 4IH8A 3CCNA 4YZBA 2WMTA 2NNWB 4YURA 1CMKE 4WO5A 4UMPA 2QOIA 4F9YA 2GS7A 5BUJA 3O8UA 5DR2A 4K6ZA 3ERKA 1QPCA 5FBOA 3FHIA 4QTEA 3FUPA 5E8VA 4ANMA 3ZZWA 5AA9A 3NCGA 1ZOHA 3LFFA 4IVCA 4UV0A 5ANJA 4YZMA 3BEAA 3QTIA 3RAWA 4O7WA 3LFAA 5FEQA 3ZXTA 4USDA 4S33A 1Y6AA 3GC0A 3I0OA 4WD5A 4QRCA 3P23A 2F7ZE 4XLIA 3MVMA 5JFVA 5HG9A 4R3PA 2ZV7A 3MY0A 4ZLOA 2ITTA 1M7QA 4NM0A 1CKIA 3FQSA 5KX8A 5BPYA 2PMLX 5IA3A 3PUPA 4P4CA 2LAVA 4F1MA 2RIOA 4BTKA 1OGYA 3ACJA 3ZO3A 1KE5A 3UMWA 4FK3A 2C3JA 4EZ3A 3FQEA 3KXXA 4KA3A 4J8NA 1SVGA 5ANGA 2A2AA 4IIRA 5EH0A 4AXAA 2OZAB 5KUPA 2C0TA 4IX6A 4PL3A 3VS0A 2ITYA 4L44A 3DAKA 4E6QA 1JAMA 5IA4A 4TYGA 4ANBA 2GMXA 4I5HA 3PSCA 4E20A 3DQXA 2YCSA 3CBLA 4IWOA 5DH3A 5CSWA 3POZA 2HYYA 3R9DA 3ZS5A 3OCTA 2O65A 1LR4A 4APPA 2HZIA 2DYLA 3VS4A 4JIAA 5AP6A 3VO3A 2QCSA 2YDIA 3MDYA 4YNOA 3MIYA 3ZDIA 4EOSA 1YWNA 3FMDA 3BELA 4G31A 5FGKA 3CD3A 3R6XA 2CN5A 2JBOA 4G2FA 3TV7A 2R7BA 1IA9A 4GT4A 1KE6A 2PZRA 4FVPA 4EK8A 1P14A 1U54B 5D1JA 4C61A 4F7SA 4I6QA 5AUXA 3AOXA 1IEPA 3MY5A 4RX9A 3V5QA 4NW5A 1YXXA 3ZO1A 5HD4A 2W0JA 3TIYA 5J7BA 3P1AA 4WRGA 3JUHA 4DEBA 4X6RA 4QT1A 3F7ZA 3QD0A 3MESA 3VRYA 4A9YA 3ORIA 4O21A 4U9AA 3JPVA 4QP2A 1UKIA 1SNXA 4PX6A 2FO0A 5AV2A 2B9IA 3W16A 3R02A 4TWPA 2X2KA 4O83A 2J0JA 3UPXA 4DC2A 2PUNA 2GFCA 4M69B 4YC6A 1YHWA 4IM3A 2ITPA 1OM1A 1UU3A 4BDKA 5I5ZA 3NFFB 3VBYA 4OBOA 3FYKX 1WZYA 3FMKA 4KABA 2IW6A 4N6ZA 2WB8A 1H1RA 5HEZA 1PMUA 4O91A 3NSZA 3R7VA 3S1HA 3N9XA 2YISA 2VX0A 4FTLA 4U3ZA 4E5WA 4PUZA 3UO6A 4XOZA 4O7ZA 4RIWB 3POOA 3R8UA 4AN3A 2C5YA 3A4OX 1GNGA 4FEUA 1GOLA 3BYUA 3MW1A 5E8UA 2WTVA 5G6VA 3MSSA 3BI6A 4NTSA 4QTCA 5C1QB 3OCGA 2W9FB 2OIDA 4YC8A 4BDHA 2XNEA 2C6TA 4IB0A 2REIA 3LLAA 1W82A 3UG2A 3FXXA 1PKDA 3OUNB 2Z7RA 4ZSAA 3LCTA 5M4UA 2OWBA 2VTIA 3ATTA 4KWPA 3TKHA 4FT7A 1YOJA 4OTRA 2NRYA 4V04A 3UGCA 3ZEPA 2BPMA 4MWIA 4E6CA 4YJUA 1Q3WA 4RJ6A 3BGZA 5C8MA 3QLFA 2GDOA 4TYIA 4DTKA 3MH0A 4PL4A 3OROA 3CQWA 4F0FA 4F65A 5E9EA 1TKIA 5LOHA 5FD2A 4KBAA 3O8TA 2VRXA 1FVVA 4FV8A 5EW8A 3TIZA 3W2RA 5A4LA 4C4HA 2QU6A 2JDOA 3DAJA 2X39A 3WYYA 4QP3A 4FGBA 4A7CA 4CKRA 4U45A 4W9XA 2YFXA 4Z3VA 4RZWA 5CU6A 2RL5A 3DV3A 3G6GA 1PXLA 3I4BA 3R1QA 4I6LA 3SHEA 4YO6A 3ORKA 4U40A 3GB2A 1XO2B 2UZTA 5HNGA 5AR2A 3WZJA 3D5WA 3KFAA 4RWLA 4MUQA 2G15A 4RIYB 4TPTA 3I79A 4XNEA 4YZNA 4E26A 4QMTA 3MVLA 5LCKA 3R71A 3TNIA 3LOKA 4RMZA 4EUUA 3VS7A 2G2IA 3QTZA 1XR1A 4EK3A 4MK0A 5KMNA 4ZTLA 2OICA 2CGXA 2UW5A 2RFSA 2PK9A 3COIA 1JOWB 4ZTHA 3G51A 3KGAA 3QHWA 4O86A 3UVRA 5IUGA 4F08A 2GQRA 3GU5A 3IW6A 5E8XA 4QP9A 5KHWA 4FIEA 3W32A 5JQ8A 3LCKA 2I1MA 2WTIA 2HY0A 1VEBA 2RFDA 5FEEA 4CZUA 4RGJA 3NPCA 4D2SA 2YM6A 3Q9WA 5EYCA 3EQPA 4XG6A 1E1VA 4IC7A 3RVGA 4QEBA 4TYHA 2V22A 1VYWA 1Y8YA 3NEWA 3FQHA 4Y5HA 4YPDA 5HG8A 4C4GA 2PSQA 2VN9A 2XNOA 2ZOQA 1SVEA 3CS9A 1MQ4A 2R3IA 3OHTA 3MJ1A 1Y91A 2GHLA 5D10A 4XG8A 4UMQA 3ZLYA 3A7JA 5HVKA 2OLCA 3AT2A 2ITNA 3MGYA 4XBUA 4CMOA 3SRVA 1BUHA 3A4PA 3C7QA 2XANA 2R3QA 1XH5A 2PZ5A 3QRTA 4GU9A 4XS2A 3RNYA 4MNEB 5KMMA 2B52A 4I5MA 4NFNA 5EM6A 5HVJA 4RJ3A 2UW6A 5DWRA 2JITA 3DBCA 3FMNA 1Q24A 5AP7A 3VS5A 4E73A 5HLNA 4HPUE 1HCLA 1WBPA 2DUVA 3E3PA 3FPQA 4FSTA 4ANSA 3B2WA 4ZTSA 3BYOA 4RQKA 2OFUA 4RZVA 1OPLA 4XH6A 3AQVA 2QU5A 4NCTA 1OB3A 3BQRA 3VBWA 4ID7A 4GG5A 3W2SA 2WOUA 3D83A 2X1NA 4ZSGA 4ALVA 3BLRA 5EYMA 4HZSA 2C3IB 5EOBA 3OBJA 2NO3A 5DGZA 5HNBA 3EL8A 3FMJA 3VS3A 2R2PA 3R1SA 3U8WA 3F5PA 4YZCA 3WZEA 4R5SA 5IA5A 3W18A 4CYIA 1FVTA 3SXSA 4UMTA 3Q6WA 1HOWA 3FDNA 5LMKC 4JG8A 5C26A 1YDRE 5M4FA 3HP5A 3VQHA 2GTMA 4G9RA 4GIHA 2RG5A 4GUBA 4PMMA 2BZKB 4I41A 3RBWA 5CEMA 1RW8A 2VUWA 2IWIA 4D4RA 4W9WA 4EKKA 2HK5A 3NWWA 3EN6A 4QPMA 3U55A 3EQFA 4LRMA 1MRYA 2PUPA 2OZAA 2NPQA 4MTAA 5A3XA 5ETCA 5FEDA 3RAIA 4AZEA 4L45A 4AGWA 4NSTA 2XJ2A 2VTQA 3CTQA 3HV6A 3IO7A 3DKOA 4LRJA 4QMWA 3H9OA 3UVQA 2CGWA 3OMVA 4FIGA 4HYHA 3KVXA 3QYWA 4RG0A 4X3FB 3W2QA 5CT0A 3EFWA 1PY5A 1OBDA 3PWDA 2NP8A 3KF4A 3PJ3A 4IXPA 2CKOA 3BHUA 2YJSA 4FICA 5B0XA 1R0PA 2WOTA 1YRPA 3E5AA 3RWQA 2YA9A 3F3TA 1SZMA 3HV5A 5CALA 1F0QA 2B9HA 4E5BA 3PG1A 4F6UA 4MD7E 1GY3A 4FTTA 3L8VA 2XALA 3W0QA 4LOOA 2YABA 3BHHA 5BVOA 4KSQA 1EH4A 2UVXA 2Z7QA 5DPVA 2XRWA 5I0BA 4AZWA 3DPKA 1H00A 3DT1A 3EOCA 2WD1A 2OSCA 4FTCA 4DFXE 2CHLA 3SAYA 5CXZA 3TJDA 4O7YA 3PVBA 3JR1A 5KE0A 4QTDA 4BCGA 2O63A 1K2PA 3SXFA 4ASDA 5IQDA 2YIWA 3NNVA 3GCSA 2YDKA 3PE2A 3I7CA 3ZBFA 4H1JA 2H96A 4IDVA 3DJ6A 3N4UA 3VUIA 2XNGA 4GFMA 3W1FA 5I9ZA 3KXZA 1TQPA 2GS6A 4RRVA 2GCDA 3QYZA 4D1ZA 3DTCA 2QQ7A 4IX3A 5HLPA 2XIYA 1UWHA 3PZEA 3HMMA 3VN9A 2VX3A 5HORA 1QMZA 4HYIA 5M51A 3HAMA 3TJCA 1J3HA 3IQ7A 4EJ7A 2Y6MA