3MI9A

Crystal structure of hiv-1 tat complexed with human p-tefb
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
337
structure length
328
Chain Sequence
VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Cell division protein kinase 9
publication title Crystal structure of HIV-1 Tat complexed with human P-TEFb.
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 328
sequence length 337
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2010-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3mi9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3mi9A01
3IPHA 3MBLA 3E93A 2YWPA 5DI1A 5HCYA 5TT7A 4XG8A 2YIWA 4M8TA 4HVGA 3U4UA 3QXOA 3OT3A 2WOTA 2WMUA 5DEYA 3LFSA 4LUDA 3O7LD 3UDBA 3R9DA 3NNVA 3FMLA 4IACA 3UIXA 1ZMWA 4MWHA 1YWRA 3MVHA 5A4EA 4BBMA 4PDYA 4FE2A 2CGXA 2UZEA 4U0IA 3C5IA 2BHHA 4BZOA 4E93A 4DCAA 2BDWA 1Q4LA 4E6AA 4HNIA 4AWIA 1FGIA 3OBJA 3ODYX 3OY1A 4O0TA 5HIDA 1M17A 5IQDA 4BCPA 3AC1A 3A60A 4MD7E 3TNIA 3HMMA 4AT3A 3KULA 1FPUA 4QP1A 5K4IA 2YERA 2BALA 3QTUA 1Y91A 2YDJA 5CT7A 3ZCLA 4E4XA 3M42A 4IWPA 4X3FB 3DXQA 2XIZA 5HG5A 3FZSA 4C37A 4FTOA 5IA5A 3L9LA 4L3LA 3W2RA 2GNHA 4GVAA 3EL7A 2BAKA 4AZEA 1IA9A 3R28A 4JQEA 3DLSA 2PZPA 3QC4A 3W8QA 2YCFA 2E9OA 4M69A 4MAOA 3BCEA 3QD0A 5EOBA 1PY5A 4UMPA 5M44A 4G3CA 4PP9A 5JFSA 5L2IA 5CT0A 4PF4A 2XB7A 4FIHA 3RCJA 3KMUA 4OR5A 3TL8A 3HP5A 4MH7A 4ALUA 4XP2A 4EBVA 2OSCA 5BUJA 3K5UA 1V0PA 4YJSA 3ACJA 4OW8A 1ZWSA 3PVWA 5J79A 1MP8A 4RSSA 3BBWA 2HK5A 4FT0A 4FA2A 3L9MA 4EOPA 2Z8CA 2X7OA 3VS7A 2RFEA 4M97A 3FXZA 4DCEA 3R7UA 2XS0A 4EKLA 3VBYA 2YITA 5D9HA 3VJNA 2UZWE 5CAUA 4L01A 3JUHA 3VC4A 4DFYA 4YBKA 3FLSA 4C36A 4RC3A 5CEIA 3VJOA 3F3UA 4NEUA 4BDEA 3EFWA 4BZDA 3AG9A 4AGWA 4Q5HA 4FSMA 4ENXA 3MWUA 2VO0A 2WMBA 5CI6A 4YJQA 3QQGA 4ANMA 3ZLSA 5ANDA 3OCBA 4YPSA 3FJQE 4YSMA 3FUPA 5L2QA 4M0ZA 1HCKA 2G2HA 2SRCA 3UTOA 4D9TA 3QQJA 2XCKA 3I81A 4BWPA 4CD0A 4E3CA 2ZM3A 4DFBA 4Q2AA 5E8TA 3VQUA 3FI8A 4YZDA 4QMWA 4RX5A 2Z60A 4WRSA 5LVNA 1BYGA 3TZ7A 4BC6A 4LI5A 3RALA 2GPHA 2RIOA 2J6MA 2F57A 3KRJA 4QPAA 4R7HA 5HNGA 4QQCA 4DFZE 2CDZA 2OBJA 4X2JA 2VTTA 2W1IA 4FICA 3GT8A 1ZOGA 3PJ8A 4EQUA 4W4XA 3DXNA 3OOMA 2UZLA 2WU7A 1KE5A 3DT1A 3IO7A 5DA3A 5FUTA 4BBFA 4WRGA 4FTLA 3VS5A 4FTQA 3OT8A 2GNFA 2GTMA 4TYHA 3UP2A 3DJ7A 4ANLA 5JFXA 4WOVA 4I4FA 3AOXA 3E8DA 3FKNA 3LHJA 4TYGA 3F3VA 4K6ZA 4XG2A 4QTBA 4Y95A 3RNIA 4TW9A 4Q5EA 3DFAA 4BCQA 3MTFA 5AP1A 1H24A 1XH8A 2E9NA 2WOUA 1DAYA 4KRDA 2FYSA 3D4QA 3SC1A 5C8MA 4XUFA 2QO7A 4J99A 3A8WA 1WVYA 4WUAA 1ZXEA 5KHWA 4FTJA 4XBRA 3E62A 5HZNA 4TWNA 3QTSA 4YC8A 2R3HA 3MB7A 3MIYA 1ZYLA 4L42A 4BVUA 3CSVA 2P3GX 2WQBA 3JYAA 4EH7A 2PVNA 4GKHA 2J0LA 4DBNA 2BRBA 2ZDTA 5BVKA 3REPA 3RZBA 4EC8A 2WQOA 5EFQA 3RK5A 4DEDA 4V04A 1ERKA 2YISA 5KHXA 3RPYA 3D15A 1WBTA 2HW7A 3O51A 1EH4A 5E8SA 2REIA 4XCUA 1IR3A 4M13A 4XLVA 3PPKA 3DZQA 1SM2A 4IVBA 4QMUA 4DTKA 2W9ZB 1OVEA 4DTBA 4FV2A 3NVKI 4FV3A 3GC0A 5IQAA 4NM7A 2W4OA 3OEZA 3DAKA 3V5PA 1SVEA 2XA4A 5LOHA 4IB5A 4KRCA 3IDCA 5JMSA 5JT2A 3D2IA 4O2PA 5AMNA 4U42A 2I0YA 4IWDA 3PP0A 3AC5A 4GVJA 1IG1A 3RK9A 4OBOA 4RZVA 1H1SA 3P7BA 4CG8A 3PG1A 4I6HA 1TQIA 2GFSA 4JI9A 4R1YA 4EH4A 4F65A 2IW8A 4YUQA 3SG8A 2X7FA 3AQVA 1BL7A 3FLYA 1G8AA 5AR2A 3ATSA 2R0IA 3R1SA 4C35A 3SDJA 4KKGA 2GQRA 5HIBA 4J53A 3UBDA 3R9NA 4U81A 4I93A 3T9TA 1ZMUA 4N70A 4F7NA 3BGZA 3EMGA 4FIEA 4PUZA 5DGZA 1VEBA 5AUZA 3N4UA 1H1QA 4QMVA 5CSWA 5I9VA 3D7ZA 4AA4A 2C0TA 1UNHA 2QD9A 2QLQA 3OEFX 3PXRA 3QZFA 1PF8A 3NUXA 3R1YA 4R3RA 3SXSA 2W1DA 4OTPA 3TEIA 3WI6A 1NA7A 4FKVA 4Y83A 5KNJA 5LQFA 4XRLA 3ALNA 3BGPA 3LJ1A 4EH2A 4C4FA 3TACA 5IEXA 3SGCA 4D5KA 2HXQA 3SKCA 5K5XA 4JXFA 3VS6A 5AP3A 4FYOA 3P79A 3LKMA 1H27A 2OF2A 4PV0A 4QYFA 4QP3A 4GUBA 3JY0A 4BI1A 3GGFA 4ZTNA 1F3MC 2ERZE 3ANRA 4DBXA 2ITNA 3LMGA 1QPEA 1JOWB 4YO6A 4FV1A 3QTIA 4WG4A 4I92A 4FL3A 3VHEA 2IVTA 3PIZA 4FKIA 4FKLA 4RX7A 3KF7A 5LVLA 1YHSA 4NM5A 1IAHA 3MVMA 2IZSA 3GB2A 4I20A 5I3RA 2B55A 4DH3A 2B9FA 4UX9A 3N51A 1YQJA 2C3JA 2JKQA 3VUDA 4F7SA 4WNPA 1KSWA 3SX9A 5M09A 3NAXA 4W8DA 3TIZA 4FEQA 4ZJVA 4J52A 2E2BA 3CTQA 5IDPA 3NUAA 5LMKA 1KE8A 4GK2A 2J0KA 3CBLA 4KBAA 3PG3A 2G2FA 4CFNA 2GCDA 4YZCA 5AADA 2QOHA 5M4UA 1H4LA 3R8VA 3ZBXA 4PY1A 4JR3A 1W84A 1KE7A 5L2SA 2QOIA 2QVSE 3ZMMA 4ASEA 3CD8A 5HVYA 3VS1A 4IBMA 3ZRKA 2B54A 5M4FA 2PULA 1LEWA 2VAGA 2F7XE 2VTLA 5EH0A 1PKDA 2PVHA 3EQFA 3ZLYA 1GZOA 4ACGA 5A14A 1PRYA 3GCPA 4WUNA 2CKPA 5IA1A 1R78A 4Z7GA 2BHEA 4A9RA 2I40A 3V3VA 3NUPA 1GIJA 1NXKA 2PE1A 1G3NA 3AMBA 3P23A 4GMYA 2GQSA 5CEOA 4L7FA 4F9YA 4EK5A 4QP7A 2W96B 4BDCA 2X9EA 4FTAA 4A07A 4F7LA 1TKIA 3F5GA 3UJGA 3TDWA 2OO8X 3HGKA 4FT3A 3WF7A 1GIIA 3AGLA 4W4YA 4IIRA 4OTHA 2PVYA 5DE2A 4DFNA 5BVNA 4IFGA 3CJGA 3S95A 1YXXA 4QMPA 3UYTA 5HQ0A 1XWSA 3DQWA 5L8JA 2XBJA 4FZFB 3EQDA 4RIXA 3OG7A 4DTAA 3Q3BA 3L9NA 3QLFA 3QRJA 4K0YA 4WKQA 3OF0A 3DTWA 4XV9A 4ZSLA 5AP2A 4ITHA 5FGKA 1GNGA 1IA8A 3VUKA 3R7GA 3A7IA 3BBTB 4HGTA 3BZ3A 3WARA 4I3ZA 4MBIA 3MIAA 4L46A 3PPZA 4CQEA 4I24A 1R1WA 2WQNA 3D94A 4HPUE 5ETAA 4DGMA 3QXPA 1O6KA 4R8QA 5KO1A 4F0IA 4RA5A 4D0XA 4DG0E 4QYHA 3RBWA 2X8EA 3EYGA 3DBCA 3BYUA 2RGPA 3KEXA 3MS9A 5AUTA 2YZLA 2O63A 3MSSA 3KXNA 2IW9A 2JAMA 3M1SA 5CQWA 4DGLC 1L8TA 3O96A 1YXSA 2H34A 3BHVA 4E4LA 4O22A 4KABA 5GINE 4TY1A 3MY5A 2W0JA 3MYGA 4U7ZA 4BDIA 4I21A 1YXTA 1YWVA 4IX6A 4JRVA 3KMMA 4W9WA 3D2KA 1FBNA 4RJ8A 2IO6A 5AV2A 5L8KA 2VU3A 3KK9A 2XF0A 5DVRA 2XBAA 4FV4A 4BRXA 3V04A 5KKRB 2W5BA 1JVPP 2XKFA 2UW0A 3BGQA 4H3BA 1ZOHA 4EHZA 5M08A 1W83A 2YAAA 4QYGA 4AT4A 1ZZ2A 4EH9A 1GZKA 3MI9A 3NSZA 1J1BA 2JGZA 2YA9A 3QTQA 4FGRA 4MNFA 2B7AA 4G16A 5DH3A 3UOLA 5FDPA 3HDMA 2VNYA 3CGFA 1WVXA 2OJJA 4FK3A 2R0UA 2WMAA 3F9NA 3NZ0A 4W9XA 3BWJA 2ZB1A 1FINA 2J50A 2YIQA 4WG5A 3Q4ZA 5TO8A 4APPA 2B4SB 4MNEA 5CAOA 1JQHA 2RFDA 4Z9LA 5AX9A 4XMOA 3VBWA 2J7TA 3KCKA 5CASA 3UNKA 3C5UA 4G9CA 3BLHA 3NW7A 3FSFA 3OROA 3TTIA 5EYMA 3LXKA 3R83A 4A9TA 3Q4TA 4USDA 4BCOA 5K0XA 1Y8YA 3VUMA 3A62A 2HWOA 2V7AA 1GZ8A 2YM5A 3FZRA 4GL9A 4IHPA 3F3ZA 3ELJA 4KKHA 1UA2A 1G5SA 3Q6UA 3QF9A 2WTIA 3Q6WA 2FSTX 5GIOE 4ANOA 2WTKC 4MXXA 4KA3A 4HYUA 4XLIA 3MFRA 2PMNX 3PRIA 2OZOA 2NNWB 2W99B 3TJCA 1H1RA 4USFA 5E8UA 4EUTA 3LCSA 1BI7A 3IECA 4DG3E 5AFVA 3GU8A 4AOIA 2W4KA 1H28A 2CNUA 4AW2A 3RGFA 4X0MA 3R22A 5IQGA 3E64A 4O7WA 2CLQA 1XBAA 3EQHA 1ZMVA 3EFJA 2HIWA 4XG7A 3PJ2A 2EB2A 2EU9A 3FKLA 4BF2A 5BYLA 5FP6A 5CU0A 1J7IA 2WAJA 4FSRA 1G8SA 4GUEA 2O64A 2HAKA 4UV0A 3EFKA 2YCRA 5L4QA 3O17A 5E90A 5BNJA 5IQCA 4WIHA 4Y46A 5CSHA 5H2UA 5AP6A 4BCNA 2QQ7A 4IM0A 3K5VA 3U51A 5JRQA 3FXXA 2GMXA 1SZMA 2VTMA 3E87A 4QPSA 4W4WA 2OFUA 2C5OA 2WTJA 3DDPA 4IVCA 4O2ZA 4UXQA 4V0GA 5LVMA 2ZDUA 3DAJA 4A4XA 4H58A 3BU3A 5IG1A 2IVVA 2OICA 5CAQA 2OJFE 4IXPA 4ZMEA 5EI6A 3Q4CA 1U59A 5DFPA 2P2IA 4I5CA 3ZM4A 5JFWA 2HW6A 2OH0E 3ROYA 5IA0A 3LXPA 3Q2MA 5HG7A 1H08A 3SRVA 1KOBA 3VF9A 4C3PA 5J5TA 4BI0A 3C7QA 3DB8A 3BEAA 4JBPA 3R7YA 3PIXA 4BDKA 5IEYA 5C4KA 4IAFA 3FWQA 4KBCA 4QP4A 1Q8UA 2FSMX 4PL3A 4G6NA 2Z7SA 1SVHA 4GS6A 4CV8A 2I1MA 2VWUA 3EYHA 4FV5A 4E6QA 2R3QA 5IMXA 3U55A 4LL0A 4G3FA 1R0EA 2OIQA 3QYZA 3ZXZA 5GJFA 5DR9A 3OXTA 3G90X 4BYIA 3LAUA 5EDPA 5K3YA 4CSVA 1OUKA 5J5SA 2WMWA 4AZVA 2A19B 2UVXA 2O5KA 4GKIA 3DS6A 4JX3A 4M0YA 3KL8A 5HVKA 4GK3A 3LPBA 2HCKA 4PDOA 4LGDA 5JQ5A 3LFDA 1YKRA 4RIOA 2EXCX 3QD4A 4OT5A 1P14A 3T3UA 4BFMA 3ZBFA 3UQCA 3VF8A 3CGOA 4QYYA 1M2RA 1Q8WA 2BPMA 3C0HA 4AN3A 4ZSAA 2CHLA 4OGRA 3NUYA 5D7VA 4EK6A 1WCCA 4AW1A 4AZWA 5BX0A 4FL1A 4YTFA 4LG4A 4ALVA 1NW1A 4EZ3A 2VWBA 3ERKA 4UXLA 2V0DA 3F6XA 1UU9A 1W8CA 3FE3A 3NNXA 3WYXA 3F2AA 4DFLA 5DHJA 1BMKA 3M11A 3ZLWA 4I23A 2Y8OA 5CF8A 3R71A 4AACA 2CKEA 3M2WA 4IANA 3O0GA 3SV0A 4HVSA 5FEDA 3TZMA 4NYEA 4GJ3A 2J0JA 5J9YA 4QO9A 3ZZEA 4ALWA 2VTIA 4FSQA 2EVAA 4RRVA 5CEKA 4QMMA 3I0OA 4GEOA 2X6EA 1ZY4A 2FB8A 3KKVA 3JY9A 4D55A 3ORXA 4BWKA 4JL9A 3G6HA 2ITXA 2UZTA 2Y6MA 4Y73A 3FMEA 3PRFA 5HNBA 3TV7A 4IE9A 1Y6AA 5HI2A 3QQKA 2YLFA 4IM2A 4NZWB 3O71A 3PPJA 1H0VA 4AZTA 2Z7LA 3VO3A 2XKDA 4X3FC 4HZRA 4BL1A 1QCFA 2R2PA 3VW8A 2QR8A 4I1ZA 2CN5A 3EQGA 4I5HA 3VHKA 4AFJA 2BFXA 4DG2E 2YFXA 5EDRA 3PE1A 1L3RE 4JLCA 4UBAA 4NIFB 4I41A 5M51A 3DLZA 2X8IA 1S9JA 4YHJA 4C4IA 1UV5A 4G5JA 5JK3A 3G5DA 4OTQA 3HRFA 4O6LA 2VWWA 3EQIA 4D0WA 5KMOA 3PJCA 3R0TA 3OZ6A 5DIAA 3LCOA 4GYGA 3C4XA 4TL0A 4FKTA 1BUHA 4EKKA 3AT4A 3BHYA 5IQFA 2BUJA 4HCVA 2VWVA 4CMOA 5KZIA 3GU5A 3QGYA 4L9IA 4QMYA 4G3EA 1UKHA 2OF4A 3ZTXA 3CIKA 3PY0A 3FL4A 2JBPA 5ANGA 4FG7A 4AF3A 3FL5A 4R3PA 4LMNA 3A4PA 4Y85A 2PK9A 3S2PA 3GCSA 2B9HA 3FZOA 2UUEA 4KSQA 2W17A 2XZSA 3A7FA 3CP9A 3DOGA 5CEMA 3VBQA 3OTVA 3I7BA 1B38A 4QQ5A 2W5HA 5JZNA 3SRVB 3C9WA 3EQCA 1F5QA 4F63A 4WT6A 4FT5A 4H1JA 4RZWA 5EDQA 3TNHA 2BVAA 3SAYA 4NW6A 3LQ3A 2C6KA 4RWIA 1Q24A 5B2KA 2OXYA 4NFMA 2YDKA 3VBVA 4CMUA 1S9IA 2WPAA 1UVRA 1YHWA 1T46A 2QODA 5FQDC 4G3GA 3LLTA 3N9XA 4U97A 5DT4A 3R30A 1JKLA 3WF8A 5CYIA 4FSWA 3RTPA 4C7TA 3FKOA 1BLXA 3OWKA 1J7LA 3C13A 2VO3A 4WHZA 2R3PA 3RK7A 5JH6A 3B8RA 2BRNA 5BMMA 3EH9A 3ORIA 4Q9ZA 4AP7A 3ZM9A 4BTJA 1P2AA 5KBRA 2JBOA 4UMRA 5BUIA 4KKEA 4BWXA 3QAME 1OUYA 1YRPA 2PMLX 4U40A 3UODA 3GENA 4OTRA 4YJOA 2CGVA 4LOOA 5CU6A 1VR2A 3WOWA 2XIKA 4EK8A 4FTNA 5FG8A 3JXWA 4GG5A 3U4WA 2XMYA 4PMMA 4QRCA 1Q8TA 2QURA 2F49A 2H9VA 4HJOA 4PRJA 2YM6A 5HICA 4A9YA 4O83A 5AV0A 2VZ6A 4CRSA 3GCVA 4JVGA 3O8PA 4BKZA 4DE4A 4CEGA 1ZYDA 2HZ0A 3I6WA 4O0XA 5AUYA 3FI2A 4D1ZA 4F1TA 2PMIA 2W9FB 5AA9A 4O7SA 3D9VA 4BGHA 4C4HA 2OJGA 3UOKA 3FEGA 3HMPA 3KF4A 4DFUA 3PXZA 5F1ZA 3R9HA 3ACKA 4DLJA 4ACDA 5L6WL 4KINA 1Q3DA 2QOCA 5BUEA 3CPCA 3UMXA 2JITA 1MRVA 4Y8DA 5F94A 4D2VA 4DH1A 3GFEA 3UMWA 4IADA 3PWDA 1AD5A 4KIOA 4L3JA 1UU3A 2JDTA 1QL6A 2WTWA 4L00A 1GZNA 3HZTA 3V6SA 4IAZA 3QQUA 5AM6A 5I3OA 1PYXA 4LGGA 1OB3A 2DS1A 2XEZA 5EM6A 3P9JA 4H39A 3KVWA 1XHAA 4FEVA 4YNEA 1OL5A 5IZFA 2PSQA 2J5FA 2F2UA 4H1MA 1I44A 4JJRA 2R3MA 1CKPA 1JAMA 1XBCA 3K3IA 3L1SA 4LUEA 2ZV9A 5LCKA 3UO6A 1PMUA 1BL6A 5BYZA 3F5XA 1WVWA 3HV4A 3W16A 3UG1A 1OL2A 4F64A 3HAVA 4W4VA 3LCDA 4UN0C 2ETKA 3SXRA 1H8FA 3FZTA 4B99A 2HOGA 1XBBA 2E9VA 1YDRE 2XNOA 4EORA 4FIJA 3UQGA 4O91A 1OECA 3MA6A 4AZFA 3Q9ZA 3W2QA 4D5HA 4KB8A 2RFSA 1WBPA 4Y5HA 4PNKA 2HYYA 3POOA 4BDDA 3TKHA 4EH8A 3PVBA 5AIRA 5CXZA 2JKMA 3PE2A 1NVSA 3MJ2A 3QA8A 4M68A 4FGBA 4PPAA 3MFTA 4QOXA 2VTPA 2XNMA 2QOOA 3QZGA 4YLJA 1U46A 3AMYA 4HOKA 4OUCA 4R3CA 1WFCA 2WO6A 2WU6A 4QQJA 5FM2A 4DEBA 3MH1A 4E73A 2QC6A 3VRZA 3RAWA 3V8SA 5I4NA 2PVJA 4IAIA 2H6DA 4QMXA 2FSOX 4G2FA 5J1WA 5EW8A 5DYJA 3CE3A 4JBOA 2ITWA 2PZIA 1OKYA 4ACCA 4UWBA 2CN8A 4N6ZA 3NPCA 4FTRA 5BVDA 4D4VA 3HMNA 1OKWA 2BRGA 4B7TA 2PVLA 4XV2A 5C26A 4AN2A 3C0IA 4FYNA 4ZTSA 4LFIA 2QR7A 4UMTA 3QRTA 4ITIA 1ATPE 1CSNA 3HUBA 3I7CA 3JR1A 2QOKA 4DHFA 3LQ8A 3KXGA 3RI1A 2RFNA 2XNEA 2QG5A 3P86A 3D5VA 4AU8A 2GHGA 4JDIA 1U54B 2ONLA 3R8ZA 3VS2A 4IZYA 3ZZWA 3KU2A 3P78A 4O27B 4O7ZA 1LPUA 4M14A 4QMLA 4YHTA 3VBXA 4DINA 3W2CA 5AR8A 3I4BA 2PVRA 4TWCA 5FTQA 4J97A 4FVQA 2BDJA 4E5BA 4EEVA 4X2FA 3ZO4A 4Z3VA 3L8VA 5CVGA 2C5YA 1M14A 4TWOA 1V0OA 3QUDA 4E4MA 5M57A 4AA0A 4GG7A 1CM8A 1OI9A 3EQRA 3TUCA 4GFGA 3DA6A 2IW6A 1J1CA 3E92A 4LM5A 4GFOA 3DBEA 5E4HA 5H9BA 5CENA 4ONAA 5ANKA 5EYKA 4UB7A 4DGGA 1J7UA 1XO2B 4FEXA 2ZV7A 4RLLA 4QMZA 3I6UA 4YTIA 4ZZMA 5CAVA 1WBWA 3PLSA 1WAKA 5JQ8A 3E3PA 5CALA 3ORPA 5DBXA 3FHIA 2B9JA 5J7BA 2CPKE 2P0CA 3MPAA 4MKCA 4ANSA 5FDXA 5CVFA 2C5VA 3TV4A 5BYYA 2PE2A 3R63A 5CVHA 3AMAA 2UW4A 4J8NA 4ZK5A 1IAJA 5EQPA 3KC3A 2WMVA 3BPRA 3LM5A 4LL5A 2YJSA 1PJKA 4AX8A 1B6CB 5M4IA 3BE2A 3RJCA 3QCYA 3BIZA 3QRKA 3VUGA 4L43A 1PXPA 3OWPA 1J3HA 1PW2A 4HPTE 4C3RA 2UV2A 2DWBA 3W55A 3QLGA 4JX7A 3FMMA 4AA5A 2W1ZA 4ERWA 3MV5A 5E8ZA 1PXMA 3NYXA 3UNJA 4F6SA 4YC3A 3KREA 4QMTA 2OXXA 5IH4A 3WYYA 1ZYJA 5E8YA 3ULIA 2WKMA 1LP4A 2XUUA 4AGUA 2O0UA 2WEVA 3F88A 5HE2A 2XCHA 3U9NA 5LMBA 4U3ZA 4IVAA 4B0GA 4KS7A 4JR7A 2OXDA 3R7OA 2QU6A 5LMAA 3WE4A 4BDHA 2WELA 4L67A 5A4LA 1H07A 1SVGA 2OGVA 3QTRA 3E3BX 4I4EA 5KCVA 4CZYB 2GS6A 3R04A 4D2PA 3ORNA 3G0EA 4FIFA 4BDAA 1PYEA 2NRUA 1JBPE 3EIDA 4LV8A 4O6EA 3MVJA 4MWIA 4OTFA 1RE8A 4QQTA 3UVPA 5LVOA 3DPKA 5B2LA 5HU3A 5KMIA 2PE0A 4FT9A 4ANQA 3V5QA 3C4FA 3D5WA 2YM8A 3BV3A 5IQEA 4EQMA 4JG7A 1QMZA 2H96A 4UMQA 1Y6BA 3MH0A 4U5JA 2ETMA 4U3YA 5CQUA 4PDSA 1F0QA 3U6HA 4EOJA 3BHUA 3VAPA 5AR7A 5HE0A 3LCKA 5CU3A 3V5WA 3ZYAA 3IGGA 4I6QA 4LOPA 5JGBA 5DWRA 4BN1A 1OIRA 3QZHA 5I0BA 4HW7A 5IF1A 1ND4A 3SG9A 4BICA 4U6RA 4IM3A 3SOCA 5LWMA 2HENA 2X81A 5DT0A 2CJMA 4JBQA 3OVVA 3B2WA 3G33A 1Q41A 3FMDA 3MH2A 5FEQA 3EN6A 4RC4A 4RVLA 4CFVA 3OTUA 3LFBA 4MTAA 1B39A 3IW8A 3GXLA 3COIA 4WA9A 4HNFA 4EH3A 5KMLA 4F1OA 1M7QA 1TQMA 2NO3A 2X8DA 3EFLA 3UVQA 4CLIA 4ZY4A 4DAWA 3ULZA 2R7IA 5CTPA 4IAKA 4XBUA 4D4SA 5LMKC 3AT3A 5EQEA 4K18A 5GHVA 3C0GA 4YZMA 5BVOA 4GCJA 4FKQA 4YSJA 5A4TA 4XX9A 3PVUA 4RA4A 3TN8A 2VRXA 1K3AA 3H10A 2GQGA 2J0IA 2VO7A 3BI6A 5KMMA 1PXNA 3FZPA 3PXFA 4G31A 4IAYA 4M3QA 4O1OA 3VW6A 2ITTA 3EN9A 4AAAA 3R00A 4EJ7A 5A46A 1VYZA 2V55A 4P7EA 2E9UA 4NJ3A 5B0XA 4LQMA 3LFAA 4RMZA 3VUHA 1MUOA 2WMTA 2YM3A 3OCGA 2XNGA 3IDPA 2B1PA 2FGIA 1PMVA 3OCSA 4MXYA 4FUXA 4QPMA 4AT5A 2UZDA 2C1BA 4ZLOA 3ANQA 3LIJA 2WD1A 4RT7A 4YR8A 3DK3A 2VTOA 5AR3A 4IDTA 3NEWA 4O1PA 5CF5A 3KRRA 4J95A 4CTCA 3CC6A 5B7VA 5JGAA 3EJ1A 4ORKA 3UZRA 2Z2WA 4FL2A 2YABA 4B8MA 3R1NA 1RDQE 2Y7JA 2EWAA 4CVAA 1ZAOA 3RAIA 3LJ2A 3RKBA 3GVUA 4AW5A 3NX8A 4JG8A 4KIKB 2R3RA 5AAFA 4XNEA 2F2CB 5HORA 4DT8A 2F4JA 5I5ZA 5GNKA 4XV3A 4BDBA 5JKGA 5M07A 4GT4A 4L68A 3NIEA 3FMHA 5GJDA 3VS4A 2RG5A 2BKZA 1PXOA 3U6IA 4ZJJA 5HOAA 1Q62A 5D12A 4BTKA 3C51A 4OT6A 2HZ4A 4S34A 4L44A 3QD3A 3R7VA 3QBNA 1Q3WA 2W1EA 3FLZA 3G0FA 4PWNA 4EJNA 1PXJA 2C3KA 1MRYA 4G6LA 4ACHA 5JFVA 3LOKA 3MA3A 1LEZA 3RINA 3UG2A 3PFQA 3KMWA 2J51A 4FK6A 5CWZA 2X2MA 5CI7A 4XS2A 4ZXTA 1SYKA 5IH5A 5LXMA 3KCFA 5T3QA 4FNWA 4HGEA 3TXOA 2XH5A 2Y0AA 1STCE 2R3FA 3I1AA 3QUEA 1I09A 4X21A 4DH5A 3FAAA 2JKOA 3HMOA 3POZA 5TE0A 2PL0A 4XOZA 2Q83A 4EL9A 2PUIA 5EHYA 3RM6A 3JVRA 1H01A 3JPVA 3DBQA 2I7QA 2JFMA 4RGJA 5HD7A 3TDVA 3GNIB 2W1GA 3L8PA 3RPVA 2YZAA 3CLYA 3ZO2A 2C69A 2C47A 2J5EA 4YJPA 2C6OA 4XOYA 3GEQA 2CSNA 3HKOA 3QQFA 4EHVA 3GC9A 4IB0A 4IZ7A 2A1AB 4L45A 4JOAA 4A4OA 3EN7A 4OTWA 4L7SA 2P2HA 3F69A 2R3KA 2VTAA 3NUNA 3ENHA 3O8UA 4PTGA 3A7GA 3MFUA 3WF6A 2ZVAA 1GJOA 3A7HA 3R02A 4FTMA 3UIUA 4BB4A 2VTRA 3TZ9A 4D2SA 4Z7HA 3WZDA 4BYJA 4FNYA 4FV7A 4FNZA 1JNKA 1JSUA 2QCSA 3KRXA 4NW5A 2I0VA 4RJ3A 2LGCA 5AR4A 4C3FA 2WTDA 2R3OA 3UE4A 4DLIA 3BHTA 3H3CA 5CSXA 3ZC6A 5EYCA 4S30A 4CFWA 4MXCA 1SMHA 3BU5A 4J71A 4TT7A 3W18A 1DM2A 4CYIA 5CF4A 3FYJX 3QHWA 1Q99A 4RVMA 3SW4A 3GC7A 3QA0A 1JWHA 3VULA 4UY9A 4AG8A 2DQ7X 3ZUUA 4B6LA 4IB3A 5C1QB 1OL6A 1H0WA 2FH9A 1FQ1B 2X2LA 3ZHPC 3QALE 4IJ9A 5HG9A 5IKWA 3DXPA 3GOKA 2YHVA 3KY2A 1OIYA 2IG7A 4ZP5A 1OL1A 3Q9YA 3QGWA 3Q5ZA 4N57A 2C1AA 4CCBA 3R7EA 4DH8A 3BELA 1E9HA 5FEEA 2G2IA 4FUYA 1URCA 2VTQA 4GIIA 3PTGA 4CKRA 4CLJA 2EUFB 4ZTQA 4RX8A 2JFLA 4M15A 3CD3A 4RQKA 3DK6A 4I0RA 4DEIA 5FXRA 1XR1A 3I5ZA 5TF9A 4O7YA 2XK7A 2YJRA 4NIFA 4F70A 5AEPA 2QG7A 3SA0A 5EM8A 4ANBA 4AE9A 3ZOSA 3CXWA 2PZ5A 3ZLXA 2OKRA 1WBOA 3HP2A 3AD5A 3PY3A 4E6CA 4ZS0A 4FEUA 4L3PA 2HY81 2IN6A 2O3PA 1JPAA 3HRBA 4GYIA 5CZIA 4EZ5A 1CMKE 3FPQA 2W1HA 2PZYA 3DDQA 3LM0A 3T9IA 3DFCB 1CKIA 4O0UA 5ACKA 4IW0A 3LFQA 4RJ5A 4GT3A 3VRYA 3TM0A 2VGPA 3PA3A 5L8LA 2WTCA 3BYSA 5AR5A 4WBBB 4ZTHA 4FV6A 1GIHA 4NWMA 3KXHA 4FVRA 4WNKA 3V5TA 4XG6A 4I5MA 4K77A 3AGMA 4Y5QA 2E9PA 4BKYA 5EYDA 4EQCA 3W8LA 5M53A 2DYLA 3GI3A 4K33A 4Z55A 5DMZA 3TG1A 1OGUA 4O7VA 4NKSA 1ZYCA 3FQSA 3TCPA 4B8LA 2QOFA 3CY3A 3NAYA 4ZY5A 3LFEA 3BKBA 3NYNA 3IS5A 4I5PA 2Y4IB 4FKGA 3VQHA 3V01A 4EOSA 3UO5A 2CMWA 2PWLA 3WE8A 3NR9A 4M66A 4RIWB 4S33A 3TUDA 2B0QA 1OM1A 2GTNA 3PXKA 3ZFYA 4OBPA 1H26A 4MQ1A 2Z7RA 4YJUA 2CKQA 4N0SA 2PUPA 4FOCA 2EXMA 4R5SA 4G9RA 3GQIA 5FRIA 1Q97A 4ASZA 1FVTA 4FF8A 1QPJA 2A4LA 2DUVA 2YCQA 1K9AA 3EKNA 1IEPA 1V0BA 4PX6A 3DKGA 3DY7A 4BKJA 2JC6A 2QO9A 3BYMA 3Q4UA 4FX3A 4ZIMA 1VZOA 4YBJA 3NDMA 2HWPA 5C9CA 2FVDA 5JGDA 2V62A 1WBSA 4GU9A 4K1BA 3PZHA 4Q9SA 3WIGA 5L6OA 1NT2A 1XH7A 2GS2A 3DCVA 1E1XA 4U45A 5DN3A 3G2FA 4FTIA 4IX3A 5ETFA 3RM7A 3UNZA 4F9WA 5HTIA 2PZRA 2C30A 2VNWA 3H30A 2V7OA 4LOQA 2I0HA 3I60A 4ZZNA 4MEDA 2PYWA 5I9WA 4PMTA 3ET7A 1JSTA 3B8QA 3CQWA 3HV7A 3F61A 4FTUA 2UZVA 4O0RA 2QHMA 2J9MA 4F0FA 3F7ZA 4PPCA 2RF9A 2WQMA 3NLBA 5J95A 4O7RA 3EB0A 3IGOA 4RBLA 5FTGA 4YLLA 4GK4A 4AOJA 3FMNA 4JQ7A 3MY0A 2R5TA 3CKXA 3LZBA 2PU8A 2G15A 3F2NA 2ETRA 4CGAA 3COKA 2BCJA 1V1KA 2JD5A 4X6QC 1HOWA 4XP3A 4U44A 3OD6X 1KV2A 3NUUA 4FSZA 3WZKA 3QWJA 4AUAA 3KB7A 4QMSA 1YXVA 5E8XA 4N6YA 2JDSA 4DGOA 4XG4A 3U87A 1ZRZA 3NUSA 4PTCA 3ZC5A 5HX6A 2HXLA 3D7TB 4EK4A 4EYMA 2Y4PA 4E5AX 2XIXA 4YTHA 1YOJA 4BCJA 4O0SA 4R77A 3TNQB 4RFMA 2X7GA 2XK6A 3HA6A 4O96A 5DRDA 5I9XA 3TNPC 5AX3A 4CXAA 3IW4A 2F7ZE 4CFXA 2KTYA 3DU8A 3F82A 3QQLA 1O6YA 1Q8ZA 2UZOA 4TTHB 4DEHA 1PHKA 4JBVA 5HLNA 5IH6A 3VNTA 2XRWA 4CKIA 2BKKA 2JDVA 2VGOA 4ZTLA 4C2WA 2CKOA 5CZHA 3OWJA 4D2RA 3OXZA 4PNIA 4YZNA 1XQZA 3QTWA 5EI8A 3OFMA 5HEZA 2C5NA 1ZLTA 3FI4A 5D11A 4A9UA 3P0MA 4CQGA 2R9SA 4AS0A 4OAVB 3SXFA 4XH6A 4ACMA 3GQLA 4G17A 3DK7A 3LW0A 2ZM4A 5D7AA 4EOMA 2F9GA 2ZMDA 5J8IA 3IOPA 3EQBA 3IK3A 3HMIA 2CGUA 3HA8A 4M67A 3S1HA 2WTKB 2WQEA 2VWXA 2A2AA 2LAVA 3UC3A 1DI9A 2UW6A 3N4TA 3DNDA 3VVHA 3FMJA 3HEGA 4R7IA 3PJ3A 3PXQA 2IZRA 4EBWA 4ASDA 4MHAA 5IUGA 1OPKA 4UALA 5AUVA 5H8EA 3OW3A 5C8NA 5HBEA 2VX1A 4C33A 4L52A 4EWHA 5EK7A 1XH4A 2QOQA 4IB1A 2B52A 4TRLA 1AGWA 5CEQA 2BFYA 4FIGA 4U41A 2YM4A 4C02A 5HU9A 5J9LA 4HCUA 3KGAA 2X0GA 4K2RA 3FXWA 4PL4A 1U54A 4MD9E 3BHHA 5EHOA 4APCA 3MGYA 3KA0A 4FBXA 5FP5A 3CEKA 3G9NA 4O0YA 5ETIA 2YEXA 2O2UA 4ZY6A 2BDFA 1BX6A 2QKWB 3CCNA 3TKIA 4BZNA 2Z7QA 4C34A 3BX5A 4FV0A 4DH7A 3UPZA 4H05A 4FZ7A 1YOLA 2PY3A 4AOTA 2GNIA 4NCTA 5AV4A 3VBTA 3RCDA 3NYVA 5EG3A 4FSNA 4M7IA 3LXNA 2JIUA 4TN6A 3FQHA 4IX4A 3HDNA 4MVFA 2YIRA 4P2KA 3OMVA 1KUTA 2J90A 4BHZA 2ESMA 2BAJA 1YOMA 4II5A 4CTBA 1BI8A 4FTKA 2C6TA 3ZDUA 1O6LA 1XH9A 2H8HA 3F66A 3FDNA 4C62A 4CFUA 4A9SA 3PSDA 4FKPA 5CX9A 3QX2A 3R6XA 3MTLA 2OIDA 1UU8A 2WXVA 5AAGA 2XIYA 2OJ9A 2XP2A 3C50A 2UW3A 4L8MA 3DJ6A 4FSYA 4C4EA 1FMKA 4TKSA 3PXYA 3E63A 3DQXA 3HECA 1OKVA 3UZPA 2ITPA 4E20A 4F0GA 5KX8A 4RJ6A 5I9ZA 2ZMCA 4ZZOA 4X2GA 2KULA 5EW3A 4F9AA 3RHKA 1JKTA 2ZYBA 4MD8E 3ZH8A 3HLLA 4BCMA 3P7AA 4YJNA 3ZRMA 5C27A 3OOGA 3Q52A 4HYIA 3QRIA 2V5QA 4UYAA 4HVHA 4LRKA 3PA5A 2FO0A 2OLCA 4YNOA 3MH3A 4QYEA 4L6QA 5CU4A 3THBA 2R4BA 2BTRA 4W8EA 2W4JA 1VYWA 5KMKA 5IQHA 4UWYA 3ZEPA 4X2NA 5IUHA 2BZHB 2XK8A 3UOHA 3PJ1A 2CCHA 4IDVA 3A99A 4GU6A 4PDPA 3DAEA 4ENYA 1UNGA 4C4JA 5A6NA 3RAHA 4ID7A 3ZSHA 3GCQA 4F4PA 4FZAB 3E88A 5A4CA 2IVSA 5HBJA 3W2SA 3HV5A 3AC2A 3AC8A 3V5LA 5HNIX 2CNQA 2BILB 4R5YA 2XIRA 2RKUA 3FZ1A 1ZY5A 2O8YA 4UYNA 4PTEA 4DFXE 4XV1A 1A9UA 3GP0A 3ODZX 2OZAB 3S4QA 3GFWA 3S00A 2BIYA 4JT3A 4RVTA 3IW6A 1H25A 3K2LA 5AP4A 4RIYB 3RMFA 2UZUE 2WFYA 3G15A 2IVUA 2R3JA 5HO6A 4AE6A 4IZ5A 4EI4A 2WEIA 4GFMA 2V22A 3MPMA 1YHVA 1Z5MA 3GCUA 3MPTA 3NW6A 3PP1A 1MQ4A 4TYEA 5GZ8A 3P7CA 4QMQA 4EH5A 4HCTA 4E6DA 2VTSA 3I5NA 3W32A 1Q8YA 4QTCA 1W0XC 3FYKX 3A4OX 3Q04A 4BIEA 3O7LB 3QD2B 4FKUA 5E9EA 4ZSGA 2PUUA 3QZIA 3QYWA 4C59A 3ORMA 1DI8A 5L6PA 2AC3A 3UP7A 3S3IA 2W06A 5DRBA 1VJYA 4NSTA 4YJRA 3O8TA 1GY3A 2ONLC 3IG7A 4XRJA 3Q9XA 3V51A 4CT2A 4U9AA 3NNWA 4U79A 1U5RA 3W1FA 4A7CA 2JLDA 3P08A 4I6FA 3DJ5A 3U54A 5JSMA 3SOAA 4E4NA 4TZRA 5LJJA 2PPQA 3MW1A 3BRBA 4C61A 1Z57A 1X8BA 4AW0A 3PSBA 3LFFA 2I6LA 1R3CA 2F7EE 3F5PA 2ITYA 5D1JA 3FC2A 3E5AA 3U9CA 4D9UA 3HV6A 1JLUE 1QPCA 4RLKA 3RVGA 3P1AA 5LCJA 4JDKA 4G6OA 1UWHA 5AP0A 4DA5A 5HE3A 1LR4A 2QO2A 3MB6A 4RFZA 3A8XA 4GSBA 3R8UA 4EK3A 4EONA 3PY1A 3C4EA 4HVIA 4ZJIA 5JEBA 3ATTA 3F2RA 5FTOA 5L2WA 1REKA 4E1ZA 5AA8A 3EL8A 4WSYA 1FVRA 3PUPA 2WNTA 5IA4A 3RHXA 2BZJA 3R01A 5IA3A 3ZO3A 4JIAA 4EC9A 4ERKA 4YTCA 4K9YA 3RNYA 4MK0A 3HV3A 1ZYSA 3IW7A 4OLIA 3ZFXA 4CZUA 4MCVA 2P4IA 3FY0A 1SNUA 4FV8A 3PZEA 4KAOA 4J8MA 3HRCA 4WBOA 2X4FA 2EB3A 2GNLA 4AZSA 5AV3A 5IA2A 5IMEA 2BTSA 5EKOA 1CTPE 2VTNA 3F3WA 4HZSA 4B4LA 4MF1A 2C5XA 3OY3A 3FPMA 3TTJA 3PLAE 5EQYA 3IW5A 4FKSA 3QKMA 4AQCA 4E5WA 1Q61A 3UYSA 1K2PA 4YP8A 2OW3A 5HCXA 3CJFA 4PMSA 2R64A 1YDTE 5TR6A 1Z9XA 5M4CA 4GT5A 1U5QA 5AUWA 3NIZA 4KBKA 2FSLX 4IWQA 4S32A 4TYJA 4O0WA 5AP5A 4BIDA 4KIKA 5DR2A 3TZ8A 4FKRA 1NY3A 1APME 1ZARA 4LMUA 4BCKA 5L2TA 3BV2A 4AXAA 5IPJA 4XEYA 1OBDA 5C4LA 2X4ZA 4O82A 3GU7A 3KRWA 2JEDA 3UIMA 4EUUA 3VUTA 3HX4A 3QC9A 5HTBA 4UZHA 5AV1A 4O7TA 2GHMA 2ITOA 5D10A 3ALOA 4TXCA 2WMXA 3W10A 4QD6A 4CZTA 5BPYA 4F7JA 2GNGA 3KRLA 5KUPA 2RSVA 2XNNA 4IEBA 4IZAA 3AD4A 3ZU7A 4O7NA 5E1EA 4ZS4A 5DT3A 5FWKK 5KMNA 3QHRA 2QLUA 4FKJA 3II5A 5E8WA 5AWMA 4OTGA 4JIKA 4FG8A 3R2YA 4BGGA 4IH8A 1ZOEA 2XYUA 2ZAZA 4FKWA 2ZV8A 3GC8A 5AAEA 3FSKA 4JAIA 4JNWA 1UWJA 3G9LX 2UZNA 3P5KA 4ZSJA 3KK8A 3PIYA 1UNLA 4XG9A 4AGCA 1AQ1A 4EOIA 5M56A 4O84A 2ITVA 2R3GA 4ZEGA 5CY3A 4YMJA 5JRSA 1OIUA 3C1XA 5BVEA 4YJVA 3U6JA 2ZV2A 3DB6A 4A4LA 2UVZA 4V01A 5A54A 3CR0A 4RG0A 4QTEA 2B53A 2JIVA 4EZ7A 5E8VA 3KULB 3FY2A 3CPBA 5KKRC 2OI4X 5HG8A 3LXLA 4R7BA 4F9CA 4IJPA 3KXXA 5A9UA 3UC4A 1P5EA 3NCGA 1JKKA 4HYSA 3QU0A 4U80A 2Y9QA 5ANEA 4DYMA 3L8XA 2CNVA 2YDIA 5ANIA 5LWNA 2XM8A 1UU7A 4NTSA 1MQBA 4MBLA 4EHGA 3RPRA 2XYNA 3Q96A 5ANOA 2OG8A 3QWKA 4M69B 3LQ5A 2CCIA 2YLEA 2UW5A 1E1VA 3BLRA 2ITQA 2ITUA 3CTHA 5M06A 1YW2A 5B2MA 2PVFA 5H3QA 4D4RA 4H3PA 4KWPA 3R7IA 2W1FA 2OH4A 5AIKA 3Q2JA 2YIYA 3TT0A 4FVPA 3EN4A 3ZEWA 3LJ0A 3Q53A 4I6BA 4CYJA 4FG9A 2OU7A 4DC2A 2XRUA 3E7VA 2AUHA 3QQHA 4YHFA 5DNRA 3RP9A 4DEGA 3F3TA 3PVGA 1M2PA 3TIYA 4UEUA 5IEVA 1FMOE 4B9DA 4PP7A 5KBQA 3G51A 4TNBA 3EZVA 2GNJA 4FC0A 2QHNA 1OL7A 2QOLA 1W7HA 5IISA 2EXEA 1IRKA 2J4ZA 4K11A 1OZ1A 3PA4A 5EHLA 4IC7A 3OP5A 4FSUA 5J7HA 2P33A 1UKIA 2W5AA 4CNHA 4X2KA 5CNOA 5J87A 3HVCA 3CTJA 2CGWA 5FM3A 4BIBA 5A3XA 4P5ZA 3U8WA 4RVKA 3WZEA 1DAWA 4RJ7A 5BVFA 1GAGA 2C6MA 3FI3A 4V05A 5HLWA 4YZBA 3TV6A 1OPJA 1PMEA 3AD6A 3IONA 5CF6A 4IQ6A 4OBQA 2AC5A 1OMWA 2HZIA 3QL8A 3FC1X 3MESA 4GIHA 4G3DA 4LV5A 3COMA 3B2TA 4EH6A 4QP6A 3TUBA 4NFNA 1RJBA 4TPTA 4MXZA 2C0IA 5M55A 4FOBA 4D58A 4ZMFA 4MXAA 3MDYA 2PHKA 3OW4A 4RPVA 1QPDA 2WIPA 3UIBA 4ZLZA 2XK4A 3ENMA 3KVXA 4QMNA 4D4YA 3LLAA 3O23A 3NVMB 3DKCA 4O38A 2OJIA 3NW5A 4FZDB 4I0TA 4NUSA 5ITAA 3LMHA 4FNXA 4TYHB 3IDBA 4J7BA 3TWJA 5ICPA 4BCIA 2XJ0A 3H0ZA 5LARA 3LE6A 4Y72A 4C4GA 3ZO1A 2C6EA 3QX4A 4AFEA 3O2MA 2UVYA 5FD2A 3QTZA 5DPVA 3OC1A 5AJQA 5CSPA 4EOKA 4TWPA 4KNBA 3MY1A 2PVMA 2Y4IC 1FOTA 5T6KA 3E8EA 3EHAA 3C4CA 4UMUA 5K4JA 3COHA 3EWHA 4QP2A 3O50A 2C4GA 2BAQA 4S2ZA 2XVDA 5HVJA 1J91A 2ACXA 3VS3A 2X2KA 4BCFA 2HELA 4F09A 5AP7A 3EZRA 4RWJA 2JAVA 5JN2A 4HGLA 2QOBA 4N4SA 1Y8GA 4F08A 4RIWA 4GRBA 3UGCA 3ORZA 4X7QA 5IUIA 3AC4A 4CCUA 3E7OA 4OAUC 3ZUTA 5HCZA 4Z16A 1R0PA 2UW9A 1M52A 4YZ9A 3OCTA 3Q9WA 2YM7A 2Z02A 4XP0A 3RPSA 4C57A 3LFCA 4IVDA 4FIIA 4NK9A 4BDFA 4C8BA 4O7LA 4KIQA 3Q5IA 5HESA 4OTDA 4DEAA 5AM7A 1HCLA 3RWQA 4YPDA 4ITJA 5DEWA 4NTTA 5CSVA 5C03A 3S0OA 3FMKA 4NJDA 1JKSA 2R3LA 3QTXA 4QTAA 2J2IB 2A27A 2QI8A 1YXUA 5F4NA 2PTKA 4PPBA 3GUBA 4NU1A 3DGKA 5BMSA 4ZAUA 4RQVA 4FSTA 4DN5A 1RQQA 3QKLA 4JQ8A 3DBDA 4R6VA 3VN9A 1KE6A 2GS7A 3HL7A 5FLFA 4CT1A 4XHKB 4EOQA 4KS8A 1FGKA 2Y6OA 3R9OA 3K54A 3ITZA 5I9UA 4S31A 2VX0A 4ASXA 3C4WA 3BQRA 3SD0A 4CMTA 2VO6A 3NNUA 2BIKB 2WIHA 4ANNA 2XM9A 4H36A 4EOLA 1P4FA 3I0QA 1M2QA 4DEEA 3NMUF 1TVOA 4IMYA 1H1PA 4CV9A 4O21A 2ERKA 2RL5A 2UW7A 4J1RA 4ZTMA 3SHEA 2I0EA 5HTCA 4KD1A 2ZM1A 4BCHA 5F20A 5HE1A 3V5JA 3TNWA 4AN9A 5L3AA 2RG6A 4WD5A 3UVRA 4E26A 3AXWA 3UOJA 1A48A 5D41A 2A0CX 5E91A 4BR3A 3LCTA 3D7TA 3ZFMA 3K3JA 3WBLA 5ETCA 2X6DA 3NYOA 3PYYA 4PQNA 1W82A 4LGHA 2OFVA 3ORLA 1YWNA 3VWAA 5HIEA 5F9EA 3SVVA 1PKGA 5FXSA 4ZSEA 2HZNA 4YC6A 3T8OA 4BBEA 2BZKB 2YN8A 4DT9A 4F6WA 4RX9A 4BI2A 4FZ6A 4YLKA 5HO7A 4F6UA 4KIPA 2JKKA 5G6VA 3CS9A 3Q60A 5CS6A 3SLSA 1XKKA 2BROA 2OWBA 5TKDA 4NT4A 4RFYA 2JDOA 1ZZLA 2GU8A 4E8AA 5GZ9A 2GHLA 4RJ4A 4WNMA 2XK9A 2Q0BA 4BDGA 3E8CA 3QUPA 4AGDA 5I9YA 1GOLA 2GFCA 5IU2A 5EOLA 3DZOA 3BE9A 4GH2A 2NRYA 4USEA 3KFAA 1JSVA 2XKCA 1OPLA 2C6LA 3HNGA 1CDKA 5H8BA 5CANA 3PWYA 3TI1A 4WSQA 4MX9A 3GOPA 3VS0A 2VN9A 3H4JA 5FBOA 3SW7A 2X39A 3NWWA 4BGQA 3IQ7A 4JDHA 4NL0A 4EOOA 1H00A 1FVVA 4J96A 4MQ2A 4RWLA 4IWOA 2VUWA 3R9RA 3ZONA 4DGNA 3UQFA 2P55A 3H9OA 3R2BA 3QCSA 2VWZA 5IQIA 4C58A 4XG3A 3IOKA 2WGJA 3AT2A 2ITZA 3AC3A 1YVJA 5T68A 3WZUA 3PDTA 4CFMA 2BRMA 4FKOA 1TQPA 4FMQA 4LRJA 4NKAA 5DLSA 4RIXB 3A2CA 2VTJA 2YWVA 2W1CA 2YCSA 3C4ZA 4NM0A 3H0YA 3OWLA 4LRMA 2J0MB 1OITA 2XKEA 3R73A 4FTTA 3FBVA 5CNNA 5GZAA 5AUXA 4M12A 1LUFA 3FV8A 4FODA 3CY2A 4JDJA 4XJ0A 4P4CA 5BVWA 1CKJA 4D2TA 1OBGA 5BQ0A 2C3LA 3MFSA 4MXOA 4NH1A 4HVDA 1U4DA 3P4KA 3WF9A 3IKAA 3ZSGA 3D83A 2G01A 4QP8A 3TKUA 1REJA 1R39A 1H1WA 1Y57A 1YI4A 2WMSA 3D5XA 4FV9A 4BCGA 4GJ2A 2W05A 3OXIA 5KE0A 2BZIB 2VX3A 3V8WA 5HO8A 4BHNA 4MF0A 4CG9A 2ZOQA 3OS3A 5G1XA 5IQBA 5AUUA 3FQEA 3ZS5A 3GU6A 4H3QA 4BTMA 3DBFA 5CEPA 4R78A 2JIIA 4C2VA 4FI1A 3ZSIA 2VWYA 4ZLYA 3KXZA 4CFFA 1M7NA 2C6DA 3BYOA 4FTCA 2PMOX 3WZJA 3FLNC 2B9IA 1KV1A 4I22A 5HLPA 3RWPA 3R21A 1WBVA 4JAJA 4YURA 5IDNA 2VWIA 3L9PA 4X6RA 5CXHA 4CRLA 4C0TA 5HX8A 4D28A 3SQQA 4J98A 2IWIA 1P4OA 4FT7A 4GV1A 4QNAA 5DOSA 3WIKA 4F1MA 3BEGA 5E1SA 3NRMA 4KUJA 2ZJWA 3FLWA 2R3NA 4O81A 4YJTA 2QKRA 3BQCA 3VIDA 5GIPE 3KQ7A 5H8GA 4YGAA 1URWA 2WMRA 4JS8A 4P5QA 4UZDA 4P90A 4U43A 4MNEB 5E7RA 3ZDIA 4BY9E 3BLQA 3OHTA 3OUKA 3KN5A 1T45A 3D14A 4I0SA 3KXMA 3RZFA 3DKFA 4QT1A 4RC2A 5ANJA 2OZAA 4G34A 4LYNA 5C01A 5EW9A 3W2PA 3WF5A 1PXKA 3MN3A 3D0EA 3PSCA 4XYFA 4RIYA 4ZOGA 2VV9A 5GJGA 3DTCA 4IFCA 5ACBC 2IJMA 5C8KA 3NS9A 3DKOA 4K8AA 3LMIA 3NCZA 4GW8A 3F5UA 4EYJA 2HY0A 3EQPA 4NM3A 5J9ZA 1DS5A 2NP8A 2PUNA 3CQEA 3QRUA 1MRUA 1KWPA 2BMCA 5KZ0A 5K9IA 3I79A 5LVPA 1KE9A 4X3FA 5HHWA 2FUMA 1BKXA 4RWKA 2FA2A 2BRHA 2GDOA 2UZBA 4WG3A 5F95A 4FR4A 4QTDA 4BDJA 4G5PA 4YO4A 4D1XA 1SNXA 2WMQA 5HBHA 4F9BA 3D5UA 3JVSA 3GU4A 3EN5A 1IASA 2WB8A 2WHBA 1PXLA 1OKZA 2CLXA 2Q0NA 2YACA 3F7WA 5FXQA 4I94A 4X3JA 2AYPA 3JS2A 5CU2A 4D1SA 3MJ1A 3A61A 2G9XA 3VUIA 5J1VA 2PVKA 3CQUA 4D2WA 4YU2A 4HYHA 2GSFA 3DV3A 1WZYA 1YI6A 2QNJA 1OIQA 2VD5A 2W7XA 2YAKA 3H9RA 3HUCA 4MBJA 4NCTC 4WO5A 5A6OA 5HD4A 5KMJA 4V0GB 3H9FA 5A4QA 3UZTA 4TYIA 3LVPA 4JRNA 5EI2A 3ORKA 2OK1A 2X1NA 3L8SA 4PL5A 4FEWA 5E92A 3NGAA 4HGSA 4C38A 3ZXTA 4F99A 4EWQA 2IPXA 3QKKA 3OUNB 2BR1A 2C0OA 4MYGA 4IAAA 4TNDA 3TJDA 2UW8A 4QMOA 5TOZA 1WBNA 3ZUVA 4QP9A 1NVQA 2JDRA 2QONA 2OIBA 2XNPA 1YI3A 3BYVA 3W33A 2IZUA 3HAMA 2VTHA 2XJ2A 4ZTRA 3QCXA 2C68A 4WNOA 2WZJA 4JG6A 4U8ZA 3GBZA 4QNYA 5K5NA 3MVLA 2QU5A 4ARKA 3A7JA 5DR6A 4G1WA 4O86A 4DF3A 2XNBA 1XJDA 5HKMA 3R8PA 3LFNA 3DNEA 5EM7A 3OBGA 1WMKA 2IZTA 4KSPA 1KOAA 5FBNC 3UO4A 3V6RA 2YIXA 1Q5KA 1XH6A 4A06A 2O65A 3QFVA 3FHRA 4O0VA 3BWFA 5EM5A 3G6GA 3V8TA 1PMNA 5JZJA 2XK3A 3QCQA 5HGIA 3ROCA 3T3VA 3ID6C 3N4VA 5EKNA 4IC8A 1XH5A 3RAKA 3R8LA 4CKJA 2C6IA 3EOCA 3EKKA 4IX5A 2WTVA 2ZB0A 3BU6A 5CAPA 3KN6A 4EHEA 3ORTA 4M84A 4L53A 5DG5A 1RW8A 3R8MA 3RPOA 3WILA 1A06A 3E8NA 3Q32A 1O9UA 1NVRA 2G1TA 5K0KA 3UPXA 3ETAA 3R1QA 3ZRLA 2R3IA 4R1VA 5CLPA 4BTFA 4OTIA 1PXIA 1W98A 4DITA 2XEYA 4UWCA 2C3IB 2XJ1A 3HYHA 1YDSE 3W2OA 4E7WA 4PMPA 2NPQA 2R7BA 2X9FA 3CKWA 3FLQA
chains in the Genus database with same CATH superfamily
3IPHA 3MBLA 3E93A 2YWPA 5DI1A 5HCYA 5TT7A 4XG8A 2YIWA 4M8TA 4HVGA 3U4UA 3QXOA 3OT3A 2WOTA 2WMUA 5DEYA 3LFSA 4LUDA 3O7LD 3UDBA 3R9DA 3NNVA 3FMLA 4IACA 3UIXA 1ZMWA 4MWHA 1YWRA 3MVHA 5A4EA 4BBMA 4PDYA 4FE2A 2CGXA 2UZEA 4U0IA 3C5IA 2BHHA 4BZOA 4E93A 4DCAA 2BDWA 1Q4LA 4E6AA 4HNIA 4AWIA 1FGIA 3OBJA 3ODYX 3OY1A 4O0TA 5HIDA 1M17A 5IQDA 4BCPA 3AC1A 3A60A 4MD7E 3TNIA 3HMMA 4AT3A 3KULA 1FPUA 4QP1A 5K4IA 2YERA 2BALA 3QTUA 1Y91A 2YDJA 5CT7A 3ZCLA 4E4XA 3M42A 4IWPA 4X3FB 3DXQA 2XIZA 5HG5A 3FZSA 4C37A 4FTOA 5IA5A 3L9LA 4L3LA 3W2RA 2GNHA 4GVAA 3EL7A 2BAKA 4AZEA 1IA9A 3R28A 4JQEA 3DLSA 2PZPA 3QC4A 3W8QA 2YCFA 2E9OA 4M69A 4MAOA 3PFYA 3BCEA 3QD0A 5EOBA 1PY5A 4UMPA 5M44A 4G3CA 4PP9A 5JFSA 5L2IA 5CT0A 4PF4A 2XB7A 4FIHA 3RCJA 3KMUA 4OR5A 3TL8A 3HP5A 4MH7A 4ALUA 4XP2A 4EBVA 2OSCA 5BUJA 3K5UA 1V0PA 4YJSA 3ACJA 4OW8A 1ZWSA 3PVWA 5J79A 1MP8A 4RSSA 3BBWA 2HK5A 4FT0A 4FA2A 3L9MA 4EOPA 2Z8CA 2X7OA 3VS7A 2RFEA 4M97A 3FXZA 4DCEA 3R7UA 2XS0A 4EKLA 3VBYA 2YITA 5D9HA 3VJNA 2UZWE 5CAUA 4L01A 3JUHA 3VC4A 4DFYA 4YBKA 3FLSA 4C36A 4RC3A 5CEIA 3VJOA 3F3UA 4NEUA 4BDEA 3EFWA 4BZDA 3AG9A 4AGWA 4Q5HA 2XANA 4FSMA 4ENXA 3MWUA 2VO0A 2WMBA 5CI6A 4YJQA 3QQGA 4ANMA 3ZLSA 5ANDA 3OCBA 4YPSA 3FJQE 4YSMA 3FUPA 5L2QA 4M0ZA 1HCKA 2G2HA 2SRCA 3UTOA 4D9TA 3QQJA 2XCKA 3I81A 4BWPA 4CD0A 4E3CA 2ZM3A 1XMLA 4DFBA 4Q2AA 5E8TA 3VQUA 3FI8A 4YZDA 4QMWA 4RX5A 2Z60A 4WRSA 5LVNA 1BYGA 3TZ7A 4BC6A 4LI5A 3RALA 2GPHA 2RIOA 2J6MA 2F57A 3KRJA 4QPAA 4R7HA 5HNGA 4QQCA 4DFZE 2CDZA 2OBJA 4X2JA 2VTTA 2W1IA 4FICA 3GT8A 1ZOGA 3PJ8A 4EQUA 4W4XA 3DXNA 3OOMA 2UZLA 2WU7A 1KE5A 3DT1A 3IO7A 5DA3A 5FUTA 4BBFA 4WRGA 4FTLA 3VS5A 4FTQA 3OT8A 2GNFA 2GTMA 4TYHA 3UP2A 3DJ7A 4ANLA 5JFXA 4WOVA 4I4FA 3AOXA 3E8DA 3FKNA 3LHJA 4TYGA 3F3VA 4K6ZA 4XG2A 4QTBA 4Y95A 3RNIA 4TW9A 4Q5EA 3DFAA 4BCQA 3MTFA 5AP1A 1H24A 1XH8A 2E9NA 2WOUA 1DAYA 4KRDA 2FYSA 3D4QA 3SC1A 5C8MA 4XUFA 2QO7A 4J99A 3A8WA 1WVYA 4WUAA 1ZXEA 5KHWA 4FTJA 4XBRA 3E62A 5HZNA 4TWNA 3QTSA 4YC8A 2R3HA 3MB7A 3MIYA 1ZYLA 4L42A 4BVUA 3CSVA 2P3GX 2WQBA 3JYAA 4EH7A 2PVNA 4GKHA 2J0LA 4DBNA 2BRBA 2ZDTA 5BVKA 3REPA 3RZBA 4EC8A 2WQOA 5EFQA 3RK5A 4DEDA 4V04A 1ERKA 2YISA 5KHXA 3RPYA 3D15A 1WBTA 2HW7A 3O51A 1EH4A 5E8SA 2REIA 4XCUA 1IR3A 4M13A 4XLVA 3PPKA 3DZQA 1SM2A 4IVBA 4QMUA 4DTKA 2W9ZB 1OVEA 4DTBA 4FV2A 3NVKI 4FV3A 3GC0A 5IQAA 4NM7A 2W4OA 3OEZA 3DAKA 3V5PA 1SVEA 2XA4A 5LOHA 4IB5A 4KRCA 3IDCA 5JMSA 5JT2A 3D2IA 4O2PA 5AMNA 4U42A 2I0YA 4IWDA 3PP0A 3AC5A 4GVJA 1IG1A 3RK9A 4OBOA 4RZVA 1H1SA 3P7BA 4CG8A 3PG1A 4I6HA 1TQIA 2GFSA 4JI9A 4R1YA 4EH4A 4F65A 2IW8A 4YUQA 3SG8A 2X7FA 3AQVA 1BL7A 3FLYA 1G8AA 5AR2A 3ATSA 2R0IA 3R1SA 4C35A 3SDJA 4KKGA 2GQRA 5HIBA 4J53A 3UBDA 3R9NA 4U81A 4I93A 3T9TA 1ZMUA 4N70A 4F7NA 3BGZA 3EMGA 4FIEA 4PUZA 5DGZA 1VEBA 5AUZA 3N4UA 1H1QA 4QMVA 5CSWA 5I9VA 3D7ZA 4AA4A 2C0TA 1UNHA 2QD9A 2QLQA 3OEFX 3PXRA 3QZFA 1PF8A 3NUXA 3R1YA 4R3RA 3SXSA 2W1DA 4OTPA 3TEIA 3WI6A 1NA7A 4FKVA 4Y83A 5KNJA 5LQFA 4XRLA 3ALNA 3BGPA 3LJ1A 4EH2A 4C4FA 3TACA 5IEXA 3SGCA 4D5KA 2HXQA 3SKCA 5K5XA 4JXFA 3VS6A 5AP3A 4FYOA 3P79A 3LKMA 1H27A 2OF2A 4PV0A 4QYFA 4QP3A 4GUBA 3JY0A 4BJJB 4BI1A 3GGFA 4O4CA 4ZTNA 1F3MC 2ERZE 3ANRA 4DBXA 2ITNA 3LMGA 1QPEA 1JOWB 4YO6A 4FV1A 3QTIA 4WG4A 4I92A 4FL3A 3VHEA 2XALA 2IVTA 3PIZA 4FKIA 4FKLA 4RX7A 3KF7A 5LVLA 1YHSA 4NM5A 1IAHA 3MVMA 2IZSA 3GB2A 4I20A 5I3RA 3W0NA 2B55A 4DH3A 2B9FA 4UX9A 3N51A 1YQJA 2C3JA 2JKQA 3VUDA 4F7SA 4WNPA 1KSWA 3SX9A 5M09A 3NAXA 4W8DA 3TIZA 4FEQA 4ZJVA 4J52A 2E2BA 3CTQA 5IDPA 3NUAA 5LMKA 1KE8A 4GK2A 2J0KA 3CBLA 4KBAA 3PG3A 2G2FA 4CFNA 2GCDA 4YZCA 5AADA 2QOHA 5M4UA 1H4LA 3R8VA 3ZBXA 4PY1A 4JR3A 1W84A 1KE7A 5L2SA 2QOIA 2QVSE 3ZMMA 4ASEA 3CD8A 5HVYA 3VS1A 4IBMA 3ZRKA 2B54A 5M4FA 2PULA 1LEWA 2VAGA 2F7XE 2VTLA 5EH0A 1PKDA 2PVHA 3EQFA 3ZLYA 1GZOA 4ACGA 5A14A 1PRYA 3GCPA 4WUNA 2CKPA 5IA1A 1R78A 4Z7GA 2BHEA 4A9RA 2I40A 3V3VA 3NUPA 1GIJA 1NXKA 2PE1A 1G3NA 3AMBA 3P23A 4GMYA 3UDZA 2GQSA 5CEOA 4L7FA 4F9YA 4EK5A 4QP7A 2W96B 4BDCA 2X9EA 4FTAA 4A07A 4F7LA 1TKIA 3F5GA 3UJGA 3TDWA 2OO8X 3HGKA 4FT3A 3WF7A 1GIIA 3AGLA 4W4YA 4IIRA 4OTHA 2PVYA 5DE2A 4DFNA 5BVNA 3VONA 4IFGA 3CJGA 3S95A 1YXXA 4QMPA 3UYTA 5HQ0A 1XWSA 3DQWA 5L8JA 2XBJA 4FZFB 3EQDA 4RIXA 3OG7A 4DTAA 3Q3BA 3L9NA 3QLFA 3QRJA 4K0YA 3TYKA 4WKQA 3OF0A 3DTWA 4XV9A 4ZSLA 5AP2A 4ITHA 5FGKA 1GNGA 1IA8A 3VUKA 3R7GA 3A7IA 3BBTB 4HGTA 3BZ3A 3WARA 4I3ZA 4MBIA 3MIAA 4L46A 3PPZA 4CQEA 4I24A 1R1WA 2WQNA 3D94A 4HPUE 5ETAA 4DGMA 3QXPA 1O6KA 4R8QA 3W0PA 5KO1A 4F0IA 4RA5A 4D0XA 4DG0E 4QYHA 3RBWA 2X8EA 3EYGA 3DBCA 3BYUA 4FRFA 2RGPA 3KEXA 3MS9A 5AUTA 2YZLA 2O63A 3MSSA 3KXNA 2IW9A 2JAMA 3M1SA 5CQWA 4DGLC 1L8TA 3O96A 1YXSA 2H34A 3BHVA 4E4LA 4O22A 4KABA 5GINE 4TY1A 3MY5A 2W0JA 3MYGA 4U7ZA 4BDIA 4I21A 1YXTA 1YWVA 4IX6A 4JRVA 3KMMA 4W9WA 3D2KA 1FBNA 4RJ8A 2IO6A 5AV2A 5L8KA 2VU3A 3KK9A 2XF0A 5DVRA 2XBAA 4FV4A 4BRXA 3V04A 5KKRB 2W5BA 1JVPP 2XKFA 2UW0A 3BGQA 4H3BA 1ZOHA 4EHZA 5M08A 1W83A 2YAAA 4QYGA 4AT4A 1ZZ2A 4EH9A 1GZKA 3MI9A 3NSZA 1J1BA 2JGZA 2YA9A 3QTQA 4FGRA 4MNFA 2B7AA 4G16A 5DH3A 3UOLA 5FDPA 3HDMA 2VNYA 3CGFA 1WVXA 2OJJA 4FK3A 2R0UA 2WMAA 3F9NA 3NZ0A 4W9XA 3BWJA 2ZB1A 1FINA 2J50A 2YIQA 4WG5A 3Q4ZA 5TO8A 4APPA 2B4SB 4MNEA 5CAOA 1JQHA 2RFDA 4Z9LA 5AX9A 4XMOA 3VBWA 2J7TA 3KCKA 5CASA 3UNKA 3C5UA 4G9CA 3BLHA 3NW7A 3FSFA 3OROA 3TTIA 5EYMA 3LXKA 3R83A 4A9TA 3Q4TA 4USDA 4BCOA 5K0XA 1Y8YA 3VUMA 3A62A 2HWOA 2V7AA 1GZ8A 2YM5A 3FZRA 4GL9A 4IHPA 3F3ZA 3ELJA 4KKHA 1UA2A 1G5SA 3Q6UA 3QF9A 2WTIA 3Q6WA 2FSTX 5GIOE 4ANOA 2WTKC 4MXXA 4KA3A 4HYUA 4XLIA 3MFRA 2PMNX 3PRIA 2OZOA 2NNWB 2W99B 3TJCA 1H1RA 4USFA 5E8UA 4EUTA 3LCSA 1BI7A 3IECA 4DG3E 5AFVA 3GU8A 4AOIA 2W4KA 1H28A 2CNUA 4AW2A 3RGFA 4X0MA 3R22A 5IQGA 3E64A 4O7WA 2CLQA 1XBAA 3EQHA 1ZMVA 3EFJA 2HIWA 4XG7A 3PJ2A 2EB2A 2EU9A 3FKLA 4BF2A 5BYLA 5FP6A 5CU0A 1J7IA 2WAJA 4FSRA 1G8SA 4GUEA 2O64A 2HAKA 4UV0A 3EFKA 2YCRA 5L4QA 3O17A 5E90A 5BNJA 5IQCA 4WIHA 4Y46A 5CSHA 5H2UA 5AP6A 4BCNA 2QQ7A 4IM0A 3K5VA 3U51A 5JRQA 3FXXA 2GMXA 1SZMA 2VTMA 3E87A 4QPSA 4W4WA 2OFUA 2C5OA 2WTJA 3DDPA 4IVCA 4O2ZA 4UXQA 4V0GA 5LVMA 2ZDUA 3DAJA 4A4XA 4H58A 3BU3A 5IG1A 2IVVA 2OICA 5CAQA 2OJFE 4IXPA 4ZMEA 5EI6A 3Q4CA 1U59A 5DFPA 2P2IA 4I5CA 3ZM4A 5JFWA 2HW6A 2OH0E 3ROYA 5IA0A 4MUQA 3LXPA 3Q2MA 5HG7A 1H08A 3SRVA 1KOBA 3VF9A 4C3PA 5J5TA 4BI0A 3C7QA 3DB8A 3BEAA 4JBPA 3R7YA 3PIXA 4BDKA 5IEYA 5C4KA 4IAFA 3FWQA 4KBCA 4QP4A 1Q8UA 2FSMX 4PL3A 4G6NA 2Z7SA 1SVHA 4GS6A 4CV8A 2I1MA 2VWUA 3EYHA 4FV5A 4E6QA 2R3QA 5IMXA 3U55A 4LL0A 4G3FA 1R0EA 2OIQA 3QYZA 3ZXZA 5GJFA 5DR9A 3OXTA 3G90X 4BYIA 3LAUA 5EDPA 5K3YA 4CSVA 1OUKA 5J5SA 2WMWA 4AZVA 2A19B 2UVXA 2O5KA 4GKIA 3DS6A 4JX3A 4M0YA 3KL8A 5HVKA 4GK3A 3LPBA 2HCKA 4PDOA 4LGDA 5JQ5A 3LFDA 1YKRA 4RIOA 2EXCX 3QD4A 4OT5A 1P14A 3T3UA 4BFMA 3ZBFA 3UQCA 3VF8A 3CGOA 4QYYA 1M2RA 1Q8WA 2BPMA 3C0HA 4AN3A 4ZSAA 2CHLA 4OGRA 3NUYA 5D7VA 4EK6A 1WCCA 4AW1A 4AZWA 5BX0A 4FL1A 4YTFA 4LG4A 4ALVA 1NW1A 3UDSA 4EZ3A 2VWBA 3ERKA 4UXLA 2V0DA 3F6XA 1W8CA 1UU9A 3FE3A 3NNXA 3WYXA 3F2AA 4DFLA 5DHJA 1BMKA 3M11A 3ZLWA 2XARA 4I23A 2Y8OA 5CF8A 3R71A 4AACA 2CKEA 3M2WA 4IANA 3O0GA 3SV0A 4HVSA 5FEDA 3TZMA 4NYEA 4GJ3A 2J0JA 5J9YA 4QO9A 3ZZEA 4ALWA 2VTIA 4FSQA 2EVAA 4RRVA 5CEKA 4QMMA 3I0OA 4GEOA 2X6EA 1ZY4A 4JMQA 2FB8A 3KKVA 3JY9A 4D55A 3ORXA 4BWKA 4JL9A 3G6HA 2ITXA 2UZTA 2Y6MA 4Y73A 3FMEA 3PRFA 5HNBA 3TV7A 4IE9A 1Y6AA 5HI2A 3QQKA 2YLFA 4IM2A 4NZWB 3O71A 3PPJA 1H0VA 4AZTA 2Z7LA 3VO3A 2XKDA 4X3FC 4HZRA 4BL1A 1QCFA 2R2PA 3VW8A 2QR8A 4I1ZA 2CN5A 3EQGA 4I5HA 3VHKA 4AFJA 2BFXA 4DG2E 2YFXA 5EDRA 3PE1A 1L3RE 4JLCA 4UBAA 4NIFB 4I41A 5M51A 3DLZA 2X8IA 1S9JA 4YHJA 4C4IA 1UV5A 4G5JA 5JK3A 3G5DA 4OTQA 3HRFA 4O6LA 2VWWA 3EQIA 4D0WA 5KMOA 3PJCA 3R0TA 3OZ6A 5DIAA 3LCOA 4GYGA 3C4XA 4TL0A 4FKTA 1BUHA 4EKKA 3AT4A 3BHYA 5IQFA 2BUJA 4HCVA 2VWVA 4CMOA 5KZIA 3GU5A 3QGYA 4L9IA 4QMYA 4G3EA 1UKHA 2OF4A 3ZTXA 3CIKA 3PY0A 3FL4A 2JBPA 5ANGA 4FG7A 4AF3A 3FL5A 4R3PA 4LMNA 3A4PA 4Y85A 2PK9A 3S2PA 3GCSA 2B9HA 3FZOA 2UUEA 4KSQA 2W17A 2XZSA 3A7FA 3CP9A 3DOGA 5CEMA 3VBQA 3OTVA 3I7BA 1B38A 4QQ5A 2W5HA 5JZNA 3SRVB 3C9WA 3EQCA 1F5QA 4F63A 4WT6A 4FT5A 4H1JA 4RZWA 5EDQA 3TNHA 2BVAA 3SAYA 4NW6A 3LQ3A 2C6KA 4RWIA 1Q24A 5B2KA 2OXYA 4NFMA 1W2FA 2YDKA 3VBVA 4CMUA 1S9IA 2WPAA 1UVRA 1YHWA 1T46A 2QODA 5FQDC 4G3GA 3LLTA 3N9XA 4U97A 5DT4A 3R30A 1JKLA 3WF8A 5CYIA 4FSWA 3RTPA 4C7TA 3FKOA 1BLXA 3OWKA 1J7LA 3C13A 2VO3A 4WHZA 2R3PA 3RK7A 5JH6A 3W0QA 3B8RA 2BRNA 5BMMA 3EH9A 3ORIA 4Q9ZA 4AP7A 3ZM9A 4BTJA 4AXDA 1P2AA 4AXCA 5KBRA 2JBOA 4UMRA 5BUIA 4KKEA 4BWXA 3QAME 1OUYA 1YRPA 2PMLX 4U40A 3UODA 3GENA 4OTRA 4YJOA 2CGVA 4LOOA 5CU6A 1VR2A 3WOWA 2XIKA 4EK8A 4FTNA 5FG8A 3JXWA 4GG5A 3U4WA 2XMYA 4PMMA 4QRCA 1Q8TA 2QURA 2F49A 2H9VA 4HJOA 4PRJA 2YM6A 5HICA 4A9YA 1OGYA 4O83A 5AV0A 2VZ6A 4CRSA 3GCVA 4JVGA 3O8PA 4BKZA 4DE4A 4CEGA 1ZYDA 2HZ0A 3I6WA 4O0XA 5AUYA 3FI2A 4D1ZA 4F1TA 4AAYA 2PMIA 2W9FB 5AA9A 4O7SA 3D9VA 4BGHA 4C4HA 1ST0A 2OJGA 3UOKA 3FEGA 3HMPA 3KF4A 4DFUA 3PXZA 5F1ZA 3R9HA 3ACKA 4DLJA 4ACDA 5L6WL 4KINA 1Q3DA 2QOCA 5BUEA 3CPCA 3UMXA 2JITA 1MRVA 4Y8DA 5F94A 4D2VA 4DH1A 3GFEA 3UMWA 4IADA 3PWDA 1AD5A 4KIOA 4L3JA 1UU3A 2JDTA 1QL6A 2WTWA 4L00A 1GZNA 3HZTA 3V6SA 4IAZA 3QQUA 5AM6A 5I3OA 1PYXA 4LGGA 1OB3A 2DS1A 2XEZA 5EM6A 3P9JA 4H39A 3KVWA 1XHAA 4FEVA 5BV3A 4YNEA 1OL5A 5IZFA 2PSQA 2J5FA 2F2UA 4H1MA 1I44A 4JJRA 2R3MA 1CKPA 1JAMA 1XBCA 3K3IA 3L1SA 4LUEA 2ZV9A 5LCKA 3UO6A 1PMUA 1BL6A 5BYZA 3F5XA 1WVWA 3HV4A 3W16A 3UG1A 1OL2A 4F64A 3HAVA 4W4VA 3AKKA 3LCDA 4UN0C 2ETKA 3SXRA 1H8FA 3FZTA 4B99A 2HOGA 1XBBA 2E9VA 1YDRE 2XNOA 4EORA 4FIJA 3UQGA 4O91A 1OECA 3MA6A 4AZFA 3Q9ZA 3W2QA 4D5HA 4KB8A 2RFSA 1WBPA 4Y5HA 4PNKA 2HYYA 3POOA 4BDDA 3TKHA 4EH8A 3PVBA 5AIRA 5CXZA 2JKMA 3PE2A 1NVSA 3MJ2A 3QA8A 4M68A 4FGBA 2A98A 3MFTA 4PPAA 2VTPA 2XNMA 2QOOA 3QZGA 4YLJA 1U46A 3AMYA 4HOKA 4OUCA 4R3CA 1WFCA 2WO6A 2WU6A 4QQJA 5FM2A 4DEBA 3MH1A 4E73A 2QC6A 3VRZA 3RAWA 3V8SA 5I4NA 2PVJA 4IAIA 2H6DA 4QMXA 2FSOX 4G2FA 5J1WA 3ML1A 5EW8A 5DYJA 3CE3A 4JBOA 2ITWA 2PZIA 1OKYA 4ACCA 4UWBA 2CN8A 4N6ZA 3NPCA 4FTRA 5BVDA 4D4VA 1XMMA 3HMNA 1OKWA 2BRGA 4B7TA 2PVLA 4XV2A 5C26A 4AN2A 3C0IA 4FYNA 4ZTSA 4LFIA 2QR7A 4UMTA 3QRTA 4ITIA 1ATPE 1CSNA 3HUBA 3I7CA 3JR1A 2QOKA 4DHFA 3LQ8A 3KXGA 4BJJA 3RI1A 2RFNA 2XNEA 2QG5A 3P86A 3D5VA 4AU8A 2GHGA 4JDIA 1U54B 2ONLA 3R8ZA 3VS2A 4IZYA 3ZZWA 3KU2A 3P78A 4O27B 4O7ZA 1LPUA 4M14A 4QMLA 4YHTA 3VBXA 4DINA 3W2CA 5AR8A 3I4BA 2PVRA 4TWCA 5FTQA 4J97A 4FVQA 2BDJA 4E5BA 4EEVA 4X2FA 3ZO4A 4Z3VA 3L8VA 5CVGA 2C5YA 1M14A 4TWOA 1V0OA 3QUDA 4E4MA 5M57A 4AA0A 4GG7A 1CM8A 1OI9A 3EQRA 3TUCA 4GFGA 3DA6A 2IW6A 1J1CA 3E92A 4LM5A 4GFOA 3DBEA 5E4HA 5H9BA 5CENA 4ONAA 5ANKA 5EYKA 4UB7A 4DGGA 1J7UA 3BLAA 1XO2B 4FEXA 2ZV7A 4RLLA 3O5AA 4QMZA 3I6UA 4YTIA 4ZZMA 5CAVA 1WBWA 3PLSA 1WAKA 5JQ8A 3E3PA 5CALA 3ORPA 5DBXA 3FHIA 2B9JA 5J7BA 2CPKE 2P0CA 3MPAA 4MKCA 4ANSA 5FDXA 5CVFA 2C5VA 3TV4A 5BYYA 2PE2A 3R63A 5CVHA 3AMAA 2UW4A 4J8NA 4ZK5A 1IAJA 5EQPA 3KC3A 2WMVA 3BPRA 3LM5A 4LL5A 2YJSA 1PJKA 4AX8A 1B6CB 5M4IA 3BE2A 3RJCA 3QCYA 3BIZA 3QRKA 3VUGA 4L43A 1PXPA 3OWPA 1J3HA 1PW2A 4HPTE 4C3RA 2UV2A 2DWBA 3W55A 3QLGA 4JX7A 3FMMA 4AA5A 2W1ZA 4ERWA 3MV5A 5E8ZA 1PXMA 3NYXA 3UNJA 4F6SA 4YC3A 3KREA 4QMTA 2OXXA 5IH4A 3WYYA 1ZYJA 5E8YA 3ULIA 2WKMA 1LP4A 2XUUA 4AGUA 2O0UA 2WEVA 3F88A 5HE2A 2XCHA 3U9NA 5LMBA 4U3ZA 4IVAA 4B0GA 4KS7A 4JR7A 2OXDA 3R7OA 2QU6A 5LMAA 3WE4A 4BDHA 2WELA 4L67A 5A4LA 1H07A 1SVGA 2OGVA 3QTRA 3E3BX 4I4EA 5KCVA 4CZYB 2GS6A 3R04A 4D2PA 3ORNA 3G0EA 4FIFA 4BDAA 1PYEA 2NRUA 1JBPE 3EIDA 4LV8A 4O6EA 3MVJA 4MWIA 4OTFA 1RE8A 4QQTA 3UVPA 5LVOA 3DPKA 5B2LA 5HU3A 5KMIA 2PE0A 4FT9A 4ANQA 3V5QA 3C4FA 3D5WA 2YM8A 3BV3A 4O4DA 4QEBA 5IQEA 4EQMA 4JG7A 1QMZA 2H96A 4UMQA 1Y6BA 3MH0A 4U5JA 2ETMA 4U3YA 5CQUA 4PDSA 1F0QA 3U6HA 1W2DA 4EOJA 3BHUA 3VAPA 5AR7A 5HE0A 3LCKA 5CU3A 3V5WA 3ZYAA 3IGGA 4I6QA 4LOPA 5JGBA 5DWRA 4BN1A 1OIRA 3QZHA 5I0BA 4HW7A 5IF1A 1ND4A 3SG9A 4BICA 4U6RA 4IM3A 3SOCA 5LWMA 2HENA 2X81A 5DT0A 4O4EA 2CJMA 4JBQA 3OVVA 3B2WA 3G33A 1Q41A 3FMDA 3MH2A 5FEQA 3EN6A 4RC4A 4RVLA 4CFVA 3OTUA 3LFBA 4MTAA 1B39A 3IW8A 3GXLA 3COIA 4WA9A 4HNFA 4EH3A 5KMLA 4F1OA 1M7QA 1TQMA 2NO3A 2X8DA 3EFLA 3UVQA 4CLIA 4ZY4A 4DAWA 3ULZA 2R7IA 3UDTA 5CTPA 4IAKA 4XBUA 4D4SA 5LMKC 3AT3A 5EQEA 4K18A 5GHVA 3C0GA 4YZMA 5BVOA 4GCJA 4FKQA 4YSJA 5A4TA 4XX9A 3PVUA 4RA4A 3TN8A 3PUFC 2VRXA 1K3AA 3AKJA 3TMOA 3H10A 1G8JA 2GQGA 2J0IA 2VO7A 3BI6A 5KMMA 1PXNA 3FZPA 3PXFA 4G31A 4IAYA 4M3QA 4O1OA 3VW6A 2ITTA 3EN9A 4AAAA 3R00A 4EJ7A 5A46A 1VYZA 2V55A 4P7EA 4QDEA 2E9UA 4NJ3A 5B0XA 4LQMA 3LFAA 4RMZA 3VUHA 1MUOA 2WMTA 2YM3A 3OCGA 2XNGA 3IDPA 2B1PA 2FGIA 1PMVA 3OCSA 4MXYA 4FUXA 4QPMA 4AT5A 2UZDA 2C1BA 4ZLOA 3ANQA 3LIJA 2WD1A 4RT7A 4YR8A 3DK3A 2VTOA 5AR3A 4IDTA 3NEWA 4O1PA 5CF5A 3KRRA 4J95A 4CTCA 3CC6A 5B7VA 5JGAA 3EJ1A 4ORKA 3UZRA 2Z2WA 4FL2A 2YABA 4B8MA 3R1NA 1RDQE 2Y7JA 2EWAA 4CVAA 1ZAOA 3RAIA 3LJ2A 3RKBA 3GVUA 4AW5A 4DDGA 3NX8A 4JG8A 4KIKB 2R3RA 5AAFA 4XNEA 2F2CB 5HORA 4DT8A 2F4JA 5I5ZA 5GNKA 4XV3A 4BDBA 5JKGA 5M07A 4GT4A 4L68A 3NIEA 3FMHA 5GJDA 3VS4A 2RG5A 2BKZA 1PXOA 3U6IA 4ZJJA 5HOAA 1Q62A 5D12A 4BTKA 3C51A 4OT6A 2HZ4A 4S34A 4L44A 3QD3A 3R7VA 3QBNA 1Q3WA 2W1EA 3FLZA 3G0FA 4PWNA 4EJNA 1PXJA 2C3KA 1MRYA 4G6LA 4ACHA 5JFVA 3LOKA 3MA3A 1LEZA 3RINA 3UG2A 3PFQA 3KMWA 2J51A 4FK6A 5CWZA 2X2MA 5CI7A 4XS2A 4ZXTA 1SYKA 5IH5A 5LXMA 3KCFA 5T3QA 4FNWA 4HGEA 3TXOA 2XH5A 2Y0AA 1STCE 2R3FA 3I1AA 4I6LA 3QUEA 1I09A 4X21A 4DH5A 3FAAA 2JKOA 3HMOA 3POZA 5TE0A 2PL0A 4XOZA 2Q83A 4EL9A 2PUIA 5EHYA 3RM6A 3JVRA 1H01A 3JPVA 3DBQA 2I7QA 2JFMA 4RGJA 5HD7A 2ZFYA 3TDVA 3GNIB 2W1GA 3L8PA 3RPVA 2YZAA 3CLYA 3ZO2A 2C69A 2C47A 2J5EA 4YJPA 2C6OA 4XOYA 3GEQA 2CSNA 3HKOA 3QQFA 4EHVA 3GC9A 4IB0A 4IZ7A 2A1AB 4L45A 4JOAA 4A4OA 3EN7A