2RKUA

Structure of plk1 in complex with bi2536
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
294
structure length
294
Chain Sequence
b'AKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKVLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase PLK1
publication title Selectivity-determining residues in Plk1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 294
sequence length 294
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2rkuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2rkuA01
4O83A 4PUZA 5L8KA 4IHPA 3EQBA 4DG3E 4PTGA 3HECA 1FGKA 3Q5IA 4JQEA 4PPCA 4N70A 2X7GA 1M52A 4AFEA 4C3RA 3ATTA 5M56A 3RM6A 1WBVA 1OKWA 5IA4A 2UVYA 4YP8A 3PA4A 4QPAA 3VO3A 4AWIA 4E8AA 3DY7A 1OUKA 5KX8A 3FL5A 3S4QA 4FV3A 4ZLZA 3L9NA 1M14A 5J87A 4F0GA 4FEWA 3WE4A 1W7HA 2C3LA 5BVWA 4FK3A 5HG5A 5A4QA 2QLQA 1Y6AA 5B0XA 3U51A 5BUIA 3QCQA 3OC1A 2UZNA 3MY0A 3TWJA 1YW2A 2F4JA 3PIZA 1LEZA 5JRSA 2WU7A 3ODYX 3IPHA 5CNNA 2HAKA 5EOLA 2R3OA 3FDNA 3QUPA 2W7XA 5HG8A 3VHKA 2XK6A 5BNJA 2OI4X 3QCXA 3VS1A 3OBJA 3WILA 3P7AA 5HE2A 3RI1A 3TI1A 3BBWA 3PTGA 4G3DA 3NEWA 3QZFA 3OUKA 4AS0A 3QKMA 2RSVA 2XIKA 2XH5A 2WMTA 4EUUA 3D4QA 3PIXA 1FMKA 2XK9A 4YJRA 5HX8A 2O3PA 4CYIA 1YHWA 4AN3A 2E9VA 4U43A 5CYIA 5D11A 5ANJA 3QLFA 2BPMA 3R7YA 1AD5A 3P9JA 5BVEA 3WZUA 3NNWA 5CALA 3CBLA 5HTIA 2G9XA 5J7HA 5JQ8A 4O2ZA 4AA0A 3KU2A 5I9WA 3PSDA 4EHZA 2XM8A 2YM6A 5L6OA 4FSYA 5I5ZA 5K5NA 1E1XA 1KE6A 4OTRA 3RPSA 4FTQA 4DG2E 4U97A 4AGDA 3OTVA 4Y73A 3KMMA 5C8KA 4RIWA 3LCTA 1M17A 2WIPA 4EOSA 4ITIA 2REIA 5D10A 2CMWA 3PPZA 3UNJA 3W2QA 2YN8A 3PY3A 4R7IA 3E3PA 2ITOA 2UZVA 4G34A 3H30A 4ZSGA 3FMLA 2W1ZA 3LFAA 1TQMA 1YOLA 2UW6A 4FV2A 4I5PA 1BKXA 4WSQA 4DEDA 4ASZA 1UA2A 3AT3A 5DRBA 3DNEA 3WF7A 5FTQA 3MI9A 4UYAA 4JNWA 2O8YA 3C50A 4AN9A 3SOCA 5IPJA 1GZOA 4XG6A 1F5QA 2GU8A 3O51A 2PTKA 1ERKA 2XJ1A 4E5WA 4QQ5A 3UG1A 2XIYA 4CFFA 5C1QB 3MPAA 2J0LA 4LUDA 1YXSA 3LCOA 1OIYA 3D0EA 2YWPA 4FKOA 5A54A 5M4FA 3ITZA 5HG9A 4QMYA 4BIBA 5IMXA 3C4EA 3HRBA 4CKJA 5KO1A 2C1BA 4BGHA 5H9BA 1ZY5A 4EK8A 3U6JA 5IMEA 1KUTA 3VIDA 3IW4A 4M0ZA 2QOQA 5T68A 2F7EE 3PLAE 3VUDA 4UMPA 2IVUA 2GNJA 2J0KA 3TKHA 3GU8A 3MSSA 3GC8A 4NYEA 4JDIA 3VF9A 2ITUA 4C38A 4NK9A 4E5BA 3DB6A 3F2NA 2PVNA 3DDPA 3RZFA 3CSVA 2IPXA 3HRFA 3BHTA 2HY0A 1CM8A 5TF9A 3E7VA 2HY81 1SM2A 4BIDA 2GQSA 2YFXA 3S00A 1TVOA 4QMTA 1YWRA 3F3ZA 4I6BA 4ZAUA 3DV3A 4G9RA 1H1WA 2NNWB 2RFSA 4RZVA 3R8LA 3EHAA 5M53A 4I22A 1H27A 4HZRA 5A4EA 2CKPA 5KKRB 4GSBA 3PJ1A 5E90A 4XUFA 1H0VA 4KS7A 4MXAA 3LCSA 3DJ7A 1XH4A 2G01A 4J8MA 4HPTE 4HJOA 3LQ5A 5GJFA 5CU2A 5I3OA 3NIEA 1Q61A 3UP7A 4DEGA 4ZSAA 4BDJA 3NLBA 1FINA 4BKZA 5AEPA 3TXOA 2YCSA 4MF1A 3SG8A 2CKEA 5AUTA 2OF2A 1AQ1A 3NRMA 4RA5A 3RNYA 4TN6A 3FLSA 1PXJA 3IOKA 1UKIA 4KRDA 4YJTA 4BWKA 3AOXA 3F3UA 3OHTA 1H4LA 4FIEA 4ZZMA 4EONA 3NPCA 5HD7A 1MQ4A 5CF4A 3CS9A 2GQRA 4FG9A 3DNDA 2W4OA 4GK3A 4IEBA 4FSRA 2CHLA 4MK0A 4BDAA 4MD9E 2C6MA 3DCVA 3R21A 2NP8A 2VX0A 3FI2A 2PVHA 5EDRA 4YJQA 3RPOA 3PE1A 3QWJA 2YM8A 3LXLA 4HGSA 4OTQA 3SOAA 3QQUA 3IO7A 3OOGA 5EM7A 3UG2A 4KA3A 2X2KA 4RSSA 4GFGA 3OBGA 4DFUA 1FBNA 4NIFB 1Y91A 3H9FA 2BAJA 5CQWA 4O22A 3MYGA 4JDJA 3UOKA 4HCTA 4D28A 4EEVA 5LQFA 3V3VA 4TWPA 3U54A 4YZMA 2BDJA 3T3VA 5IQHA 4QMSA 1YDRE 4EWQA 4UZDA 3H0ZA 3D7TB 2O64A 3BU6A 3ODZX 3BLHA 4MXZA 3UO4A 3NNXA 3V5LA 2HZ4A 1WFCA 2QOCA 3EQPA 2C47A 3KRLA 3LJ0A 5FP5A 3QTIA 4FVRA 5CEKA 1CTPE 4U8ZA 5IQEA 3P0MA 4M69A 4RWIA 4EI4A 5L2TA 4E6AA 5CEPA 3HX4A 3KB7A 4MXYA 1OUYA 1PXMA 4QNYA 4KBKA 4S30A 1R0PA 3R7UA 1BUHA 1PKDA 2GQGA 3S95A 3QRJA 4AW1A 5AAEA 1L8TA 5L8LA 2WEVA 4CRSA 4D2PA 2I40A 3KULA 1MP8A 3ZO2A 5JGAA 4CZTA 3HMPA 4FC0A 2DUVA 4IAFA 1GZNA 3PG1A 5AA8A 5CF8A 2P33A 2HZNA 4JQ7A 2XEZA 3W2CA 2JDVA 2IVTA 4R7HA 3OF0A 4F70A 3CY2A 2IZRA 4L6QA 1L3RE 2VN9A 4FIIA 2GSFA 3QZIA 4RC4A 2BZJA 2VNYA 1BMKA 2B7AA 4FT9A 2R2PA 3COIA 5AM7A 4F9BA 4U9AA 5BYLA 1OI9A 4IADA 2OW3A 3NNVA 3FMDA 3E92A 3NUXA 1U5RA 2YM4A 4TPTA 3ZSGA 1YHSA 2WQMA 3R9OA 1S9JA 5FP6A 3PWDA 3IS5A 3PXFA 3V5PA 3QTZA 2HW6A 5CQUA 3R6XA 3EKKA 3D9VA 2FA2A 1Y6BA 4FNWA 5DNRA 5AR5A 5FEQA 3WOWA 4E6CA 4EJNA 4EOOA 3UIXA 2BMCA 2GDOA 1PXLA 3KC3A 5AR3A 2YIQA 4R5YA 2QKWB 5TR6A 4WUNA 4NM3A 4N0SA 4AGCA 2WMBA 3G5DA 3OW3A 2UW9A 3FPQA 2IZTA 3NGAA 3QZHA 3TKUA 2QOKA 3SXSA 2QO7A 1YHVA 4NT4A 3U4UA 2OJIA 3ZEWA 3FI8A 3P08A 3RAHA 3A7HA 4I0RA 4X0MA 1MRYA 5GJGA 4NM0A 4GV1A 4KIOA 2HWOA 2C0IA 5KKRC 1RQQA 3BQRA 2OBJA 3EL7A 3FMKA 4YZBA 5IISA 4R7BA 3VRYA 2BRHA 1IA8A 3PVGA 4XEYA 5LOHA 3FQEA 1JNKA 3TUCA 1GY3A 3CKXA 2CGVA 4KIQA 4KABA 2JBOA 3MH0A 4OGRA 5JEBA 3QHRA 4L3JA 3LFQA 2XVDA 2WMVA 4IVBA 5HGIA 4CGAA 2Q83A 3QD4A 3T3UA 4KIPA 5IQAA 3GFWA 4MWIA 1Q8WA 4WG4A 1VJYA 3L1SA 4XG3A 2XK4A 5J95A 4RVLA 4GJ2A 4GK4A 4O6EA 3UOJA 4B4LA 2NRYA 3AGLA 5CU6A 3QQFA 3U8WA 4CV9A 4DEAA 2GMXA 3WYYA 4QPMA 1H1PA 5IQIA 4WRGA 2ZM3A 1DS5A 4AG8A 1GJOA 4FF8A 4J96A 4QYGA 4XG8A 4XG2A 3LPBA 3JR1A 3PVBA 4J97A 3ZZEA 4AA5A 2JFLA 4BZNA 3AXWA 1SVHA 2X9FA 3NYXA 1H07A 5CXZA 4X3FB 2A1AB 2E9PA 4D2RA 1DI9A 2GS7A 4WUAA 1H00A 2FSTX 4HNFA 4MQ1A 1R0EA 4JIAA 4R6VA 4E26A 3UOLA 4NCTC 2OO8X 1OIRA 2QHMA 5HO6A 5DFPA 1ZYSA 3O23A 4FKJA 2W1CA 4FUXA 4MNFA 3KK9A 4QMVA 5EOBA 4BGQA 3C4FA 4HYSA 4IM2A 5CT0A 3DQXA 3HMOA 3Q04A 1G3NA 3MB6A 4FMQA 5HBEA 4FODA 4UMUA 5ANGA 4CFVA 2C5YA 3IKAA 3REPA 3NUNA 4FV8A 4JBPA 4JL9A 4N4SA 3F3TA 3HDMA 2RF9A 1JSTA 2R3MA 4C0TA 3TZ7A 1ATPE 3EQHA 3HUCA 1YXTA 1ZLTA 4TYHA 3H9OA 3N4UA 2WXVA 3KXXA 3TG1A 4BDCA 4PX6A 5DT3A 1JKSA 1YQJA 4GU9A 4NJ3A 2H96A 1XH9A 2O5KA 1KE8A 2OK1A 2PUUA 3AMBA 3JY9A 1NVQA 2X6DA 4UMTA 4MXXA 4TT7A 2WTJA 2R3KA 5E8UA 3V5WA 4ALUA 4I0TA 4M0YA 5F4NA 3TV7A 2WOUA 4OTWA 4P4CA 2QO9A 4WNKA 5JQ5A 2YIYA 3RK7A 4YSJA 4WD5A 3FMHA 5BUEA 5FDXA 4GU6A 4YNEA 2Y6OA 3FKNA 3NYNA 4Q5HA 4BVUA 2ZVAA 2JITA 4D4RA 3UC3A 1JSVA 4O7NA 5I9YA 4EH8A 4E20A 1XHAA 2B1PA 2RG6A 2BFYA 4W8DA 5HIDA 4D2SA 1OBGA 3FUPA 2ITQA 3M42A 3A60A 2ESMA 1WBWA 4LV5A 2PU8A 5AP0A 4QMWA 1CDKA 3I0QA 4DCEA 3JY0A 4OTHA 4UB7A 4G3GA 4WHZA 1ZAOA 3SQQA 3BV2A 2G15A 3FSKA 3MPMA 1ZYCA 2NRUA 1J7IA 3VUGA 3NYOA 4ACHA 4GVJA 4I21A 3BEAA 4BIEA 5B7VA 4U81A 4KIKA 1GAGA 1OKZA 3LJ2A 4RLKA 4TXCA 5HE0A 4L00A 4S34A 1NY3A 3VUIA 4BHNA 5LJJA 2B54A 3F7ZA 5KHXA 1G8AA 3SG9A 4XRLA 2ERKA 4RWJA 3UPZA 4AOIA 2VTLA 3H0YA 5HLWA 2PUPA 3SW4A 3PXKA 3AC2A 3OUNB 4GH2A 4K18A 4K33A 5JH6A 3PA3A 4HVSA 3QD3A 4EK5A 3PWYA 3V8TA 2PE1A 4HGLA 2C6IA 3DPKA 4XG7A 3KK8A 4B99A 4D5KA 4F64A 2XNEA 4GVAA 4RJ4A 5DLSA 4CFXA 3DA6A 5AUVA 3FQHA 3QD2B 3AC4A 3KXHA 4NM5A 5HBJA 3RAIA 2YZLA 3WF6A 4J99A 3G33A 1XO2B 3LMGA 1XH7A 2A2AA 4HW7A 4KD1A 3GFEA 3WYXA 4ANLA 4PQNA 1J1CA 3TNWA 4ANSA 5LWMA 4HYIA 4YC6A 3ATSA 1PXOA 1WVXA 5KZ0A 4E4NA 1ZMUA 3MESA 4V04A 4O0UA 5LMBA 4C4IA 5AP7A 4DFXE 2VX3A 3GC7A 1H28A 4LRMA 2JDRA 4FKLA 3KN6A 4U6RA 1H24A 4U41A 4Z55A 5DEWA 2VV9A 5ANKA 2PSQA 4U80A 5J79A 1WAKA 4EYMA 3AGMA 4X3FC 5AR8A 4ASEA 4O86A 4GW8A 3V51A 4U5JA 4PNIA 4W4XA 4TWCA 5CEMA 1UU7A 4K9YA 4ZY4A 2PVJA 1VR2A 2Z7QA 4NFMA 3NS9A 4FKWA 1NVSA 3TKIA 4QQJA 4R5SA 4DC2A 3K5UA 2WQEA 3IK3A 4YC3A 5AR4A 4FTKA 5M4UA 1K2PA 3KCFA 2JGZA 2GFCA 4J53A 2C3KA 2PE0A 1JLUE 1R1WA 1REJA 4WRSA 3L8PA 4GG5A 4W4WA 2GNFA 4OTIA 2WTKB 2CKQA 5AIKA 3F5UA 4L52A 3CJGA 3PY1A 4I6HA 1PXIA 3Q9ZA 5HG7A 2HZ0A 4XOYA 3VW8A 3NMUF 5K9IA 2C30A 2VTIA 4EHGA 4NJDA 3GGFA 4RIOA 2X8IA 2YIWA 4OLIA 5IA5A 1K3AA 2WQBA 3KN5A 4HZSA 4F09A 4USFA 4FZFB 1S9IA 3G9LX 3LZBA 2BALA 5CS6A 4EYJA 4UN0C 3HDNA 3RK5A 3O8TA 4AGUA 4OBPA 4J8NA 5J8IA 2HENA 1UNLA 1ZARA 5EHLA 4MXOA 4O38A 4YJSA 3UZRA 3H3CA 4FKVA 2A0CX 3W18A 1CKPA 3EKNA 3ZEPA 4MD7E 2C3IB 1Q97A 3ORIA 3SW7A 4JJRA 4YLJA 4PNKA 2RFNA 4QYYA 4ZS4A 2HXQA 5H2UA 5BUJA 2PUNA 3A62A 4V0GA 3NVKI 2WTCA 5D12A 4AZEA 1OL2A 5LWNA 2CCHA 4WBOA 4BL1A 3AMYA 2E9OA 2CDZA 3QXOA 3TV4A 1VEBA 2HK5A 3VWAA 4JT3A 2UW7A 5M4IA 3C4CA 2GHGA 3HA8A 3KXMA 4RT7A 4AT4A 3G6GA 3MJ2A 2YDIA 3PJ8A 4FV5A 5CEQA 3OT8A 5LMKC 3MB7A 3HNGA 2F49A 5LVNA 2OSCA 2XMYA 2ETMA 3ZFMA 4C61A 4CT2A 2CGWA 2QR8A 2VWVA 3G0EA 3Q4CA 4PL3A 1H1QA 4XV9A 2WTVA 5CF6A 3BWJA 3MWUA 4PP9A 4E4LA 3R22A 3PP0A 4CQGA 2AUHA 4C35A 4I6QA 5DWRA 4D1SA 2WAJA 5AWMA 3DFCB 4ENXA 2CPKE 1OL6A 4KAOA 2BVAA 4JLCA 1OMWA 3ZXZA 3KMWA 4EHEA 5LVPA 1ZMVA 4APPA 2IVSA 2E2BA 3F69A 5HHWA 3DTWA 4OUCA 5DEYA 5DE2A 4F99A 1ND4A 1W84A 4ACCA 4G31A 2GFSA 4IM0A 5EYCA 3CP9A 3NCZA 3FLNC 4PPAA 4EJ7A 2BRGA 2PMLX 3VS2A 3BYSA 5DR9A 3PYYA 2WO6A 1I44A 4UWYA 2EXMA 4I41A 3P86A 2CSNA 3B2TA 4A9RA 4U45A 1FMOE 4RQVA 2RL5A 3I4BA 4H3PA 5A6NA 5C26A 3QQLA 4RBLA 2J5FA 4A4LA 4O7SA 4E3CA 4CSVA 4FTRA 4OTPA 2V62A 3TJDA 4D1XA 4X7QA 2ITYA 3SV0A 4ZZNA 3EYHA 2W1EA 4IJ9A 5HTCA 3WIGA 3Q4ZA 2UZLA 4IBMA 3TNIA 4FZ7A 2CNUA 4M66A 1SMHA 2VGPA 3DK6A 2JBPA 4IDVA 3V04A 4A9SA 4BCKA 3SXFA 3GOKA 4BRXA 3CR0A 3SRVB 4EOLA 5LVOA 1ZMWA 3UMWA 4C57A 2VTMA 1F0QA 2JC6A 1M7NA 4L45A 3P5KA 1OPKA 2QI8A 2W5HA 3ORMA 4FTNA 5A3XA 5L6WL 3UYSA 2XEYA 3GP0A 4NUSA 4I5HA 4FKQA 4PPBA 4OT6A 3GBZA 4BN1A 2W0JA 2ONLC 5CSXA 4O0YA 5EYMA 3CTJA 1OB3A 2F57A 4NEUA 4RWKA 3KXZA 1WBTA 4FTJA 4BI0A 4MCVA 3RWQA 5GZAA 5HZNA 4AZSA 4FSNA 5JFSA 2WTKC 3LCDA 4LGDA 4U42A 4L68A 4ACGA 4C02A 1R3CA 2B53A 2FYSA 3Q9XA 4OTDA 2C6KA 4ZTQA 2R3HA 4EH5A 5LXMA 3A4PA 5E4HA 4G1WA 3LHJA 5AP2A 4F7LA 4DN5A 2W96B 3FZ1A 1JKKA 2WEIA 5EHYA 4FYNA 4ZSLA 3R71A 2YITA 5J9ZA 1LP4A 4FA2A 3MTFA 4XLVA 4DH8A 4O0WA 4IQ6A 3AC3A 4D2TA 5HX6A 4FV7A 4K6ZA 1H26A 4U7ZA 4YO4A 3CEKA 5FD2A 3RINA 4EOMA 5HVJA 3SAYA 3NCGA 5DOSA 2QODA 2VWUA 1BLXA 2ITNA 3A7GA 1PF8A 3EFWA 5KBRA 2LAVA 2EVAA 4IX4A 4E5AX 2OZAB 1K9AA 5DHJA 4QTAA 1JQHA 3C4WA 2QG7A 4FT7A 4AUAA 3U9CA 4K11A 1G5SA 4NM7A 4D4VA 2HZIA 4RX7A 4FNYA 5K0KA 5M55A 2CN5A 4I93A 4M8TA 1XH6A 4ONAA 1Q41A 5CASA 4O7RA 4EC9A 1YI3A 3C0GA 4KSPA 5I0BA 4QMOA 1APME 4C59A 3DBFA 5IZFA 5EQYA 3OP5A 3PRFA 5C9CA 2XRWA 3HP5A 3MDYA 3MJ1A 1GIJA 4Z7GA 5JSMA 5H8GA 1XH8A 1V0PA 5EW3A 3SXRA 4EZ5A 4FNZA 3HAVA 3OWKA 1XBBA 4W8EA 2BKZA 3EWHA 3KRJA 3Q32A 2W5BA 5AV1A 4O91A 3UVRA 3JVRA 3BEGA 4DEEA 5AX9A 2C0OA 4B8LA 5L2IA 3MFTA 2WD1A 2WZJA 3QQGA 4GCJA 2VTRA 4MAOA 4GKIA 2Z7RA 4UYNA 2PHKA 4YHJA 4B9DA 4ASXA 5IA2A 2OXYA 1DM2A 1GIIA 4ANQA 3U55A 2J0MB 3LMIA 4DFNA 3GI3A 4RPVA 2R3GA 4PDYA 3MA6A 4CMOA 3MFUA 4MBLA 4AF3A 5GINE 2FSOX 2W99B 3BCEA 3HMNA 3ZM9A 3ETAA 2C1AA 2BTRA 2W9ZB 3LFCA 5JFXA 4G3EA 4ITJA 4QOXA 3EMGA 4IIRA 4QNAA 3VF8A 3VS4A 2X39A 4AP7A 3KFAA 2JIUA 3V5JA 2R9SA 3F7WA 3NUSA 3QA0A 4FT0A 4QMXA 3HAMA 2YJRA 4ORKA 3MH2A 1H0WA 4LL0A 3MVJA 3O8UA 2QOLA 1HOWA 5E8VA 2CLXA 4IVAA 3UYTA 4YJPA 4QPSA 4DYMA 1U54A 3OMVA 5GZ8A 4NTTA 4AXAA 4L46A 3FZRA 5HNIX 3WIKA 4A06A 2JLDA 3FMNA 3UZTA 3AC5A 5IA3A 4LMNA 4O0TA 4D9UA 3IW6A 5C4LA 3RM7A 3GVUA 4IZ5A 3TTIA 1U4DA 3BE9A 4NU1A 1JAMA 3DKFA 4UY9A 3PFQA 4FK6A 4UALA 2UZDA 5K4JA 2FO0A 5AUXA 1YOJA 2O0UA 4Q9SA 2ZMDA 3ZLWA 4P2KA 3V6RA 5A6OA 2XNNA 4CV8A 4C4HA 5CNOA 2PVYA 3IGOA 2XKFA 2F7ZE 3ALNA 3AT2A 4F08A 2EUFB 4RJ5A 5C4KA 3E88A 3LXKA 4I4EA 4FOCA 5HO7A 3MW1A 4RFYA 5G6VA 1Z5MA 2R4BA 3TN8A 4DAWA 2QR7A 4CKRA 5E9EA 3TACA 2W1DA 3ANQA 2WQOA 4JX3A 4IAZA 5IQCA 4QP6A 2VX1A 2QNJA 5A46A 3GC9A 1ZOEA 2VWXA 2ZV7A 3QRTA 2XUUA 5AV3A 5M08A 3O8PA 1NW1A 3UNZA 2HIWA 3QX4A 4RQKA 2JKKA 4D1ZA 3B8RA 5DG5A 1P4FA 4IX3A 3TCPA 4EH7A 3D83A 2FB8A 2WGJA 3PLSA 5D1JA 2BRMA 3OG7A 5J1WA 3BU3A 2R0UA 4YPDA 2EB2A 3JS2A 5F94A 4I1ZA 4XP3A 3V8SA 4JS8A 3C5IA 1V0OA 2HXLA 3O71A 5ACKA 3RMFA 3KCKA 1O6KA 1W98A 4ZTNA 3CD3A 1JOWB 3LFSA 3ZLSA 3FZOA 4H58A 4TY1A 2J5EA 3RPYA 4DHFA 2IG7A 4GMYA 1FOTA 4FTIA 1CKJA 4IAKA 4QTBA 4XG4A 2JEDA 5CY3A 5F9EA 3FHRA 4PRJA 3F88A 4IM3A 4QMQA 4AE6A 2BZHB 2UZEA 3IW8A 4KB8A 1M2QA 2FSMX 5M44A 3VS6A 3EQCA 3FPMA 5DR2A 2C69A 3F82A 3QTQA 2X4ZA 3K5VA 1KWPA 4JIKA 2J4ZA 3QXPA 4GRBA 4F9AA 3D94A 4C3PA 3AD6A 2Y6MA 3FI3A 4H39A 4XHKB 4Y95A 2X0GA 4FKSA 2Y4PA 3OY1A 1J91A 1KV2A 1YI6A 3Q6UA 3ZUTA 4TRLA 3BV3A 4DGNA 4FEVA 2WMUA 4P5QA 5EQEA 2EU9A 2UZUE 2ZYBA 5CANA 4M69B 4IFGA 4ZTRA 4JG6A 3GT8A 4WKQA 1Q5KA 3R2YA 4IVDA 4JBVA 4EBWA 3EFJA 3WF5A 2F9GA 2ITVA 4WSYA 5FWKK 3PJ2A 3FXZA 2C5NA 4QQCA 5E8ZA 5M09A 4CFWA 3DXNA 4FSWA 5M07A 3E93A 4I3ZA 4ZTHA 3QKKA 3PRIA 4HGTA 3QTXA 3Q52A 4RC3A 1ZY4A 1XJDA 1KOAA 5L2WA 3C5UA 1OECA 4XP2A 3LXPA 3UIBA 1JVPP 4CZYB 5J5SA 5IEVA 4ARKA 3CJFA 4DEIA 5TO8A 5C8NA 1MRVA 1V1KA 4GUEA 5AAFA 1YXXA 2C6DA 4XMOA 5HLNA 2YACA 4QMMA 3WZKA 3LM0A 2PMOX 2UZOA 2WOTA 2YLEA 3T9TA 2PZ5A 3BHVA 1FVVA 4FKPA 1OL7A 3BBTB 3EN4A 4O0VA 1Y8GA 4FTOA 5L6PA 3QU0A 5AP3A 4WNMA 2BCJA 4BDIA 3TT0A 3UOHA 2QOBA 3KRWA 3D2IA 5KMOA 1KV1A 3TNQB 3BHHA 4FKIA 3DLSA 3F61A 3WARA 4Y85A 3QTUA 4F9WA 5L8JA 3R8VA 2BAKA 3DKGA 4ZJIA 4ZJVA 4YJNA 4BB4A 3BGQA 3BGPA 1UU3A 2R3RA 2VWBA 3MV5A 4QD6A 3NUAA 4XP0A 4IB5A 3ORTA 3R8MA 3TDVA 5ANOA 1BYGA 3GCQA 3KF4A 3UP2A 3LLAA 1LUFA 3JXWA 3OCBA 1QCFA 1WZYA 2C0TA 2XS0A 3FLWA 3KQ7A 4QYFA 5LVMA 2QVSE 4EK4A 3C0IA 4CTCA 4F6WA 2OZOA 4M13A 3IW5A 2NPQA 1PXKA 4RLLA 5AV4A 5H8EA 5FBOA 4CG8A 3VS7A 4EOIA 5JZNA 3RVGA 2W9FB 5L4QA 4R8QA 1CSNA 1PHKA 2DWBA 3L8VA 2OF4A 4Z3VA 3LE6A 3DK3A 2WMSA 3IDCA 4FEUA 1ZZLA 3FV8A 4NCTA 4NIFA 4KKHA 5CTPA 4G6LA 3A8XA 5BVKA 4E73A 4D4YA 2EXCX 2ZV9A 5AM6A 3R8UA 2W1HA 4YHFA 5ANEA 3V5QA 3R9RA 4KKGA 3KY2A 3ROYA 3D7TA 3OVVA 1WBOA 2PMIA 3K3JA 4BCNA 3CTQA 4O0SA 4RIYB 5FTOA 5H3QA 3P4KA 3LIJA 4IJPA 3BPRA 3Q2MA 4TWOA 2AC5A 4AW0A 5IQGA 2IW6A 3HP2A 3R9DA 4CFMA 3LXNA 2UW4A 5HNGA 4DFZE 4RVKA 3NW6A 3BHUA 1WBSA 3VBQA 2OIQA 2VTAA 4XV1A 2OLCA 5GIOE 3PIYA 2KULA 4UWBA 2XIZA 4G3FA 1YXUA 2JDSA 1R78A 3MTLA 4X2GA 2ZMCA 3DZQA 5E8XA 4FX3A 2F2UA 4Y72A 3ZRLA 3SD0A 3POOA 2Z60A 3QAME 4M97A 4HNIA 5A4CA 1TQIA 3ELJA 3L8SA 3QALE 4C4GA 5L2SA 4L42A 1ZXEA 3UO5A 2QKRA 3VJOA 3BELA 4V05A 4LOPA 5DI1A 5E92A 4JQ8A 2ZM4A 5DN3A 4D9TA 4S31A 3ZO1A 4MVFA 5A4TA 4Y8DA 2XKCA 3O17A 3Q60A 3MN3A 2VWIA 4ACMA 4EH3A 4FUYA 3C4ZA 2I0HA 2J0JA 2IWIA 3KRXA 5FBNC 5GJDA 4BCHA 5DA3A 3ROCA 4EK3A 2AC3A 4WA9A 3VBTA 4LM5A 4TW9A 2YAKA 3P7CA 4DBNA 4IWQA 3L8XA 4J71A 3S3IA 3KGAA 2RIOA 3IQ7A 3GQLA 3R1YA 4MBJA 4Z7HA 3R02A 1ZYJA 2B9JA 3C1XA 2VWWA 5D7VA 4H1JA 2UZBA 3NDMA 3HZTA 3IDBA 2I6LA 3F9NA 3K2LA 4HCUA 3POZA 4NH1A 3U6IA 2IZSA 1YWVA 3CPBA 1PW2A 3BWFA 3U87A 5KNJA 2XP2A 2YCQA 3PSCA 2G1TA 4FL1A 4O7TA 4YTIA 5EYKA 1Q62A 3EQFA 5BVDA 5CVGA 3RALA 5I9ZA 4LMUA 4LRJA 3S2PA 1QPDA 3PVWA 3I7CA 3L9LA 3G0FA 4W4YA 3BLRA 4XV2A 3BE2A 4M15A 4PWNA 5AX3A 4D5HA 1MUOA 3FWQA 2XNMA 5EG3A 3FMEA 1OL1A 2YISA 3I0OA 4J1RA 3W2RA 2UW5A 4P5ZA 3R0TA 1WBNA 4RA4A 2CN8A 4C34A 3R9HA 4O7WA 4AT5A 5CAQA 3D5XA 4BTMA 3PXYA 4XLIA 4IB0A 4PV0A 2W06A 2W4KA 3UVPA 4O0XA 5FRIA 3JVSA 3GXLA 3A99A 4U44A 3UTOA 4ALVA 4IX6A 1U59A 3GCPA 4XS2A 3MFSA 4GEOA 3P23A 3Q3BA 4I5CA 2QU5A 3QRIA 4YGAA 3EFKA 5HIBA 2VU3A 4GIIA 5G1XA 4L44A 3K54A 3NUUA 4GJ3A 4N6YA 4OTGA 4TNDA 3ZO3A 5JGDA 3UQFA 3HV6A 4EZ7A 3KF7A 4PDPA 4NL0A 5AV2A 3FZTA 2JIVA 3IG7A 4OBOA 2GNIA 1JSUA 4D2VA 2O65A 4WOVA 4BZOA 5BVFA 2NO3A 3D5WA 3NX8A 4X3FA 4B7TA 5AUUA 5L2QA 3UDBA 4QMUA 5B2KA 3I79A 4LFIA 5GHVA 3QQHA 3TZ9A 3UMXA 2JDTA 3PXZA 3F3VA 5EM8A 3RHXA 1FGIA 2YLFA 5J9LA 4S2ZA 4MNEA 4U3ZA 2XRUA 3R00A 4BKJA 4TYEA 5TOZA 4AQCA 2OU7A 3D5UA 3TDWA 4GYIA 3CY3A 3E8NA 1Q8UA 2OJFE 3AG9A 1CMKE 4DG0E 2YCFA 4MQ2A 4WBBB 4DT9A 4GYGA 2WTIA 5HE1A 3F3WA 2WMQA 2XIXA 3DTCA 4CCBA 3QF9A 4WT6A 4TYIA 1Q4LA 1RW8A 2ITPA 1SVEA 2GPHA 4AZWA 4JDHA 4EZ3A 4YMJA 5HU9A 4FSTA 1RE8A 2VO3A 3I81A 4FV4A 2JAMA 3G90X 5DYJA 1PXPA 2WFYA 3DBQA 3GENA 3SC1A 1G8SA 3GUBA 5FLFA 3QRKA 5B2MA 5IEYA 5TKDA 2C5XA 4AE9A 2QU6A 2P2HA 3GEQA 2W4JA 5J7BA 2X8EA 2R3NA 3LMHA 3OZ6A 4FOBA 5FXSA 5JGBA 2RFDA 3CQWA 4EKKA 1V0BA 3DAJA 3S0OA 4BDGA 3TIYA 4C36A 3ZTXA 4CTBA 3JPVA 3ZDUA 2HELA 3WZDA 3ZSHA 5AUYA 3OTUA 4CRLA 1IAHA 3FLQA 3FKOA 2XYUA 4LI5A 2WIHA 1W83A 1IRKA 3UNKA 4DITA 4TZRA 3ZH8A 3A7IA 2CGXA 4Y5QA 4L8MA 2V0DA 1FVRA 4CMUA 2JKQA 5D41A 4D4SA 2VZ6A 5LMKA 4IW0A 3PPJA 4K0YA 2GHLA 4KKEA 1Q3WA 4P90A 4W9WA 5HO8A 3PDTA 4I20A 3PXRA 3R28A 2BROA 4G9CA 4F9YA 3MH3A 2PZIA 3MVMA 2VO7A 3EZRA 2O63A 3ZFYA 4EORA 5HTBA 3OEZA 2CNVA 4YBJA 4AOJA 3R7EA 3AC8A 3IW7A 4ZY6A 2QOOA 3UVQA 2ZV8A 4ANNA 4BZDA 4O82A 4LRKA 2C6EA 4N6ZA 4X6QC 4BCPA 4ZLOA 3U6HA 4NW5A 4FSQA 4FT5A 5EK7A 2SRCA 2WMWA 5EHOA 5I3RA 4FSUA 5IA1A 1UV5A 3PZEA 4A9UA 3DDQA 2VTTA 3NAXA 3CQUA 2BHEA 3LFNA 4O1PA 4GKHA 3OXIA 1JBPE 2W5AA 3NAYA 5M4CA 4LG4A 2VTSA 4D0XA 1OM1A 2Y8OA 4EC8A 4OAUC 1W0XC 1E1VA 3NIZA 4QP4A 4I24A 4RFZA 4WG3A 5AP5A 4Q9ZA 5A4LA 2R64A 5IH4A 4KS8A 3SHEA 4F1MA 3CC6A 4KBCA 4YZCA 4DGOA 5KUPA 4NTSA 4DGLC 5CAUA 3OXZA 3HKOA 4R3RA 4DLIA 4BDFA 4C2VA 5DMZA 4CFNA 4O0RA 5HOAA 4HVGA 3G9NA 3QHWA 3LFDA 4JVGA 3ULZA 2YEXA 4PMSA 5BMMA 3RK9A 3LJ1A 3VS0A 4YTHA 3ENMA 1XH5A 4FKTA 3FLZA 2IN6A 1NXKA 2VTPA 4TTHB 4JI9A 2G2FA 2WNTA 5C8MA 2B9HA 2I0YA 4YURA 4AZFA 1JKTA 4H36A 1F3MC 4XV3A 2OH4A 4FV6A 3AQVA 1NVRA 3LM5A 2Z7SA 2GNLA 2ONLA 3N9XA 1VYWA 2R3PA 4FTMA 4DLJA 4ZOGA 5CVFA 3BLQA 4OT5A 4QYEA 1JPAA 3NWWA 4IAAA 5TT7A 3RTPA 2JDOA 3F5PA 3ZS5A 2QOFA 1H25A 4YZDA 1BL6A 3HMIA 5EDPA 4RIXB 2JKOA 3ANRA 3QTRA 3FZPA 2BAQA 3EOCA 3AD5A 2XBJA 3ORKA 4TL0A 1H08A 5IF1A 4BDKA 4ZMEA 4JG8A 4F4PA 2QO2A 3GU6A 5IU2A 2ZV2A 3PJCA 1OZ1A 4WG5A 4FSMA 4CEGA 3I6WA 4GT4A 1UNGA 5HESA 4CKIA 4RVTA 3PPKA 1HCKA 4JXFA 4H3QA 5E1EA 5E8WA 4XH6A 3ZDIA 2BIKB 1J3HA 3KXNA 3FMMA 4MHAA 1H1RA 5F1ZA 4EHVA 4AU8A 2OJGA 4O7VA 2WKMA 4JRNA 4TKSA 5KCVA 3UJGA 5KMLA 3CIKA 4FTLA 5ITAA 3LQ8A 5E8TA 3IGGA 2JKMA 4IWOA 4ZTLA 3VS5A 4Y5HA 3W8QA 4R1VA 2C68A 1I09A 3Q96A 3DB8A 4DCAA 5DBXA 2X2MA 4C33A 1Z57A 3W10A 2PVLA 3PY0A 3ZO4A 1UNHA 1PMUA 4PY1A 2ETRA 3ZXTA 3CTHA 3V01A 4M67A 3W2PA 5GZ9A 3THBA 4A9TA 5HIEA 4JOAA 4LGGA 2X6EA 4RX8A 3VC4A 5HLPA 4TYJA 2QONA 4UZHA 3KREA 4YTFA 1PMVA 4YLLA 4BI1A 4GK2A 2I0EA 4BYJA 3VN9A 5IKWA 3VAPA 2X7FA 2Z8CA 3M11A 4KNBA 3FAAA 4FIFA 4L7SA 5CXHA 5ETIA 5EW8A 1IASA 4BI2A 5BX0A 5JMSA 3NZ0A 2B52A 5HBHA 2PY3A 2ERZE 2JIIA 2R3QA 5HEZA 2OG8A 4AACA 1Z9XA 3HYHA 4FIHA 4FVPA 5CAVA 1UKHA 2UW8A 4IB1A 3RAWA 1ZWSA 2OFUA 3NUPA 4D0WA 3VQHA 1SVGA 2PK9A 1UU9A 4GFOA 3FYJX 4O7YA 3ERKA 1M2PA 3FKLA 4CT1A 2F7XE 4IACA 2PPQA 3A4OX 3UIMA 3TV6A 3V6SA 3W33A 4DH1A 3LVPA 3FXWA 4HGEA 4IE9A 2X7OA 4EOJA 2XCKA 2R3JA 4QMPA 2YZAA 4BCIA 4X2NA 5CI6A 4X6RA 2E9NA 4C4FA 3VQUA 1GOLA 4BHZA 3NVMB 5KMKA 3R04A 5J9YA 3SKCA 4XX9A 5KMIA 2XM9A 4YPSA 4AGWA 4G17A 4P7EA 4YLKA 2UZTA 3SLSA 4O81A 4RJ7A 3E63A 4L3PA 3R9NA 4QP7A 3L9PA 4USDA 4CYJA 3W55A 4BBMA 4FG7A 3TM0A 4MD8E 1SNUA 3SRVA 3SA0A 4NKSA 3ORPA 3R7VA 4RWLA 3SDJA 2R3LA 4RIWB 5FXRA 3CXWA 3N4VA 4QO9A 4JR3A 5IUGA 4EH2A 1DAYA 4AZTA 3E5AA 3VUKA 3TZMA 2LGCA 2X8DA 4QP8A 4R78A 3FQSA 4UV0A 3ORXA 4K77A 3QC4A 3R8PA 2ZDUA 4O7LA 3G2FA 3QUEA 1U54B 3RAKA 5EM5A 2Z7LA 4FV1A 2B4SB 2C6LA 1H8FA 3KMUA 4FV0A 2XJ2A 3RZBA 3TZ8A 5CU3A 3RP9A 1W8CA 5I9VA 4DGMA 2G2IA 4FGBA 3OEFX 1LR4A 4WIHA 5EH0A 1ZOHA 2QD9A 4HYUA 5HCXA 3Q53A 4FTAA 4BKYA 3M2WA 1UU8A 3D15A 5I9UA 3ZBXA 3BRBA 1TQPA 4L01A 3GOPA 4R3PA 4JBOA 3CGFA 1B39A 2FH9A 1YVJA 3I1AA 4IWDA 4GT3A 3F6XA 3E7OA 5HVYA 5AR2A 5JFWA 4MEDA 3BI6A 2Y9QA 1AGWA 1MQBA 5EI2A 3BYMA 2XCHA 5IUHA 4IANA 2XK8A 2OICA 4ERWA 4RFMA 1JWHA 2VNWA 4K1BA 4BTJA 1YDTE 4QRCA 2QG5A 1WVWA 2FSLX 3C4XA 3TTJA 1UVRA 3LCKA 1ZOGA 1XWSA 3BU5A 3P1AA 3QC9A 2VAGA 2YM5A 3BIZA 3HMMA 2KTYA 3UBDA 4JRVA 2OZAA 3RJCA 4BDHA 1BI8A 3DJ6A 2RFEA 3GCSA 3DFAA 4A9YA 1PRYA 2CCIA 4I23A 4K8AA 3FL4A 2JD5A 4ZTMA 1BI7A 2IJMA 4FR4A 1B6CB 2VO6A 2GCDA 3LFBA 3OT3A 4JBQA 3E3BX 5EFQA 3TIZA 3V8WA 4AFJA 3GC0A 1WCCA 5K5XA 1OIUA 3RBWA 1YDSE 3QCYA 3OWPA 4I0SA 4NZWB 4YO6A 5IQDA 3I5NA 3R30A 1PYXA 5L3AA 3RHKA 4U40A 3Q4TA 2F2CB 4G6NA 4F6SA 4BR3A 3A8WA 4OW8A 4DT8A 5BMSA 1YXVA 4LGHA 3TJCA 4ZY5A 5IDNA 5EQPA 5K3YA 2B9FA 1EH4A 1TKIA 2IO6A 3MY1A 3KXGA 4KRCA 4NSTA 5FXQA 3ENHA 3QTSA 2PVMA 3QGYA 4B6LA 5CU0A 3W1FA 4PDOA 2HW7A 3ZLYA 4BDBA 1PJKA 5T6KA 4YUQA 5I9XA 3C9WA 2UVZA 2P2IA 4J98A 2E9UA 4J52A 3GU5A 5ACBC 5JK3A 1FVTA 5DVRA 5DH3A 3SVVA 4BC6A 2ITTA 4QT1A 1QPCA 2PULA 2BUJA 2CJMA 4O84A 5CSPA 4BCMA 2YCRA 4DBXA 4RZWA 3E8EA 3MBLA 4L43A 3GU7A 2BRBA 4YSMA 1STCE 2RG5A 3BYOA 3EN6A 2UVXA 5KMJA 5KMMA 3G6HA 4FV9A 4CLJA 1RDQE 2B0QA 1OIQA 2FVDA 4A4XA 4IVCA 2FGIA 4U0IA 3HL7A 5DT4A 3O7LD 4FT3A 3R83A 3CE3A 3EYGA 3VHEA 5M51A 3EQRA 3VBYA 2CGUA 4IAIA 1QPJA 4IZAA 4LUEA 3OY3A 4ZSJA 3IDPA 4O1OA 2H6DA 4YJOA 4S33A 2CNQA 3D2KA 1RJBA 5CI7A 5HKMA 5IH5A 3KRRA 3QZGA 2UUEA 4B0GA 3RNIA 3ZZWA 4DFBA 5E1SA 1P14A 4PF4A 4F1OA 2X2LA 4HVIA 1JKLA 2JFMA 2BKKA 3BYVA 3BYUA 4C37A 3GQIA 3CQEA 5AUZA 4LOOA 2V7OA 4UBAA 3QQKA 3DJ5A 2GS6A 5AJQA 1XBCA 3BKBA 1WMKA 4CCUA 4X21A 4E1ZA 2OGVA 5HI2A 3W32A 4PL5A 3COKA 4ENYA 1HCLA 4MKCA 1P5EA 5KHWA 3B8QA 4YTCA 3F5GA 4JAIA 4RRVA 3SGCA 1WVYA 3KKVA 3ORLA 3PE2A 3OCGA 4KINA 1B38A 2IZUA 3QL8A 3WZJA 4HOKA 1XKKA 3CGOA 3DBCA 4PP7A 5K4IA 3KULB 3LFFA 3VUMA 3C51A 4IB3A 3EH9A 2QQ7A 2I0VA 5DT0A 5IA0A 5EKNA 1NT2A 3NSZA 3R7OA 5LCKA 2BIYA 5CEOA 3O2MA 4ZJJA 4EUTA 3VUHA 3E87A 5KZIA 5HD4A 2Y7JA 5FTGA 3RPVA 4QP3A 3DBEA 5CU4A 3TNHA 4ANOA 5C01A 2PVKA 5BQ0A 5KMNA 3LKMA 4QMZA 3BHYA 3COHA 3C7QA 3OW4A 4X2FA 5DR6A 4BDDA 4CD0A 4FKRA 2UW0A 3O0GA 1URCA 5FQDC 3VBVA 4F9CA 2W17A 1WBPA 3M1SA 3P78A 5ANDA 4BWXA 4U3YA 3QCSA 4XNEA 4YJVA 1OVEA 4FEQA 1A06A 5K0XA 4PTEA 2X9EA 2YDKA 1A48A 4RJ3A 1M2RA 4PMMA 1GIHA 1MRUA 4E4MA 4MF0A 5FEDA 4ACDA 3OWJA 3F2AA 4ITHA 2YERA 4PMTA 3FY2A 3BQCA 1QMZA 2V5QA 4I94A 3HRCA 4DGGA 4CXAA 4EQUA 3UQGA 3D14A 4AN2A 2C6TA 2R5TA 4U79A 3MPTA 3PZHA 4FTUA 2WELA 4NW6A 3Q4UA 3FJQE 5JRQA 2J0IA 2JAVA 3NYVA 4XBUA 3FEGA 4TNBA 5CSWA 1IR3A 1DAWA 4AT3A 3WE8A 2GTNA 5FEEA 3MH1A 4QP1A 2P3GX 3EN9A 4EH4A 2ETKA 1X8BA 4BCGA 3ZUUA 2PZRA 2BFXA 2ZB0A 3FY0A 2H9VA 3DAEA 4MTAA 3IECA 3FI4A 4F7SA 3HA6A 4V01A 5AIRA 3Q2JA 2PVRA 4ZEGA 2XKDA 3DOGA 3OOMA 4HVDA 3I5ZA 3OXTA 4J95A 3KL8A 4YU2A 4IMYA 2J90A 4L9IA 4X2KA 3KVWA 5KE0A 4G16A 2ZJWA 3OS3A 4PL4A 2ACXA 2BHHA 5FM3A 2HOGA 4G2FA 3E8DA 4I5MA 5CT7A 3ULIA 1BX6A 5JN2A 2VRXA 2WHBA 2PE2A 5HE3A 2VTJA 1DI8A 2VTNA 3HV4A 4YJUA 4DH3A 2OH0E 4IC7A 4XG9A 3E62A 2DYLA 2YIXA 2OXXA 3GCUA 3LFEA 3Q9YA 4AA4A 5C03A 2XZSA 4Q2AA 5ETFA 1PY5A 4KUJA 3QYZA 1FPUA 2VTQA 4ZLYA 4M7IA 2XNPA 3QYWA 4QTDA 5ETAA 5E8SA 4Y46A 3WF8A 3Q5ZA 3QRUA 3ZHPC 3W2OA 4BBFA 5EYDA 2R7IA 4FYOA 4KWPA 2X1NA 5D7AA 5JFVA 3UIUA 4LL5A 3O50A 2XNBA 3EIDA 2O2UA 4RMZA 4USEA 4AAAA 2QCSA 4NWMA 3P79A 4O27B 4YBKA 4BICA 4D2WA 3QLGA 5HVKA 4GL9A 4WNOA 4HVHA 1OGUA 3R7GA 4ZP5A 5IDPA 4QYHA 3JYAA 4QMNA 3BX5A 4BCJA 4TYHB 1PMNA 5BYZA 5E8YA 3HV5A 1U5QA 4W9XA 5LARA 4AZVA 4BTFA 2BZKB 2RKUA 3ZOSA 4LOQA 4Z16A 5M06A 5HORA 2RGPA 2YABA 3OD6X 3UQCA 4XCUA 2J9MA 4I4FA 4A07A 2ITXA 2A19B 4ZXTA 2DS1A 1P2AA 4YHTA 4RG0A 3DKCA 3D5VA 4CZUA 4DH5A 3R1QA 4DTKA 4C58A 2X4FA 4QMLA 4RC2A 2Q0NA 2G2HA 3MS9A 4UMRA 2PYWA 1OKVA 5AFVA 4K2RA 3FLYA 5EI6A 4DTBA 5CSHA 3GB2A 5HNBA 4FIGA 3VBWA 3HUBA 5IEXA 5FG8A 1PXNA 3ORNA 5EW9A 4FBXA 2WMAA 4XRJA 5BPYA 4YNOA 2XNOA 3EQDA 4NFNA 1W82A 3NW5A 4DE4A 4FE2A 3RCDA 3ZSIA 3F2RA 3B2WA 4ERKA 4ZTSA 3DAKA 3HVCA 2C5VA 3MVLA 4FZAB 4G3CA 3PG3A 4IFCA 1SNXA 4R1YA 4RIYA 4X3JA 1E9HA 5EKOA 3TL8A 1O9UA 4WNPA 4F7NA 4QQTA 3F5XA 3O96A 5AADA 2ITWA 3GNIB 4BYIA 3DXPA 2PMNX 3VRZA 3H10A 4EQMA 4IX5A 1GZ8A 2Y4IB 2ZDTA 4FTTA 3T8OA 4C62A 3AMAA 5TE0A 3PP1A 4EBVA 5JT2A 2I7QA 4FG8A 4E7WA 3UE4A 5ETCA 3FBVA 4O6LA 4MNEB 3ZC5A 3QQJA 1KE9A 4II5A 5AA9A 2PUIA 4KIKB 1LPUA 3UGCA 5H8BA 3WBLA 4UWCA 2FUMA 2WTWA 4EOPA 2QOIA 2PZYA 2ZOQA 2XYNA 3DBDA 3UZPA 2EWAA 2YHVA 3II5A 1GNGA 3R01A 2OFVA 2EB3A 3HV7A 4RJ8A 1T45A 3VJNA 1Q8YA 4EOKA 3R2BA 3NUYA 1QPEA 4FKGA 4ANBA 3P7BA 2QHNA 3PUPA 3E8CA 4GFMA 4FICA 5CAOA 3NR9A 5JKGA 4L7FA 2V7AA 2BDFA 3FMJA 2GNHA 4JG7A 3DZOA 3OCSA 3ID6C 2AYPA 1IG1A 2R3IA 3DK7A 2VO0A 2WMXA 3MIYA 4ALWA 5FDPA 3WI6A 1KOBA 3NNUA 4J7BA 3EB0A 2V55A 5EM6A 3OROA 5AP4A 1NA7A 2Z2WA 2UZWE 1URWA 2VD5A 3IOPA 4ZSEA 5HICA 1Q3DA 5M57A 1QL6A 5HCYA 4BY9E 3DXQA 4I6FA 3CD8A 3EZVA 4ZS0A 4G5JA 2GS2A 5AAGA 3TUBA 3FXXA 4FSZA 1KE5A 4IH8A 3PJ3A 3EN5A 2HCKA 5CAPA 5CLPA 3EFLA 4JAJA 2VUWA 3RCJA 4FL2A 3DLZA 2UV2A 3VULA 4OBQA 4CNHA 2PVFA 2OIDA 2ZM1A 4LV8A 2J50A 2B55A 4RVMA 2XF0A 5LVLA 3IONA 2BTSA 1VYZA 3DS6A 4DINA 4TYGA 3MIAA 2QC6A 3Q9WA 5BYYA 2DQ7X 3K3IA 2YIRA 4BDEA 4B8MA 3FC2A 4GIHA 3KA0A 3ORZA 3OCTA 4IZ7A 3QA8A 3MFRA 3VUTA 4BCOA 4ZZOA 5FGKA 5DGZA 2H34A 2I1MA 3TNPC 4L3LA 4YZNA 4F7JA 3PXQA 2XNGA 2IVVA 4EKLA 3ZBFA 2W1IA 5F95A 4M12A 5DPVA 1O6YA 2YAAA 3ET7A 1SZMA 4L67A 3DGKA 5KBQA 4ZK5A 2VTHA 3ZRKA 1XR1A 4DA5A 2YM7A 1XQZA 3GU4A 3BGZA 4S32A 4AOTA 3W8LA 4YZ9A 4XJ0A 3S1HA 4BGGA 4PTCA 3EL8A 3FZSA 3ZFXA 4E6QA 4DTAA 4PMPA 4OTFA 3LW0A 2CKOA 4FGRA 3VVHA 3G15A 3BZ3A 5DIAA 1ZYLA 2BILB 5AMNA 3I6UA 3U9NA 5CWZA 3EQIA 4O2PA 4GG7A 2X81A 1ZYDA 3FYKX 3R73A 4H3BA 4RX9A 4GS6A 4E6DA 5A9UA 3W16A 2A4LA 3KVXA 4F0IA 5LMAA 4BCQA 1H01A 4ZMFA 2H8HA 4FI1A 1KE7A 4O21A 2QURA 1OPLA 2WB8A 3MGYA 2OXDA 4V0GB 4QP9A 2OWBA 4TWNA 3QGWA 4NKAA 5CSVA 2YA9A 2QOHA 4XBRA 2P0CA 1OL5A 1SYKA 3ZUVA 4D58A 3A61A 3Q6WA 4BWPA 1YKRA 4MXCA 4BF2A 1IA9A 2VGOA 4DF3A 1LEWA 4G6OA 2R7BA 5CENA 3CLYA 3LOKA 3VNTA 2YJSA 4HPUE 5CEIA 1YRPA 5I4NA 2W1GA 3MA3A 1UWJA 4Z9LA 3I60A 2Y4IC 4IC8A 2XA4A 4KSQA 3ZLXA 3FHIA 5EI8A 5AUWA 4C8BA 3R7IA 4CMTA 2YM3A 1CKIA 4FTCA 1XBAA 4MH7A 4F63A 3ALOA 5FUTA 3RGFA 4BFMA 4CLIA 4HCVA 2Q0BA 5CX9A 4Q5EA 2Y0AA 2C6OA 3QUDA 1OBDA 3C0HA 3JUHA 1Q24A 5LCJA 4BTKA 4H05A 2YWVA 1O6LA 4OAVB 4I92A 5T3QA 4C4EA 3C13A 3MY5A 5DRDA 4L53A 3TEIA 3V5TA 5JZJA 3F66A 3A7FA 3SX9A 3ZU7A 3UC4A 2UW3A 2W1FA 2YDJA 2J2IB 4FL3A 3CPCA 3LAUA 4LQMA 4UMQA 2HYYA 3ACKA 2IW9A 1UWHA 4FVQA 4EOQA 5B2LA 3QKLA 4CVAA 1BL7A 4KBAA 4D55A 5BVNA 4AW2A 2W05A 1PKGA 1ZZ2A 2GHMA 3D7ZA 3ZC6A 1YOMA 5AP6A 3PVUA 5IQBA 1PYEA 4C2WA 5GIPE 3DT1A 5F20A 3VBXA 3LLTA 1YWNA 3R8ZA 3OWLA 2PL0A 2XBAA 1REKA 2BR1A 3H4JA 3KEXA 5BVOA 4O7ZA 4IAYA 3E64A 3O7LB 4A4OA 3QBNA 5IUIA 3ZCLA 5ANIA 4ASDA 1J7LA 1OKYA 4FNXA 3WF9A 5A14A 3L9MA 3NW7A 5IG1A 4IDTA 2BZIB 4WO5A 4QP2A 4BCFA 4JR7A 4W4VA 4F6UA 1U46A 3AD4A 1FQ1B 1T46A 3MVHA 5HCZA 3W2SA 4FEXA 3RPRA 4QTCA 3N4TA 1GZKA 4FZDB 2Z02A 2R3FA 4E4XA 3GCVA 1OITA 3TUDA 1VZOA 3COMA 2ITZA 2P55A 4HYHA 4E93A 1YI4A 4MYGA 4RJ6A 3R1SA 5CZHA 5AP1A 3FC1X 2XK3A 2WPAA 3QD0A 2XB7A 1Y8YA 2VTOA 3QWKA 4IXPA 4M3QA 3ZONA 4UXLA 3ZMMA 3DKOA 2XKEA 4OR5A 3RKBA 2WMRA 3HEGA 2IW8A 4EH9A 4QTEA 1M7QA 3UPXA 2J7TA 4XOZA 4RGJA 3A2CA 4EWHA 2HWPA 2B9IA 2BDWA 4CG9A 3N51A 4C4JA 3A7JA 3UO6A 2XIRA 4GT5A 4H1MA 4DEBA 4MBIA 2GNGA 3H9RA 4BBEA 5HU3A 3AC1A 3T9IA 2XJ0A 3HGKA 4AW5A 4EL9A 4R77A 5AR7A 4IZYA 1J1BA 4DEHA 4N57A 3QX2A 2XK7A 3FSFA 4APCA 4IWPA 4UX9A 3AT4A 3VS3A 5EDQA 2ZAZA 2OIBA 4FIJA 3R1NA 4YR8A 3EN7A 4MWHA 4X2JA 3EJ1A 3QTWA 3VW6A 4F1TA 4M84A 3DQWA 5FM2A 5IQFA 3HV3A 1ZRZA 1OPJA 2C5OA 2WTDA 1P4OA 4XYFA 2EXEA 4ZIMA 4CQEA 2VWZA 3LQ3A 1IEPA 3R63A 2PZPA 1Q8TA 4JX7A 5CVHA 1Q8ZA 5J1VA 3RWPA 5E7RA 1IAJA 3EQGA 1A9UA 4LYNA 4RIXA 3OFMA 4M14A 1KSWA 2BRNA 2J6MA 4PDSA 3U4WA 2VWYA 2WQNA 3ZM4A 3CKWA 3FE3A 5IH6A 2A27A 4MX9A 5D9HA 4F65A 4EH6A 4C3FA 3PSBA 4DFLA 2R0IA 2OJJA 4GUBA 4UXQA 3ACJA 2OKRA 2QLUA 4EQCA 5E91A 4DFYA 4RX5A 3G51A 2WU6A 4FKUA 5CZIA 3WZEA 5C27A 4EK6A 3DU8A 2J51A 4Y83A 3UODA 4ID7A 3CCNA 3ZRMA 4AX8A 4R3CA 2ZB1A 2V22A 4F0FA 1H1SA 2PWLA 3QFVA 5ICPA 4DH7A 4UEUA 5CF5A 5J5TA 5HQ0A 3I7BA 1J7UA 4G5PA 4O96A 4YC8A 4FZ6A 4M68A 2GTMA 4ANMA 5GNKA 1Q99A 4A7CA 4C7TA 2P4IA 2OJ9A 5AV0A 4CFUA 3PA5A 1Y57A 2CLQA 1PMEA 2C4GA 1R39A 3ZYAA 4JDKA 2C3JA 3HLLA
chains in the Genus database with same CATH superfamily
4O83A 4PUZA 5L8KA 4IHPA 3EQBA 4LDTA 4DG3E 4PTGA 3HECA 1FGKA 3Q5IA 4JQEA 4PPCA 4N70A 2X7GA 1M52A 4AFEA 4C3RA 3ATTA 5M56A 3RM6A 1WBVA 1OKWA 5IA4A 2UVYA 4YP8A 3PA4A 4QPAA 3VO3A 4AWIA 4E8AA 3DY7A 1OUKA 5KX8A 3FL5A 3S4QA 4FV3A 4ZLZA 3L9NA 1M14A 5J87A 4F0GA 4FEWA 3WE4A 1W7HA 2C3LA 5BVWA 4FK3A 5HG5A 5A4QA 2QLQA 1Y6AA 5B0XA 3U51A 5BUIA 3QCQA 3BL9A 3OC1A 2UZNA 3MY0A 3TWJA 1YW2A 2F4JA 3PIZA 1LEZA 5JRSA 2WU7A 3ODYX 3IPHA 5CNNA 2HAKA 5EOLA 2R3OA 3FDNA 3QUPA 2W7XA 5HG8A 3VHKA 2XK6A 5BNJA 2OI4X 3QCXA 3VS1A 3OBJA 3WILA 3P7AA 5HE2A 3RI1A 3TI1A 3BBWA 3PTGA 4G3DA 3NEWA 3QZFA 3OUKA 4AS0A 3QKMA 2RSVA 2XIKA 2XH5A 2WMTA 4EUUA 3D4QA 3PIXA 1FMKA 2XK9A 4YJRA 5HX8A 2O3PA 4CYIA 1YHWA 4AN3A 2E9VA 4U43A 5CYIA 5D11A 5ANJA 3QLFA 2BPMA 3R7YA 1AD5A 3P9JA 5BVEA 3WZUA 3NNWA 5CALA 3CBLA 5HTIA 2G9XA 5J7HA 5JQ8A 4O2ZA 4AA0A 3KU2A 5I9WA 3PSDA 4EHZA 2XM8A 2YM6A 5L6OA 4FSYA 5I5ZA 5K5NA 1E1XA 1KE6A 4OTRA 3RPSA 4FTQA 4DG2E 4U97A 4AGDA 3OTVA 4Y73A 3KMMA 5C8KA 4RIWA 3LCTA 1M17A 2WIPA 4EOSA 4ITIA 2REIA 5D10A 2CMWA 3PPZA 3UNJA 3W2QA 2YN8A 3UDZA 4AQKA 3PY3A 4R7IA 3E3PA 2ITOA 2UZVA 4G34A 3H30A 4ZSGA 3FMLA 2W1ZA 3LFAA 1TQMA 1YOLA 2UW6A 4FV2A 4I5PA 1BKXA 4WSQA 4DEDA 4ASZA 1UA2A 3AT3A 5DRBA 3DNEA 3WF7A 5FTQA 3MI9A 2ZFYA 4UYAA 4JNWA 2O8YA 3C50A 4AN9A 3SOCA 5IPJA 1GZOA 4XG6A 1F5QA 2GU8A 3O51A 2PTKA 1ERKA 2XJ1A 4E5WA 4AXCA 4QQ5A 3UG1A 2XIYA 4CFFA 5C1QB 3MPAA 2J0LA 4LUDA 1YXSA 3LCOA 1OIYA 3D0EA 2YWPA 4FKOA 5A54A 5M4FA 2XALA 3ITZA 5HG9A 4QMYA 4BIBA 5IMXA 3C4EA 3HRBA 3ML1A 4CKJA 5KO1A 2C1BA 4BGHA 5H9BA 1ZY5A 4EK8A 3U6JA 5IMEA 1KUTA 3VIDA 3IW4A 4M0ZA 2QOQA 5T68A 2F7EE 3PLAE 3VUDA 4UMPA 2IVUA 2GNJA 2J0KA 3TKHA 3GU8A 3MSSA 3GC8A 4NYEA 4JDIA 3VF9A 2ITUA 4C38A 2XAMA 4NK9A 4E5BA 3DB6A 3F2NA 2PVNA 3DDPA 3RZFA 3CSVA 2IPXA 3HRFA 4BJJA 3BHTA 2HY0A 1CM8A 5TF9A 3E7VA 2HY81 1SM2A 4BIDA 2GQSA 2YFXA 3S00A 1TVOA 4QMTA 1YWRA 3F3ZA 4I6BA 4ZAUA 3DV3A 4G9RA 1H1WA 2NNWB 2RFSA 4RZVA 3R8LA 3EHAA 5M53A 4I22A 1H27A 4HZRA 5A4EA 2CKPA 5KKRB 4GSBA 3PJ1A 5E90A 4XUFA 1H0VA 4KS7A 4MXAA 3LCSA 3DJ7A 1XH4A 2G01A 4J8MA 4HPTE 4HJOA 3LQ5A 5GJFA 5CU2A 5I3OA 3NIEA 1Q61A 3UP7A 4DEGA 4ZSAA 4BDJA 3NLBA 1FINA 4O4CA 4BKZA 5AEPA 3TXOA 2YCSA 4MF1A 3SG8A 2CKEA 5AUTA 2OF2A 1AQ1A 1W2CA 3NRMA 4RA5A 3RNYA 4TN6A 3FLSA 1PXJA 3IOKA 1UKIA 4KRDA 4YJTA 4BWKA 3AOXA 3F3UA 3OHTA 1H4LA 4FIEA 4ZZMA 4EONA 3NPCA 5HD7A 1MQ4A 5CF4A 3CS9A 2GQRA 4FG9A 3DNDA 2W4OA 4GK3A 4IEBA 4FSRA 2CHLA 4MK0A 4BDAA 4MD9E 2C6MA 3DCVA 3R21A 2NP8A 2VX0A 3FI2A 2PVHA 5EDRA 4YJQA 3RPOA 3PE1A 3QWJA 2YM8A 3LXLA 4HGSA 4OTQA 3SOAA 3QQUA 3IO7A 3OOGA 5EM7A 3UG2A 4KA3A 2X2KA 4RSSA 4GFGA 3OBGA 4DFUA 1FBNA 4NIFB 1Y91A 3H9FA 2BAJA 5CQWA 4O22A 3MYGA 4JDJA 3UOKA 4HCTA 4D28A 4EEVA 5LQFA 3V3VA 4TWPA 3U54A 4YZMA 2BDJA 3T3VA 5IQHA 4QMSA 1YDRE 4EWQA 4UZDA 3H0ZA 3D7TB 2O64A 3BU6A 3ODZX 3BLHA 4MXZA 3UO4A 3NNXA 3V5LA 2HZ4A 1WFCA 2QOCA 3EQPA 2C47A 3KRLA 3LJ0A 5FP5A 3QTIA 4FVRA 5CEKA 1CTPE 4U8ZA 5IQEA 3P0MA 4M69A 4RWIA 4EI4A 5L2TA 4E6AA 5CEPA 3HX4A 3KB7A 4MXYA 1OUYA 1PXMA 4QNYA 4KBKA 4S30A 1R0PA 3R7UA 1BUHA 1PKDA 2GQGA 3S95A 3QRJA 4AW1A 5AAEA 1L8TA 5L8LA 2WEVA 4CRSA 4D2PA 2I40A 3KULA 1MP8A 3ZO2A 5JGAA 4CZTA 3HMPA 4FC0A 2DUVA 4IAFA 1GZNA 3PG1A 5AA8A 5CF8A 2P33A 2HZNA 4JQ7A 2XEZA 3W2CA 2JDVA 2IVTA 4R7HA 3OF0A 4F70A 2IZRA 3CY2A 4L6QA 1L3RE 2VN9A 4FIIA 2GSFA 3QZIA 4RC4A 2BZJA 2VNYA 1BMKA 2B7AA 4FT9A 2R2PA 3COIA 5AM7A 4F9BA 4U9AA 5BYLA 1OI9A 4IADA 2OW3A 3NNVA 3FMDA 3E92A 3NUXA 1U5RA 2YM4A 4TPTA 3ZSGA 1YHSA 2WQMA 3R9OA 1S9JA 5FP6A 3PWDA 3IS5A 3PXFA 3V5PA 3QTZA 2HW6A 5CQUA 3R6XA 3EKKA 3D9VA 2FA2A 1Y6BA 4FNWA 5DNRA 5AR5A 5FEQA 3WOWA 4E6CA 4EJNA 4EOOA 3UIXA 2BMCA 2GDOA 1PXLA 3KC3A 5AR3A 2YIQA 4R5YA 2QKWB 5TR6A 4WUNA 4NM3A 4N0SA 4AGCA 2WMBA 3G5DA 3OW3A 2UW9A 3FPQA 2IZTA 3NGAA 3QZHA 3TKUA 2QOKA 3SXSA 2QO7A 1YHVA 4NT4A 3U4UA 2OJIA 3ZEWA 3FI8A 3P08A 3RAHA 3A7HA 4I0RA 4X0MA 1MRYA 5GJGA 4NM0A 3W0NA 4GV1A 4KIOA 3UDTA 2HWOA 2C0IA 5KKRC 1RQQA 3BQRA 2OBJA 3EL7A 3FMKA 4YZBA 5IISA 4R7BA 3VRYA 2BRHA 1IA8A 3PVGA 4XEYA 5LOHA 3FQEA 1JNKA 3TUCA 1GY3A 3CKXA 2CGVA 4KIQA 4KABA 2JBOA 3MH0A 4OGRA 5JEBA 3QHRA 4L3JA 3LFQA 2XVDA 2WMVA 4IVBA 5HGIA 4CGAA 2Q83A 3QD4A 3T3UA 4KIPA 5IQAA 3GFWA 4DHIB 4MWIA 1Q8WA 4WG4A 1VJYA 3L1SA 4XG3A 2XK4A 5J95A 4RVLA 4GJ2A 4GK4A 4O6EA 3UOJA 4B4LA 2NRYA 2XAOA 3AGLA 5CU6A 3QQFA 3U8WA 4CV9A 4DEAA 2GMXA 3WYYA 4QPMA 1H1PA 5IQIA 4WRGA 2ZM3A 1DS5A 4AG8A 1GJOA 4FF8A 4J96A 4QYGA 4XG8A 4XG2A 3LPBA 3JR1A 3PVBA 4J97A 3ZZEA 4AA5A 2JFLA 4BZNA 3AXWA 1SVHA 2X9FA 3NYXA 1H07A 5CXZA 4X3FB 2A1AB 2E9PA 4D2RA 1DI9A 2GS7A 4WUAA 1H00A 2FSTX 4HNFA 4MQ1A 1R0EA 4JIAA 4R6VA 4E26A 3UOLA 4NCTC 2OO8X 1OIRA 2QHMA 5HO6A 5DFPA 1ZYSA 3O23A 4FKJA 2W1CA 4FUXA 4MNFA 3KK9A 4QMVA 5EOBA 4BGQA 3C4FA 4HYSA 4IM2A 5CT0A 3DQXA 3HMOA 3Q04A 1G3NA 3MB6A 4FMQA 5HBEA 4FODA 4UMUA 5ANGA 4CFVA 2C5YA 3IKAA 3REPA 3NUNA 4FV8A 4JBPA 4JL9A 4N4SA 3F3TA 3HDMA 2RF9A 1JSTA 2R3MA 4C0TA 3TZ7A 1ATPE 3EQHA 3HUCA 1YXTA 1ZLTA 4TYHA 3H9OA 3N4UA 2WXVA 3KXXA 3TG1A 4BDCA 4PX6A 5DT3A 1JKSA 1YQJA 4GU9A 4NJ3A 2H96A 1XH9A 2O5KA 1KE8A 2OK1A 2PUUA 3AMBA 3JY9A 1NVQA 2X6DA 4UMTA 4MXXA 2IF8A 4TT7A 2WTJA 2R3KA 5E8UA 3V5WA 4ALUA 4I0TA 4M0YA 5F4NA 3TV7A 2WOUA 4OTWA 4P4CA 2QO9A 4WNKA 5JQ5A 2YIYA 3RK7A 4YSJA 4WD5A 3FMHA 5BUEA 5FDXA 4GU6A 4YNEA 2Y6OA 3FKNA 3NYNA 4Q5HA 4BVUA 2ZVAA 2JITA 4D4RA 3UC3A 1JSVA 4O7NA 5I9YA 4EH8A 4E20A 1XHAA 2B1PA 2RG6A 2BFYA 4W8DA 5HIDA 4D2SA 1OBGA 3FUPA 2ITQA 3M42A 3A60A 2ESMA 1WBWA 4LV5A 2PU8A 5AP0A 4QMWA 1CDKA 3I0QA 4DCEA 3JY0A 4OTHA 4UB7A 4G3GA 4WHZA 1ZAOA 3SQQA 3BV2A 3AKLA 2G15A 3FSKA 3MPMA 1ZYCA 2NRUA 1J7IA 3VUGA 3NYOA 4ACHA 4GVJA 4I21A 3BEAA 4BIEA 5B7VA 4U81A 4KIKA 1GAGA 1OKZA 3LJ2A 4RLKA 4TXCA 5HE0A 4L00A 4S34A 1NY3A 3VUIA 4BHNA 5LJJA 2B54A 3F7ZA 5KHXA 1G8AA 3SG9A 4XRLA 2ERKA 4RWJA 3UPZA 4AOIA 2VTLA 3H0YA 5HLWA 2PUPA 3SW4A 3PXKA 3AC2A 3OUNB 4GH2A 4K18A 4K33A 5JH6A 3PA3A 4HVSA 3QD3A 4EK5A 3PWYA 3V8TA 2PE1A 4HGLA 2C6IA 3DPKA 4XG7A 3KK8A 4B99A 4D5KA 4F64A 2XNEA 4GVAA 4RJ4A 5DLSA 4CFXA 3DA6A 5AUVA 3FQHA 3QD2B 3AC4A 3KXHA 4NM5A 5HBJA 3RAIA 2YZLA 3WF6A 4J99A 3G33A 1XO2B 3LMGA 1XH7A 2A2AA 4HW7A 4KD1A 3GFEA 3WYXA 4ANLA 4PQNA 1J1CA 3TNWA 4ANSA 5LWMA 4HYIA 4YC6A 3ATSA 1PXOA 1WVXA 5KZ0A 4E4NA 1ZMUA 3MESA 4V04A 4O0UA 4O4BB 4C4IA 5LMBA 5AP7A 4DFXE 2VX3A 3GC7A 1H28A 4LRMA 2JDRA 4FKLA 3KN6A 4U6RA 1H24A 4U41A 4Z55A 5DEWA 2VV9A 5ANKA 2PSQA 4U80A 5J79A 1WAKA 4EYMA 3AGMA 4X3FC 5AR8A 4ASEA 4O86A 4GW8A 3V51A 4U5JA 4PNIA 4W4XA 4TWCA 5CEMA 1UU7A 4K9YA 4ZY4A 2PVJA 1VR2A 2Z7QA 4NFMA 3NS9A 4FKWA 1NVSA 3TKIA 4QQJA 4R5SA 4DC2A 3K5UA 2WQEA 3IK3A 4YC3A 5AR4A 4FTKA 5M4UA 1K2PA 3KCFA 2JGZA 2GFCA 4J53A 2C3KA 2PE0A 1JLUE 1R1WA 1REJA 4WRSA 3L8PA 4GG5A 4W4WA 2GNFA 4OTIA 2WTKB 2CKQA 5AIKA 3F5UA 4L52A 3CJGA 3PY1A 4I6HA 1PXIA 3Q9ZA 5HG7A 2HZ0A 4XOYA 3VW8A 3NMUF 5K9IA 2C30A 2VTIA 4EHGA 4NJDA 3GGFA 4RIOA 2X8IA 2YIWA 4OLIA 5IA5A 1K3AA 2WQBA 3KN5A 4HZSA 4F09A 4USFA 4FZFB 1S9IA 3G9LX 3LZBA 2BALA 5CS6A 4EYJA 4UN0C 3HDNA 3RK5A 3O8TA 4AGUA 4OBPA 4J8NA 5J8IA 2HENA 1UNLA 1ZARA 5EHLA 4MXOA 4O38A 4YJSA 3UZRA 3H3CA 4FKVA 2A0CX 3W18A 1CKPA 3EKNA 3ZEPA 4MD7E 2C3IB 1Q97A 3ORIA 3SW7A 4JJRA 4YLJA 4PNKA 2RFNA 4QYYA 4ZS4A 2HXQA 5H2UA 5BUJA 2PUNA 3A62A 4V0GA 3NVKI 2WTCA 5D12A 4AZEA 1OL2A 5LWNA 2CCHA 4WBOA 4BL1A 3AMYA 2E9OA 2CDZA 3QXOA 3TV4A 1VEBA 2HK5A 3VWAA 4JT3A 2UW7A 5M4IA 3C4CA 2GHGA 3HA8A 3KXMA 4RT7A 4AT4A 3G6GA 3MJ2A 2YDIA 3PJ8A 4FV5A 5CEQA 3OT8A 2IEWA 5LMKC 3MB7A 3HNGA 2F49A 5LVNA 3TYKA 2OSCA 2XMYA 2ETMA 3ZFMA 4C61A 4CT2A 2CGWA 2QR8A 2VWVA 3G0EA 3Q4CA 4PL3A 1H1QA 4XV9A 2WTVA 5CF6A 3BWJA 3MWUA 4PP9A 1W2FA 4E4LA 3R22A 3PP0A 4CQGA 2AUHA 4C35A 4I6QA 5DWRA 4D1SA 2WAJA 5AWMA 3DFCB 4ENXA 2CPKE 1OL6A 4KAOA 2BVAA 4JLCA 1OMWA 3ZXZA 3KMWA 4EHEA 5LVPA 1ZMVA 4APPA 2IVSA 2E2BA 3F69A 5HHWA 3DTWA 4OUCA 5DEYA 5DE2A 4F99A 1ND4A 1W84A 4ACCA 4G31A 2GFSA 4IM0A 5EYCA 3CP9A 3NCZA 3FLNC 4PPAA 4EJ7A 2BRGA 2PMLX 3VS2A 3BYSA 5DR9A 3PYYA 2WO6A 1I44A 4UWYA 2EXMA 4I41A 3W0PA 3P86A 2CSNA 3B2TA 4A9RA 4U45A 1FMOE 4RQVA 2RL5A 3I4BA 4H3PA 5A6NA 5C26A 3QQLA 4RBLA 2J5FA 4A4LA 4O7SA 4E3CA 4CSVA 4FTRA 4OTPA 2V62A 3TJDA 4D1XA 4X7QA 2ITYA 3SV0A 4ZZNA 3EYHA 2W1EA 4IJ9A 5HTCA 3WIGA 3Q4ZA 2UZLA 4IBMA 3TNIA 4FZ7A 2CNUA 4M66A 1SMHA 2VGPA 3DK6A 2JBPA 4IDVA 3V04A 4A9SA 4BCKA 3SXFA 3GOKA 4BRXA 3CR0A 3SRVB 4EOLA 5LVOA 1ZMWA 3UMWA 4C57A 2VTMA 1F0QA 2JC6A 1M7NA 4L45A 3P5KA 1OPKA 2QI8A 2W5HA 3ORMA 4FTNA 5A3XA 5L6WL 3UYSA 2XEYA 3GP0A 4NUSA 4I5HA 4FKQA 4PPBA 4OT6A 3GBZA 4BN1A 2W0JA 2ONLC 5CSXA 4O0YA 5EYMA 3CTJA 1OB3A 2F57A 4NEUA 4RWKA 3KXZA 1WBTA 4FTJA 4BI0A 4MCVA 3RWQA 5GZAA 1TZDA 5HZNA 4AZSA 4FSNA 5JFSA 2WTKC 3LCDA 4LGDA 4U42A 4L68A 4ACGA 4C02A 1R3CA 2B53A 2FYSA 3Q9XA 4OTDA 2C6KA 4ZTQA 2R3HA 4EH5A 5LXMA 3A4PA 5E4HA 4G1WA 3LHJA 5AP2A 4F7LA 4DN5A 2W96B 3FZ1A 1JKKA 2WEIA 5EHYA 4FYNA 4ZSLA 3R71A 2YITA 5J9ZA 1LP4A 4FA2A 3MTFA 4XLVA 4DH8A 4O0WA 4IQ6A 3AC3A 4D2TA 5HX6A 4FV7A 4K6ZA 1H26A 4U7ZA 4YO4A 3CEKA 5FD2A 3RINA 4EOMA 5HVJA 3SAYA 3NCGA 5DOSA 4AXDA 2QODA 2VWUA 1BLXA 2ITNA 3A7GA 1PF8A 3EFWA 5KBRA 4AXEA 2LAVA 2EVAA 4IX4A 4E5AX 2OZAB 1K9AA 5DHJA 4QTAA 1JQHA 3C4WA 2QG7A 4FT7A 4AUAA 3U9CA 4K11A 1G5SA 4NM7A 4D4VA 2HZIA 4RX7A 4FNYA 5K0KA 5M55A 2CN5A 4I93A 4M8TA 1XH6A 4ONAA 1Q41A 5CASA 4O7RA 4EC9A 1YI3A 3C0GA 4KSPA 5I0BA 4QMOA 1APME 4C59A 3DBFA 5IZFA 5EQYA 3OP5A 3PRFA 5C9CA 2XRWA 3HP5A 3MDYA 3MJ1A 1GIJA 4Z7GA 5JSMA 5H8GA 1XH8A 1V0PA 5EW3A 3SXRA 4EZ5A 4FNZA 3HAVA 3OWKA 1XBBA 4W8EA 2BKZA 3EWHA 3KRJA 3Q32A 2W5BA 5AV1A 4O91A 3UVRA 3JVRA 3BEGA 4DEEA 5AX9A 2C0OA 4B8LA 5L2IA 3MFTA 2WD1A 2WZJA 3QQGA 4GCJA 2VTRA 4MAOA 4GKIA 2Z7RA 4UYNA 2PHKA 4YHJA 4B9DA 4ASXA 5IA2A 2OXYA 1DM2A 1GIIA 4ANQA 3U55A 2J0MB 3LMIA 4DFNA 3GI3A 4RPVA 2R3GA 4PDYA 3MA6A 4CMOA 3MFUA 4MBLA 4AF3A 5GINE 2FSOX 2W99B 3BCEA 3HMNA 3ZM9A 3ETAA 1G8KA 2C1AA 2BTRA 2W9ZB 4LV7A 3LFCA 5JFXA 4G3EA 4ITJA 4QOXA 3EMGA 4IIRA 4QNAA 3VF8A 3VS4A 2X39A 4AP7A 3KFAA 2JIUA 3V5JA 2R9SA 3F7WA 3NUSA 3QA0A 4FT0A 4QMXA 3HAMA 2YJRA 4ORKA 3MH2A 1H0WA 4LL0A 3MVJA 3O8UA 2QOLA 1HOWA 5E8VA 2CLXA 4IVAA 3UYTA 4YJPA 4QPSA 4DYMA 1U54A 3OMVA 5GZ8A 4NTTA 4AXAA 4L46A 3FZRA 5HNIX 3WIKA 4A06A 2JLDA 3FMNA 3UZTA 3AC5A 4BJJB 5IA3A 4LMNA 4O0TA 4D9UA 3IW6A 5C4LA 3RM7A 3GVUA 4IZ5A 3TTIA 1U4DA 3BE9A 4NU1A 1JAMA 3DKFA 4UY9A 3PFQA 4FK6A 4UALA 2UZDA 5K4JA 2FO0A 5AUXA 1YOJA 2O0UA 4Q9SA 4QEBA 2ZMDA 3ZLWA 4P2KA 3V6RA 5A6OA 2XNNA 4CV8A 4C4HA 5CNOA 2PVYA 3IGOA 2XKFA 2F7ZE 3ALNA 3AT2A 4F08A 2EUFB 4RJ5A 5C4KA 3E88A 3LXKA 4I4EA 4FOCA 5HO7A 3MW1A 4RFYA 5G6VA 1Z5MA 2R4BA 3TN8A 4DAWA 2QR7A 4CKRA 5E9EA 3TACA 4DDIA 2W1DA 3ANQA 2WQOA 4JX3A 4IAZA 5IQCA 4QP6A 2VX1A 2QNJA 5A46A 3GC9A 1ZOEA 2VWXA 2ZV7A 3QRTA 2XUUA 5AV3A 5M08A 3O8PA 1NW1A 3UNZA 2HIWA 3QX4A 4RQKA 2JKKA 4D1ZA 3B8RA 5DG5A 1P4FA 4IX3A 3TCPA 4EH7A 3D83A 2FB8A 2WGJA 3PLSA 5D1JA 2BRMA 3OG7A 5J1WA 3BU3A 2R0UA 4YPDA 2EB2A 3JS2A 5F94A 4I1ZA 4XP3A 3V8SA 4JS8A 3C5IA 1V0OA 2HXLA 3O71A 5ACKA 3RMFA 3KCKA 1O6KA 1W98A 4ZTNA 3CD3A 1JOWB 3LFSA 3ZLSA 3FZOA 4H58A 4TY1A 2J5EA 3RPYA 4DHFA 2IG7A 4GMYA 1FOTA 4FTIA 1CKJA 4IAKA 4QTBA 4XG4A 2JEDA 5CY3A 5F9EA 3FHRA 4PRJA 1G8JA 3F88A 4IM3A 4QMQA 4AE6A 2BZHB 2UZEA 3IW8A 4KB8A 1M2QA 2FSMX 5M44A 3VS6A 3EQCA 3FPMA 5DR2A 2C69A 3F82A 3QTQA 2X4ZA 3K5VA 1KWPA 4JIKA 2J4ZA 3QXPA 4GRBA 4F9AA 3D94A 4C3PA 3AD6A 2Y6MA 3FI3A 4H39A 4XHKB 4Y95A 2X0GA 4FKSA 2Y4PA 3OY1A 1J91A 1KV2A 1YI6A 3Q6UA 3ZUTA 4TRLA 3BV3A 4DGNA 4FEVA 2WMUA 4P5QA 5EQEA 2EU9A 2UZUE 2ZYBA 5CANA 4M69B 4IFGA 4ZTRA 4JG6A 3GT8A 4WKQA 1Q5KA 3R2YA 4IVDA 4JBVA 4EBWA 3EFJA 3WF5A 2F9GA 2ITVA 4WSYA 5FWKK 3PJ2A 3FXZA 2C5NA 4QQCA 5E8ZA 5M09A 4CFWA 3DXNA 4FSWA 5M07A 3E93A 4I3ZA 4ZTHA 3QKKA 3PRIA 4HGTA 3QTXA 3Q52A 4RC3A 1ZY4A 1XJDA 1KOAA 5L2WA 3C5UA 1OECA 4XP2A 3LXPA 3UIBA 1JVPP 4CZYB 5J5SA 5IEVA 4ARKA 3CJFA 4DEIA 5TO8A 5C8NA 1MRVA 1V1KA 4GUEA 5AAFA 1YXXA 2C6DA 4XMOA 5HLNA 2YACA 4QMMA 3WZKA 3LM0A 2PMOX 2UZOA 2WOTA 2YLEA 3T9TA 2PZ5A 3BHVA 1FVVA 4FKPA 1OL7A 3BBTB 3EN4A 4O0VA 1Y8GA 4FTOA 5L6PA 3QU0A 5AP3A 4WNMA 2BCJA 4BDIA 3TT0A 3UOHA 2QOBA 3KRWA 3D2IA 5KMOA 1KV1A 3TNQB 3BHHA 4FKIA 3DLSA 3F61A 3WARA 4Y85A 3QTUA 4F9WA 5L8JA 3R8VA 2BAKA 3DKGA 4ZJIA 4ZJVA 4YJNA 4BB4A 3BGQA 3BGPA 1UU3A 2R3RA 2VWBA 3MV5A 4QD6A 3NUAA 4XP0A 4IB5A 3ORTA 3R8MA 3TDVA 5ANOA 1BYGA 3GCQA 3KF4A 3UP2A 3LLAA 1LUFA 3JXWA 3OCBA 1QCFA 1WZYA 2C0TA 2XS0A 3FLWA 3KQ7A 4QYFA 5LVMA 2QVSE 4EK4A 3C0IA 3W0SA 4CTCA 4F6WA 2OZOA 4M13A 3IW5A 2NPQA 1PXKA 4RLLA 5AV4A 5H8EA 5FBOA 4CG8A 3VS7A 4EOIA 5JZNA 3RVGA 2W9FB 5L4QA 4R8QA 1CSNA 1PHKA 2DWBA 3L8VA 2OF4A 4Z3VA 3LE6A 3DK3A 2WMSA 3IDCA 4FEUA 1ZZLA 3FV8A 4NCTA 4NIFA 4KKHA 5CTPA 4G6LA 3A8XA 5BVKA 4E73A 4D4YA 2EXCX 2ZV9A 5AM6A 3R8UA 2W1HA 1XMMA 4YHFA 5ANEA 3V5QA 3R9RA 4KKGA 3KY2A 3ROYA 3D7TA 3OVVA 1WBOA 2PMIA 3K3JA 4BCNA 3CTQA 4O0SA 4RIYB 5FTOA 5H3QA 3P4KA 3LIJA 4IJPA 3BPRA 3Q2MA 4TWOA 2AC5A 4AW0A 5IQGA 2IW6A 3HP2A 3R9DA 4CFMA 3LXNA 2UW4A 5HNGA 4DFZE 4RVKA 3NW6A 3BHUA 1WBSA 3VBQA 2OIQA 2VTAA 4XV1A 2OLCA 5GIOE 3PIYA 2KULA 4UWBA 2XIZA 4G3FA 1YXUA 2JDSA 1R78A 3MTLA 4X2GA 2ZMCA 3DZQA 5E8XA 4FX3A 2F2UA 4Y72A 3ZRLA 3SD0A 3POOA 2Z60A 3QAME 4M97A 4HNIA 5A4CA 1TQIA 3ELJA 3L8SA 3QALE 4C4GA 5L2SA 4L42A 1ZXEA 3UO5A 2QKRA 3VJOA 1ST4A 3BELA 4V05A 4LOPA 5DI1A 5E92A 4JQ8A 2ZM4A 5DN3A 4D9TA 4S31A 3ZO1A 4MVFA 5A4TA 4Y8DA 2XKCA 3O17A 3Q60A 3MN3A 2VWIA 4ACMA 4EH3A 4FUYA 3C4ZA 2I0HA 2J0JA 2IWIA 3KRXA 5FBNC 5GJDA 4BCHA 5DA3A 3ROCA 4EK3A 2AC3A 4WA9A 3VBTA 4LM5A 4TW9A 2YAKA 3P7CA 4DBNA 4IWQA 3L8XA 4J71A 3S3IA 3KGAA 2RIOA 3IQ7A 3GQLA 3R1YA 4MBJA 4Z7HA 3R02A 1ZYJA 2B9JA 3C1XA 2VWWA 5D7VA 4H1JA 2UZBA 3NDMA 3HZTA 3IDBA 2I6LA 3F9NA 3K2LA 4HCUA 3POZA 4NH1A 3U6IA 2IZSA 1YWVA 3CPBA 1PW2A 3BWFA 3U87A 5KNJA 2XP2A 2YCQA 3PSCA 2G1TA 4FL1A 4O7TA 4YTIA 5EYKA 1Q62A 3EQFA 5BVDA 5CVGA