2RKUA

Structure of plk1 in complex with bi2536
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
294
structure length
294
Chain Sequence
AKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKVLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PLK1
publication title Selectivity-determining residues in Plk1.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 294
sequence length 294
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2rkuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2rkuA01
4CZYB 4KRCA 2X4ZA 3LFAA 4RWIA 4RVLA 1E9HA 3TKUA 3HA6A 2XKDA 3V8WA 2IVSA 2Y6OA 4ALUA 4Y72A 4OUCA 3A7IA 3RJCA 2F7EE 5I9UA 1IEPA 3W2OA 1U46A 5E8XA 3FMNA 3V6RA 4FTJA 1I44A 5EM6A 3L9MA 3CEKA 2YM3A 3Q5ZA 4O7RA 3BCEA 3ZS5A 2B0QA 2BRBA 4IWDA 4Y5HA 2ITNA 4JOAA 3UC4A 3RAHA 3DKCA 4D2TA 3R8LA 3QD0A 3EN5A 2QKWB 3G51A 4D4YA 4UYAA 3VW8A 1M7QA 3CR0A 2XK6A 4ANSA 3E88A 3U51A 3AD5A 2FSOX 3AC8A 3OC1A 3QQGA 4M84A 1OZ1A 4M8TA 2PMIA 3NGAA 3CJGA 4M67A 4G6LA 3E92A 4A4LA 5AM6A 4JX7A 4BCGA 3N4TA 4IB3A 2JFMA 3VUDA 4EH7A 3OW3A 5EW3A 3QRIA 2RFDA 4E26A 4EHVA 1W82A 2PZRA 4PUZA 4UWBA 5AV4A 3LFFA 2OXYA 2HXQA 2IZUA 4YPSA 5E9EA 4IQ6A 3BHYA 4FL1A 4XG7A 3R83A 4XV9A 2JGZA 5AX9A 1YOMA 4APCA 4GH2A 1CSNA 2V0DA 4H1JA 5A4LA 1OPJA 5HTBA 4LQMA 3PTGA 3QC4A 1M17A 2W5HA 3ZXZA 2WZJA 3MPMA 3POZA 3QC9A 4I21A 4S31A 5HNBA 4ZJJA 5L2SA 4JG6A 4ACMA 4RG0A 3EFJA 2Q83A 2YWVA 2XNNA 3DKOA 3KRWA 4EOQA 5DEWA 4JNWA 2F4JA 1PXMA 3PLSA 3V5QA 3PRFA 2Y0AA 2YCSA 5CZIA 3FI2A 5LVPA 3NUPA 2JEDA 3MY5A 3MI9A 3R1QA 3R8UA 3P79A 3PA5A 1GY3A 2C6IA 2O63A 3BQRA 2E9NA 4GVAA 4FTRA 1ZXEA 3GNIB 3ZBXA 3QKKA 1S9JA 5IMXA 4FBXA 3MH3A 3MIAA 4C4GA 4HZRA 4L8MA 1ZYLA 3HV6A 3DLSA 3F3ZA 3HEGA 3UP7A 4ACDA 4AW0A 4O81A 4WNPA 4FKGA 1HCLA 2JKMA 4DH3A 2PVKA 2WMUA 5AIRA 4TL0A 1KE5A 2XM8A 4DFBA 4XCUA 3E7OA 5IA2A 1JVPP 4BCHA 1BL6A 3C9WA 4ZTHA 5LOHA 3ZC6A 4J8MA 4CYIA 4HZSA 4GK2A 3BKBA 1M2RA 4H3QA 2W1EA 2P33A 4FSTA 5HICA 4CMTA 4RX5A 4PNKA 3V5TA 4JLCA 4BTJA 4O91A 4AGWA 4NJDA 4XP3A 5TO8A 3BWJA 3FL4A 1P4FA 5TR6A 4FKRA 4XX9A 2FYSA 2IJMA 4F4PA 2BZJA 4A9TA 5DH3A 2C3KA 3RM6A 4A4XA 4BFMA 4A9RA 2PZYA 5JZNA 1H4LA 2JDVA 3GQLA 4IACA 4BHZA 3TTJA 3PIZA 2B52A 2C69A 3PVBA 4G9CA 3LMGA 4OAVB 5I9WA 1S9IA 2NP8A 5C8MA 1OI9A 4FVRA 4TYEA 5TF9A 1R1WA 3MSSA 4FF8A 5DOSA 5IUIA 3OCGA 3E3PA 4BY9E 2OXDA 4YHFA 4IAZA 5HHWA 5CF8A 1FMKA 3BRBA 4LL5A 5E8VA 5BUEA 5DPVA 3OXTA 3U87A 3OXIA 4XG6A 4HVGA 5HO7A 5J8IA 3D14A 3HV3A 1BI7A 5HQ0A 4D5HA 5L4QA 4J99A 4N0SA 1L3RE 4P2KA 4IM3A 5BQ0A 3JXWA 3UVRA 3RAKA 2BFXA 2BR1A 4BI2A 4C58A 5H2UA 1WBOA 5IF1A 3UJGA 3MA3A 2IZTA 3ZEPA 1OBDA 3ZDUA 1LUFA 3NUAA 4WHZA 3ZO3A 4RIWA 2WELA 4DTKA 4XHKB 3TACA 2A4LA 4FODA 1SMHA 3H4JA 2BZIB 3MTLA 4JBQA 4I6FA 4LGGA 4AN3A 1OL6A 4JIAA 4EUUA 1U59A 4EOIA 2BZHB 2CKEA 3PSBA 3W2PA 4AW5A 3PYYA 1XH9A 4GL9A 4D4SA 3C4XA 3FHIA 3B8QA 2PVJA 5IA5A 3AG9A 2OH0E 3BYVA 4IB0A 5EI2A 3E63A 3KQ7A 3QZIA 4KRDA 3FLSA 4HCUA 4AAAA 3KGAA 3LJ2A 1H1SA 4RC4A 3FLZA 4J1RA 5LARA 2VD5A 2CHLA 1H8FA 2UVZA 2WD1A 5JGDA 4MVFA 4U42A 4AS0A 4TYHB 1WBVA 4GT3A 1W7HA 3A7HA 3CTQA 2BUJA 3FPMA 3LFEA 4WOVA 5JSMA 2WOTA 4OTIA 2X7FA 3HNGA 4H36A 4IAKA 5IA3A 2YZAA 4QP9A 4QMYA 3ZCLA 4CKIA 4X3FA 4BZOA 2OWBA 2Z02A 4UN0C 3CGFA 4NW5A 4YHJA 4RJ3A 4LUDA 2B7AA 2BIKB 2HOGA 3FC2A 5BYYA 1Y8GA 5M44A 3ZO1A 2GTMA 4EZ3A 4JL9A 1CKPA 4WNMA 3PZHA 5IMEA 2JKKA 2PULA 3DGKA 2R3PA 1DAYA 4L53A 5HO6A 4EI4A 4RIOA 2PZ5A 4AA5A 3DQWA 3NR9A 4OTFA 3F3TA 4LYNA 4BCOA 1PJKA 5J79A 2X6EA 2ITUA 3CD8A 3LXLA 4MCVA 2XNEA 3FJQE 3NUNA 5I3RA 2HY81 3NNUA 1YI4A 4GK4A 3MIYA 5JQ5A 2VWIA 4P4CA 3WZJA 3P0MA 5HE0A 4C57A 5ANEA 3PVGA 4L3LA 1GZNA 3RPYA 4YGAA 3KREA 2NPQA 1Q8ZA 4L7FA 2P4IA 3R6XA 3F3WA 1JPAA 3QQJA 4Z3VA 4R1VA 3MB7A 4YSJA 2YERA 4ZY6A 3WZDA 4ZTSA 3QD3A 4RA5A 4M12A 3R1NA 4DITA 2JDTA 4D0WA 4WKQA 1DI8A 4ENYA 2ITXA 3NUSA 4FTCA 2ZB0A 4K11A 5A3XA 4TWNA 3VF8A 3KEXA 2QO9A 3K3IA 2W5AA 2C6DA 1PF8A 1Y6BA 3ORXA 4BDAA 2X8IA 3UVQA 1T46A 3U4WA 2JITA 3GCPA 1XH7A 4DEDA 4WNOA 1Q41A 3MFUA 4TTHB 4AGDA 4F9WA 1ZAOA 3CCNA 3Q4CA 4C4JA 2C6EA 4YLKA 1O6KA 5F94A 2J5EA 2QONA 5AP6A 1UU3A 1PXIA 2VX3A 4F6SA 2XJ1A 2YIQA 2J0IA 2QOQA 2XUUA 3E8DA 4GK3A 2JBPA 4DLJA 2YCFA 3NVMB 2ITYA 4EBVA 2C5YA 4BDCA 5K9IA 3OWJA 1DAWA 1QMZA 4C61A 5DR2A 5HE1A 5IA4A 4X2FA 5K5NA 2YM7A 3IDBA 3TJCA 1YHSA 2OZAA 3O71A 1OBGA 3PSDA 3GI3A 3IGGA 2ZB1A 5M09A 2O5KA 3PA3A 1ZYSA 3QX4A 3DXQA 4DEGA 2C5OA 2A0CX 4XJ0A 5DR6A 5HEZA 4C4EA 3FQEA 2F7ZE 3DBCA 4L9IA 4ZP5A 2CKOA 1G3NA 4LL0A 3QD2B 5I9YA 3TIZA 4CMOA 4HPTE 4HPUE 4XLIA 3W8QA 3UO5A 3I7BA 4FIHA 4EJNA 2DQ7X 3D5XA 2C4GA 3AC3A 4M69B 3GVUA 3UOLA 4YURA 2QOHA 2QLUA 4PDOA 2VNWA 3GCUA 4BZDA 4E1ZA 2ERKA 3CY2A 1H00A 3PE2A 1YOLA 4ZTMA 4YC3A 3IW4A 3NPCA 4ZZMA 2GMXA 3VUMA 5I9XA 3KRLA 3R01A 5IQFA 4E8AA 4IWPA 3QX2A 3DA6A 4FKIA 2UW9A 5E90A 3QF9A 4J97A 4O0UA 1GZOA 2Q0BA 4H39A 3VUHA 5JFWA 2PL0A 3BLHA 3P7CA 2BAQA 3QXOA 2VWVA 2I0HA 5CT7A 4LMUA 4NSTA 1BKXA 5L2TA 4O83A 5AP5A 4RSSA 4Y73A 3UOKA 3PXQA 3ZEWA 3ALOA 3ZONA 4GJ2A 4IVDA 4JX3A 4QMZA 4QYHA 4I5PA 3R02A 1OIUA 4I5HA 4NM5A 5HCZA 4MQ1A 4HCTA 2WU6A 4KINA 4PY1A 5GZ9A 4LRJA 2PVRA 4AF3A 1ZOHA 3BZ3A 4UB7A 3VUTA 3GB2A 4U45A 4CCBA 1YWRA 4DLIA 4LG4A 4FNWA 4MNEA 2C6OA 2YJSA 4YPDA 3MVLA 5HD7A 5J5SA 4BCJA 5CAVA 2W1HA 5A46A 4EKLA 3B2WA 3HMPA 4FK6A 2ZJWA 3A4OX 4FKLA 5FD2A 4ANMA 4FKTA 1GAGA 3QWKA 4XYFA 4C37A 1W0XC 2QODA 2X6DA 2XYUA 4L01A 3RWPA 3HRFA 3QHRA 4D0XA 4F7SA 2AUHA 3UNKA 3GU5A 3VS7A 1KWPA 2GDOA 4E5BA 3W10A 5FM3A 3GC0A 3K5VA 5FEEA 4GVJA 2G15A 1FVRA 4QMQA 4FG8A 2GS2A 4RFYA 1U5RA 1JSTA 5EW8A 2GHMA 3KXMA 4OW8A 4P90A 5AP4A 2YIXA 3NVKI 3QWJA 4IZAA 1WBSA 3PXFA 4FTNA 2ITOA 3P23A 2PVLA 3C1XA 4EH9A 2R3IA 4FYOA 2FO0A 1SVHA 4FV5A 3TZ9A 2B9HA 4OTDA 2W1GA 4NCTC 2ZMDA 2QD9A 4HYHA 3SXSA 3V6SA 3KK8A 3AC4A 2JIUA 3KMWA 5FBOA 3A4PA 4GRBA 2GPHA 4IAYA 3RAWA 3FMDA 1T45A 4O6LA 3M1SA 5I4NA 2J4ZA 3LQ5A 4TWCA 1YI3A 1MQBA 3MPTA 2DWBA 4BTMA 2VTOA 2XZSA 5J1WA 3VBXA 4B0GA 3N4VA 5B7VA 1URWA 5IDNA 3HLLA 5HGIA 3QQLA 4GUEA 4A4OA 2PVMA 1YXUA 4K1BA 2XRWA 5EDPA 4E6QA 3GC8A 4QP8A 2R9SA 5E1EA 3VUGA 3ENHA 4EOKA 4XOZA 4DGNA 1NY3A 5K4JA 4FL3A 4RQKA 4UBAA 4CGAA 4IC8A 4HJOA 4RWJA 3R7OA 2IZSA 1OL1A 4MTAA 3E93A 3UPZA 4KS7A 2PE2A 2XMYA 2BILB 2QOLA 5EDQA 5KZIA 3DB8A 5L2WA 2YZLA 4I22A 5AV1A 4ZY5A 5HU9A 1H0WA 5DT4A 4JIKA 2JKOA 5BVKA 3SOCA 4E73A 1PXPA 4KD1A 5EYDA 2GNJA 3QBNA 2YM5A 1EH4A 5EYKA 1UVRA 3R04A 4HCVA 4YBKA 5CY3A 2ZM4A 5AR2A 5CF4A 4AOIA 3QQUA 3QTZA 2XIXA 5E8YA 3I6UA 5C4KA 3EMGA 3U54A 3C7QA 4AACA 1Y91A 3LQ8A 4UYNA 2GHLA 3ID6C 3D2IA 5EW9A 4EH8A 1IAHA 1IAJA 4I6HA 4UZDA 2FH9A 3BV3A 3F5GA 3VBYA 4Y46A 2UZDA 4ZLYA 2ETMA 5C8KA 1HCKA 4JXFA 2EXEA 4V04A 4CD0A 4O0RA 3U8WA 1JSUA 4QMMA 3TEIA 3ZZEA 4R77A 2WMXA 4EQCA 2WTKC 3OXZA 3TI1A 1WFCA 2W1DA 1FGIA 4UV0A 2BRMA 3HZTA 3TCPA 3EYGA 4FV9A 3RPVA 3TNWA 5M07A 5I9ZA 4W8EA 1RQQA 4IADA 3WF9A 3R8ZA 2XP2A 4XH6A 5FUTA 1YXTA 2UZOA 1OB3A 4FICA 2XVDA 3VBVA 4TYHA 5HD4A 3W8LA 3FXWA 1VYZA 2DS1A 4V05A 5DWRA 2OJJA 4JS8A 5C03A 1XH8A 1XBAA 3VIDA 2OJGA 5DN3A 3ENMA 5BUJA 3OTVA 3R73A 2GTNA 4RX7A 1O6YA 4QMOA 2ITTA 4FGBA 3UIUA 2UZEA 1TQMA 3GFEA 1GZKA 3QA0A 3FZPA 4FIIA 5ETIA 5AR5A 2VO7A 3O8PA 4Z7GA 4MYGA 4I93A 2J51A 4NM7A 4D9UA 1KE6A 2XKCA 3BE9A 4IFCA 4JG7A 4GKHA 5CTPA 5FM2A 4WIHA 5JMSA 3O50A 4ASXA 2PZPA 2R0UA 4L67A 2W1FA 3A99A 3FI4A 3QA8A 2FSMX 4DCAA 4JBOA 4USEA 3CIKA 4JDHA 1K9AA 3QALE 1XH6A 2XK4A 5E92A 2VX1A 4ZJVA 2UW4A 3C0GA 4O7LA 5J9ZA 4CG9A 2XKFA 4PDSA 3ZZWA 4XV1A 5IZFA 5E1SA 5A4TA 5AR8A 3BYOA 2CLQA 4D2PA 4L52A 2YHVA 2R3FA 3GC7A 3Q52A 2HZ4A 1PY5A 3C5IA 2HAKA 5FLFA 3DKGA 2HXLA 3RAIA 5LWMA 5F20A 1PKDA 1PXJA 4XMOA 2BMCA 3BHHA 4YZMA 4RRVA 4B8MA 4U9AA 2BKKA 5CXZA 2G1TA 3R7VA 3WE8A 4LUEA 3GFWA 4G3FA 4GG7A 4HNIA 4D2VA 4RIXB 1JAMA 4YJOA 1PMUA 3PWDA 2P55A 1QPDA 1BX6A 2B54A 2WMBA 5HORA 2R5TA 3RMFA 3CTJA 4ITJA 5DIAA 3LW0A 4U6RA 4LI5A 3PRIA 4KIPA 3WARA 5EI8A 2BKZA 4EK4A 3ZU7A 4PDYA 3HECA 4O7YA 2A27A 2IVTA 5DYJA 2PWLA 4L00A 1SVEA 4M14A 5E8WA 3ZLYA 5LMBA 3QRKA 4BIBA 2YABA 4XNEA 3KK9A 5FTOA 4GT4A 3U9CA 3UMXA 2ZVAA 3KF7A 4RC3A 1P2AA 5BMMA 4ZLZA 2WQBA 3EKNA 4C3FA 1AQ1A 1F3MC 4G3EA 4KBCA 4BCFA 5A54A 2H9VA 2XRUA 4TYGA 3G90X 3CJFA 2P3GX 3ET7A 4TWOA 5HLPA 2YM6A 2ZMCA 2X81A 4UXLA 3RPSA 2BVAA 4I0RA 2F7XE 2WMAA 3NWWA 2PUNA 1JKTA 5KMIA 3MB6A 4ZLOA 2GHGA 2YAAA 3FMMA 4K2RA 3TWJA 3G9NA 4QQ5A 3GCQA 2I0VA 2PHKA 3ROCA 4DYMA 3RTPA 4YO4A 5IQIA 4EK6A 4DGOA 4M69A 4W4WA 5EHOA 1UNLA 3COKA 3ZLXA 4C34A 4OLIA 3V8SA 2CDZA 3D7ZA 1JNKA 3FSFA 3LM0A 4O7TA 2Z7RA 2VUWA 2CGVA 4QMUA 5EM5A 5J7HA 2YLEA 3BBTB 3RI1A 4IH8A 2RIOA 2W4KA 3DJ5A 4YTIA 4ORKA 3A8WA 3EFKA 4ASZA 5EYMA 2C3IB 3LFSA 4I6QA 4TYJA 4PL3A 4XRJA 4F6WA 3Q6WA 3UYSA 5DRBA 4GFGA 5CANA 2F57A 4PTGA 2ZM3A 4S33A 3V3VA 4JT3A 3UIXA 3LCOA 2G2HA 2YIRA 3FYJX 4RX9A 3F2NA 2IG7A 2WMVA 3FMLA 5I5ZA 2YDKA 3ANRA 4YJRA 4Q5HA 4QQTA 2J50A 4ZIMA 3DNEA 4JR7A 3KL8A 1PMVA 3ODZX 3QZFA 4KIOA 3G5DA 3MFTA 4BGGA 4D5KA 4DG3E 3TG1A 4IB1A 4HW7A 5AAFA 3DJ6A 2VO0A 3ZM9A 3LLTA 2PK9A 4KKGA 4LMNA 2VN9A 3OTUA 2PU8A 4XBRA 4FT0A 4CZUA 4YU2A 5KO1A 2QO2A 3R7EA 3EFLA 1U4DA 5FXSA 3WOWA 3ZTXA 1MQ4A 4CFVA 1B38A 5GJGA 3CKWA 5EQPA 5CAUA 4DEAA 3AMBA 4DC2A 2X2KA 3EHAA 3L9NA 2W0JA 4OT5A 2BRHA 3RNIA 4BF2A 2QU6A 4FR4A 5ANGA 5EOBA 1B39A 4IXPA 3VS4A 4XRLA 3LIJA 4X2NA 2ZV7A 4U7ZA 1BUHA 2PVYA 4EL9A 2CPKE 4RX8A 4FKSA 1X8BA 2XNGA 5CU4A 4BCIA 2OZAB 4CT1A 3TNIA 3TM0A 2W99B 4QTCA 3BYSA 2HZIA 3D94A 3SD0A 3ZLWA 3QHWA 2I0EA 4C4FA 3WF6A 5GJFA 4E20A 1DM2A 3ZUUA 4V01A 2CN5A 1KSWA 5D41A 5ANJA 5CENA 4RIYA 3P1AA 4FOBA 4O96A 4U97A 4DH7A 5AA8A 5EH0A 4CV8A 1XO2B 4EYMA 1J7UA 3L8XA 3Q9WA 3LMHA 2XCKA 3KXZA 3Q04A 3D15A 4FK3A 4FV2A 3SKCA 4UX9A 4ZSEA 3QZHA 3VBTA 4F0IA 5C9CA 5LCJA 4QNAA 1OKZA 2C68A 3HP2A 4C59A 4PP7A 3Q32A 4FGRA 1JKLA 2QKRA 3QTUA 4RJ6A 4BCNA 4QMSA 4LFIA 4YSMA 4BKZA 2HW6A 4C7TA 4FT5A 3UO6A 2ZDTA 4EHZA 2B9FA 3ZDIA 2YCQA 3SW7A 2YCRA 4R3RA 4YZ9A 3FI3A 2WQOA 3H3CA 4Q5EA 4X21A 2C47A 5EOLA 3V5WA 4XBUA 4QMLA 4DGGA 1YI6A 4G6NA 4PL4A 4OTWA 4FSNA 1SNUA 3ETAA 4PRJA 2IW9A 5L3AA 4FEWA 4FE2A 4EC8A 3UIMA 4XG4A 3COHA 3COIA 2C3JA 2CGWA 4GU6A 2WNTA 3QUEA 4IZ7A 4QMWA 2QR8A 3Q9XA 3BHUA 3PA4A 5AP1A 3QCXA 4YC6A 5EHYA 2JIIA 3PVWA 3GU7A 4O0VA 4H05A 4JRVA 3NCGA 4HOKA 3ZO2A 4E4LA 5CSPA 4YJNA 4K9YA 3SGCA 3THBA 1R78A 5D12A 5BVOA 2VTMA 4KKEA 4BB4A 4DFZE 4MNEB 3A7FA 5CEKA 2W1IA 4I24A 2Q0NA 1UU7A 3AOXA 3EQHA 1KV2A 3EKKA 3C51A 3EQGA 4A9SA 5ANIA 4R7BA 2XJ2A 4H1MA 3FDNA 4IAIA 4QYFA 3SDJA 3D5UA 2WEIA 1OL7A 2JDSA 2O2UA 4AP7A 2A19B 2R3LA 5HG8A 4FEUA 2WB8A 4LV8A 3DKFA 4ACGA 4D9TA 3SA0A 4W4YA 4Y85A 5D10A 2ZYBA 5ACKA 4GV1A 4FV0A 5HU3A 3EWHA 5HVYA 5C4LA 3CPBA 2UZVA 3GQIA 3OP5A 1TQPA 5CZHA 4S32A 4C38A 4C4IA 1H25A 3BLQA 3LXNA 2Y4IC 4BC6A 4K77A 3KMUA 2P0CA 4PMPA 2ZV2A 5AV0A 2FGIA 4ID7A 4IZYA 1O6LA 2LGCA 4GUBA 4OBOA 3C4ZA 2OF2A 3RCJA 3OY3A 3QCYA 3D2KA 2PMLX 2YFXA 2Y6MA 2KULA 4BBEA 3N51A 1REKA 4UMUA 4LOPA 1IA9A 2CJMA 2OFVA 3G0EA 3E8EA 3NNWA 3DK3A 5JH6A 3RPRA 4ACHA 4F09A 4M13A 1OMWA 2VNYA 2GNLA 4QP1A 3R9OA 5L8KA 1A06A 1OGUA 5DT3A 4DEHA 3SVVA 1APME 2JIVA 4GSBA 3FZOA 2RKUA 2VTSA 2C6MA 1WBTA 2ITZA 1F5QA 1L8TA 5E91A 4U5JA 2YITA 2XK8A 5EM8A 1G8SA 3D4QA 3I0OA 1J1BA 3R7UA 4YZCA 2H34A 3R9NA 5KMMA 3GCSA 5FWKK 3TUBA 2O8YA 4ZEGA 1Z5MA 4EH2A 4R7IA 3C0HA 2ESMA 4PP9A 2VWUA 4KSQA 4C2WA 2HZNA 3RHKA 2RF9A 2E2BA 3L8SA 4O0WA 4AZWA 3C4EA 3SG9A 1Q24A 2V55A 5LVMA 4U3YA 4ZJIA 3T8OA 5CU3A 1OIQA 4NCTA 2OJ9A 3KF4A 1UWJA 2VWXA 3M2WA 1DS5A 5EK7A 3FY2A 4W9XA 3DDPA 3DFAA 1ZYDA 2FVDA 4U41A 5EKNA 5L6OA 3CXWA 3F69A 3VHEA 1ZOEA 4F9BA 3B8RA 5FP5A 2VTTA 3JUHA 3RHXA 3FYKX 3NX8A 4WNKA 4YJVA 3FQSA 3ZLSA 4QYYA 1WVWA 4AG8A 3TZ8A 5IA0A 1P14A 4M68A 3CTHA 4K18A 2YAKA 5AV2A 1PKGA 2ZM1A 3KULB 4RIXA 2JAMA 3GGFA 4N70A 4FIJA 4C0TA 4IJPA 4CKJA 3OCBA 4BCMA 5GZ8A 4L7SA 1M7NA 5IUGA 4DG2E 3R0TA 2UW7A 5J7BA 3KXNA 5CSVA 4KUJA 4HNFA 4EORA 4A07A 2B9JA 4IEBA 3MDYA 3M42A 3GOPA 1UU8A 3H10A 4CZTA 5J95A 3FKOA 4FIGA 2O65A 4FEVA 4EOOA 1Z9XA 3C13A 3MY1A 3TV4A 1OITA 2PMNX 4DN5A 1Q99A 3QTQA 4XEYA 3FKNA 3LFQA 4HGSA 4AGCA 4D4RA 3LPBA 2WXVA 3BLRA 3CQWA 2B4SB 3SQQA 1RDQE 2VGOA 5LMKC 3H0ZA 2RSVA 4JAJA 4J7BA 4E7WA 1UNHA 5JN2A 3FE3A 4X3JA 3V5PA 4TWPA 3ZRKA 4BKJA 4NK9A 2YISA 2J0MB 4DH1A 3PY0A 5T3QA 3AQVA 4EKKA 2C0OA 4R78A 3DTWA 2O3PA 4OTPA 3LCTA 1H27A 2C6LA 3FMKA 3FXXA 3FMHA 4FKUA 2UW3A 3U6JA 3JR1A 4BCKA 4L43A 2XKEA 4MX9A 4B9DA 2Y4IB 4UZHA 1WBNA 3F82A 2FA2A 4XP0A 3RVGA 3I5NA 3KMMA 3Q9ZA 3UG1A 1J3HA 3RINA 2O0UA 3HDMA 1CM8A 1YHVA 4AW2A 4I5MA 5M06A 5LCKA 4N57A 4E93A 2OI4X 3CPCA 2CLXA 3LZBA 5K0KA 4U3ZA 5IQGA 4E4NA 2VV9A 4EQUA 3OMVA 3LM5A 4OBQA 2E9VA 4Z9LA 5E8TA 4CFXA 4EHEA 2VTRA 2X7GA 5CAPA 5GZAA 5J5TA 1GOLA 2CNVA 4PWNA 1PYEA 2W1CA 1ZARA 4Y83A 2YA9A 2F9GA 1VR2A 3UPXA 5IU2A 5ANDA 4F9YA 3FL5A 4ZOGA 5EG3A 3IKAA 4UXQA 3VS3A 2E9PA 4O86A 3FLNC 2Y9QA 3S0OA 2X7OA 5L6WL 4AWIA 4BWKA 2VGPA 2Z2WA 2ZV8A 4F7JA 2I6LA 2OIDA 4ZY4A 5HIEA 1PMEA 2RL5A 2IWIA 4APPA 3F7WA 2EWAA 3ODYX 4FTQA 4MAOA 4O21A 3VS6A 3P9JA 3IQ7A 4IVBA 3UE4A 3SG8A 5IQEA 4F1OA 4GIIA 5EM7A 4O7VA 4EK3A 3EFWA 1ZZ2A 3R00A 4OGRA 3QKMA 4NH1A 4R5YA 3RK7A 5CAQA 4I94A 4CFNA 3F5UA 4ANLA 4A9UA 3JVRA 2FSTX 2WTVA 4RBLA 5CEPA 3F7ZA 5I3OA 5ACBC 4PTCA 1NA7A 3NIZA 1OIRA 4H58A 4NZWB 4L42A 5CXHA 3VUKA 2QQ7A 3HA8A 5EDRA 5HG5A 5FDXA 3WF7A 4J52A 4I0SA 3DBFA 3EL8A 4U8ZA 3TV7A 3K2LA 2B9IA 2WIHA 2J2IB 1YDTE 3LCKA 3OG7A 4WG4A 5DG5A 4BKYA 2UZNA 1JWHA 3BYUA 2AC3A 4OBPA 1AD5A 4UY9A 3EL7A 4QP4A 3FQHA 4QMNA 1V0OA 4CSVA 3PDTA 1ZMVA 5FTGA 4CVAA 3GP0A 3NW7A 4QMVA 4AZSA 4CLIA 1ZRZA 3FLQA 5IH4A 4RVKA 3QUPA 3DZOA 4AOTA 4GFMA 3EYHA 4D58A 4U44A 2CGXA 3HMOA 4F6UA 3KXHA 1ZY5A 1ATPE 3AC2A 4FTLA 1FVVA 4NEUA 4YZNA 3NAYA 4EZ5A 4DA5A 4S34A 2WHBA 4LGHA 1MP8A 3OFMA 5E8SA 1JKKA 4FUYA 5D11A 3VVHA 4O7NA 3MPAA 3NYXA 2JC6A 4RJ8A 5KBRA 3K3JA 3BI6A 1YXXA 5KMLA 1P5EA 3LCDA 2NO3A 3MJ2A 3VULA 3ZRLA 2OGVA 2VAGA 2XBJA 3G0FA 2WAJA 4O82A 3ZSIA 4XG9A 3EQFA 3LLAA 4DCEA 4KAOA 3R1YA 5AR4A 3REPA 5AM7A 3SLSA 3WE4A 4II5A 3AT3A 3NLBA 1WCCA 4O0SA 5ANOA 5CU2A 1OUKA 1WMKA 3OY1A 4FSUA 4NYEA 2REIA 3NNXA 4UWCA 4IZ5A 5JZJA 3KFAA 4G1WA 2XK9A 1REJA 4NKAA 2PVFA 3ANQA 4FTTA 3RK5A 3GOKA 4C8BA 3C4WA 4QNYA 4BICA 3Q96A 4DG0E 2RFEA 1JKSA 2EU9A 3HGKA 2W9FB 1I09A 1IR3A 5BMSA 4XP2A 2XIZA 4C62A 4DEIA 2YEXA 3P78A 4MNFA 3VS1A 4FKWA 5HLWA 4FZ7A 5J9YA 5IH5A 2G9XA 1NVSA 3LHJA 3VO3A 5KCVA 3I1AA 3ULZA 5C27A 2I0YA 3IECA 5KMOA 4NFNA 4E6DA 3PJ2A 4AN2A 4DE4A 4AT3A 4TT7A 4JBPA 3NNVA 2Y4PA 4RIYB 4QP2A 4ANQA 3A62A 2JDRA 4HGTA 5GIPE 4R1YA 5J9LA 5D7VA 4Q9SA 4QPSA 5F95A 3W2QA 3NAXA 3UG2A 3O8UA 4FSZA 1JQHA 4R5SA 5IDPA 1YDRE 4FKQA 5DMZA 4QYEA 3PUPA 2XYNA 3EN7A 4PMTA 1ZY4A 2XIYA 1H28A 5B0XA 5EHLA 5IQDA 5L8LA 3EQPA 1ZOGA 2VTQA 3BGPA 3FWQA 4RLKA 5HOAA 3UZPA 4BDKA 3LCSA 3LJ0A 4M3QA 3QLFA 4EK8A 3F2RA 3UOJA 5AADA 4RGJA 4ZTQA 5M51A 3CSVA 3DDQA 4O6EA 5M08A 1BI8A 2AC5A 4TZRA 1K2PA 4OTRA 1ZWSA 1WVYA 3ZFMA 4YJTA 4F7NA 3ZFYA 1YHWA 1WZYA 3DQXA 4IAFA 1FOTA 1U54A 3DK6A 4JQEA 2PYWA 4C02A 2XEYA 3NYVA 5FBNC 4E4MA 5CVFA 2UZWE 5JGBA 3FZTA 4GCJA 2W96B 3F2AA 3PY3A 4JRNA 2JLDA 4GT5A 4QMTA 4DH5A 2RG6A 2OJFE 2WIPA 4RA4A 3DB6A 3WYXA 1Q8UA 2R3RA 3W2SA 4BN1A 4Q2AA 4AN9A 3PXKA 4R3PA 3MY0A 4I4EA 4CFUA 1BYGA 3W55A 1UKIA 4F7LA 1JOWB 2H6DA 5HO8A 5BPYA 2BTRA 3BU6A 3OWPA 4MXZA 4WO5A 2XEZA 4MBJA 3V5LA 3K5UA 2OW3A 4WD5A 3UIBA 5HVKA 5TKDA 2IN6A 3O51A 1OKWA 3WILA 4XG2A 2XK3A 4K6ZA 4MXAA 2WQEA 4BDHA 4U80A 3LFBA 3BEAA 4LRMA 2R3MA 2UW6A 2DUVA 2WKMA 3FXZA 4NWMA 2C0IA 4QYGA 2VTPA 1H26A 1XH4A 3NYOA 5FXRA 4FV7A 4YNEA 1ND4A 4RJ5A 1R3CA 4WA9A 4O7WA 1XJDA 3ZUTA 4BI1A 1H01A 1QL6A 4E6AA 4DFYA 3ZXTA 3F6XA 3KULA 5CX9A 5HIDA 2E9OA 5LVNA 3LFDA 3QXPA 4XS2A 4C3PA 4D28A 4RWKA 1H0VA 5A6OA 1H1QA 5KNJA 1PHKA 5AUYA 4YC8A 2X39A 1A9UA 1H24A 2FB8A 4FTUA 4F70A 3NDMA 3MJ1A 1OVEA 2P2IA 3OF0A 3R2BA 3VS2A 3U9NA 1J7LA 2CNUA 3KU2A 2IO6A 4HYSA 4RLLA 2BRNA 3DTCA 4IDVA 4X3FC 3RPOA 4CEGA 2EXMA 5GIOE 1BLXA 4IDTA 4RFZA 4TXCA 4D1SA 4Z55A 2CCIA 4G5PA 2OH4A 2WOUA 2WMRA 4W4XA 1YWNA 4PDPA 3IDCA 4O0TA 3SV0A 4ZMEA 2VTAA 3KA0A 2OJIA 3BGZA 3G2FA 3KRXA 1Y8YA 4GU9A 2GCDA 5FDPA 3ZSGA 3HVCA 4KKHA 3SX9A 3RWQA 1FMOE 1R0PA 5DBXA 3P5KA 1IA8A 3UVPA 2ZOQA 3COMA 2X9EA 3OBGA 2YM4A 3O7LD 1Q5KA 3FHRA 3OWKA 1E1VA 3CLYA 3DBDA 3HDNA 4GFOA 5HKMA 4RJ7A 4J96A 3S1HA 2HELA 4CG8A 3S00A 2R4BA 2UVXA 5JFXA 3BX5A 2WTIA 3ZC5A 4BBFA 4BBMA 5HTIA 5CALA 3ORNA 5HESA 3R8MA 2C5NA 5M4IA 1B6CB 3DZQA 3IGOA 3FZ1A 3MA6A 3BU3A 5IQCA 1LEZA 1XH5A 4NUSA 3R9DA 3BHTA 5IISA 4MWIA 3AMYA 3MV5A 3OCTA 5CSWA 4EJ7A 2X2LA 4GIHA 1SM2A 2PZIA 2WQNA 3IOKA 2BIYA 2BTSA 2UV2A 3EJ1A 4FKJA 4RVMA 4I6BA 4FV6A 4FV4A 1GIJA 5IH6A 2QHMA 3S2PA 2QOCA 3LJ1A 4G16A 3BBWA 3JVSA 4G17A 4F0FA 5CASA 3GU6A 1XR1A 3BU5A 4NIFB 5BX0A 3CD3A 3QRTA 4I4FA 5ETAA 3EN4A 2WFYA 3CP9A 5IEVA 4O7SA 4BZNA 4A06A 3UTOA 1M2QA 2LAVA 5FG8A 4LOOA 4JBVA 1GNGA 4FSRA 5CYIA 4FZAB 5TT7A 3P7AA 2UW0A 4FNXA 3ZBFA 4XV2A 4BDJA 2QG7A 4IBMA 2E9UA 4L6QA 4CTCA 4G3GA 5LWNA 3VBWA 4U81A 2DYLA 3FKLA 2GQGA 4YMJA 3TT0A 4C2VA 2JAVA 1YWVA 4QTAA 4GYGA 5JEBA 3DXPA 2H8HA 2XNOA 5AUVA 3OEFX 3DBEA 4YBJA 2YIWA 4M97A 3V5JA 2W1ZA 3C5UA 3HYHA 2HIWA 3ACKA 4MK0A 4LM5A 1JBPE 2OF4A 3I81A 4AA4A 3HRBA 1YOJA 2P2HA 4CFFA 3W16A 4J95A 3A8XA 4F64A 1GZ8A 1Z57A 4GMYA 2F2CB 1W83A 4XUFA 2WTJA 2YM8A 3MFRA 5JQ8A 2IVUA 4X0MA 3QTSA 4TYIA 3Q60A 3CBLA 4DT8A 4I0TA 5BVNA 5CEQA 5HLNA 5H3QA 4FNYA 2B53A 2VTIA 4LRKA 2QHNA 3E8CA 4IMYA 2WTKB 3Q5IA 5ANKA 2YACA 5KZ0A 2QC6A 4FKPA 4QTBA 4MXYA 2J0LA 3TIYA 2JKQA 2VX0A 3UOHA 3Q2JA 3F66A 5CEOA 4USDA 5M56A 3C0IA 3TDWA 5DHJA 2WTDA 4AA0A 2ITPA 3BIZA 3LXKA 4YO6A 5LMKA 4BDGA 3L9LA 4UMRA 5BYZA 5DVRA 3T3UA 5M57A 5A9UA 3I4BA 3OUNB 2NRUA 4ZS4A 4E4XA 5DRDA 3IO7A 4OTHA 4WBOA 3HMIA 4NFMA 2VWWA 4CV9A 4M7IA 2WQMA 3HV7A 4BDIA 4FT9A 1Y6AA 5JT2A 5IPJA 4MBIA 4A7CA 4EZ7A 3KY2A 4LOQA 5AMNA 5H8EA 5CVHA 2CN8A 3D5VA 3FV8A 5CSHA 4YHTA 4DF3A 2XB7A 4G3CA 3VS0A 5JKGA 4YZBA 3QCQA 5AAEA 4A9YA 2YDJA 3G33A 3IW7A 4PNIA 1RW8A 3MYGA 3DFCB 4QMXA 4XG3A 2EB2A 2VZ6A 4F0GA 3TXOA 4JJRA 3QRJA 4BWXA 1E1XA 2XNPA 4IM0A 4QP7A 4TPTA 5CS6A 3VNTA 4AZEA 3PXZA 4B6LA 2HWPA 5K4IA 3IW8A 4F65A 2C1BA 3I0QA 3IS5A 1OUYA 3MFSA 3KRRA 3NIEA 3WIGA 4CLJA 4F99A 3PPKA 4AFJA 5LXMA 4CMUA 2X9FA 2XBAA 5AR7A 2XIKA 1G8AA 1XBBA 4PF4A 4AE9A 5EQEA 2BDWA 3ZOSA 1XQZA 1P4OA 1WBWA 5HBJA 2ITVA 3NEWA 4JVGA 2ONLC 4O0XA 4HYUA 1K3AA 3TNQB 4PL5A 5BYLA 4PPCA 2UZLA 4Y8DA 4CXAA 1SZMA 5FQDC 4BGHA 3Q53A 3T9IA 1PXKA 2R3KA 3FMEA 3LOKA 3VJNA 2Z7QA 4AE6A 4FTAA 4G3DA 2OIBA 3BGQA 4FMQA 2PPQA 4ERKA 4AUAA 3E8NA 4IX3A 4NTTA 3PJ1A 4IX5A 1YDSE 4BDFA 3MWUA 1AGWA 3QYWA 4DEBA 3PIXA 4O2ZA 2O64A 4L68A 4GYIA 4OTGA 2BCJA 3FAAA 3QTWA 3ORMA 4O2PA 4OT6A 1YXSA 3ZYAA 1V0BA 3WF8A 2PVNA 4ANBA 3AXWA 1OL2A 3ROYA 2IVVA 4D2RA 3OHTA 2A1AB 5AP2A 2R3QA 2CCHA 3HP5A 5A4CA 3Q6UA 1KE8A 2XH5A 5KHXA 2BPMA 2W5BA 3L1SA 4C35A 5CT0A 3Q4TA 1G5SA 3ACJA 2QG5A 4YZDA 1KOBA 4ZTLA 3NCZA 5AJQA 1FPUA 4L3PA 4QTDA 3OEZA 2GQRA 5DT0A 5TE0A 4IW0A 2VTLA 2BFYA 5GNKA 2OFUA 3BWFA 5JRSA 2C1AA 1UA2A 3FPQA 4NTSA 2NNWB 4PPBA 2KTYA 1Y57A 5AUZA 1TKIA 4N6ZA 2QOFA 4BRXA 1XBCA 2FSLX 2QOIA 3ORIA 3PPJA 4RZWA 5TOZA 2QOBA 3PXRA 4Z7HA 3L8PA 3MVHA 1F0QA 2ACXA 5GJDA 5HX8A 2C0TA 4FVPA 4TKSA 4DGMA 5D7AA 3D0EA 4AW1A 5CF6A 4FNZA 2W9ZB 4K8AA 5L2IA 3QTIA 3UQGA 3QKLA 5I0BA 2WTWA 5GHVA 3WZEA 4F1MA 3AT4A 4GJ3A 5M4FA 3AC5A 3PIYA 1GIHA 3AD6A 4CRSA 5G6VA 4EWHA 1DI9A 2JDOA 4G5JA 3FSKA 3CY3A 4L44A 4PMMA 4C4HA 3QRUA 3DAJA 4ONAA 4YLLA 3QUDA 4WUAA 3SW4A 3JY0A 5E7RA 4JAIA 2IZRA 3TV6A 1FINA 5CEIA 5AFVA 5IQHA 4LV5A 3PLAE 4YJSA 5DI1A 2F49A 5DEYA 4IJ9A 2OG8A 4GKIA 4WT6A 2GNFA 4EH4A 4D1ZA 5CF5A 4FSMA 3G6HA 4FZ6A 3E5AA 1PXNA 2HY0A 4K33A 4MH7A 5ICPA 5LVOA 1UU9A 4KBAA 5KE0A 1ZYCA 2W06A 4FEXA 2WPAA 3WBLA 1CKJA 2PTKA 2QU5A 2R3GA 3E7VA 2YIYA 3GUBA 3OW4A 5AEPA 2BDJA 3QGWA 1YQJA 3LFNA 3HV4A 2HZ0A 4MD9E 4AFEA 3QGYA 3TL8A 1SVGA 3CKXA 5HIBA 2UZTA 5JGAA 3NUYA 4PTEA 3KCKA 4RVTA 1U54B 3POOA 4KSPA 4V0GB 3R8PA 3PJ3A 3EQBA 3D7TB 2VO3A 1Q62A 3T9TA 3FLWA 3GCVA 3Q4UA 1OKVA 3QL8A 3D9VA 4FV3A 2QR7A 3R2YA 5EFQA 3ZSHA 4UEUA 4BTFA 5BVEA 4I23A 3TNHA 3OD6X 5AUUA 3V01A 3DV3A 1KUTA 3RGFA 3I60A 4HVHA 4CT2A 4RZVA 1NT2A 2RFSA 4X6QC 5T68A 4FIEA 2W4OA 1H1WA 4QP3A 5HCXA 3JS2A 4AOJA 4TN6A 4FVQA 4KIKB 2GFCA 1UNGA 4M66A 4MD7E 3TZ7A 3TNPC 2UW8A 4FOCA 3W2RA 1XHAA 1NXKA 5HVJA 3H9RA 3II5A 3SRVB 2X8DA 1GIIA 3MH0A 2WTCA 3L9PA 4FG9A 2Z7SA 4BHNA 4BYIA 5KMNA 2YN8A 3UMWA 4BDEA 3EH9A 3HL7A 3UC3A 2HENA 2JFLA 4Y95A 4NJ3A 3UNJA 2IW6A 3AMAA 5M4UA 4I3ZA 4I1ZA 5B2KA 4LGDA 3UQFA 5E4HA 1NW1A 3ORLA 4NIFA 5DE2A 3E64A 4FSQA 4GS6A 4F9AA 5IUHA 1Q8YA 2X4FA 5LVLA 4YTFA 2XA4A 4BCQA 4AZFA 3RKBA 4FZFB 5HZNA 5ITAA 4ZSGA 5CI6A 3VC4A 3EN6A 3R21A 3DLZA 3R9RA 2BALA 2XIRA 4IC7A 4RPVA 2Y7JA 2QI8A 3LQ3A 3BPRA 3KVWA 3P7BA 3FLYA 3M11A 4YJUA 3QAME 2G01A 5HBEA 3HUCA 1GJOA 1R0EA 4FEQA 5KKRC 4UWYA 5KUPA 4WBBB 4CCUA 4G31A 4IANA 4O38A 1CDKA 2WO6A 4B4LA 2PE1A 4EOSA 2J5FA 5DFPA 2UW5A 3VUIA 2WEVA 1LEWA 5LMAA 3GU8A 3O7LB 2ITQA 3NRMA 5A4EA 1ZYJA 4TRLA 4QTEA 5L2QA 3VAPA 4YTCA 2V62A 1Q3DA 3WYYA 2BHHA 3KXXA 4X2KA 4CRLA 3RZFA 5A14A 3OROA 5J87A 5C01A 3O2MA 4XG8A 1PYXA 5IQBA 5FEQA 4FIFA 5CQWA 2W4JA 3ITZA 1IRKA 3ZM4A 4AT5A 5I9VA 1A48A 2EB3A 2VWBA 3FEGA 4QRCA 1VYWA 3G9LX 4JI9A 4MQ2A 3KN6A 4O1OA 4ARKA 5BNJA 2R3JA 2QNJA 3KVXA 4WRGA 4EH5A 5JK3A 5IKWA 3E3BX 3OCSA 4EBWA 2YWPA 5DNRA 5E8UA 4QT1A 3WF5A 4PQNA 4ENXA 2RGPA 4D2WA 5LQFA 1LP4A 3TUDA 4L46A 4XV3A 2WMQA 2VU3A 1UWHA 3PVUA 4EYJA 3DJ7A 3QYZA 5F1ZA 3RM7A 4R3CA 5FRIA 1ERKA 4GEOA 4CNHA 2UUEA 4DAWA 4EUTA 4FG7A 3MW1A 4IVAA 4CFWA 3EQDA 4I5CA 3QLGA 4HYIA 4ALWA 5HX6A 1FBNA 5AV3A 4DINA 4YNOA 5FXQA 3QD4A 4CQGA 2EXCX 4D1XA 4X2JA 4ALVA 3RBWA 3UNZA 3VRYA 4CFMA 2ETRA 4GG5A 2J9MA 1H1RA 3F5PA 1YXVA 4ZS0A 3UGCA 2VWYA 2QVSE 3IONA 5BVDA 4EOLA 2R3HA 3IW5A 4BIDA 2XS0A 5FGKA 2GQSA 4S30A 3UZTA 2EVAA 3MVJA 3DPKA 3F3UA 2B1PA 5FP6A 1M52A 3FI8A 3NW6A 4KABA 5M55A 5IQAA 3U55A 2JD5A 2V22A 1Q8WA 2R2PA 3P4KA 3RZBA 3VS5A 4JQ8A 5H8GA 4D55A 5HBHA 2SRCA 4WSQA 5H8BA 1J1CA 3T3VA 3C50A 5CSXA 3DAEA 4FSWA 4C3RA 3HAVA 3H30A 1OIYA 3OOGA 5AWMA 2ZAZA 4PMSA 3PP0A 1QPEA 3GEQA 3PP1A 1Q61A 4JQ7A 3TZMA 3Q2MA 3E62A 3ZUVA 5CAOA 2R7IA 3TJDA 2WMSA 3MGYA 3PJ8A 1HOWA 4YUQA 3HAMA 2UZBA 2QOKA 3IPHA 4ANNA 5DLSA 3NW5A 5KBQA 1PXLA 5AR3A 3TKIA 4L45A 2J6MA 1QPCA 1MRYA 3ZO4A 4YJPA 4FSYA 5AP7A 3H9FA 4JDIA 2R3OA 3ERKA 3PXYA 3FC1X 1LR4A 1TVOA 2BAJA 3NUXA 3FMJA 3VJOA 3W32A 5KKRB 4ASDA 3BEGA 4IVCA 5D1JA 1CKIA 4MEDA 2OKRA 3DOGA 4MF0A 2UZUE 3QTRA 4M15A 3HRCA 2XNMA 1XKKA 3FZRA 3OT3A 4AU8A 1STCE 2X1NA 3NMUF 2VTJA 4O1PA 3F3VA 4IWQA 3UYTA 5E8ZA 4TY1A 1MUOA 2R3NA 3HX4A 1Q4LA 5DA3A 2YJRA 4DEEA 2GNGA 4R7HA 1KV1A 4X7QA 3SXFA 2VO6A 1ZMUA 3QQFA 1Q8TA 4JR3A 4O0YA 3P08A 4XOYA 4NL0A 5AP3A 4ASEA 5M4CA 2J7TA 5GINE 3C4FA 4KNBA 2HYYA 3EQCA 4P5ZA 5IG1A 3IW6A 2AYPA 3UZRA 1RJBA 1Q3WA 4D4VA 4UALA 2C6TA 5KHWA 4TNBA 3F9NA 1KOAA 3KC3A 3R28A 3SHEA 2BHEA 4CKRA 3RP9A 1PXOA 3DAKA 4AT4A 5C8NA 4FZDB 3BYMA 3R30A 4RT7A 2ETKA 4XLVA 1CTPE 5CVGA 1J7IA 4O7ZA 1OPLA 2GS6A 3GBZA 2X0GA 4ZAUA 4P7EA 1IASA 3ORPA 3KXGA 3LVPA 5CI7A 3VWAA 2WU7A 4BYJA 3QFVA 3UBDA 3OS3A 3RCDA 2YDIA 3S3IA 2J0KA 5CU0A 3A7JA 4EH6A 4I20A 2W7XA 3UO4A 1BL7A 5HE2A 3DY7A 3WZKA 2CKPA 4J53A 3W2CA 4IB5A 4G9RA 5CU6A 3AT2A 4U79A 3JY9A 3VRZA 3OZ6A 5BUIA 2CMWA 3F61A 4RWLA 4ACCA 4HVIA 4USFA 2VRXA 3ATSA 2WMTA 1QCFA 5BVWA 3MH1A 1PW2A 3KB7A 4RC2A 2GU8A 4R6VA 4FL2A 4O84A 4RJ4A 5H9BA 4BI0A 5EKOA 4QD6A 4FT3A 3RNYA 3CS9A 3EB0A 4N4SA 2B55A 4QP6A 4EONA 1YVJA 4EC9A 3TKHA 3LMIA 2J0JA 4V0GA 3RK9A 4PPAA 2VTNA 4E5AX 3D7TA 4IX6A 3ELJA 4Y5QA 2OK1A 3GT8A 3MH2A 2QURA 1UKHA 4JDJA 3W1FA 4UMTA 3PJCA 4C36A 4DGLC 4DFUA 1H1PA 2HK5A 2BAKA 2C6KA 3AD4A 1XWSA 3O23A 1FGKA 4FKVA 4KB8A 1URCA 3BHVA 4RMZA 4YTHA 4ZTNA 3I79A 4YP8A 5C1QB 4WG3A 4DBXA 4DTBA 5AA9A 3ORTA 2PY3A 3P86A 1VJYA 2ONLA 3UDBA 4BTKA 3TUCA 3ZHPC 3QCSA 4KIQA 1Q97A 3EQIA 3TN8A 2PSQA 3TTIA 2R0IA 2BDFA 3FUPA 4QOXA 4H3BA 1QPJA 4HGEA 4KIKA 4HGLA 4ITHA 5LJJA 4TNDA 3A7GA 5HG7A 5FEDA 1PRYA 3MTFA 3I5ZA 3SRVA 3RALA 2GSFA 3AGLA 3MS9A 2OICA 3F88A 2C3LA 2XM9A 2PUUA 3C4CA 2GS7A 4F63A 3EQRA 5K5XA 3ZFXA 1W84A 2JBOA 4ERWA 3R22A 3F5XA 3LE6A 3ZMMA 1OPKA 4W4VA 4MWHA 3OWLA 3R8VA 2V7AA 1OL5A 3G15A 4U43A 1YRPA 3V51A 3VQHA 2IPXA 3N4UA 4UMQA 4AX8A 2UVYA 4OTQA 2PE0A 5HNIX 2EUFB 3MESA 3I7CA 2OIQA 1JSVA 1ZLTA 2ZDUA 3QQKA 4BR3A 4FI1A 5CLPA 3U6IA 3LFCA 2WGJA 2NRYA 4FT7A 4HVDA 4AZVA 4ITIA 4GW8A 4IE9A 4EHGA 2RFNA 3HV5A 1O9UA 3DNDA 4FUXA 5CNOA 4EEVA 3KN5A 3U4UA 1RE8A 3BELA 3NSZA 5L6PA 4IX4A 2BZKB 5IEXA 5DR9A 3R71A 2V5QA 1UV5A 1W98A 4Q9ZA 2GNIA 3SC1A 4MXCA 3GENA 4CYJA 4EK5A 3OVVA 3Q3BA 4EH3A 4ZZNA 2W05A 3NS9A 2PUIA 3KKVA 2OZOA 3QTXA 3K54A 5DGZA 4M0YA 1OKYA 3AGMA 3AC1A 4WG5A 1H08A 3OOMA 4MXXA 4J98A 4CTBA 3VQUA 4MKCA 2J90A 4L3JA 5K3YA 4NKSA 1OECA 1MRUA 3PFQA 2OLCA 5AP0A 3E87A 3ULIA 2GFSA 4C33A 3Q9YA 4P5QA 3GC9A 5A6NA 4DTAA 1W8CA 3BE2A 3A61A 4DH8A 4WSYA 4MD8E 1OM1A 4YLJA 3WI6A 3UODA 4U0IA 1BMKA 3ZRMA 4UMPA 2ITWA 5HG9A 3LAUA 4BIEA 3O17A 4HVSA 4IHPA 2R64A 1V1KA 4FTOA 4B7TA 2XK7A 3HMMA 2OO8X 2XJ0A 3B2TA 4I41A 2HWOA 2ERZE 2BROA 3SOAA 3TDVA 2XNBA 4K0YA 1JLUE 3HMNA 5EYCA 4ZSLA 5AX3A 3MBLA 4QMPA 4BGQA 5D9HA 3CE3A 3OBJA 5T6KA 1WBPA 2XCHA 3BQCA 4BL1A 3A2CA 1M2PA 3PG3A 5BVFA 4D2SA 3DBQA 3QU0A 3OUKA 4MBLA 3O8TA 3VHKA 3FY0A 4Z16A 5B2MA 3CQUA 3UQCA 1NVRA 2WMWA 3Q4ZA 2QOOA 3ORZA 1CMKE 3IDPA 4ZTRA 3R7YA 4BWPA 5F9EA 2PVHA 2QO7A 3W18A 5ETFA 2H96A 5ETCA 5AUXA 5FTQA 2CGUA 3DS6A 4FTMA 4QPMA 3WZUA 5IEYA 4E3CA 1PMNA 3VN9A 5M53A 4BDDA 3MVMA 4YR8A 2HW7A 3EZRA 4X6RA 5KMKA 4ZXTA 2OXXA 4DBNA 3PE1A 2OU7A 2X2MA 3EIDA 5B2LA 1H07A 3PWYA 3R63A 4KBKA 4IAAA 3BV2A 2Z7LA 4I92A 2I1MA 4RIWB 4W9WA 5KX8A 4CQEA 3DCVA 2XF0A 3EOCA 4JG8A 4WRSA 2CSNA 4QQCA 5L8JA 4EOMA 4EWQA 5JRQA 1SYKA 4OAUC 3CQEA 2C5XA 3HUBA 1M14A 5HI2A 2R7BA 4BCPA 3DXNA 4EQMA 3R7GA 3FZSA 2W17A 2VWZA 4MHAA 3S4QA 4F1TA 3U6HA 3NUUA 5IA1A 3ORKA 3NZ0A 4FYNA 3G6GA 3S95A 4J71A 3D83A 4KS8A 5G1XA 5AAGA 3CC6A 4U40A 3W33A 1WVXA 4IIRA 4B99A 5J1VA 3D5WA 5C26A 2PMOX 4BVUA 1KE7A 4KWPA 3LKMA 4S2ZA 1KE9A 1TQIA 4B8LA 1VZOA 1ZMWA 2X8EA 3SXRA 1NVQA 3PPZA 4QQJA 1FVTA 3IG7A 4YJQA 3O96A 5HTCA 2IW8A 4FTKA 3V8TA 4AGUA 4WUNA 4N6YA 4G6OA 3ATTA 3KRJA 2CNQA 2HCKA 4F9CA 4FV8A 4ZMFA 3QQHA 4NM0A 2A2AA 2C30A 2BRGA 5CQUA 2OSCA 3LXPA 4KA3A 3WIKA 4NU1A 4FKOA 4X3FB 5AUWA 4NT4A 3PSCA 5HCYA 3VF9A 4EOJA 5CWZA 3DU8A 1LPUA 1R39A 2Y8OA 3EN9A 3VW6A 5HE3A 4ZSAA 2PUPA 2C5VA 3SAYA 3R9HA 3A60A 3ZH8A 1YKRA 3MN3A 4JDKA 2G2IA 2QCSA 3R1SA 4O27B 4ZZOA 3EZVA 4R8QA 2CKQA 3IOPA 2OBJA 2Z8CA 4DT9A 3ALNA 3GU4A 4BDBA 2V7OA 4FA2A 3FBVA 3PZEA 4RFMA 4E5WA 1J91A 4PV0A 1SNXA 4M0ZA 4AQCA 2YLFA 3NYNA 4DFLA 4DHFA 3GXLA 3L8VA 1FQ1B 2RG5A 3H0YA 4PX6A 3R7IA 5K0XA 3IK3A 5EQYA 2VTHA 4O22A 4H3PA 2F2UA 1WAKA 4FX3A 2G2FA 5CEMA 3H9OA 3OT8A 1IG1A 4RQVA 5JFSA 3N9XA 3UP2A 4FC0A 4MF1A 2I7QA 2I40A 5HNGA 4ZK5A 4AZTA 4E6CA 3DT1A 4MXOA 2GNHA 4DFNA 4EOPA 4ZSJA 1V0PA 5F4NA 3V04A 4ANOA 1U5QA 3O0GA 5KMJA 4G2FA 5AIKA 4OR5A 4QPAA 4IWOA 1MRVA 4QO9A 4W8DA 1ZZLA 3DK7A 4G34A 5CNNA 2Z60A 4TW9A 3KCFA 3JYAA 3QZGA 1VEBA 2QLQA 3I6WA 2FUMA 4IFGA 4NW6A 4AXAA 5AUTA 4X2GA 3VBQA 3CGOA 5EI6A 4F08A 1YW2A 4IM2A 4DFXE 3PG1A 4FTIA 4FV1A 3HKOA 3PY1A 4J8NA 5A4QA 3JPVA 5JFVA 2ZV9A 4NM3A
chains in the Genus database with same CATH superfamily
4CZYB 4KRCA 2X4ZA 3LFAA 4RWIA 4RVLA 1E9HA 3TKUA 3HA6A 2XKDA 3V8WA 2IVSA 2Y6OA 4ALUA 4Y72A 4OUCA 3A7IA 3RJCA 2F7EE 5I9UA 1IEPA 3W2OA 1U46A 5E8XA 3FMNA 3V6RA 4FTJA 1I44A 5EM6A 3L9MA 3CEKA 2YM3A 3Q5ZA 4O7RA 3BCEA 3ZS5A 2B0QA 2BRBA 4IWDA 4Y5HA 2ITNA 4JOAA 3UC4A 3RAHA 3DKCA 4D2TA 3R8LA 3QD0A 3EN5A 2QKWB 3G51A 4D4YA 4QDVA 4UYAA 3VW8A 1M7QA 3CR0A 2XK6A 4ANSA 3E88A 3U51A 3AD5A 2FSOX 3AC8A 3OC1A 3QQGA 4M84A 1OZ1A 4M8TA 2PMIA 3NGAA 3CJGA 4M67A 4G6LA 3E92A 4A4LA 5AM6A 4JX7A 4BCGA 3N4TA 4IB3A 2JFMA 3VUDA 4EH7A 3OW3A 5EW3A 3QRIA 2RFDA 4E26A 4EHVA 1W82A 2PZRA 4PUZA 4UWBA 5AV4A 3LFFA 2OXYA 2HXQA 2IZUA 4YPSA 5E9EA 4AAYA 4IQ6A 3BHYA 4FL1A 4XG7A 3R83A 4XV9A 2JGZA 5AX9A 1YOMA 4APCA 4GH2A 1CSNA 2V0DA 4H1JA 5A4LA 1OPJA 5HTBA 4LQMA 3PTGA 3QC4A 1M17A 2W5HA 3ZXZA 2WZJA 3MPMA 3POZA 3QC9A 4I21A 4S31A 5HNBA 4ZJJA 5L2SA 4JG6A 4ACMA 4RG0A 3EFJA 2Q83A 2YWVA 2XNNA 3DKOA 3KRWA 4EOQA 5DEWA 4JNWA 2F4JA 1PXMA 3PLSA 3V5QA 3PRFA 2Y0AA 2YCSA 5CZIA 3FI2A 5LVPA 3NUPA 2JEDA 3MY5A 3MI9A 3R1QA 3R8UA 3P79A 3PA5A 1GY3A 2C6IA 2O63A 3BQRA 2E9NA 4GVAA 4FTRA 1ZXEA 3GNIB 3ZBXA 3QKKA 1S9JA 5IMXA 4FBXA 3MH3A 3MIAA 4C4GA 4HZRA 4L8MA 1ZYLA 3HV6A 3DLSA 3F3ZA 3HEGA 3UP7A 4ACDA 4AW0A 4O81A 4WNPA 4FKGA 1HCLA 2JKMA 4DH3A 2PVKA 2WMUA 5AIRA 4TL0A 1KE5A 2XM8A 4DFBA 4XCUA 3E7OA 5IA2A 1JVPP 4BCHA 1BL6A 3C9WA 4ZTHA 5LOHA 3ZC6A 4J8MA 4CYIA 4HZSA 4GK2A 3BKBA 1M2RA 4H3QA 2W1EA 2P33A 4FSTA 5HICA 4CMTA 4RX5A 4PNKA 3V5TA 4JLCA 4BTJA 4O91A 4AGWA 4NJDA 4XP3A 5TO8A 3BWJA 3FL4A 1P4FA 5TR6A 4FKRA 4XX9A 2FYSA 2IJMA 4F4PA 2BZJA 4A9TA 5DH3A 2C3KA 3RM6A 4A4XA 4BFMA 4A9RA 2PZYA 5JZNA 3P5JC 1H4LA 2JDVA 3GQLA 4IACA 4BHZA 3TTJA 3PIZA 2B52A 2C69A 3PVBA 4G9CA 3LMGA 4OAVB 5I9WA 1S9IA 2NP8A 5C8MA 1OI9A 4FVRA 4TYEA 5TF9A 1R1WA 3MSSA 4FF8A 5DOSA 5IUIA 4DHZA 3OCGA 3E3PA 4BY9E 2OXDA 4YHFA 4IAZA 5HHWA 5CF8A 1FMKA 3BRBA 4LL5A 5E8VA 5BUEA 5DPVA 3OXTA 3U87A 3OXIA 4XG6A 4HVGA 5HO7A 5J8IA 4QDEA 3D14A 3HV3A 1BI7A 5HQ0A 4D5HA 5L4QA 4J99A 4N0SA 1L3RE 4P2KA 4IM3A 5BQ0A 3JXWA 3UVRA 3RAKA 2BFXA 2BR1A 4BI2A 4C58A 5H2UA 1WBOA 5IF1A 3UJGA 3MA3A 2IZTA 3ZEPA 1OBDA 3ZDUA 1LUFA 3NUAA 4WHZA 3ZO3A 4RIWA 2WELA 4DTKA 4XHKB 3TACA 2A4LA 4FODA 1SMHA 3H4JA 2BZIB 3MTLA 4JBQA 4I6FA 4LGGA 4AN3A 1OL6A 4JIAA 4EUUA 1U59A 4EOIA 2BZHB 2CKEA 3PSBA 3W2PA 4AW5A 3PYYA 1XH9A 4GL9A 4D4SA 3C4XA 3FHIA 3B8QA 2PVJA 5IA5A 3AG9A 2OH0E 3BYVA 4IB0A 5EI2A 3E63A 3KQ7A 3QZIA 4KRDA 3FLSA 4HCUA 4AAAA 3KGAA 3LJ2A 1H1SA 4RC4A 3FLZA 4J1RA 5LARA 2VD5A 2CHLA 1H8FA 2UVZA 2WD1A 5JGDA 4MVFA 4U42A 4AS0A 4TYHB 1WBVA 4GT3A 1W7HA 3A7HA 3CTQA 2BUJA 3FPMA 3LFEA 4WOVA 5JSMA 2WOTA 4OTIA 2X7FA 3HNGA 4H36A 4IAKA 5IA3A 2YZAA 4QP9A 4QMYA 3ZCLA 4CKIA 4X3FA 4BZOA 2OWBA 2Z02A 4UN0C 3CGFA 4NW5A 4YHJA 4RJ3A 4LUDA 2B7AA 2BIKB 2HOGA 3FC2A 5BYYA 1Y8GA 5M44A 3ZO1A 2GTMA 4EZ3A 4JL9A 1CKPA 4WNMA 3PZHA 5IMEA 2JKKA 2PULA 3DGKA 2R3PA 1DAYA 4L53A 5HO6A 4EI4A 4RIOA 2PZ5A 4AA5A 3DQWA 3NR9A 4OTFA 3F3TA 4LYNA 4BCOA 1PJKA 5J79A 2X6EA 2ITUA 3CD8A 3LXLA 4MCVA 2XNEA 3FJQE 3NUNA 5I3RA 2HY81 3NNUA 1YI4A 4GK4A 3MIYA 5JQ5A 2VWIA 4P4CA 3WZJA 3P0MA 5HE0A 4C57A 5ANEA 3PVGA 4L3LA 1GZNA 3RPYA 4YGAA 3KREA 2NPQA 1Q8ZA 4L7FA 2P4IA 3R6XA 3F3WA 1JPAA 3QQJA 4Z3VA 4R1VA 3MB7A 4YSJA 2YERA 4ZY6A 3WZDA 4ZTSA 3QD3A 4RA5A 4M12A 3R1NA 4DITA 2JDTA 4D0WA 4WKQA 1DI8A 4ENYA 2ITXA 3NUSA 4FTCA 2ZB0A 4K11A 5A3XA 4TWNA 3VF8A 3KEXA 2QO9A 3K3IA 2W5AA 2C6DA 1PF8A 1Y6BA 3ORXA 4BDAA 2X8IA 3UVQA 1T46A 3U4WA 2JITA 3GCPA 1XH7A 4DEDA 4WNOA 1Q41A 3MFUA 4TTHB 4AGDA 4F9WA 1ZAOA 4DDIA 3CCNA 3Q4CA 4C4JA 2C6EA 4YLKA 1O6KA 5F94A 2J5EA 2QONA 5AP6A 1UU3A 1PXIA 2VX3A 4F6SA 2XJ1A 2YIQA 2J0IA 2QOQA 2XUUA 3E8DA 4GK3A 2JBPA 4DLJA 2YCFA 3NVMB 2ITYA 4EBVA 2C5YA 4BDCA 5K9IA 3OWJA 1DAWA 1QMZA 4C61A 5DR2A 5HE1A 5IA4A 4X2FA 5K5NA 2YM7A 3IDBA 3TJCA 1YHSA 2OZAA 3O71A 1OBGA 3PSDA 3GI3A 3IGGA 2ZB1A 5M09A 2O5KA 3PA3A 1ZYSA 3QX4A 3DXQA 4DEGA 2C5OA 2A0CX 4XJ0A 5DR6A 5HEZA 4C4EA 3FQEA 2F7ZE 3DBCA 4L9IA 4ZP5A 2CKOA 1G3NA 4LL0A 3W0PA 3QD2B 5I9YA 3TIZA 4CMOA 4HPTE 4HPUE 4XLIA 3W8QA 3UO5A 3I7BA 4FIHA 4EJNA 2DQ7X 3D5XA 1XMMA 2C4GA 3AC3A 4M69B 3GVUA 3UOLA 4YURA 2QOHA 2QLUA 4PDOA 2VNWA 3GCUA 4BZDA 4E1ZA 1VLRA 2ERKA 3CY2A 1H00A 3PE2A 1YOLA 4ZTMA 4YC3A 3IW4A 3NPCA 4ZZMA 2GMXA 3VUMA 5I9XA 3KRLA 3R01A 5IQFA 4E8AA 4IWPA 3QX2A 3DA6A 4FKIA 2UW9A 5E90A 3QF9A 4J97A 4O0UA 1GZOA 2Q0BA 4H39A 3VUHA 5JFWA 2PL0A 3BLHA 3P7CA 2BAQA 4O4DA 3QXOA 2VWVA 2I0HA 5CT7A 4LMUA 4NSTA 1BKXA 5L2TA 4O83A 5AP5A 4RSSA 4Y73A 3UOKA 3PXQA 3ZEWA 3ALOA 3ZONA 4GJ2A 4IVDA 4JX3A 4QMZA 4QYHA 4I5PA 3R02A 1OIUA 4I5HA 4NM5A 5HCZA 4MQ1A 4HCTA 2WU6A 4KINA 4PY1A 5GZ9A 4LRJA 2PVRA 4AF3A 1ZOHA 3BZ3A 4UB7A 3VUTA 3GB2A 4U45A 4CCBA 1YWRA 4DLIA 4LG4A 4FNWA 4MNEA 2C6OA 2YJSA 4YPDA 3MVLA 5HD7A 5J5SA 4BCJA 5CAVA 2W1HA 3W0NA 5A46A 4EKLA 3B2WA 3HMPA 4FK6A 2ZJWA 3A4OX 4FKLA 5FD2A 4ANMA 4FKTA 1GAGA 3QWKA 4XYFA 4C37A 1W0XC 2QODA 2X6DA 2XYUA 4L01A 3RWPA 3HRFA 3QHRA 4D0XA 4F7SA 2AUHA 3UNKA 3GU5A 3VS7A 1KWPA 2GDOA 4E5BA 3W10A 5FM3A 3GC0A 3K5VA 5FEEA 4GVJA 2G15A 1FVRA 4QMQA 4FG8A 2GS2A 4RFYA 1U5RA 1JSTA 5EW8A 2GHMA 3KXMA 4OW8A 4P90A 5AP4A 2YIXA 3NVKI 3QWJA 4IZAA 1WBSA 3PXFA 4FTNA 2ITOA 3P23A 2PVLA 3C1XA 4EH9A 3W0OA 2R3IA 4FYOA 2FO0A 1SVHA 4FV5A 3TZ9A 2B9HA 4OTDA 4MUQA 2W1GA 4NCTC 2ZMDA 2QD9A 4HYHA 3SXSA 3V6SA 3KK8A 3AC4A 2JIUA 3KMWA 5FBOA 3A4PA 4GRBA 3TYKA 2GPHA 4IAYA 3RAWA 3FMDA 1T45A 4O6LA 3M1SA 5I4NA 2J4ZA 3LQ5A 4TWCA 1YI3A 1MQBA 3MPTA 2DWBA 4BTMA 2VTOA 2XZSA 5J1WA 3VBXA 4B0GA 3N4VA 5B7VA 1URWA 5IDNA 3HLLA 5HGIA 3QQLA 4GUEA 4A4OA 2PVMA 1YXUA 4K1BA 2XRWA 5EDPA 4E6QA 3GC8A 4QP8A 2R9SA 5E1EA 3VUGA 3ENHA 4EOKA 4XOZA 4DGNA 1NY3A 5K4JA 4FL3A 4RQKA 4UBAA 4CGAA 4IC8A 4HJOA 4RWJA 3R7OA 2IZSA 1OL1A 4MTAA 3E93A 3UPZA 4KS7A 2PE2A 2XMYA 2BILB 2QOLA 5EDQA 5KZIA 3DB8A 5L2WA 2YZLA 4I22A 5AV1A 4ZY5A 5HU9A 1H0WA 5DT4A 4JIKA 2JKOA 5BVKA 3SOCA 4E73A 1PXPA 4KD1A 5EYDA 2GNJA 3QBNA 2YM5A 1OGYA 1EH4A 5EYKA 1UVRA 1TZDA 3R04A 4HCVA 4YBKA 2ZM4A 5CY3A 5AR2A 5CF4A 4AOIA 3QQUA 3QTZA 2XIXA 5E8YA 3I6UA 5C4KA 3EMGA 3U54A 3C7QA 4AACA 1Y91A 3LQ8A 4UYNA 2GHLA 3ID6C 3D2IA 5EW9A 4EH8A 1IAHA 4DDGA 1IAJA 4I6HA 4UZDA 2FH9A 3BV3A 3F5GA 3VBYA 4Y46A 2UZDA 4ZLYA 2ETMA 5C8KA 1HCKA 4JXFA 2EXEA 4V04A 4CD0A 4O0RA 3U8WA 1JSUA 4QMMA 3TEIA 3ZZEA 4R77A 2WMXA 4EQCA 4LDTA 2WTKC 3OXZA 3TI1A 1ST0A 1WFCA 2W1DA 1FGIA 4UV0A 2BRMA 3HZTA 3TCPA 3EYGA 4FV9A 3RPVA 3TNWA 5M07A 5I9ZA 4W8EA 1RQQA 4IADA 3WF9A 3R8ZA 2XP2A 4XH6A 5FUTA 1YXTA 2UZOA 1OB3A 4FICA 2XVDA 3VBVA 4TYHA 5HD4A 2XAMA 3W8LA 3FXWA 3W0RA 1VYZA 2DS1A 4V05A 5DWRA 2OJJA 4JS8A 5C03A 1XH8A 1XBAA 3VIDA 2OJGA 5DN3A 3ENMA 5BUJA 3OTVA 3R73A 2GTNA 4RX7A 1O6YA 4QMOA 2ITTA 2NYAA 4FGBA 3UIUA 2UZEA 1TQMA 3GFEA 1GZKA 3QA0A 3FZPA 4FIIA 5ETIA 5AR5A 2VO7A 3O8PA 4Z7GA 4MYGA 4I93A 2J51A 4NM7A 4D9UA 1KE6A 2XKCA 3BE9A 4IFCA 4JG7A 4GKHA 5CTPA 5FM2A 4WIHA 5JMSA 3O50A 4ASXA 2PZPA 2R0UA 4L67A 2W1FA 3A99A 3FI4A 3QA8A 2FSMX 4DCAA 4JBOA 4USEA 3CIKA 4JDHA 1K9AA 3QALE 1XH6A 2XK4A 5E92A 2VX1A 4ZJVA 2UW4A 3C0GA 4O7LA 5J9ZA 4CG9A 2XKFA 4PDSA 3ZZWA 4XV1A 5IZFA 5E1SA 5A4TA 5AR8A 3BYOA 2CLQA 4D2PA 4L52A 2YHVA 2R3FA 3GC7A 3Q52A 2HZ4A 1PY5A 3C5IA 2HAKA 5FLFA 3DKGA 2HXLA 3RAIA 5LWMA 5F20A 1PKDA 1PXJA 4XMOA 2BMCA 3BHHA 4YZMA 4RRVA 4B8MA 4U9AA 2BKKA 5CXZA 2G1TA 3BL9A 3R7VA 3WE8A 4LUEA 3GFWA 4G3FA 4GG7A 4HNIA 4D2VA 4RIXB 1JAMA 4YJOA 1PMUA 3PWDA 2P55A 1QPDA 1BX6A 2B54A 2WMBA 5HORA 2R5TA 3RMFA 3CTJA 4ITJA 4AXFA 5DIAA 3LW0A 4U6RA 4LI5A 3PRIA 4KIPA 3WARA 5EI8A 2BKZA 4EK4A 3ZU7A 4PDYA 4AXEA 3HECA 4O7YA 2A27A 2IVTA 1XMLA 5DYJA 2PWLA 4L00A 1SVEA 1G8JA 4M14A 5E8WA 3ZLYA 5LMBA 3QRKA 4BIBA 2YABA 4XNEA 3KK9A 5FTOA 4GT4A 3U9CA 3UMXA 2ZVAA 3KF7A 4RC3A 1P2AA 5BMMA 4ZLZA 2WQBA 3EKNA 4C3FA 1AQ1A 1F3MC 4G3EA 4KBCA 4BCFA 5A54A 2H9VA 2XRUA 4TYGA 3G90X 3CJFA 2P3GX 3ET7A 4TWOA 5HLPA 2YM6A 2ZMCA 2X81A 4UXLA 3RPSA 2BVAA 4I0RA 2F7XE 2WMAA 3NWWA 2PUNA 1JKTA 5KMIA 3MB6A 4ZLOA 2GHGA 2YAAA 3FMMA 4K2RA 3TWJA 3G9NA 4QQ5A 3GCQA 2I0VA 2PHKA 3ROCA 4DYMA 3RTPA 4YO4A 5IQIA 4EK6A 4DGOA 4M69A 4W4WA 5EHOA 1UNLA 3COKA 3ZLXA 4C34A 4OLIA 3V8SA 2CDZA 3D7ZA 1JNKA 3FSFA 3LM0A 4O7TA 2Z7RA 2VUWA 2CGVA 4QMUA 5EM5A 5J7HA 2YLEA 3BBTB 3RI1A 4IH8A 2RIOA 2W4KA 3DJ5A 4YTIA 4ORKA 3A8WA 3EFKA 3O5AA 4ASZA 5EYMA 2C3IB 3LFSA 4I6QA 4TYJA 4PL3A 4XRJA 4F6WA 2ZFYA 3Q6WA 3UYSA 5DRBA 4GFGA 5CANA 2F57A 4PTGA 2X0OA 2ZM3A 4S33A 3V3VA 4JT3A 3UIXA 3LCOA 3NFGB 2G2HA 2YIRA 3FYJX 4RX9A 3F2NA 2IG7A 2WMVA 3FMLA 5I5ZA 2YDKA 3ANRA 4YJRA 4Q5HA 4QQTA 2J50A 4ZIMA 3DNEA 4JR7A 3KL8A 1PMVA 3ODZX 3QZFA 4KIOA 3G5DA 3MFTA 4BGGA 4D5KA 4DG3E 3TG1A 4IB1A 4HW7A 5AAFA 3DJ6A 2VO0A 3ZM9A 3LLTA 2PK9A 4KKGA 4LMNA 2VN9A 3OTUA 2PU8A 4XBRA 4FT0A 4CZUA 4YU2A 5KO1A 2QO2A 3R7EA 3EFLA 1U4DA 5FXSA 3WOWA 3ZTXA 1MQ4A 4CFVA 1B38A 5GJGA 3CKWA 5EQPA 5CAUA 4DEAA 3AMBA 4DC2A 2X2KA 3EHAA 3L9NA 2W0JA 4OT5A 2BRHA 3RNIA 4BF2A 2QU6A 4FR4A 5ANGA 5EOBA 1B39A 4IXPA 3VS4A 4XRLA 3LIJA 4X2NA 2ZV7A 4U7ZA 1BUHA 2PVYA 4EL9A 2CPKE 4RX8A 4FKSA 1X8BA 2XNGA 5CU4A 4BCIA 2OZAB 4CT1A 3TNIA 3TM0A 2W99B 4QTCA 3BYSA 2HZIA 3D94A 3SD0A 3ZLWA 3BLAA 3QHWA 2I0EA 4C4FA 3WF6A 4FJVA 5GJFA 4E20A 1DM2A 3ZUUA 4V01A 2CN5A 1KSWA 5D41A 5ANJA 5CENA 4RIYA 3P1AA 4FOBA 4O96A 4U97A 4DH7A 5AA8A 5EH0A 4CV8A 1XO2B 3PUFC 4EYMA 1J7UA 3L8XA 3Q9WA 3LMHA 2XCKA 3KXZA 3Q04A 3D15A 4FK3A 4FV2A 3SKCA 4UX9A 4ZSEA 3QZHA 3VBTA 4F0IA 5C9CA 5LCJA 4QNAA 1OKZA 2C68A 3HP2A 4C59A 4PP7A 3Q32A 4FGRA 1JKLA 2QKRA 3QTUA 4RJ6A 4BCNA 4QMSA 4LFIA 4YSMA 4BKZA 2HW6A 4C7TA 4FT5A 3UO6A 1W2DA 2ZDTA 4EHZA 2B9FA 3ZDIA 2YCQA 3SW7A 1W2FA 2YCRA 4R3RA 4YZ9A 3FI3A 2WQOA 3H3CA 4Q5EA 4X21A 2C47A 5EOLA 3V5WA 4O4BB 4XBUA 4QMLA 4DGGA 1YI6A 4G6NA 4PL4A 4OTWA 4FSNA 1SNUA 3ETAA 4PRJA 2IW9A 5L3AA 4FEWA 4FE2A 4EC8A 3UIMA 4XG4A 4AQKA 3COHA 3COIA 2C3JA 2CGWA 4GU6A 2WNTA 3QUEA 4IZ7A 4QMWA 2QR8A 3Q9XA 3BHUA 3PA4A 5AP1A 3QCXA 4YC6A 5EHYA 2JIIA 3PVWA 3GU7A 4O0VA 4H05A 4JRVA 3NCGA 4HOKA 3ZO2A 4E4LA 5CSPA 2XANA 4YJNA 4K9YA 3SGCA 3THBA 1R78A 5D12A 5BVOA 2VTMA 4KKEA 4BB4A 4DFZE 4MNEB 3A7FA 5CEKA 2W1IA 4I24A 2Q0NA 1UU7A 3AOXA 3EQHA 1KV2A 3BL7A 3EKKA 3C51A 3EQGA 4A9SA 5ANIA 4R7BA 2XJ2A 4H1MA 3FDNA 4IAIA 4QYFA 3SDJA 3D5UA 2WEIA 1OL7A 2JDSA 2O2UA 4AP7A 2A19B 2R3LA 5HG8A 4FEUA 2WB8A 4LV8A 3DKFA 4ACGA 4D9TA 3SA0A 4W4YA 4Y85A 5D10A 2ZYBA 5ACKA 4GV1A 4FV0A 5HU3A 3EWHA 5HVYA 5C4LA 3CPBA 2UZVA 3GQIA 3OP5A 1TQPA 5CZHA 4S32A 4C38A 4C4IA 1H25A 3BLQA 3LXNA 2Y4IC 4BC6A 4K77A 3KMUA 2P0CA 4PMPA 2ZV2A 5AV0A 2FGIA 4ID7A 4IZYA 4DHIB 1O6LA 2LGCA 4GUBA 4OBOA 3C4ZA 2OF2A 3RCJA 3OY3A 3QCYA 3D2KA 2PMLX 2YFXA 2Y6MA 3W0QA 4AXDA 2KULA 4BBEA 3N51A 1REKA 4UMUA 4LOPA 1IA9A 2CJMA 2OFVA 3G0EA 3E8EA 3NNWA 3DK3A 5JH6A 3RPRA 4ACHA 4F09A 4M13A 1OMWA 2VNYA 2GNLA 4QP1A 3R9OA 5L8KA 1A06A 1OGUA 5DT3A 4DEHA 3SVVA 1APME 2JIVA 4GSBA 3FZOA 2RKUA 2VTSA 2C6MA 1WBTA 2ITZA 1F5QA 1L8TA 5E91A 4U5JA 2YITA 2XK8A 5EM8A 1G8SA 3D4QA 3I0OA 1J1BA 3R7UA 4YZCA 2H34A 3R9NA 5KMMA 3GCSA 5FWKK 3TUBA 2O8YA 4ZEGA 1Z5MA 4EH2A 4R7IA 3C0HA 2ESMA 4PP9A 2VWUA 4KSQA 4C2WA 2HZNA 3RHKA 2RF9A 2E2BA 3L8SA 4O0WA 4AZWA 3C4EA 3SG9A 1Q24A 2V55A 5LVMA 4U3YA 4ZJIA 3T8OA 5CU3A 1OIQA 4NCTA 2OJ9A 3KF4A 1UWJA 2VWXA 3M2WA 1DS5A 5EK7A 3FY2A 4W9XA 3DDPA 3DFAA 1ZYDA 2FVDA 4U41A 5EKNA 5L6OA 3CXWA 3F69A 3VHEA 1ZOEA 4F9BA 3B8RA 5FP5A 2VTTA 3JUHA 3RHXA 3FYKX 3NX8A 4WNKA 4YJVA 3FQSA 3ZLSA 4QYYA 1WVWA 4AG8A 3TZ8A 1TFFA 5IA0A 1P14A 4M68A 3CTHA 4K18A 3AKLA 2YAKA 5AV2A 1PKGA 2ZM1A 3KULB 4RIXA 2JAMA 3GGFA 4N70A 4FIJA 4C0TA 4IJPA 4CKJA 3OCBA 4BCMA 5GZ8A 4L7SA 1M7NA 5IUGA 4DG2E 3R0TA 2UW7A 5J7BA 3KXNA 5CSVA 4KUJA 4HNFA 4EORA 4A07A 2B9JA 4IEBA 3MDYA 3M42A 3GOPA 1UU8A 3H10A 4CZTA 5J95A 3FKOA 4FIGA 2O65A 4FEVA 4EOOA 1Z9XA 3C13A 3MY1A 3TV4A 1OITA 2PMNX 4DN5A 1Q99A 3QTQA 4XEYA 3FKNA 3LFQA 4HGSA 4AGCA 4D4RA 3LPBA 2WXVA 3BLRA 3CQWA 2B4SB 3SQQA 1RDQE 2VGOA 5LMKC 3H0ZA 2RSVA 4JAJA 4J7BA 4E7WA 1UNHA 5JN2A 3FE3A 4X3JA 3V5PA 4TWPA 3ZRKA 4BKJA 4NK9A 2YISA 2J0MB 4DH1A 3PY0A 5T3QA 3AQVA 4EKKA 2C0OA 4R78A 3DTWA 2O3PA 4OTPA 3LCTA 1H27A 2C6LA 3FMKA 3FXXA 3FMHA 4FKUA 2UW3A 3U6JA 3JR1A 4BCKA 4L43A 2XKEA 4MX9A 4B9DA 2Y4IB 4UZHA 1WBNA 3F82A 2FA2A 4XP0A 3RVGA 3I5NA 3KMMA 3Q9ZA 3UG1A 1J3HA 3RINA 2O0UA 3HDMA 1CM8A 1YHVA 4AW2A 4I5MA 5M06A 5LCKA 4N57A 4E93A 2OI4X 3CPCA 2CLXA 3LZBA 5K0KA 4U3ZA 5IQGA 4E4NA 2VV9A 4EQUA 3OMVA 3LM5A 2XARA 4OBQA 2E9VA 4Z9LA 5E8TA 4CFXA 4EHEA 2VTRA 2X7GA 5CAPA 5GZAA 5J5TA 1GOLA 2CNVA 4PWNA 1PYEA 2W1CA 1ZARA 4Y83A 2YA9A 2F9GA 1VR2A 3UPXA 5IU2A 5ANDA 4F9YA 3FL5A 4ZOGA 5EG3A 2IEWA 3IKAA 4UXQA 3VS3A 2E9PA 4O86A 3FLNC 2Y9QA 3S0OA 2X7OA 5L6WL 4AWIA 4BWKA 2VGPA 2Z2WA 2ZV8A 4F7JA 2I6LA 2OIDA 4ZY4A 5HIEA 1PMEA 2RL5A 2IWIA 4APPA 3F7WA 2EWAA 3ODYX 4FTQA 4MAOA 4O21A 3VS6A 3P9JA 3IQ7A 4IVBA 3UE4A 3SG8A 5IQEA 4F1OA 4GIIA 5EM7A 4O7VA 4EK3A 3EFWA 1ZZ2A 3R00A 4OGRA 3QKMA 4NH1A 4R5YA 3RK7A 5CAQA 4I94A 4CFNA 3F5UA 4ANLA 4A9UA 3JVRA 2FSTX 2WTVA 4RBLA 5CEPA 3F7ZA 5I3OA 5ACBC 4PTCA 1NA7A 3NIZA 1OIRA 4H58A 4NZWB 4L42A 5CXHA 3VUKA 2QQ7A 3HA8A 5EDRA 5HG5A 5FDXA 3WF7A 4J52A 4I0SA 3DBFA 3EL8A 4U8ZA 3TV7A 3VONA 3K2LA 2B9IA 2WIHA 2J2IB 1YDTE 3LCKA 3OG7A 4WG4A 5DG5A 4BKYA 2UZNA 1JWHA 3BYUA 2AC3A 4OBPA 1AD5A 4UY9A 3EL7A 4QP4A 3FQHA 4QMNA 1V0OA 4CSVA 3PDTA 1ZMVA 5FTGA 4CVAA 3GP0A 3NW7A 4QMVA 4AZSA 4CLIA 1ZRZA 3FLQA 5IH4A 4RVKA 3QUPA 3DZOA 4AOTA 4GFMA 3EYHA 4D58A 4U44A 2CGXA 3HMOA 4F6UA 3KXHA 1ZY5A 1ATPE 3AC2A 4FTLA 1FVVA 4NEUA 4YZNA 3NAYA 4EZ5A 4DA5A 4S34A 2WHBA 4LGHA 1MP8A 3OFMA 5E8SA 1JKKA 4FUYA 5D11A 3VVHA 4O7NA 3MPAA 3NYXA 2JC6A 4RJ8A 5KBRA 3K3JA 3BI6A 1YXXA 5KMLA 1P5EA 3LCDA 2NO3A 3MJ2A 3VULA 3ZRLA 2OGVA 2VAGA 2XBJA 3G0FA 2WAJA 4O82A 3ZSIA 4XG9A 3EQFA 3LLAA 4DCEA 4KAOA 3R1YA 5AR4A 3REPA 5AM7A 3SLSA 3WE4A 4II5A 3AT3A 3NLBA 1WCCA 4O0SA 5ANOA 5CU2A 1OUKA 1WMKA 3OY1A 4FSUA 4NYEA 2REIA 3NNXA 4UWCA 4IZ5A 5JZJA 3KFAA