2RKUA

Structure of plk1 in complex with bi2536
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
294
structure length
294
Chain Sequence
AKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKVLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase PLK1
publication title Selectivity-determining residues in Plk1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 294
sequence length 294
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2rkuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2rkuA01
2EU9A 3PZEA 3DQWA 4JI9A 5IISA 4MYGA 5IA1A 1IAHA 3A7IA 4EJ7A 2WIPA 3K54A 3QLFA 3V5WA 4HW7A 4GUEA 4D1SA 5EKOA 3C0GA 4JDHA 5E9EA 3Q04A 4A9RA 2PMLX 4FIIA 4E4MA 4AUAA 4DHFA 4ORKA 4IX3A 3I7BA 3EQCA 4IZYA 3II5A 1FPUA 3MPTA 5LQFA 3O0GA 1VEBA 3Q9WA 4TL0A 5DEWA 3QLGA 5HGIA 4M0ZA 3OW3A 2YISA 2R7IA 2R3QA 3PSCA 3LFAA 2W4OA 1WVXA 3QU0A 4RWIA 2J4ZA 4YJTA 4YZMA 5BX0A 5CEMA 3PLAE 3OEFX 4DG0E 5CT7A 4FKWA 1Q99A 5AP1A 3W32A 2YAAA 2UW7A 3AC1A 4MNFA 4J71A 4Y73A 5DLSA 5AWMA 4JIAA 4G6LA 4FL2A 4ZXTA 3PRIA 4D4VA 4PL5A 1WAKA 2XMYA 3AT2A 3R9RA 2XEZA 3U55A 1PXOA 4MK0A 3ANRA 4W4XA 3ZRLA 5DNRA 1PXLA 3NNXA 4NM5A 4FSYA 1Y6BA 4FT5A 4ASEA 4BVUA 3VS5A 3HV6A 3VS7A 4O0VA 1NT2A 3R22A 2B1PA 3FMHA 3GCUA 4YGAA 5F94A 3WF7A 4BICA 5LVMA 4N57A 5AUWA 3OZ6A 2VTQA 3D2IA 2H96A 3QC4A 5LVPA 2HOGA 3QXPA 2JEDA 4RC3A 3M11A 3HYHA 2R3GA 5ANKA 3RWPA 4GVJA 4EZ5A 3SHEA 4IM2A 2I6LA 4I1ZA 2OWBA 4BDCA 1DI9A 5D10A 5GZAA 2PVLA 3BBWA 4IZ7A 4TYIA 3AD6A 2GDOA 3UBDA 2J2IB 4O2ZA 5E8ZA 3K3JA 4BGHA 2CGWA 2I0HA 2VTSA 1BL7A 4K2RA 4N0SA 4XLVA 5HD7A 3UIBA 3ALOA 5CASA 5L6OA 4CRLA 3BLQA 3KL8A 1PXPA 1O6YA 4OTGA 4TY1A 3UNJA 3QUPA 4BCOA 4BDIA 5A4LA 2BAKA 4YJVA 5AUXA 3MWUA 1PY5A 3FXXA 2V22A 2Z7LA 3ACKA 3TIYA 3ID6C 3A8WA 3R01A 3MSSA 4UMPA 4CTCA 3WF9A 5FP5A 3WIGA 4YNOA 3LXKA 3HMOA 2VTNA 1B6CB 3HECA 3LIJA 3CC6A 4L01A 4U9AA 4AZFA 3DZQA 3E87A 3NW7A 3QGYA 3ZH8A 2QKRA 4E7WA 3A99A 4O7NA 3I60A 3OVVA 4CMTA 3ORNA 5E8TA 4FIEA 3LAUA 4K6ZA 4I93A 3EQGA 4C3PA 3VRZA 5IEYA 5KMMA 1J1CA 4EK8A 5L2TA 3GU8A 3ORTA 2BDFA 2C4GA 3OMVA 3MB6A 3PVUA 4YZ9A 4Z7HA 5E91A 2RSVA 4C4GA 3WYXA 1OPLA 2B9JA 3VC4A 3C9WA 3G2FA 3R7GA 4U0IA 2B0QA 3NUAA 3P4KA 3THBA 2XJ1A 4C4JA 5HLWA 4QQTA 3OC1A 4IB5A 1ZYCA 4I4EA 2HY0A 4AGWA 2WTVA 2PTKA 2RGPA 1CKPA 5AV0A 4OAUC 5LCJA 5ANEA 1VZOA 3Q32A 3Q4TA 2R3MA 4L00A 4UMRA 2C5OA 3P23A 4QNAA 5HG9A 3MA3A 1Q8TA 4DGGA 5JZJA 3EIDA 2JFLA 4I41A 3G51A 1O9UA 4CFWA 4EH3A 4IB1A 3QWKA 3FJQE 4WNKA 3R9HA 4FTUA 4TXCA 4W9WA 2H8HA 1XHAA 2VX0A 5AEPA 3O8UA 2HZIA 2YDKA 5CU4A 5E4HA 3HKOA 3V5LA 5CAUA 2WOUA 4FF8A 3VF9A 4GSBA 4YHJA 3EL7A 2XM8A 4FTNA 3OW4A 4G5PA 2RIOA 5J8IA 4F09A 3KULB 3NNUA 3R7UA 4FV8A 3GVUA 3N51A 2ZDUA 3ORPA 3HRFA 4XOYA 4QMOA 3P0MA 3S4QA 1DM2A 3ZZWA 4PPBA 5CU0A 1Q3WA 3OCBA 5JKGA 3QX4A 3FPQA 4WUAA 4U43A 1YKRA 3ZM4A 5KKRB 2X8EA 2IZUA 3FLZA 4DINA 4EK6A 3OXTA 3PIYA 4WNMA 5BVDA 3CTHA 4FZFB 1OL5A 5HLPA 2QLQA 4YBJA 5KMNA 2WMVA 1TVOA 2CHLA 1P14A 4IDVA 4GL9A 3EHAA 4RGJA 2HZ0A 4YHTA 2WZJA 3MFTA 1QPEA 3GU5A 2J6MA 3UG1A 4ANQA 4AT3A 5C8NA 3RJCA 2ITQA 3L9NA 5AR2A 4ANOA 5EQEA 3R1YA 4DN5A 4DH8A 4BZDA 4GG7A 4AW0A 3DXPA 4RIWA 3JXWA 2IVTA 2R3OA 4JBPA 2PVNA 4O0SA 4P7EA 4YTIA 4XP0A 1IEPA 1GZKA 2PMIA 4U45A 2XK4A 3FLQA 4KIOA 4BCIA 5KMLA 1SVGA 4DTKA 3MY0A 4DFLA 2OIDA 4JQ8A 1P4OA 3BHTA 4J7BA 3TNIA 4NIFB 5HBJA 4NKAA 5EI8A 2R3PA 4L7SA 3TEIA 1Q8ZA 3V5TA 4CYIA 4GK2A 3WYYA 5IQCA 3B2TA 4C4HA 2JKOA 1Y6AA 5KBRA 4A4OA 5HNBA 5AFVA 3E92A 2XK9A 2XYNA 2WGJA 2Z7RA 3AC5A 3CJGA 3QRKA 2VTPA 1YI3A 4I20A 4D2SA 4IEBA 3NZ0A 1YRPA 5ETCA 1R3CA 2P4IA 2BR1A 3TT0A 2OJIA 4XMOA 3PE2A 4M7IA 3ATSA 2P3GX 3HGKA 3H0YA 4GK3A 2FSMX 5BVWA 4FVRA 5L3AA 2XNGA 1Q62A 4JVGA 3EFWA 3DK7A 4C3FA 5IZFA 4FKUA 4DEGA 2FB8A 3DDPA 1KE8A 5ANIA 4PDOA 4QMXA 2HW6A 2B7AA 4IAFA 3FMJA 4WIHA 3I7CA 5IMEA 1Q97A 4CFVA 4JR7A 2C6KA 2VTTA 4IVBA 4KB8A 2O64A 3HMMA 4CKRA 3QA0A 2PMNX 5FTQA 3N4VA 4EOIA 3DXNA 4V05A 5KHXA 5FTGA 1OL2A 5EG3A 3D94A 3TI1A 3OWPA 5AV4A 1Q24A 3BYVA 3CGFA 3GOKA 4FV5A 2B9HA 5IQIA 3PLSA 4DFZE 3GEQA 2AC3A 3DPKA 1NA7A 3F3ZA 5AR7A 4QTDA 4NTSA 1ZZLA 2YM7A 2W1CA 4U41A 5C8MA 3R7OA 1ZWSA 2GHGA 3EWHA 5DIAA 3UVQA 2EVAA 4FKQA 2OFVA 1EH4A 3FMDA 3NW5A 3DKCA 3EN7A 3PY1A 2HENA 2J0JA 3I4BA 4IANA 5EYMA 2XRUA 3QRIA 2XB7A 4V01A 4IXPA 3E62A 4AOJA 5BUIA 4J1RA 1GAGA 1LP4A 4XEYA 4AZEA 4C2VA 2EXCX 4IHPA 4L43A 2PVHA 4P90A 5J7HA 4LV5A 5CNOA 3D7ZA 3A7FA 4RLKA 3V04A 4MNEA 4BWPA 3AG9A 4K8AA 2C5NA 4HCVA 4XG9A 5M55A 4L7FA 2QC6A 4Z7GA 4RX8A 4CD0A 3NUYA 5M06A 2BRNA 3PZHA 3QTZA 1YOLA 3COMA 4M69A 3P79A 4Z3VA 4GIIA 4EEVA 3S1HA 4L53A 3SAYA 4X0MA 3RK7A 3DJ7A 3MJ1A 2NNWB 4HVDA 3SDJA 4AOIA 2WNTA 4FNXA 4C33A 4J52A 1JKKA 3FC2A 3ORZA 4L42A 4XV9A 3BGPA 4HGLA 4ZTNA 5K5XA 4X6QC 3UC3A 4QP4A 5AA8A 2WELA 5CEPA 3O71A 3PG1A 4DFUA 2RFDA 4I21A 4BBMA 3ERKA 2XCHA 1QL6A 4ZS4A 3EZVA 3C4WA 3QCXA 4S31A 2F2CB 3VQUA 4ITJA 4F7JA 3IGGA 5IUGA 4NCTA 3LKMA 5IQDA 3H30A 2C68A 4R7IA 5IDPA 3IECA 3WZKA 4FIFA 3LQ3A 3BEGA 3PP0A 4A7CA 4W4VA 4OTWA 1YI4A 2WMUA 1H8FA 2OZAA 3IPHA 3CGOA 4O27B 1SNXA 4QMMA 1JLUE 3CD8A 4DEAA 4I0RA 4YZCA 2QNJA 3QGWA 3TL8A 4EHZA 2VX1A 3WF6A 1URCA 3EN5A 3SLSA 3LCKA 4IC7A 3GQLA 4FVPA 2PZIA 4O82A 1NVRA 3D14A 4M15A 1WCCA 4O0UA 4IVCA 5BVEA 5JFVA 4ZZNA 4IWQA 3QAME 3UQGA 4FTCA 4EK4A 2NO3A 3OXIA 3PY3A 3I79A 5A6NA 4KKEA 5E90A 4ERKA 4QP8A 3CTJA 5K3YA 2VUWA 4QYHA 5DE2A 4E5AX 5AM6A 4PP9A 2UZLA 5B2KA 4D2PA 4E8AA 3TZ7A 5M44A 5JEBA 2BTRA 2ZM1A 1CKIA 1H1QA 3FY0A 3I6WA 4NCTC 4EJNA 2C30A 2B9FA 4IE9A 1PHKA 1WFCA 4ANBA 4O96A 4PNIA 2OBJA 3A61A 2XKEA 3VW8A 4W8EA 4XP3A 3POZA 3GFWA 2H9VA 4DFYA 3R6XA 3KRRA 5CVFA 3DLZA 5GIOE 1SVHA 2CNQA 4UWCA 3CBLA 3IW8A 1DS5A 4AA4A 4F0GA 3C5IA 2XRWA 3LOKA 3E64A 5IPJA 1ZMWA 1YHWA 5LVLA 4F0IA 5HO7A 5BPYA 4PF4A 4L68A 5IEXA 4G9CA 4XNEA 1GY3A 4QT1A 1FMKA 4R6VA 3T8OA 3SV0A 2OG8A 3TKUA 2W4KA 3C51A 4GRBA 4BR3A 2UZOA 3DU8A 2VO7A 4Z16A 5E7RA 5HIEA 4FTTA 4WSYA 2ITUA 4NFMA 1OUKA 2GHLA 3C13A 4F6SA 3M42A 4QMPA 4RWKA 4E6AA 5A4CA 5FD2A 2FO0A 2YFXA 3BHVA 4DG2E 2Z7SA 2UZVA 2W7XA 3HMPA 3FZTA 4FYOA 4CFFA 2LGCA 2X1NA 4DFBA 3ZO4A 4XP2A 2BIKB 4MBJA 5FRIA 2XIKA 4NEUA 5JQ8A 4DCAA 1XH7A 4FKTA 4II5A 2YCRA 4J99A 3TXOA 4BKYA 3ZUVA 2CKOA 4LOPA 4MAOA 4AN2A 2AUHA 2ZM4A 1APME 4I4FA 1R0PA 4WRSA 4CV8A 4F1TA 5GZ8A 4AN3A 5L6PA 3LQ8A 1KV1A 4FKGA 3QKMA 4AU8A 2Y6OA 4USFA 2H34A 1CSNA 2P2IA 2J0LA 3HP2A 4J95A 2V55A 3L8SA 4H58A 5AP6A 3W16A 4BTFA 2OW3A 4EBWA 4UMUA 1LEWA 5HIBA 4D2VA 5HZNA 1RQQA 3KVWA 4MVFA 2WXVA 5CU3A 4QP6A 4IWOA 1KWPA 1P4FA 4EK3A 5HX6A 3BLHA 2XVDA 3FHIA 4KKHA 3QRTA 5CU2A 3PJ1A 2G2IA 4TW9A 4U8ZA 4UXQA 5KE0A 4XRLA 3VBVA 3PVWA 2PZRA 1V0OA 3MJ2A 3WF8A 4QD6A 1YI6A 3BGQA 2Y6MA 4USEA 2SRCA 3NCGA 5JFSA 1PYXA 4A07A 4OTFA 1H1SA 4AA0A 4ANNA 3NYXA 5JMSA 3P9JA 1LUFA 1MQ4A 2X39A 3GQIA 2PZYA 2Y9QA 3IDCA 3L8VA 5CSHA 4ZIMA 5FXSA 3MTFA 2BZJA 2YZAA 3NEWA 3MFRA 5HHWA 4CZYB 5IG1A 3NUNA 1KUTA 4ZTQA 4PDYA 2QLUA 3FMEA 4M14A 4D9TA 3HVCA 4BCJA 4E1ZA 5CF4A 4FZDB 3NLBA 1VJYA 2XH5A 3HNGA 5T6KA 3VUIA 3KREA 3MVLA 3H0ZA 3LJ1A 3KULA 2Q83A 1H07A 4L3PA 5F95A 2IVUA 3D0EA 3QUDA 3U9NA 4ACMA 2YLEA 5I0BA 3CR0A 1WBPA 2CMWA 3OWLA 1Q3DA 2XNMA 4IB0A 2V5QA 1PF8A 3CKXA 4F9BA 4ASXA 5K4IA 1WVYA 5L8LA 4GYIA 3ZFMA 3OEZA 2F49A 2UZNA 2VTRA 2YIWA 3FZRA 2YCQA 1PKDA 3DCVA 3NX8A 4PPAA 3KFAA 5CSXA 5DT3A 5EW3A 3GC9A 4ZTLA 2WTKC 5DR2A 3OS3A 1KE7A 3QKKA 1ZYDA 4NW6A 5GJFA 3ZFYA 4K1BA 4YZNA 2R3IA 2I0YA 2FGIA 3TUDA 4FL3A 2CKPA 2G9XA 1A06A 2W9FB 5FDPA 4BI1A 4YJRA 4LYNA 1XJDA 5DT4A 4AWIA 2VTIA 3F3TA 1FMOE 2XNBA 4BCGA 5A6OA 3E8DA 1IAJA 2JC6A 3GGFA 3TNPC 2QG5A 4H39A 4F65A 1R1WA 5CTPA 4HCUA 4OTHA 5M51A 3E93A 5J79A 4QMUA 5D12A 3ZXTA 4EUTA 5A4TA 2QU5A 5A9UA 3TUCA 2HYYA 1J7IA 3HV3A 4O84A 3BBTB 1IRKA 1LR4A 2B9IA 4RZWA 3UIUA 3TM0A 2BZHB 5ANDA 5A46A 4CGAA 4FEQA 4KSQA 2XIXA 5J1VA 4F9CA 5IQGA 3OCSA 2ZMDA 1YXSA 2UW6A 1REJA 2XEYA 3DAEA 2F9GA 3G0FA 3MH0A 4NIFA 1NVQA 4MXAA 4GT4A 5IA0A 2DUVA 3MI9A 2QOIA 4H3QA 4BI2A 2VV9A 2O63A 5FP6A 3U87A 4AS0A 4TWOA 4EZ7A 4O6LA 3ULZA 4L3LA 2DQ7X 2UVYA 4XLIA 5KKRC 4GFMA 2X6EA 2J9MA 3DBCA 4QP9A 2QO9A 3QZIA 4EQMA 3A4PA 4FSNA 4QP1A 2C6IA 2C0IA 5BNJA 2X8DA 3HRCA 5CI6A 5DN3A 4ZEGA 3DB8A 4JQ7A 3BX5A 3D5VA 5DEYA 2IW8A 4I5HA 1FGKA 5T3QA 5FG8A 2BVAA 4G6NA 4BZOA 2UW4A 3RM6A 3WARA 5BVOA 5JGBA 2E2BA 2C5VA 2QO7A 4DH3A 3F5XA 3UO5A 1XWSA 3FYJX 4P4CA 5EM6A 4CQGA 3HV4A 5EHOA 1IA9A 4YUQA 4L52A 4DBNA 4HGEA 1NW1A 5ACKA 2XNNA 4O7WA 5IQAA 2IN6A 4HYSA 5DG5A 1KSWA 3BU3A 2JIVA 2X9EA 4CFUA 1E1VA 4Y95A 4Y5HA 5L2SA 3FQSA 3G33A 3TNWA 3TNQB 4EL9A 2ONLA 1FGIA 3D7TB 3R9DA 4WG4A 4AGCA 3ET7A 2J0IA 4MF1A 4QOXA 4YTCA 5BVNA 2G2FA 1ZOEA 4QTCA 5CNNA 3R83A 4DCEA 4XG8A 1YXUA 3MB7A 3T3UA 2XIYA 4DTAA 1JOWB 1XR1A 2XF0A 5F9EA 2GSFA 3R1QA 3FEGA 2W1FA 2ZMCA 3BYSA 4FT3A 2ITTA 5JRSA 4JDJA 3RMFA 4HPTE 3DAJA 5LVNA 5GZ9A 3VBTA 5HICA 4ITIA 4E93A 2CLQA 5EM7A 2OJ9A 5ETIA 4R77A 3D83A 4RVMA 4I22A 2Q0BA 4L9IA 5CYIA 4ZOGA 4BIBA 3MPMA 5K9IA 3U9CA 1OB3A 4LRJA 5HG8A 3PYYA 3ZTXA 5B0XA 4CT1A 2AYPA 3WIKA 4KSPA 4QQ5A 3UP7A 1OGUA 5AP5A 4CLIA 2WD1A 4GG5A 4AFJA 4O22A 4MF0A 4ENYA 4XX9A 5HQ0A 4ASDA 1V0PA 2R3JA 4I0SA 2UZUE 1AD5A 1Z5MA 5H8BA 4C4IA 2C3IB 5BMMA 4CCBA 4IVDA 3ZU7A 4ZTMA 4KBKA 3VUKA 2BCJA 3ZC6A 3FKOA 3E8CA 3NAXA 4IBMA 2W1HA 1WBNA 4NTTA 2CDZA 3FMKA 1YXVA 4MCVA 3V5JA 5EW8A 4EH5A 2YAKA 4U97A 2WQBA 3P5KA 4XV2A 3F3WA 4AW5A 3VF8A 2VTHA 3QTIA 5HD4A 2J7TA 5JH6A 4JNWA 2Z60A 5D9HA 4BGQA 3RAKA 2PE0A 1TQIA 4A06A 4Q2AA 3CQWA 4AF3A 3PXKA 5A4QA 2WEVA 5IA2A 1ZXEA 4OTDA 2A2AA 2W5AA 4BTKA 2PUPA 4U6RA 4CG9A 5ACBC 3KC3A 4TNBA 5TO8A 3RPOA 2PVFA 4XYFA 3QALE 3NIEA 4BWXA 3CKWA 3O8PA 5HCZA 1U59A 1H26A 4TWPA 2I40A 2PVYA 2C6EA 3EQDA 4U79A 2R5TA 1T45A 3MV5A 4DGLC 3PXFA 4U3ZA 5AP2A 4L6QA 4QMYA 3PWYA 5CU6A 4MWIA 4BF2A 5ETAA 4N70A 3PJ3A 3C4XA 2V62A 3KXXA 4N6YA 3TCPA 4LM5A 5HIDA 4EHGA 3PXYA 3QD2B 4P5QA 4H05A 3WE8A 5IU2A 4APPA 1H0VA 2X81A 3FAAA 3ULIA 4M8TA 3ZMMA 1H27A 4LRMA 1M2RA 2XKDA 3HUBA 4F63A 2QOHA 4TTHB 4BCHA 5IQBA 4I5CA 5BVFA 3RTPA 4QMQA 1F3MC 2VTAA 3LE6A 2OJFE 4QYEA 3UIMA 5BQ0A 3DXQA 2CN8A 4I6HA 5HG5A 3RKBA 3L9LA 4E4XA 1OKZA 4NW5A 2HXLA 4RIOA 5EDPA 4NZWB 3EB0A 4R1YA 3VULA 1J91A 2B54A 4FX3A 3MGYA 4WA9A 3UDBA 3VUTA 3Q53A 3TNHA 4YBKA 4A9YA 2XK6A 5M4IA 1UA2A 5CVGA 5DRBA 4RA5A 1OL7A 4YZDA 3VS6A 3S0OA 3ROCA 3FYKX 3FZ1A 3BV2A 1PMNA 3QKLA 2CNVA 2QD9A 4QNYA 3MH1A 5L8KA 5AV1A 2BZIB 2WU7A 3GCVA 2PE1A 3F2AA 5HVJA 5B2LA 4AGUA 2QR7A 4JG6A 5I9WA 2PSQA 1PXIA 4G5JA 4IADA 4ASZA 3ORLA 3F2RA 3DBEA 1PMEA 4P5ZA 4S2ZA 3RK5A 4EQUA 5M4CA 3ALNA 1MRVA 3G6HA 2OSCA 3UOJA 4M66A 3RAHA 5TE0A 5IQFA 4O7SA 3E88A 1E9HA 4R3PA 3COKA 4QTBA 3BI6A 1R0EA 2QI8A 4PMTA 1F5QA 5HO6A 3TDVA 1KV2A 4EH2A 4GVAA 2EWAA 4OBPA 3FXWA 3ORMA 3OOMA 3E8NA 4C62A 3GXLA 4CMOA 4CKJA 5J7BA 4BB4A 5KMOA 3AGMA 4HYUA 5CS6A 3NYOA 4FTOA 3CY2A 3U6IA 1SM2A 3OT3A 2IPXA 3CE3A 4O0YA 3LFEA 3WZJA 4LUDA 3IQ7A 4AA5A 3TZ8A 4IAZA 3AC8A 5FEQA 3R00A 4FK6A 3ZS5A 4NT4A 3OY3A 1H1PA 3VO3A 4BYIA 5I4NA 5JFXA 3PG3A 4R3RA 4BDDA 4IX5A 1VYZA 1GZNA 1M7NA 3BQRA 4GUBA 4U5JA 2GS7A 4FV4A 4X2FA 4C57A 3FI2A 4EK5A 4O7TA 3G5DA 4ANLA 2PU8A 2WMRA 3BHHA 5JGDA 3ZOSA 1RDQE 2YM4A 2ETRA 2PZPA 2WTKB 2F7EE 4P2KA 4RPVA 1Y8YA 4ZS0A 3WF5A 3ZC5A 3EFKA 4IB3A 3SX9A 4EKLA 4R3CA 3BU6A 3HLLA 3Q6WA 1OUYA 1M14A 4NM3A 2WQEA 4O0RA 5CSPA 1W0XC 5KHWA 3GU6A 2WO6A 1XH8A 1UU3A 3OHTA 3QL8A 3P1AA 4L45A 2VWXA 5DRDA 5A3XA 5B2MA 2W05A 2C6DA 5LVOA 3IW6A 2IZTA 2J5EA 2UW0A 3CQUA 4MD8E 5FGKA 5CENA 2BDJA 3LCSA 2WTDA 2C5YA 4OTQA 2QO2A 2HWOA 3LJ0A 4ALWA 2FSTX 2PVJA 4MEDA 5E8VA 2OGVA 1CKJA 3W2QA 2R3NA 4LRKA 4I0TA 4DEHA 2PVRA 3AMYA 3WI6A 4G2FA 4O83A 2B52A 4NKSA 2PUUA 4ALUA 5DR6A 5K0XA 2IJMA 3GUBA 1W98A 1XH5A 2BKZA 2OJJA 4GT3A 4B8LA 1JVPP 2R3FA 3AT3A 5HG7A 2QOBA 4RJ8A 4C3RA 4BIEA 2X2KA 5I9ZA 3QD0A 4TZRA 2X8IA 2WQMA 1G3NA 2WTIA 1GIHA 3MVJA 2PUIA 2PVKA 2XNOA 4HVGA 4W9XA 4DFNA 3LQ5A 1H08A 2RF9A 3PTGA 5I5ZA 5L8JA 1YDSE 1Y57A 3W2RA 3ZUTA 1PKGA 3NR9A 3LFSA 2UVXA 2BAQA 3IW5A 3UZPA 4JX3A 3D5UA 2GS2A 3R8PA 4BZNA 1XH9A 3DOGA 4GH2A 5FXQA 1ZMUA 2CJMA 3BZ3A 1YHVA 4NK9A 5BVKA 3FUPA 4BFMA 3NVMB 4EC8A 2WPAA 4RJ5A 4FTRA 2ZAZA 4X21A 3VBXA 3UE4A 2R3HA 4PDPA 1PJKA 2F7XE 3ZYAA 3RNYA 2XJ2A 3Q3BA 5L2WA 4EZ3A 3K3IA 3KXHA 5HI2A 3KY2A 3GP0A 3VS3A 3R02A 5K4JA 3KQ7A 3UOHA 2O2UA 4FA2A 1G8SA 3KRWA 3KK9A 1OL1A 4HGTA 2VAGA 2F4JA 3C4ZA 3DBDA 4D0XA 4D0WA 3F3UA 5EDRA 4WO5A 2B4SB 2HAKA 3BE9A 3QTSA 3DLSA 5C01A 3ZO2A 3RGFA 3M2WA 2W4JA 2UZEA 2C6TA 2IW9A 4BC6A 5DR9A 4ZTHA 2WQNA 4OTPA 1XBAA 4QP7A 2X4ZA 4NJ3A 3W33A 3C7QA 4DH5A 3DBQA 1UWHA 3PUPA 1Q4LA 4AGDA 5EQYA 2R3LA 4HJOA 3CLYA 4RMZA 3QTUA 4RVKA 3RWQA 3TTJA 4QYYA 2BALA 3CJFA 4CYJA 3G6GA 3KA0A 5FEEA 2IZSA 2C0TA 4LMUA 3VS0A 4YJSA 4LGHA 4M13A 4ZSGA 3QUEA 4LOOA 4HNIA 4JT3A 4YR8A 4QP3A 3G0EA 4FZ6A 4I5PA 3AOXA 3HA6A 4C37A 1MRUA 1Q5KA 3IO7A 4XG3A 2W17A 3F88A 4OBOA 5FLFA 3VIDA 1V0BA 4HVIA 5IA3A 2VO3A 4KBCA 2WTWA 4WNOA 3D7TA 1B38A 4G17A 4WG3A 3HAVA 4C58A 2FSLX 4DBXA 3WZUA 2JGZA 3CXWA 2UZDA 5LMKA 3QXOA 3R8VA 2P0CA 1H00A 1I09A 2I0EA 4XG7A 4GU9A 4O0TA 4ACCA 3TV6A 3LLAA 5CEQA 4EOPA 2X7OA 2QQ7A 2VNYA 2ZDTA 4IFGA 4F9WA 4ZZMA 5AMNA 5J95A 3IDPA 4YPSA 5BYZA 3D5XA 5DHJA 3R8ZA 3HV7A 4FT9A 4WSQA 3U51A 1OIRA 3VAPA 2QG7A 5AV2A 3GB2A 4PWNA 4YSMA 4ZP5A 5FEDA 4WNPA 3AT4A 4W8DA 3NS9A 4JX7A 1RW8A 4CT2A 3I81A 2VTLA 3SW7A 2JBOA 1BUHA 1YWNA 4G9RA 1JBPE 4MXOA 2F57A 3MVHA 2WOTA 4XG2A 3AGLA 4RX7A 4AZWA 2BMCA 5BMSA 3KCKA 1SMHA 5H8GA 3HDNA 4DEBA 4GFOA 2CGUA 4K18A 4EH4A 4IAAA 4FYNA 4LFIA 3PSDA 2ESMA 2ETKA 3GC7A 3UVRA 2YLFA 3BKBA 4CTBA 4FBXA 2Y4IB 2VWYA 5LMKC 4FV2A 2BROA 4D55A 3PVBA 5M4FA 4FODA 4F7LA 3DDQA 4RX9A 4DC2A 2V7AA 3N4UA 4NM7A 3JR1A 4IC8A 3LFFA 2J0KA 5KUPA 3V01A 3GU4A 1KE5A 4BDJA 4EUUA 3NRMA 3KXNA 5CAVA 3MA6A 4J98A 3UPZA 4I92A 4O7RA 3C4EA 5IEVA 1ZAOA 2C3JA 4LMNA 4HVHA 5CF8A 3C50A 3I1AA 4FE2A 2ZOQA 4TYJA 3KXZA 2UZWE 4Q9SA 4DEDA 4F9AA 2XYUA 3COIA 3MIAA 4MD9E 4O91A 4ENXA 2EXEA 4I5MA 3EQBA 4QMWA 4X3FB 4E4LA 5J9LA 3C0HA 4A9UA 5GINE 1PMUA 2G2HA 2VZ6A 3DA6A 1XBCA 4QO9A 3AC4A 4GEOA 4WG5A 1Z57A 4CVAA 3PP1A 2IZRA 5BUJA 4ID7A 1YW2A 1DI8A 2W5HA 1JSVA 5DWRA 2XIRA 2YIRA 1ZYLA 4G3CA 3ZDUA 1ATPE 4LL0A 3ENMA 5AP4A 1FOTA 3NYNA 5F1ZA 3ZO1A 2OKRA 4X6RA 4NU1A 4FTJA 2C0OA 2ZVAA 4G16A 2PPQA 3IW4A 2R64A 5C1QB 4EOSA 4YHFA 3FMLA 3UG2A 4H36A 3FQHA 3KMWA 3MW1A 4CFXA 5A54A 3PA4A 3O51A 3LCOA 4L44A 3HP5A 4EOMA 3FZOA 5KO1A 4ZZOA 4ITHA 2WMTA 4V0GB 2GNHA 4YZBA 4FSRA 3QQLA 5GJGA 4FT7A 4I3ZA 4TYEA 2XJ0A 4LUEA 3CY3A 3FI3A 3LFCA 2Z8CA 5DH3A 3EYGA 3FSFA 4KD1A 4DFXE 5CF5A 3W1FA 1PXNA 2BRGA 4Z55A 5HVKA 3MFUA 4RIYB 3QHWA 3PRFA 4W4YA 4KIKB 5CX9A 3V8WA 5IA4A 3AD5A 2ZYBA 4YC8A 1JKLA 3W55A 2GU8A 3FLNC 1TQPA 2JIIA 4F9YA 3VBWA 4EH8A 2JFMA 1K3AA 3ORXA 5HEZA 2OXYA 1U54B 1T46A 2HCKA 4GYGA 3S95A 2VWIA 3VS4A 2IWIA 4OR5A 4YJQA 2XNEA 3HEGA 2PMOX 2W5BA 5DT0A 4BDFA 5LCKA 4CZTA 3DBFA 1ZY5A 3DTCA 3HMNA 4ACDA 4CV9A 2W0JA 4D28A 4UZDA 4CSVA 1NY3A 3LFBA 4A9TA 1PW2A 4K9YA 1UNLA 2Z2WA 4XUFA 2Q0NA 1UU8A 4Y5QA 2BRHA 2WIHA 3FKLA 4QMLA 1OVEA 2GFCA 4YO6A 4EWQA 2Y0AA 3EOCA 5C27A 3I5ZA 3GNIB 3DFCB 4QMVA 4R5YA 3SOCA 4RJ4A 4CCUA 5J87A 1ZY4A 3L9MA 4QTEA 3D9VA 1MRYA 4OT6A 4PTGA 3F7ZA 2BRBA 3DGKA 1I44A 5TR6A 3OBGA 3RHXA 5LJJA 2WKMA 3F61A 3FQEA 5HX8A 4FK3A 5CZHA 3LLTA 3ODYX 4E3CA 3H9FA 3AC2A 1GZ8A 4JDKA 1WVWA 4ACHA 5E1SA 4G31A 3I6UA 3I5NA 4FG8A 3FY2A 1JKSA 5AP7A 5AX9A 2C3KA 4C7TA 2X0GA 5JGAA 3T9TA 4K11A 5A4EA 2C6MA 2Y7JA 4ZMEA 3N9XA 1W84A 4ALVA 3HV5A 4NUSA 5D11A 5IH6A 5DBXA 2C47A 4E6DA 5CQUA 2O0UA 2R7BA 1W82A 5AUTA 4KWPA 3FI8A 1JSUA 4OW8A 3D5WA 2G15A 2HIWA 1Q8UA 2ZV7A 5HESA 2PY3A 4FIHA 1FQ1B 2J0MB 2KULA 1F0QA 3O96A 4FG7A 2BUJA 5C9CA 5L2IA 3FV8A 3VJOA 4XG6A 2YWPA 4DEEA 3Q4UA 5HVYA 2RFNA 5GIPE 3W2SA 1BYGA 1G8AA 3VUMA 4FGBA 3OG7A 4FSUA 1XQZA 4ZY4A 5HLNA 3PSBA 3DAKA 3BYMA 5ANGA 3FMMA 4RX5A 4CKIA 5J5SA 2VO0A 4D58A 5IKWA 4JBQA 4IAYA 3W2CA 3MYGA 2PK9A 4JAIA 3OUNB 2YJSA 1IA8A 2VTJA 4FZAB 1YQJA 4JR3A 4C35A 4WKQA 3ZBXA 3ORKA 4EOOA 3KKVA 1QPCA 5CEIA 2F7ZE 1A48A 2IVVA 3POOA 4JG8A 4EBVA 5CAOA 1KOAA 4GT5A 4W4WA 3VW6A 4MXYA 3QA8A 4HOKA 4D1ZA 4JBVA 4QMTA 5C03A 4EH9A 3RK9A 3UJGA 1O6KA 4I6FA 3R0TA 4DGMA 1Q41A 2Y8OA 4CFMA 3BU5A 2UZTA 4FR4A 4Q5HA 4G1WA 1FVVA 2XNPA 3KRXA 4RVTA 5KMIA 3QQHA 3CIKA 3E3BX 5E8SA 4EI4A 3R21A 3RVGA 1UV5A 3R9OA 3W10A 3K2LA 1OIQA 4ZSJA 3I0OA 2BIYA 3P7BA 3QQKA 1VYWA 3RAWA 4K77A 3MN3A 3H4JA 2WMAA 4BY9E 4I23A 2X7GA 1HCLA 4PUZA 1BLXA 3UO4A 3EQRA 1ZYJA 4ZJIA 3GFEA 3QTRA 3LCDA 5CY3A 3OTUA 3OCGA 3OXZA 4M0YA 4KIQA 4NWMA 1U46A 4DH7A 2RG6A 4FI1A 4MTAA 4QPAA 4RVLA 4ZK5A 3P7CA 4RFYA 4G3DA 4YJUA 1IASA 5EW9A 2PL0A 5EOLA 4ZTRA 4MD7E 5E8UA 3TZ9A 2O65A 2XBJA 2JDVA 3DNEA 4UYNA 2GQSA 5CXZA 4ZLOA 3S2PA 2O5KA 3HX4A 2QODA 2YN8A 2GQRA 2ZV9A 2YEXA 2OXDA 2BFXA 3OFMA 3O7LD 2W1ZA 2OFUA 1ZOGA 4UXLA 4BKJA 3R1SA 2RFEA 3MFSA 1JAMA 4CXAA 5EYDA 3ZRKA 4TT7A 3VHEA 4OBQA 5AUZA 4ZAUA 3ZZEA 4MWHA 2CGXA 3WE4A 3DV3A 4BDHA 2A27A 5FBNC 4AE6A 3HRBA 4UV0A 3QD3A 4AE9A 3EQFA 2JKQA 3FI4A 5AP3A 2J51A 2C6LA 3UQFA 2FYSA 3QF9A 4H1MA 3GOPA 3LM5A 3ZLSA 2ITPA 4AAAA 1U5QA 3MY1A 4RT7A 2PE2A 3VBYA 4BYJA 4CZUA 3NUXA 3D4QA 4GKIA 5JT2A 2QOQA 3KF7A 3TIZA 3SGCA 4GIHA 4NJDA 4QPSA 4UY9A 3Q6UA 3UOLA 3W2PA 3LXLA 5H9BA 5I9UA 3ELJA 2BILB 3PVGA 4EONA 3H9RA 3OROA 4I24A 1SZMA 3NPCA 4JJRA 4MBLA 5D7VA 4QMZA 1PXJA 4C02A 4RWLA 1H25A 1UVRA 1UNGA 3JUHA 3SW4A 3RPRA 1UNHA 1BI8A 3RP9A 3ZLWA 2VU3A 5C4LA 4E6CA 2JKMA 1SNUA 4LL5A 3MY5A 1OBGA 4U44A 4KRCA 2UVZA 4RA4A 3V51A 3CPCA 3SKCA 4IFCA 3BE2A 2YWVA 3CD3A 4JXFA 1MUOA 4OGRA 2RFSA 1YHSA 3GC8A 3NGAA 3JYAA 4TPTA 5HBHA 5EHLA 4Y8DA 2Z02A 2E9VA 2G01A 1ZYSA 2E9PA 3U4WA 1KE6A 1V1KA 3Q5ZA 5HCYA 3IOPA 3V3VA 3PJ8A 4RQKA 1W7HA 3V5QA 5J5TA 4AOTA 3CTQA 4OAVB 2ITVA 5AR5A 4YLJA 5AADA 1WBTA 2YIXA 3NAYA 4X2NA 5H8EA 5G6VA 5D41A 4QMSA 5HE2A 1K9AA 4IWDA 1ERKA 3QX2A 4UB7A 4PL4A 1OBDA 4F6WA 3FC1X 2BTSA 3O2MA 4X3FA 4KIPA 3PA5A 1YVJA 3UIXA 1PMVA 1QMZA 4YO4A 4ARKA 2ZV2A 5CAQA 4QYGA 2XZSA 3O50A 3RNIA 4DEIA 4YMJA 2GNIA 1OZ1A 4KABA 5I9VA 4JAJA 1IG1A 4Z9LA 3G90X 4FTLA 4KINA 3Q4ZA 5E8YA 5M09A 1UKIA 1Q8WA 4TYGA 5CVHA 4O38A 4U81A 5F4NA 4E26A 3FLSA 3LZBA 2FA2A 2BPMA 2IVSA 3R1NA 4BHNA 2P33A 2XK3A 2Y4IC 4IMYA 3UC4A 3S00A 4XV3A 4FSZA 4BGGA 4BBFA 3ZRMA 4ZSAA 3GCQA 5JN2A 3OCTA 5EYCA 3KVXA 2C1BA 4YC3A 2X2MA 4B9DA 2E9UA 4NM0A 4F1OA 4C61A 4RLLA 3VBQA 4FTIA 4CMUA 3EN6A 4RIXB 1R78A 1P5EA 4IM0A 4V0GA 3ATTA 3F7WA 1BI7A 2GNFA 4IM3A 5DOSA 4IJ9A 4HVSA 4EHVA 3L8XA 3C0IA 5L4QA 3BWJA 5EKNA 3LMIA 3DB6A 3QRJA 5TKDA 5J1WA 3REPA 3FLYA 2GFSA 4X3FC 3QC9A 1SVEA 4K0YA 4RIYA 3N4TA 4KIKA 2OF4A 1CM8A 2JDOA 2PZ5A 2VO6A 2I7QA 3QWJA 3A2CA 3QZFA 1Q61A 4RJ7A 4FKSA 1FINA 2CGVA 2RL5A 4XJ0A 5JZNA 5HCXA 4FGRA 4BCKA 2YACA 2JKKA 3UO6A 4EH7A 3D2KA 4JRNA 5KMJA 2NRYA 3LM0A 4DG3E 3UQCA 4FEWA 3ODZX 4FUYA 3LFDA 1H01A 3BELA 2OICA 1U54A 2DWBA 4FV9A 4AQCA 3GT8A 2OF2A 4FUXA 3VN9A 4D1XA 2I0VA 3ZCLA 2ZB0A 3UTOA 5AP0A 4E6QA 4IIRA 5K5NA 2CNUA 3ZONA 2VGOA 2ITXA 1QPJA 1LEZA 3HDMA 3H9OA 2OIBA 3KK8A 5E8WA 5I9XA 3T9IA 4QYFA 3HAMA 1UKHA 4CFNA 4U42A 3DJ5A 1BL6A 5KBQA 3CQEA 5EK7A 3W18A 3ZEWA 3JPVA 4CRSA 4YTHA 5EOBA 3QCQA 2C69A 3UZTA 3BGZA 4HZRA 3QQJA 4CEGA 1STCE 5HTCA 1UU7A 2JAVA 2ITWA 3PJCA 3EFLA 2UW8A 4FTMA 3KN5A 3QHRA 4D2TA 2DYLA 1GJOA 1ZMVA 2C6OA 2BKKA 1OI9A 4G3EA 1W8CA 2GTMA 3ETAA 3RZFA 2JDTA 2QOKA 4JS8A 3DKOA 2GMXA 3NYVA 2NRUA 5K0KA 5LXMA 4BCMA 3KN6A 3FZPA 3MVMA 3PA3A 4UYAA 5FWKK 2QOLA 3VJNA 4C2WA 1OKWA 3ITZA 5BYLA 5B7VA 4O6EA 2W1DA 4AT4A 2YM8A 4YU2A 4WBOA 2OXXA 2QVSE 2VD5A 5DGZA 4FV1A 3DTWA 4L3JA 3R7VA 1YOMA 4Y46A 4NYEA 1LPUA 3HA8A 3OUKA 3BWFA 3WZEA 4BBEA 5FM3A 4TKSA 3UYSA 5DI1A 1Y8GA 5AUUA 2F2UA 2ITNA 4RJ3A 3LFQA 5L6WL 1OPKA 3SC1A 3ORIA 4EOLA 3R2YA 4R8QA 4XOZA 1GZOA 5AAEA 2C3LA 3RALA 4S30A 5CAPA 4GMYA 1J1BA 2PYWA 3R9NA 2FUMA 1WBSA 2UZBA 2YDIA 4RFMA 1JPAA 3ZSHA 3NDMA 2YERA 4EOKA 3OY1A 2WTJA 3DY7A 3MBLA 3FXZA 4A4XA 1YXTA 3MPAA 2WMXA 3LHJA 3TV4A 1REKA 2J90A 4FICA 4UMTA 3ZSIA 3V8SA 4L8MA 5HTBA 5IMXA 5HE0A 4J8MA 5HKMA 4EYJA 1MQBA 3FZSA 3SXSA 3PDTA 3EN9A 1SYKA 4J53A 5C8KA 2OK1A 4IDTA 4Y85A 4ACGA 4PMPA 4JBOA 3EMGA 2OU7A 1GIIA 3PJ2A 4FMQA 4O7ZA 4B7TA 4KS8A 1XH4A 4DGNA 3R7EA 2CLXA 2XCKA 1UWJA 2JDSA 5FQDC 4DGOA 4EHEA 3SRVB 4NSTA 2J5FA 5CXHA 4YJOA 1JWHA 3E63A 5EM5A 1H24A 3S3IA 5JK3A 2WU6A 5AUYA 2YZLA 2YM3A 3AC3A 5D7AA 3DK3A 5FTOA 3PPJA 4E5WA 1RE8A 3JVRA 2FVDA 5J9ZA 1M52A 2JITA 4C0TA 4E73A 3MDYA 1IR3A 4O0WA 4F70A 4PP7A 5EHYA 5IQHA 1E1XA 3GU7A 4O7YA 3BPRA 2QKWB 3DZOA 5EM8A 5IA5A 3G9NA 4B8MA 3ZLYA 3PWDA 4FV3A 2Y4PA 3D15A 3TZMA 3R30A 3K5UA 4FZ7A 4N6ZA 5TT7A 3F5UA 3O7LB 1S9IA 4AZSA 4PV0A 3B8RA 4M67A 4K33A 3TG1A 3UP2A 3ZO3A 2WMQA 3ZXZA 4O1OA 5CI7A 4EOQA 3CSVA 4D5HA 3CEKA 1TQMA 4JRVA 4RSSA 4Y72A 4DITA 5G1XA 3GI3A 4J96A 4O7VA 5EQPA 2B55A 5AR3A 3SQQA 4XV1A 5CLPA 4H1JA 5HORA 3QCSA 5CEKA 4BCQA 1G5SA 3KU2A 4LOQA 3VUHA 2UW3A 4YC6A 4MXZA 1BKXA 3QRUA 4UMQA 5KMKA 4FEVA 4BDEA 4FL1A 3ROYA 2BRMA 4M68A 3EKNA 3F6XA 4RWJA 4F0FA 3EYHA 3EQPA 4NFNA 4PQNA 4DA5A 4ANSA 4FC0A 3TWJA 4FKPA 4PX6A 3DQXA 4MQ2A 3VQHA 3FSKA 2OZOA 4BDAA 4EOJA 3BCEA 4ERWA 3U54A 3KB7A 4X2JA 2XA4A 3VS2A 1OPJA 4H3BA 2HW7A 4V04A 2CPKE 5CT0A 3ZLXA 2ERKA 4XCUA 3M1SA 3TTIA 4AXAA 5JSMA 4I6BA 1FBNA 4DT8A 1H1RA 1PYEA 4LG4A 5HNIX 3SXFA 4D4YA 4GJ2A 4OT5A 2B53A 5IQEA 3NUSA 4RFZA 5ANOA 3IOKA 4H3PA 3O8TA 3F5PA 1GOLA 2UV2A 3KF4A 1ZOHA 4MXXA 4PNKA 2J50A 4CNHA 3A7HA 5HBEA 3BIZA 4Q9ZA 2WFYA 4FEUA 4U3YA 3IGOA 2WMBA 4TYHB 4UWBA 3G15A 1U4DA 1H1WA 4PY1A 3LVPA 4DTBA 2HK5A 4L46A 3NVKI 4GK4A 1YXXA 2HELA 1YDTE 3KRJA 4EH6A 4CQEA 1J7UA 3R7YA 3OT8A 4IACA 4EWHA 3DK6A 2A0CX 4S34A 4UBAA 2YCFA 4X7QA 4FV0A 3MH2A 5KCVA 4LGDA 3RHKA 4GFGA 4WRGA 3FMNA 4YLLA 4CLJA 3PE1A 2X4FA 3Q52A 3EQHA 3TN8A 4FT0A 4X2GA 4B99A 4BTJA 4EQCA 3QCYA 3LMGA 4DLJA 3ENHA 3IKAA 2HXQA 4GW8A 3C1XA 2O3PA 3NWWA 5CEOA 2VNWA 1L3RE 4LV8A 3W8QA 2PULA 5F20A 4DAWA 5CSVA 3BV3A 3E7OA 4FVQA 4F7SA 5DMZA 1M2PA 4FV6A 5AJQA 4YURA 3RZBA 1OECA 3E7VA 4YJPA 3LPBA 4ZSLA 5CANA 3E3PA 4RQVA 3WBLA 3KCFA 5CALA 4FKIA 3E5AA 3Q4CA 3QQFA 3LXPA 3R2BA 4S33A 5DFPA 2WQOA 3LFNA 2W1GA 2HY81 5FXRA 4FSMA 3VWAA 3PXQA 2OLCA 1XBBA 2O8YA 1TKIA 4YPDA 5FM2A 3UVPA 4C59A 3FE3A 4FKOA 4TNDA 4A4LA 2UW5A 4OUCA 2GNJA 2V7OA 1Z9XA 4OLIA 2IW6A 4GU6A 4FKRA 5JRQA 3RI1A 3QYZA 4BTMA 4YTFA 2HZNA 4FEXA 4F1MA 5CQWA 4C4EA 5M08A 2UUEA 5M57A 4N4SA 3RM7A 4O86A 4FIGA 2C1AA 5TF9A 5H3QA 4FIJA 4QMNA 5D1JA 1KOBA 3QBNA 2QONA 1BX6A 3CCNA 2QURA 3FL4A 3RPYA 1S9JA 4LI5A 5HE1A 1QCFA 4D4RA 4BI0A 1FVTA 4BCFA 4IQ6A 3U4UA 4WD5A 4UEUA 5TOZA 5EI2A 4QP2A 4CG8A 2W96B 2YDJA 1X8BA 3EQIA 1ZLTA 3FKNA 3Q96A 4XBRA 3VRYA 4FKJA 3RPVA 2XIZA 3Q2MA 4ANMA 3VS1A 3OP5A 3GCPA 3CP9A 4G3FA 4R7HA 4HNFA 4F6UA 4FSTA 3UMWA 4X2KA 4BWKA 2ACXA 4GJ3A 4USDA 3DT1A 3A62A 4G6OA 3BHUA 3FLWA 4JL9A 4XBUA 2CKEA 3BYUA 3F82A 5AUVA 4DT9A 4O7LA 1O6LA 3QFVA 5IF1A 5J9YA 2ZJWA 3V6RA 3TDWA 4U80A 4FSQA 3SD0A 3ZBFA 4WT6A 4ZY6A 3LCTA 3U6HA 1OKYA 2UW9A 3H3CA 4Q5EA 4BCNA 2CKQA 1NVSA 3O23A 4U7ZA 3R7IA 4E20A 5LMBA 2QOOA 3DKGA 4IH8A 3Q9ZA 3AD4A 2WEIA 3F3VA 3OTVA 1PXMA 3QD4A 2ZB1A 4MQ1A 5AIRA 4D5KA 5DYJA 4FG9A 4FKVA 4RIXA 1M7QA 5BUEA 2VX3A 2FSOX 3NUPA 5IH5A 3W2OA 2BAJA 3VVHA 2OO8X 4ZLYA 1WBOA 1DAWA 4F99A 3BEAA 5HU9A 3ANQA 1JQHA 3KRLA 4HCTA 3PPZA 4IWPA 4R78A 2CSNA 3NNVA 5ITAA 1BMKA 4PDSA 4KS7A 1QPDA 1H0WA 4O2PA 5FDXA 4BKZA 3JVSA 2VWUA 4O1PA 1OITA 2V0DA 3UPXA 4RZVA 2EXMA 2QU6A 2ERZE 5CSWA 3FWQA 4J8NA 3IK3A 4B6LA 5H2UA 5KNJA 4C8BA 2GS6A 1B39A 2YITA 3JY0A 4UN0C 4XS2A 4NH1A 4AW1A 2G1TA 2ITOA 3E8EA 2QHMA 5GNKA 4FOBA 4I94A 5LWNA 1OMWA 2ETMA 2OH0E 4R7BA 4KUJA 4C34A 4QQJA 4RC2A 4ONAA 3MS9A 4RJ6A 2P2HA 4RC4A 5EH0A 5T68A 3RBWA 3WILA 4D2WA 3CPBA 5HO8A 4YSJA 2HWPA 2YIYA 4WHZA 4RRVA 5IUIA 4JDIA 4F08A 2VN9A 5M56A 3Q9YA 3F5GA 1KE9A 2JBPA 2A19B 3OOGA 3OD6X 3R8LA 4BDBA 5AAGA 2AC5A 2EUFB 4AX8A 4FTQA 2Z7QA 2ZM3A 4O21A 3IG7A 4PTCA 4KA3A 5HTIA 2JAMA 2RG5A 3L9PA 4AP7A 2VGPA 4IW0A 4BIDA 3TUBA 3R8MA 2XUUA 3Q5IA 2OJGA 3C4FA 5I9YA 2VTOA 3A7JA 3QTWA 4NL0A 1WZYA 3RCJA 1K2PA 3AQVA 1J7LA 2R2PA 3A7GA 3AMAA 3L8PA 2IO6A 2XBAA 4HYIA 4XRJA 4KKGA 3FHRA 4KRDA 3DKFA 4AZTA 3DFAA 2GCDA 4BN1A 4ZLZA 2BHEA 1GNGA 3U8WA 3FBVA 2NP8A 1WBVA 2GPHA 3GBZA 1U5RA 3C5UA 2QOCA 1A9UA 3PIZA 4AFEA 1W83A 3EJ1A 1HOWA 5L2QA 4MX9A 3EN4A 2BFYA 3NMUF 3TACA 3KMUA 4C4FA 2OI4X 2R3RA 4WUNA 5HNGA 4QTAA 3BLRA 5A14A 4YLKA 3FL5A 2CN5A 1JSTA 5LARA 4IX6A 4O0XA 3GCSA 4MHAA 3R8UA 5KZ0A 3ZDIA 1OM1A 2R9SA 2YM5A 3SA0A 3WZDA 4TWCA 3RPSA 4BDGA 1YWVA 4ZJVA 3LJ2A 5EYKA 4IX4A 1CDKA 4DLIA 1AGWA 3QQUA 4BCPA 2XM9A 1DAYA 5EI6A 4S32A 3IW7A 5E92A 4ZSEA 2HZ4A 4HPUE 4Y83A 5ETFA 2GTNA 4UWYA 3PFQA 3PXZA 4QRCA 5KZIA 3KMMA 3Q60A 4MBIA 3I0QA 4EYMA 3VUDA 1L8TA 4IZ5A 5IH4A 3SRVA 3PIXA 4BRXA 1MP8A 5EDQA 4AW2A 4G3GA 3R28A 4AACA 3LW0A 5LWMA 2YHVA 3B2WA 2OH4A 2XKFA 4E4NA 4DE4A 3VUGA 4I6QA 4DH1A 5FUTA 3NUUA 4FNZA 3PXRA 2GNLA 2H6DA 2P55A 2X7FA 3WOWA 3DS6A 5JFWA 5C4KA 4PTEA 4F7NA 3UOKA 1WMKA 4MXCA 4U40A 3SOAA 2ZV8A 1XH6A 1HCKA 4AZVA 2I1MA 3QQGA 4FTAA 3MESA 1P2AA 1OKVA 2ITZA 1PXKA 2VWWA 2JLDA 4WOVA 3F66A 2IG7A 4M84A 5HU3A 1ZRZA 3GC0A 2PHKA 3NIZA 5KX8A 4RIWB 4IJPA 3EZRA 2GNGA 3UNKA 4KNBA 3JY9A 4IAKA 4KBAA 4QPMA 3RAIA 3QYWA 3ZFXA 1M2QA 4APCA 4EORA 5AA9A 2YCSA 2QR8A 3EFJA 3A4OX 3O17A 4HGSA 4JOAA 5LMAA 2QHNA 1R39A 5M53A 4BHZA 3KXGA 3UODA 1OL6A 2JD5A 3COHA 2VTMA 3KEXA 2NPQA 1NXKA 2QOFA 3H10A 3LMHA 3NNWA 2XK7A 4PMMA 4RG0A 5JQ5A 3Q2JA 5C26A 4FOCA 3C4CA 4ZJJA 2GHMA 1RJBA 3ZHPC 1H4LA 3NW6A 3OBJA 4HZSA 4EC9A 2XKCA 1CTPE 2WMWA 4X3JA 5E1EA 4C38A 4JLCA 1ZZ2A 4IVAA 3R63A 4UZHA 4YNEA 1PRYA 5M4UA 3DNDA 2WAJA 1YWRA 3L1SA 3IDBA 5GJDA 3SXRA 4AG8A 3V6SA 5IUHA 3SVVA 4F64A 2WTCA 1H28A 4BL1A 2LAVA 2JDRA 5AM7A 2PVMA 5DA3A 3NSZA 1XKKA 3TKHA 5LOHA 3TJCA 2W1IA 2W9ZB 3VHKA 3MH3A 1CMKE 3ZUUA 3HZTA 2W1EA 2A4LA 2BDWA 3BQCA 3K5VA 2WB8A 3JS2A 4FSWA 4LQMA 3HUCA 5ANJA 2PWLA 2X2LA 4UALA 3TJDA 3P08A 3ACJA 4TYHA 4XHKB 2YA9A 3ZSGA 3R73A 4KAOA 4MKCA 4ZY5A 5HOAA 1WBWA 2R0IA 3RCDA 4B4LA 1YOJA 5I3RA 5CF6A 2EB2A 3V8TA 3HL7A 1Q8YA 3KXMA 1M17A 3UGCA 2CCIA 4M12A 1UU9A 3P7AA 4AT5A 4B0GA 5AR8A 4TN6A 5FBOA 4OTRA 2E9OA 3VNTA 4UX9A 4GKHA 2YABA 3T3VA 3EKKA 3EH9A 3UYTA 1JKTA 3FDNA 2VWBA 3BRBA 1GIJA 2WHBA 4GCJA 1Y91A 4GS6A 2XK8A 4IAIA 2W99B 4BDKA 5AIKA 4JG7A 3UZRA 2DS1A 3F69A 4A9SA 3U6JA 4FKLA 2YJRA 2EB3A 2BHHA 3TKIA 3UNZA 2BZKB 4M97A 2X6DA 3HMIA 4E5BA 3SG8A 3ZM9A 4R5SA 4HYHA 4PL3A 4FNWA 4PRJA 4RBLA 5AAFA 4FNYA 4IZAA 3AMBA 3DJ6A 3QZGA 3OF0A 4MNEB 4OTIA 3F2NA 2JIUA 4JQEA 2W06A 5CZIA 1J3HA 4F4PA 3PY0A 4O81A 4FTKA 3PPKA 2R3KA 5AV3A 4ZTSA 5AR4A 5E8XA 4YP8A 4G34A 2VWVA 5DVRA 3UMXA 4D2RA 4M69B 2VWZA 5CWZA 1VR2A 5AX3A 3TV7A 4GV1A 4DF3A 5GHVA 4AN9A 3FPMA 3MTLA 2OIQA 3QZHA 4JIKA 3OWJA 3LXNA 4R1VA 3ZEPA 3BYOA 4LGGA 1AQ1A 2XP2A 4D4SA 2YIQA 1OIYA 4QQCA 5I3OA 2CCHA 4DYMA 2YM6A 3IS5A 2XS0A 4XG4A 4XH6A 3R71A 4YJNA 5EFQA 4L67A 3KGAA 4TRLA 1FVRA 2ONLC 5IDNA 3RINA 4TWNA 4D9UA 4EKKA 1ND4A 4WBBB 2R0UA 3GENA 2PUNA 4C36A 5M07A 2C5XA 3P86A 2R4BA 1JNKA 3NCZA 1YDRE 2VRXA 3SG9A 3F9NA 3A60A 2GQGA 3G9LX 3MIYA 3V5PA 2WMSA 4J97A 3Q9XA 3QTQA 3BHYA 4PMSA 3W8LA 2FH9A 3B8QA 2X9FA 3A8XA 4M3QA 2A1AB 4PPCA 2KTYA 5BYYA 2E9NA 1URWA 5ICPA 4ZMFA 3EL8A 2RKUA 2OZAB 1XO2B 1ZARA 3IONA 5HE3A 2REIA 4MH7A 3OWKA 3QTXA 1OIUA 2ITYA 2QCSA 3R04A 3P78A 3AXWA 4FV7A 5DPVA 3CS9A
chains in the Genus database with same CATH superfamily
2EU9A 3PZEA 3DQWA 4JI9A 5IISA 4MYGA 5IA1A 1IAHA 3A7IA 4EJ7A 2WIPA 3K54A 3QLFA 3V5WA 2IF8A 4GUEA 4HW7A 4D1SA 5EKOA 3C0GA 4JDHA 5E9EA 3Q04A 4A9RA 2PMLX 4FIIA 4E4MA 4AUAA 4DHFA 4ORKA 4IX3A 3I7BA 3EQCA 4IZYA 3II5A 1FPUA 3MPTA 5LQFA 3O0GA 1VEBA 3Q9WA 4TL0A 5DEWA 3QLGA 5HGIA 4M0ZA 3OW3A 2YISA 2R7IA 2R3QA 3PSCA 3LFAA 2W4OA 1WVXA 3QU0A 4RWIA 2J4ZA 4YJTA 4YZMA 5BX0A 5CEMA 3PLAE 3OEFX 4DG0E 5CT7A 4FKWA 1Q99A 5AP1A 3W32A 2YAAA 2UW7A 3AC1A 4MNFA 4J71A 4Y73A 5DLSA 5AWMA 4JIAA 4G6LA 4FL2A 4ZXTA 3PRIA 4D4VA 4PL5A 1WAKA 2XMYA 3AT2A 3R9RA 2XEZA 3U55A 1PXOA 4MK0A 3ANRA 4W4XA 3ZRLA 5DNRA 1PXLA 3NNXA 4NM5A 4FSYA 1Y6BA 4FT5A 4ASEA 4BVUA 3VS5A 3HV6A 3VS7A 4O0VA 1NT2A 3R22A 2B1PA 3FMHA 3GCUA 4YGAA 5F94A 3WF7A 4BICA 5LVMA 4N57A 5AUWA 3OZ6A 2VTQA 3D2IA 2H96A 3QC4A 5LVPA 2HOGA 3QXPA 2JEDA 4RC3A 3M11A 3HYHA 2R3GA 5ANKA 3RWPA 4GVJA 4EZ5A 4AXDA 3SHEA 4IM2A 2I6LA 4I1ZA 2OWBA 4BDCA 1DI9A 5D10A 5GZAA 2PVLA 3BBWA 4IZ7A 4TYIA 3AD6A 2GDOA 3UBDA 2J2IB 4O2ZA 5E8ZA 3K3JA 4BGHA 2CGWA 2I0HA 2VTSA 1BL7A 4K2RA 4N0SA 4XLVA 5HD7A 3UIBA 3ALOA 5CASA 5L6OA 4CRLA 3BLQA 3KL8A 1PXPA 1O6YA 4OTGA 4TY1A 3UNJA 3QUPA 4BCOA 4BDIA 5A4LA 2BAKA 4YJVA 5AUXA 3MWUA 1PY5A 3FXXA 2V22A 2Z7LA 3ACKA 3TIYA 3ID6C 3A8WA 3R01A 3MSSA 4UMPA 4CTCA 3WF9A 5FP5A 3WIGA 4YNOA 3LXKA 3HMOA 2VTNA 1B6CB 3HECA 3LIJA 3CC6A 4L01A 4U9AA 4AZFA 3DZQA 3E87A 3NW7A 3QGYA 3ZH8A 2QKRA 4E7WA 3A99A 4O7NA 3I60A 3OVVA 4BJJA 4CMTA 3ORNA 5E8TA 4FIEA 3LAUA 4K6ZA 4I93A 3EQGA 4C3PA 3VRZA 5IEYA 5KMMA 1J1CA 4EK8A 5L2TA 3GU8A 3ORTA 2BDFA 2C4GA 3OMVA 3MB6A 3PVUA 4YZ9A 4Z7HA 5E91A 2RSVA 4C4GA 3WYXA 1OPLA 2B9JA 3VC4A 3C9WA 3G2FA 3R7GA 4U0IA 2B0QA 3NUAA 3P4KA 3THBA 2XJ1A 4C4JA 5HLWA 4QQTA 3OC1A 4IB5A 1ZYCA 4I4EA 2HY0A 4AGWA 2WTVA 2PTKA 2RGPA 1CKPA 5AV0A 4OAUC 5LCJA 5ANEA 1VZOA 3Q32A 3Q4TA 2R3MA 4L00A 4UMRA 2C5OA 3P23A 4QNAA 5HG9A 3MA3A 1Q8TA 4DGGA 5JZJA 3EIDA 2JFLA 4I41A 3G51A 1O9UA 4CFWA 2XARA 4EH3A 4IB1A 3QWKA 3FJQE 4WNKA 3R9HA 4FTUA 4TXCA 4W9WA 2H8HA 1XHAA 2VX0A 5AEPA 3O8UA 2HZIA 2YDKA 5CU4A 5E4HA 3HKOA 3V5LA 5CAUA 2WOUA 4FF8A 3VF9A 4GSBA 4YHJA 3EL7A 2XM8A 4FTNA 3OW4A 4G5PA 2RIOA 5J8IA 4F09A 3KULB 3NNUA 3R7UA 4FV8A 3GVUA 3N51A 2ZDUA 3ORPA 3HRFA 4XOYA 4QMOA 3P0MA 3S4QA 1DM2A 3ZZWA 4PPBA 5CU0A 1Q3WA 3OCBA 5JKGA 3QX4A 3FPQA 4WUAA 4U43A 1YKRA 3ZM4A 5KKRB 2X8EA 2IZUA 3FLZA 4DINA 4EK6A 3OXTA 3PIYA 4WNMA 5BVDA 3CTHA 4FZFB 1OL5A 5HLPA 2QLQA 4YBJA 5KMNA 2WMVA 2XALA 1TVOA 2CHLA 1P14A 4IDVA 4GL9A 3EHAA 4RGJA 2HZ0A 4YHTA 2WZJA 3MFTA 1QPEA 3GU5A 2J6MA 3UG1A 4ANQA 4AT3A 5C8NA 3RJCA 2ITQA 3L9NA 5AR2A 4ANOA 5EQEA 3R1YA 4DN5A 4DH8A 4BZDA 4GG7A 4AW0A 3DXPA 4RIWA 3JXWA 2IVTA 2R3OA 4JBPA 2PVNA 4O0SA 4P7EA 4YTIA 4XP0A 1IEPA 1GZKA 2PMIA 4U45A 2XK4A 3FLQA 4KIOA 4BCIA 5KMLA 1SVGA 4DTKA 3MY0A 4DFLA 2OIDA 4JQ8A 1P4OA 3BHTA 4J7BA 3TNIA 4NIFB 5HBJA 4NKAA 5EI8A 2R3PA 4L7SA 3TEIA 1Q8ZA 3V5TA 4CYIA 4GK2A 3WYYA 5IQCA 3B2TA 4C4HA 2JKOA 1Y6AA 5KBRA 4A4OA 5HNBA 5AFVA 3E92A 3VONA 2XK9A 2XYNA 2WGJA 2Z7RA 3AC5A 3CJGA 3QRKA 2VTPA 1YI3A 4I20A 4D2SA 4IEBA 3NZ0A 1YRPA 5ETCA 1R3CA 2P4IA 2BR1A 3TT0A 2OJIA 4XMOA 3PE2A 4M7IA 3ATSA 2P3GX 3HGKA 3H0YA 4GK3A 2FSMX 5BVWA 4FVRA 5L3AA 2XNGA 1Q62A 4JVGA 3EFWA 3DK7A 4C3FA 5IZFA 4FKUA 4DEGA 2FB8A 3DDPA 1KE8A 5ANIA 4PDOA 4QMXA 2HW6A 1ST4A 2B7AA 4IAFA 3FMJA 4WIHA 3I7CA 5IMEA 1Q97A 4CFVA 4JR7A 2C6KA 2VTTA 4IVBA 4KB8A 2O64A 3HMMA 4CKRA 3QA0A 2PMNX 5FTQA 3N4VA 4EOIA 3DXNA 4V05A 5KHXA 5FTGA 1OL2A 5EG3A 3D94A 3TI1A 3OWPA 5AV4A 1Q24A 3BYVA 3CGFA 3GOKA 4FV5A 2B9HA 5IQIA 3PLSA 1OGYA 4DFZE 3GEQA 2AC3A 3DPKA 1NA7A 3F3ZA 5AR7A 4QTDA 4NTSA 1ZZLA 2YM7A 2W1CA 4U41A 5C8MA 3R7OA 1ZWSA 2GHGA 3EWHA 5DIAA 3UVQA 2EVAA 1VLRA 4FKQA 2OFVA 1EH4A 3FMDA 3NW5A 3DKCA 3EN7A 3PY1A 2HENA 2J0JA 3I4BA 4IANA 5EYMA 2XRUA 3QRIA 2XB7A 4V01A 4IXPA 3E62A 4AOJA 5BUIA 4J1RA 1GAGA 1LP4A 4XEYA 4AZEA 4C2VA 2EXCX 4IHPA 4L43A 2PVHA 4P90A 5J7HA 4LV5A 5CNOA 3D7ZA 3A7FA 4RLKA 3V04A 4MNEA 4BWPA 3AG9A 4K8AA 2C5NA 4HCVA 4XG9A 5M55A 4L7FA 1W2DA 2QC6A 4Z7GA 4RX8A 4CD0A 3NUYA 5M06A 2BRNA 3PZHA 3QTZA 1YOLA 3COMA 4M69A 3P79A 4Z3VA 4GIIA 4EEVA 3S1HA 4L53A 3SAYA 4X0MA 3RK7A 3DJ7A 3MJ1A 2NNWB 4HVDA 3SDJA 4AOIA 2WNTA 4FNXA 4C33A 4J52A 1JKKA 3FC2A 3ORZA 4L42A 4XV9A 3BGPA 4HGLA 4ZTNA 5K5XA 4X6QC 3UC3A 4QP4A 5AA8A 2WELA 5CEPA 3O71A 3PG1A 4DFUA 2RFDA 4I21A 4BBMA 3ERKA 2XCHA 1QL6A 4ZS4A 3EZVA 3C4WA 3QCXA 4S31A 2F2CB 3VQUA 4ITJA 4F7JA 3IGGA 5IUGA 4NCTA 3LKMA 5IQDA 3H30A 2C68A 4R7IA 5IDPA 3IECA 3WZKA 4FIFA 3LQ3A 3BEGA 3PP0A 4A7CA 4W4VA 4OTWA 1YI4A 2WMUA 1H8FA 2OZAA 3IPHA 3CGOA 4O27B 1SNXA 4QMMA 1JLUE 3CD8A 4DEAA 4I0RA 4YZCA 2QNJA 3QGWA 3TL8A 4EHZA 2VX1A 3WF6A 1URCA 3EN5A 3SLSA 3LCKA 4IC7A 3GQLA 4FVPA 2PZIA 4O82A 1NVRA 3D14A 4M15A 1WCCA 4O0UA 4IVCA 5BVEA 5JFVA 4ZZNA 4IWQA 3QAME 3UQGA 4FTCA 4EK4A 2NO3A 3OXIA 3PY3A 3I79A 5A6NA 4KKEA 5E90A 4ERKA 4QP8A 3CTJA 5K3YA 2VUWA 4QYHA 5DE2A 4E5AX 5AM6A 4PP9A 2UZLA 5B2KA 4D2PA 4E8AA 3TZ7A 5M44A 5JEBA 2BTRA 2ZM1A 1CKIA 1H1QA 3FY0A 3I6WA 4NCTC 4FJVA 4EJNA 2C30A 2B9FA 4IE9A 1PHKA 1WFCA 4ANBA 4O96A 4PNIA 2OBJA 3A61A 2XKEA 3VW8A 4W8EA 4XP3A 3W0PA 3POZA 3GFWA 2H9VA 4DFYA 3R6XA 3KRRA 5CVFA 3DLZA 5GIOE 1SVHA 2CNQA 4UWCA 3CBLA 3IW8A 1DS5A 4AA4A 4F0GA 1G8JA 3C5IA 2XRWA 3LOKA 3E64A 5IPJA 1ZMWA 1YHWA 5LVLA 4F0IA 5HO7A 5BPYA 2XANA 4PF4A 4L68A 5IEXA 4G9CA 4XNEA 1GY3A 4QT1A 1FMKA 4R6VA 4AXEA 3T8OA 3SV0A 2OG8A 3TKUA 2W4KA 3C51A 4GRBA 4BR3A 2UZOA 3DU8A 2VO7A 4Z16A 5E7RA 5HIEA 4FTTA 4WSYA 2ITUA 4NFMA 1OUKA 2GHLA 3C13A 4F6SA 3M42A 4QMPA 4RWKA 4E6AA 5A4CA 5FD2A 2FO0A 2YFXA 3BHVA 4DG2E 2Z7SA 2UZVA 2W7XA 3HMPA 3FZTA 4FYOA 4CFFA 2LGCA 2X1NA 4DFBA 4JMQA 3ZO4A 4XP2A 2BIKB 4MBJA 5FRIA 2XIKA 4NEUA 5JQ8A 4DCAA 1XH7A 4FKTA 4II5A 2YCRA 4J99A 3TXOA 4BKYA 3ZUVA 2CKOA 4LOPA 4MAOA 4AN2A 2AUHA 2ZM4A 1APME 4I4FA 1R0PA 4WRSA 4CV8A 4F1TA 5GZ8A 4AN3A 5L6PA 3LQ8A 1KV1A 4FKGA 3QKMA 4AU8A 2Y6OA 4USFA 2H34A 1CSNA 2P2IA 2J0LA 3HP2A 4J95A 2V55A 3L8SA 4H58A 5AP6A 3W16A 4BTFA 2OW3A 4EBWA 4UMUA 1LEWA 5HIBA 4D2VA 5HZNA 1RQQA 3KVWA 4MVFA 2WXVA 5CU3A 4QP6A 4IWOA 1KWPA 1P4FA 4EK3A 5HX6A 3BLHA 2XVDA 3FHIA 4KKHA 3QRTA 5CU2A 3PJ1A 2G2IA 4TW9A 4U8ZA 4UXQA 5KE0A 4XRLA 3VBVA 3PVWA 2PZRA 1V0OA 3MJ2A 3WF8A 4QD6A 1YI6A 3BGQA 2Y6MA 4USEA 2SRCA 3NCGA 5JFSA 1PYXA 4A07A 4OTFA 1H1SA 4AA0A 4ANNA 3NYXA 5JMSA 3P9JA 1LUFA 1MQ4A 2X39A 3GQIA 2PZYA 2Y9QA 3IDCA 3L8VA 5CSHA 4ZIMA 5FXSA 3MTFA 2BZJA 2YZAA 3TYKA 3NEWA 3MFRA 5HHWA 4CZYB 5IG1A 3NUNA 1KUTA 4ZTQA 4PDYA 2QLUA 3FMEA 4M14A 4D9TA 3HVCA 4BCJA 4E1ZA 5CF4A 4FZDB 3NLBA 4MUQA 3W0NA 1VJYA 2XH5A 3HNGA 5T6KA 3VUIA 3KREA 3MVLA 3H0ZA 3LJ1A 3KULA 2Q83A 1H07A 4L3PA 5F95A 2IVUA 3D0EA 3QUDA 3U9NA 4ACMA 2YLEA 5I0BA 3CR0A 1WBPA 2CMWA 3OWLA 1Q3DA 2XNMA 4IB0A 2V5QA 1PF8A 3CKXA 4F9BA 4FRFA 4ASXA 5K4IA 1WVYA 5L8LA 4GYIA 3ZFMA 3OEZA 2F49A 2UZNA 2VTRA 2YIWA 3FZRA 2YCQA 1PKDA 3DCVA 3NX8A 4PPAA 3KFAA 5CSXA 5DT3A 5EW3A 3GC9A 4ZTLA 2WTKC 5DR2A 3OS3A 1KE7A 3QKKA 1ZYDA 4NW6A 5GJFA 3ZFYA 4K1BA 4YZNA 2R3IA 2I0YA 2FGIA 3TUDA 4FL3A 2CKPA 2G9XA 1A06A 2W9FB 5FDPA 4BI1A 4YJRA 4LYNA 1XJDA 5DT4A 4AWIA 2VTIA 3F3TA 1FMOE 2XNBA 4BCGA 5A6OA 3E8DA 1IAJA 2JC6A 3GGFA 3TNPC 2QG5A 4H39A 4F65A 1R1WA 5CTPA 4HCUA 4OTHA 5M51A 3E93A 5J79A 4QMUA 5D12A 3ZXTA 4EUTA 5A4TA 2QU5A 5A9UA 3TUCA 2HYYA 1J7IA 3HV3A 4O4EA 4O84A 3BBTB 1IRKA 1LR4A 2B9IA 4RZWA 3UIUA 3TM0A 2BZHB 5ANDA 5A46A 4CGAA 4FEQA 4KSQA 2XIXA 5J1VA 4F9CA 5IQGA 3OCSA 2ZMDA 1YXSA 2UW6A 1REJA 2XEYA 3DAEA 2F9GA 3G0FA 3MH0A 4NIFA 1NVQA 4MXAA 4GT4A 5IA0A 2DUVA 3MI9A 2QOIA 4H3QA 4BI2A 2VV9A 2O63A 5FP6A 3U87A 4AS0A 4TWOA 4EZ7A 4O6LA 3ULZA 4L3LA 2DQ7X 2UVYA 4XLIA 5KKRC 4GFMA 2X6EA 2J9MA 3DBCA 4QP9A 2QO9A 3QZIA 4EQMA 3A4PA 4FSNA 4QP1A 2C6IA 2C0IA 5BNJA 2X8DA 3HRCA 5CI6A 5DN3A 4ZEGA 3DB8A 4JQ7A 3BX5A 3D5VA 5DEYA 2IW8A 4I5HA 1FGKA 5T3QA 5FG8A 2BVAA 4G6NA 4BZOA 2UW4A 3RM6A 3WARA 5BVOA 5JGBA 2E2BA 2C5VA 2QO7A 4DH3A 3F5XA 3UO5A 1XWSA 3FYJX 4P4CA 5EM6A 4CQGA 3HV4A 5EHOA 1IA9A 4YUQA 4L52A 4DBNA 4HGEA 1NW1A 5ACKA 2XNNA 4O7WA 5IQAA 2IN6A 4HYSA 5DG5A 1KSWA 3BU3A 2JIVA 2X9EA 4CFUA 1E1VA 4Y95A 4Y5HA 5L2SA 3FQSA 3G33A 3TNWA 3TNQB 4EL9A 2ONLA 1FGIA 3D7TB 3R9DA 4WG4A 4AGCA 3ET7A 2J0IA 4MF1A 4QOXA 4YTCA 5BVNA 2G2FA 1ZOEA 4QTCA 5CNNA 3R83A 4DCEA 4XG8A 1YXUA 3MB7A 3T3UA 2XIYA 4DTAA 1JOWB 1XR1A 2XF0A 5F9EA 2GSFA 3R1QA 3FEGA 2W1FA 2ZMCA 3BYSA 4FT3A 2ITTA 5JRSA 4JDJA 3RMFA 4HPTE 3DAJA 5LVNA 5GZ9A 3VBTA 5HICA 4ITIA 4E93A 2CLQA 5EM7A 2OJ9A 5ETIA 4R77A 3D83A 4RVMA 4I22A 2Q0BA 4L9IA 5CYIA 4ZOGA 4BIBA 1TFFA 3MPMA 5K9IA 3U9CA 1OB3A 4LRJA 5HG8A 3PYYA 3ZTXA 5B0XA 4CT1A 2AYPA 3WIKA 4KSPA 4QQ5A 3UP7A 1OGUA 5AP5A 4CLIA 2WD1A 4GG5A 4AFJA 4O22A 4MF0A 4ENYA 4XX9A 5HQ0A 4ASDA 1V0PA 2R3JA 4I0SA 2UZUE 1AD5A 1Z5MA 5H8BA 4C4IA 2C3IB 5BMMA 4CCBA 4IVDA 3ZU7A 4ZTMA 4KBKA 3VUKA 2BCJA 3ZC6A 3FKOA 3E8CA 3NAXA 4IBMA 2W1HA 1WBNA 4NTTA 2CDZA 3FMKA 1YXVA 4MCVA 3V5JA 5EW8A 4EH5A 2YAKA 4U97A 2WQBA 3P5KA 4XV2A 3F3WA 4AW5A 3VF8A 2VTHA 4AXCA 4F78A 3QTIA 5HD4A 2J7TA 5JH6A 4JNWA 2Z60A 5D9HA 4BGQA 3RAKA 2PE0A 1TQIA 4A06A 4Q2AA 3CQWA 4AF3A 3PXKA 5A4QA 2WEVA 5IA2A 1ZXEA 4OTDA 3W0QA 2A2AA 2W5AA 4BTKA 2PUPA 4U6RA 4CG9A 5ACBC 3KC3A 4TNBA 5TO8A 3RPOA 2PVFA 4XYFA 3QALE 3NIEA 4BWXA 3CKWA 3O8PA 5HCZA 1U59A 1H26A 4TWPA 2I40A 2PVYA 2C6EA 3EQDA 4U79A 2R5TA 1T45A 3MV5A 4DGLC 3PXFA 4U3ZA 5AP2A 4L6QA 4QMYA 3PWYA 5CU6A 4MWIA 4BF2A 5ETAA 4N70A 3PJ3A 3C4XA 2V62A 3KXXA 4N6YA 3TCPA 4LM5A 5HIDA 4EHGA 3PXYA 3QD2B 4P5QA 4H05A 3WE8A 5IU2A 4APPA 1H0VA 2X81A 3FAAA 3ULIA 4M8TA 3ZMMA 3PUFC 1H27A 4LRMA 1M2RA 2XKDA 3HUBA 4F63A 2QOHA 4TTHB 4BCHA 5IQBA 4I5CA 5BVFA 3RTPA 4QMQA 1F3MC 2VTAA 4QEBA 3LE6A 2OJFE 4QYEA 3UIMA 5BQ0A 3DXQA 2CN8A 1TZDA 4I6HA 5HG5A 3RKBA 3L9LA 4E4XA 1OKZA 4NW5A 2HXLA 4RIOA 5EDPA 4NZWB 3EB0A 4R1YA 3VULA 1J91A 2B54A 4FX3A 3MGYA 4WA9A 2NYAA 3UDBA 3VUTA 3Q53A 3TNHA 4YBKA 4A9YA 2XK6A 5M4IA 1UA2A 5CVGA 5DRBA 4RA5A 1OL7A 4YZDA 3VS6A 3S0OA 3NFGB 3ROCA 3FYKX 3FZ1A 3BV2A 1PMNA 3QKLA 2CNVA 2QD9A 4QNYA 3MH1A 5L8KA 5AV1A 2BZIB 2WU7A 3GCVA 2PE1A 3F2AA 5HVJA 5B2LA 4AGUA 2QR7A 4JG6A 5I9WA 2PSQA 1PXIA 4G5JA 4IADA 4ASZA 3ORLA 3F2RA 3DBEA 1PMEA 4P5ZA 4S2ZA 3RK5A 4EQUA 5M4CA 3ALNA 1MRVA 3G6HA 2OSCA 3UOJA 4M66A 3RAHA 5TE0A 5IQFA 4O7SA 3E88A 1E9HA 4R3PA 3COKA 4QTBA 3BI6A 1R0EA 2QI8A 4PMTA 1F5QA 5HO6A 3TDVA 1KV2A 4EH2A 4GVAA 3W0MA 2EWAA 4OBPA 3FXWA 3ORMA 3OOMA 3E8NA 4C62A 3GXLA 4CMOA 4CKJA 5J7BA 4BB4A 5KMOA 3AGMA 4HYUA 5CS6A 3NYOA 4FTOA 3CY2A 3U6IA 1SM2A 3OT3A 2IPXA 3CE3A 4O0YA 3LFEA 3WZJA 4LUDA 3IQ7A 4AA5A 3TZ8A 4IAZA 3AC8A 5FEQA 3R00A 4FK6A 3ZS5A 4NT4A 3OY3A 1H1PA 3VO3A 4BYIA 5I4NA 5JFXA 3PG3A 4R3RA 4BDDA 4IX5A 1VYZA 1GZNA 1M7NA 3BQRA 4GUBA 4U5JA 2GS7A 4FV4A 4X2FA 4C57A 3FI2A 4EK5A 4O7TA 3G5DA 4ANLA 2PU8A 2WMRA 3BHHA 5JGDA 3ZOSA 1RDQE 2YM4A 2ETRA 2PZPA 2WTKB 2F7EE 4O4BB 4P2KA 1Y8YA 4RPVA 3WF5A 3ZC5A 3EFKA 4IB3A 3SX9A 4EKLA 4R3CA 3BU6A 3HLLA 3Q6WA 1OUYA 1M14A 4NM3A 2WQEA 4O0RA 5CSPA 1W0XC 5KHWA 3GU6A 2WO6A 1XH8A 1UU3A 3OHTA 3QL8A 3P1AA 4L45A 2VWXA 5DRDA 5A3XA 5B2MA 4LV7A 2W05A 2C6DA 5LVOA 3IW6A 2IZTA 2J5EA 2UW0A 3UDTA 3CQUA 4MD8E 5FGKA 5CENA 2BDJA 3LCSA 2WTDA 2C5YA 4OTQA 2QO2A 2HWOA 3LJ0A 4ALWA 2FSTX 2PVJA 4MEDA 5E8VA 2OGVA 1CKJA 3W2QA 2R3NA 1XMLA 4LRKA 4I0TA 4DEHA 2PVRA 3AMYA 3WI6A 4G2FA 4O83A 2B52A 4NKSA 2PUUA 4ALUA 5DR6A 5K0XA 2IJMA 3GUBA 1W98A 1XH5A 2BKZA 2OJJA 4GT3A 4B8LA 4QDVA 1JVPP 2R3FA 3AT3A 5HG7A 2QOBA 4RJ8A 4C3RA 4BIEA 2X2KA 5I9ZA 3QD0A 4TZRA 2X8IA 2WQMA 1G3NA 2WTIA 1GIHA 3MVJA 2PUIA 2PVKA 2XNOA 4HVGA 4W9XA 4DFNA 3LQ5A 1H08A 2RF9A 3PTGA 5I5ZA 5L8JA 1YDSE 1Y57A 3W2RA 3ZUTA 1PKGA 3NR9A 3LFSA 2UVXA 2BAQA 3IW5A 3UZPA 4JX3A 3D5UA 2GS2A 3R8PA 4BZNA 1XH9A 3DOGA 4GH2A 5FXQA 1ZMUA 2CJMA 3BZ3A 1YHVA 4NK9A 5BVKA 3FUPA 4BFMA 3NVMB 4EC8A 2WPAA 4RJ5A 4FTRA 2ZAZA 4X21A 3VBXA 3UE4A 2R3HA 4PDPA 1PJKA 2F7XE 3ZYAA 3RNYA 2XJ2A 3Q3BA 5L2WA 4EZ3A 3K3IA 3KXHA 5HI2A 3KY2A 3GP0A 3VS3A 3R02A 5K4JA 3KQ7A 3UOHA 2O2UA 4FA2A 1G8SA 3KRWA 3KK9A 1OL1A 4HGTA 2VAGA 2F4JA 3C4ZA 3DBDA 4D0XA 4D0WA 3F3UA 5EDRA 4WO5A 2B4SB 2HAKA 3BE9A 3QTSA 3DLSA 5C01A 3ZO2A 3RGFA 3M2WA 2W4JA 2UZEA 2C6TA 2IW9A 4BC6A 5DR9A 4ZTHA 2WQNA 4OTPA 1XBAA 4QP7A 2X4ZA 4NJ3A 3W33A 3C7QA 4DH5A 3DBQA 1UWHA 3PUPA 1Q4LA 4AGDA 5EQYA 2R3LA 4HJOA 3CLYA 4RMZA 3QTUA 4RVKA 3RWQA 3TTJA 4QYYA 2BALA 3CJFA 4CYJA 3G6GA 3KA0A 5FEEA 2IZSA 2C0TA 4LMUA 3VS0A 4YJSA 4LGHA 4M13A 4ZSGA 3QUEA 4LOOA 4HNIA 4JT3A 4YR8A 4QP3A 3G0EA 4FZ6A 4I5PA 3AOXA 3HA6A 4C37A 1MRUA 1Q5KA 3IO7A 4XG3A 2W17A 3F88A 4OBOA 5FLFA 3VIDA 1V0BA 4HVIA 5IA3A 2VO3A 4KBCA 2WTWA 4WNOA 3D7TA 1B38A 4G17A 4WG3A 3HAVA 4C58A 2FSLX 4DBXA 3WZUA 2JGZA 3CXWA 2UZDA 5LMKA 3QXOA 3R8VA 2P0CA 1H00A 1I09A 2I0EA 4XG7A 4GU9A 4O0TA 4ACCA 3TV6A 3LLAA 5CEQA 4EOPA 2X7OA 2QQ7A 2VNYA 2ZDTA 4IFGA 4F9WA 4ZZMA 5AMNA 5J95A 3IDPA 4YPSA 5BYZA 3D5XA 5DHJA 3R8ZA 3HV7A 4FT9A 4WSQA 3U51A 1OIRA 3VAPA 2QG7A 5AV2A 3GB2A 4PWNA 4YSMA 4ZP5A 5FEDA 4WNPA 3AT4A 4W8DA 3UDZA 3NS9A 4JX7A 1RW8A 4CT2A 3I81A 2VTLA 3SW7A 2JBOA 1BUHA 1YWNA 4G9RA 1JBPE 4MXOA 2F57A 3MVHA 3KIOC 2WOTA 4O4DA 4XG2A 3AGLA 4RX7A 4AZWA 2BMCA 5BMSA 3KCKA 1SMHA 5H8GA 3HDNA 4DEBA 4GFOA 2CGUA 4K18A 4EH4A 4IAAA 4FYNA 4LFIA 3PSDA 2ESMA 2ETKA 3GC7A 3UVRA 2YLFA 3BKBA 4CTBA 4FBXA 2Y4IB 2VWYA 5LMKC 4FV2A 2BROA 4D55A 3PVBA 5M4FA 4FODA 4F7LA 3DDQA 4RX9A 3UDSA 4DC2A 2V7AA 3N4UA 4NM7A 3JR1A 4IC8A 3LFFA 2J0KA 5KUPA 3V01A 3GU4A 1KE5A 4BDJA 4EUUA 3NRMA 3KXNA 5CAVA 3MA6A 4J98A 3UPZA 4I92A 3BL7A 4O7RA 3C4EA 5IEVA 1ZAOA 2C3JA 4LMNA 4HVHA 5CF8A 3C50A 3I1AA 4FE2A 2ZOQA 4TYJA 3KXZA 2UZWE 4Q9SA 4DEDA 4F9AA 2XYUA 3COIA 3MIAA 4MD9E 4O91A 4ENXA 2EXEA 4I5MA 3EQBA 4QMWA 4X3FB 4E4LA 5J9LA 3AKJA 3C0HA 4A9UA 5GINE 1PMUA 2G2HA 2VZ6A 3DA6A 1XBCA 4QO9A 3AC4A 4GEOA 4WG5A 1Z57A 4CVAA 3PP1A 2IZRA 5BUJA 4ID7A 1YW2A 1DI8A 2W5HA 1JSVA 5DWRA 4DDGA 2XIRA 2YIRA 1ZYLA 4G3CA 3ZDUA 3TMOA 1ATPE 4LL0A