2W99B

Crystal structure of cdk4 in complex with a d-type cyclin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
291
structure length
291
Chain Sequence
ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGEEGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALAPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords G1/S-SPECIFIC CYCLIN-D1
publication title Crystal Structure of Human Cdk4 in Complex with a D-Type Cyclin.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 291
sequence length 291
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2009-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2w99B02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2w99B01
3EQPA 1OI9A 5EHYA 2H9VA 3LOKA 2V55A 4ACHA 5C8MA 2J5EA 2OGVA 4AW0A 5M57A 1XKKA 3R8MA 3WI6A 3QC4A 3WF8A 2QI8A 4F64A 3HP5A 1TQIA 4J53A 4RVKA 1PW2A 3ORXA 3ET7A 4BDDA 3KVWA 3HAMA 4U41A 2ZM4A 4XV9A 3QTIA 4CGAA 3CCNA 4IB1A 4E20A 4J96A 3PJ3A 3NDMA 5H8BA 3GI3A 5IUIA 2J0JA 4QQJA 3R7YA 2QC6A 3RHKA 3ZFXA 3ZDIA 4K33A 5HG9A 1W0XC 5L2QA 4ZSGA 4OGRA 3ID6C 5GINE 3VS2A 3ZSHA 2QKRA 3QWJA 2QO2A 2UW3A 3EZRA 3SRVA 4EHEA 3HRFA 4FSZA 4IX5A 3RK5A 4CFNA 5TE0A 2W1CA 2ITVA 3EQGA 3DLSA 3K2LA 4GK3A 1IAHA 2W5AA 3O8UA 4DF3A 2ERKA 4ACGA 4PY1A 2JFMA 4ZSAA 5KUPA 2CPKE 3QTRA 3V51A 4JT3A 3R8LA 3FLWA 4TL0A 4OTIA 5GZ8A 5L6OA 3LCTA 5FTOA 2PULA 2GNLA 1OGUA 5KMOA 3NYXA 2J0LA 3FKNA 1W8CA 2V0DA 3A8WA 2PVNA 2XIZA 3E93A 3F5XA 5AV3A 4DFZE 3Q5ZA 3OG7A 2UVXA 4D58A 4E73A 3UO6A 4Z3VA 3UOLA 1OPLA 2WKMA 2OI4X 4JRVA 3QF9A 4BGHA 5A4CA 2HZNA 5J87A 5AAGA 3FLSA 2QOCA 3H4JA 5AUVA 5JKGA 3W18A 4GL9A 4QMYA 1BMKA 3HV7A 4OTWA 4AZVA 4M84A 4DEGA 1CMKE 4O21A 4BCPA 3PJ2A 4FKQA 1JSUA 1JVPP 1LEWA 2C5XA 2XH5A 3ORKA 3PVUA 4QP8A 3V5TA 5BMSA 2W96B 4NSTA 1FPUA 5M44A 5LXMA 5H8GA 1YXXA 4ZMFA 3BRBA 3KF7A 4FTOA 3LQ3A 4F6SA 1XH4A 2UZEA 4X3FB 2WIHA 4BYJA 1P2AA 2Y8OA 5AP7A 3R9DA 3KMUA 4DN5A 4Y83A 3PJ1A 5ANOA 3TL8A 3TJCA 1U46A 3DK6A 4H3PA 4HGSA 3VO3A 5K9IA 3V8SA 3FI3A 2OH4A 4QNYA 2RFEA 4QPMA 5ICPA 2JDVA 3ORIA 3I6WA 4TWNA 4LRMA 4FODA 3W2PA 5FRIA 2XF0A 4IJ9A 3H3CA 1WBVA 4H58A 2WEIA 4R8QA 3FQSA 5FWKK 3QRJA 3EQRA 2XK8A 4JAIA 3VAPA 3LJ2A 4X7QA 3CR0A 3HV6A 1FGIA 2R3RA 2EXEA 4KBAA 3DFCB 3RWPA 3ZRLA 5AIRA 2QNJA 3O7LD 3TIYA 4O1OA 4G16A 3UVPA 2J0IA 3ZFYA 2VWVA 1DM2A 3FY2A 3QCQA 4DHFA 1REJA 2PK9A 3L9NA 5HBJA 1J1CA 3HUBA 3R7VA 3MI9A 4PPCA 3QTQA 4E8AA 5LWMA 3RZFA 5FUTA 4GT3A 3L8SA 4ASDA 4IAZA 4EK8A 5CEKA 2JAVA 2PSQA 2QOHA 1BYGA 4XLIA 4BCQA 3NAYA 2R3JA 1OB3A 2QHMA 5AV2A 1U59A 1ATPE 2GQRA 3BLQA 5EG3A 4AP7A 3A7GA 4R7BA 3GBZA 2C0OA 2R3IA 2WAJA 3A4PA 3UP2A 3KU2A 5AUYA 4C58A 2XJ2A 3PWYA 4UZHA 2RFSA 1OPKA 1L8TA 4DT8A 4YJRA 3FI4A 4I20A 2O64A 3DDPA 2HIWA 3BHUA 3R2BA 4IDVA 3TACA 4NL0A 2XKEA 3NUSA 4FT3A 4RC2A 3F2NA 4EYMA 2O5KA 2QOQA 2CN8A 4NZWB 4HNFA 4NWMA 5T3QA 5C26A 5HU9A 5EW3A 3DKGA 4KS7A 4AQCA 3L8XA 4A7CA 4FEWA 2C3KA 4XP3A 3ZLSA 2PHKA 3FXWA 4RC4A 5AP6A 1JAMA 4BGGA 3EKKA 3UMXA 5EOBA 2XZSA 4ZZOA 5TF9A 3MFRA 4YR8A 1Z5MA 2PZIA 3W16A 1JNKA 4I4FA 2B9HA 2OU7A 5CLPA 1L3RE 4ID7A 4BDIA 3KCKA 2E9NA 1FVTA 4H3QA 1G8SA 3BU6A 3Q96A 4V01A 3T3VA 3HAVA 4U3ZA 4FEXA 2C69A 4PL3A 4ZZMA 4CEGA 4Y95A 2ZV2A 2VO6A 3F3TA 1Q24A 3LXPA 3P7AA 3SD0A 3CP9A 3D5VA 2BAQA 5EKOA 1V0BA 2B4SB 4C61A 3DV3A 3WARA 3QRKA 3HP2A 3ZEPA 1U5RA 2BRNA 2QURA 3ENHA 4II5A 4NIFB 2XCKA 3BE2A 2OBJA 1YWRA 2JBPA 3R2YA 4R5YA 4NYEA 4TW9A 4WG5A 2BVAA 3SKCA 3FZRA 3EIDA 4AGDA 4HVDA 5HE0A 3ULZA 5AUTA 2QR8A 4I1ZA 2PVRA 4AE6A 3W55A 5IA4A 3QYZA 4DFXE 3R71A 3ATSA 3DQWA 3R02A 3SG9A 5H3QA 1VYWA 2CKQA 1FQ1B 1Q8WA 3DTCA 3ZMMA 2XYNA 2OLCA 4NM7A 3G6HA 2OICA 2WTKC 3C13A 5CI6A 3R7OA 3H30A 3LQ8A 3VBYA 4AFJA 4EL9A 4EC9A 2IPXA 2C3JA 4HZRA 4IVCA 5E8ZA 4R77A 2W5BA 3MFTA 3PXKA 3DB6A 4Y5QA 3OROA 5KE0A 5HNIX 4BBFA 4EHVA 3MIYA 5I4NA 3RVGA 1PMEA 5EDPA 2ETKA 4S33A 5E8SA 4ASXA 4JDIA 3PUPA 3KRRA 4RIOA 3EKNA 2JKQA 1OKVA 3DGKA 3TNPC 2YIRA 5AA8A 2WOUA 3QFVA 1TVOA 5EI6A 3U9NA 4EOSA 4BR3A 1PXOA 4PTEA 5EFQA 3SVVA 2I0EA 3R00A 3C9WA 4FKGA 2GS2A 3R7GA 3RHXA 4MAOA 2JDOA 3RK9A 4AN2A 5L2IA 2RFDA 3I7BA 3POZA 4CKRA 4YHTA 2Y4IB 1T45A 1ZARA 3DK3A 3FE3A 3SRVB 4GKIA 4IB0A 4HJOA 4FKVA 4MXAA 4WSYA 4C02A 4E3CA 4XBRA 4AGWA 3QA0A 3LXKA 3D94A 3TZ7A 4BI2A 4C34A 4QT1A 4DGMA 2G15A 4DH5A 3KXHA 4LOQA 4P2KA 4M66A 3JPVA 4WSQA 5IEXA 3FSKA 4CYJA 4KSQA 5BX0A 2JDRA 5IU2A 5IQIA 2HXLA 3F2RA 3V5JA 5FBOA 4C33A 1H27A 3PA5A 2UZWE 3GVUA 4AS0A 3D7TA 2YABA 2XNBA 1CKPA 2GS6A 2CGVA 4GIHA 2WTWA 4NEUA 2QKWB 4PP9A 3GU8A 5DG5A 2IZSA 3EN7A 5AX9A 5DI1A 3R8UA 4P7EA 1BLXA 4EH9A 1W7HA 2FVDA 3B8QA 3DNDA 2EU9A 2ITUA 4KKEA 3OOGA 4RLLA 4WO5A 2QOFA 4JNWA 2CNVA 4I93A 5FTGA 2XIXA 3HNGA 4HZSA 4YLJA 3SGCA 2JGZA 3EQHA 2UVYA 3I60A 3ZH8A 2BDWA 2WMRA 4YSJA 3MY0A 4O0XA 2I40A 3FMDA 3WZEA 2ESMA 2ZV8A 4IAIA 1H1SA 4P4CA 3SDJA 3LAUA 5A6OA 4TPTA 3OVVA 3PE1A 4HCUA 1VZOA 1V1KA 5M4UA 3O2MA 2BRMA 2OO8X 4TWOA 5DOSA 5DYJA 5M09A 4ANLA 5AMNA 4FC0A 4GFGA 4IBMA 4E26A 2OZAA 2GNFA 2BDJA 3BWFA 5DRBA 5E8VA 5J1WA 3PIYA 5DN3A 3W1FA 3B2TA 4ZP5A 4EK5A 3GGFA 1WBOA 3CC6A 4K0YA 1I09A 4XYFA 1DS5A 1MQ4A 3OC1A 3AT4A 5GIPE 3BLHA 4M69B 3NNUA 4R7HA 3VUIA 5A6NA 5FDXA 3EN9A 4GH2A 5LWNA 4DA5A 4FMQA 4GU9A 5ANIA 2E9VA 2Y7JA 5JSMA 3KGAA 4IB5A 4K18A 3BPRA 4G6LA 4GVAA 2OFVA 2A19B 4TXCA 3OHTA 4FT7A 2GFCA 4QMMA 3BEAA 4WNOA 4QO9A 3S95A 3VBQA 3C51A 1MRUA 4V05A 4XCUA 3NPCA 3PXQA 5EM6A 3PG1A 4BHNA 3CTJA 3NMUF 4BTFA 4F4PA 1MUOA 5ANJA 4D9TA 4I0SA 4KKGA 5ACKA 4HYHA 5ACBC 3ORLA 1MRVA 1KSWA 1PHKA 3NW6A 4U3YA 4IM2A 4Q9ZA 4Z16A 3TZ9A 5A4EA 5GIOE 3FEGA 5AR5A 4DFYA 3OW3A 2X4FA 4CMOA 4IX3A 3HLLA 4QTDA 1ZMWA 3KY2A 3G51A 2J90A 4KD1A 3ZONA 1YOMA 2PZRA 4HGEA 4XX9A 1VEBA 3TDVA 4FKOA 4M7IA 2GHGA 4MQ1A 2XK6A 1Q8ZA 1ZMUA 2C0IA 4G3GA 4RFMA 1P4OA 5CF4A 3OXZA 4DFBA 3Q6UA 4KWPA 5IQBA 3CQWA 3C1XA 3FMHA 3O8TA 4BDJA 4EH3A 2QLQA 2C47A 2XA4A 3DY7A 2EUFB 3IOPA 3QQKA 3FZ1A 4M69A 5HZNA 4RX5A 3UOJA 3F5GA 4Q2AA 4YJQA 2YLFA 4O7WA 2BPMA 3VNTA 1H0WA 3MBLA 3ZZWA 3S2PA 4YZCA 3DA6A 4RWJA 3RINA 2HK5A 2Z7RA 2OXDA 4L9IA 4CT1A 2W06A 5LMAA 3DBCA 2IJMA 1UU3A 3OWLA 4M13A 4QMTA 2C68A 2YCFA 4YHFA 2YM6A 3G15A 4HVGA 5JRSA 4C4HA 4IWOA 5FM2A 3UO4A 4FG9A 1H1RA 2W7XA 4LFIA 4A9UA 4W4XA 5K4IA 1MRYA 3EHAA 5F1ZA 4FL3A 3RI1A 4F1MA 4TWPA 4AOJA 3MA6A 2XJ0A 5DRDA 1SZMA 1YDTE 2BIYA 3PY1A 4RJ8A 4YHJA 1LUFA 5EDRA 2EWAA 5AUXA 5KMNA 4FEUA 1XWSA 3P7BA 2R3QA 3LJ0A 4I6BA 3ZS5A 5A4QA 2W17A 2VU3A 4FVPA 4RVMA 3ORMA 4EONA 5HLNA 1YXSA 4R5SA 4TTHB 5CSHA 4CG8A 4F9WA 4FSQA 5L3AA 3GENA 4QP1A 1TKIA 4FUXA 4CLJA 1SVEA 3E92A 1CM8A 2H8HA 4L3PA 5JEBA 4BCIA 2PL0A 3RPVA 4F65A 2J6MA 2XKDA 2QHNA 4HCVA 5E8WA 2X2LA 4EUUA 3ZHPC 2ZMDA 4LRJA 3FWQA 4XRJA 3R8PA 5CALA 3U54A 2ZB1A 1YHVA 2X0GA 3ORPA 3IKAA 4ZAUA 4J8MA 4O7TA 1S9JA 4QMUA 4P90A 5I9VA 3V6SA 3S4QA 5M08A 4IE9A 5J8IA 5F95A 1M7NA 1OKYA 2DYLA 3COMA 3E8CA 2WTJA 1MP8A 4YGAA 3PZHA 3ODYX 5EOLA 3ACKA 2YM8A 4XV3A 5E8TA 5HIDA 4CFFA 5HD4A 1OKZA 1WVXA 4YC3A 3QTUA 5CWZA 3UMWA 1YWVA 3WF6A 3BEGA 4MEDA 3SW7A 2FSTX 2VTSA 4FV4A 3RAWA 4F1OA 3GQIA 5C1QB 4DG2E 2PE0A 5FEDA 3PTGA 3TKIA 4RJ6A 4EH4A 1F5QA 4JQEA 2PYWA 4FSNA 4JX7A 5ETAA 5CANA 3FUPA 3TZMA 4C2VA 2V22A 3LFSA 4IZAA 2W99B 4CMTA 1KWPA 4Z9LA 3IW6A 4I5PA 4E4MA 5HIEA 4FK6A 3AC8A 3D14A 4MBJA 5AUZA 4B9DA 5KMKA 4O0UA 4BL1A 3O96A 2WQEA 4EBWA 3UZRA 1XH9A 4FSTA 3R04A 2GSFA 3R1NA 4YU2A 5J9YA 4EZ7A 3OW4A 4IIRA 3R83A 3UNJA 2C1AA 3CXWA 4NCTC 2EVAA 3HKOA 3NSZA 1AD5A 4MXXA 4ASEA 2R3OA 2YN8A 2JKKA 4IC7A 3TNWA 3OS3A 4O6EA 3AD6A 3CIKA 2WTIA 4C0TA 2UW6A 2BRGA 4YMJA 4D2RA 5LJJA 5K0KA 3GCVA 4D2SA 3D7TB 2G2IA 3CJFA 3NS9A 1QPEA 4X3FA 4EH8A 5HX6A 5J5TA 5CQUA 2BROA 2PVLA 1FVRA 4NTTA 5CX9A 4UN0C 2VTQA 5BNJA 4BCMA 3CPBA 4FV7A 3POOA 4E6QA 5J9ZA 4FIGA 1UWJA 5IQGA 5K0XA 3E7VA 3E62A 3GCQA 4MX9A 4C3FA 5BVNA 5L4QA 3R1YA 4I5MA 3WIGA 5IMEA 2RGPA 3I1AA 5M4CA 1WBTA 4XNEA 3TTIA 3DOGA 4G34A 1R1WA 4MNEB 5EM8A 3V5QA 4DINA 5LVOA 1OBGA 3R7EA 3UOKA 2BFXA 4D4SA 2C5OA 4USDA 4FT0A 4MHAA 3NWWA 5AP1A 4EJNA 4CRSA 2ITQA 1H00A 4MH7A 2WMBA 5TKDA 5G1XA 3V5LA 1NT2A 2W9ZB 2W1IA 5CT0A 4GT4A 3UTOA 3WILA 4BBEA 3QBNA 4ALWA 3UIUA 5IQAA 4N6ZA 3A7IA 4RJ4A 3UIBA 5E90A 3DLZA 3K5UA 5CVGA 3GQLA 4CQGA 1REKA 3WZUA 4ALUA 1H24A 3NIEA 3V3VA 3VF8A 4F9AA 1R3CA 3D83A 4OT6A 4DFLA 3VBWA 4BWPA 1JKTA 3BCEA 4Q5HA 4UWYA 4W9WA 3AC4A 4WNMA 4IFCA 4M8TA 4CTCA 4YLKA 4X3JA 2YERA 4BCKA 2W1HA 1IA8A 4X2FA 3MPAA 2GHLA 3I7CA 2XKFA 3MH2A 4ANSA 2JIIA 4FEQA 2WMTA 5CSVA 4WRSA 5L8JA 3P79A 4QQ5A 5M56A 3RCDA 5KMLA 5IA3A 2X2KA 3LVPA 3QQUA 2GHMA 4ZK5A 2YAAA 3SXSA 2HZ0A 4UMQA 4F0FA 4OTFA 2I0HA 2IW9A 3S0OA 4BKYA 3VUHA 3K3JA 4GRBA 4C4EA 4EHGA 3LE6A 2JDTA 3E8DA 3FZSA 3GP0A 2F49A 2CJMA 3MFSA 3FMLA 2C6OA 4FBXA 3O23A 2VUWA 5CXZA 4IAFA 4MBIA 4TZRA 1WCCA 4L45A 4DGNA 4MK0A 3AC1A 1H07A 4HPTE 2P0CA 3OCGA 3QC9A 1O9UA 3C0IA 5E8XA 3MH3A 4O91A 2C6DA 2FYSA 3W33A 3SXFA 5HE3A 3MJ1A 3VVHA 2ACXA 4L00A 3FY0A 1WMKA 3QTXA 5IQCA 4GJ3A 1UWHA 5BYLA 4U81A 4YZNA 5HD7A 3RAHA 5CF6A 1M52A 2F57A 1JKKA 4XG2A 4FI1A 3VW6A 4OTHA 4A07A 4AA0A 4GW8A 1M14A 4BIBA 2VTIA 4ANMA 2XNPA 2B0QA 1YXUA 4RC3A 4IANA 1YI4A 5EM5A 4DC2A 5CAPA 3N4TA 3BELA 2CKPA 5DT3A 3L8VA 3A8XA 2OWBA 4YSMA 3NRMA 4L6QA 1XBCA 1GNGA 4JLCA 2BUJA 3C5IA 4N4SA 3NLBA 4NIFA 3L1SA 5IQFA 1YOLA 3GB2A 4GU6A 4TYJA 4IWDA 1V0PA 2RKUA 2YLEA 3FXZA 3P0MA 5C9CA 1CSNA 2BKZA 2C1BA 3PVWA 2VO7A 4R3CA 2C6EA 2GNHA 2PVMA 4WT6A 1ND4A 3BYUA 4JJRA 1H28A 4EOIA 1OIYA 5E1SA 2B54A 2OK1A 3W32A 3OUNB 4F0GA 5FDPA 4CFMA 3CJGA 5HHWA 3NAXA 3Q9WA 4MNFA 1MQBA 3ORZA 4LL5A 4YP8A 2X39A 3JXWA 1Y91A 3ZM9A 3EH9A 4ZJVA 5HTCA 2ERZE 1FOTA 1YKRA 3QTSA 4C8BA 5CAUA 4RZVA 3F7WA 1LPUA 3P86A 2O0UA 4X0MA 3GC0A 4HYIA 5CAVA 5HG8A 2RSVA 2UZOA 2CNUA 1UNGA 1X8BA 3KMMA 3QKKA 3MIAA 4UXQA 4IDTA 3EFJA 3MTFA 3TNIA 4YJNA 3NYOA 3TKUA 3EB0A 2XKCA 2ITWA 4J52A 4YBKA 3TIZA 3IW4A 4FNZA 3H9OA 4RJ3A 3QCYA 3AMYA 3UO5A 4BCJA 4EQUA 4R1VA 4AZFA 5IDPA 3ACJA 4G17A 4DEBA 5LMKC 1H0VA 4DBNA 1Q62A 3QQJA 5IKWA 4UYNA 2HCKA 2FA2A 3F3VA 3QALE 4LV5A 4S30A 1J3HA 4A9RA 4RVTA 4O82A 3QD3A 1A48A 1O6YA 5FP6A 2PPQA 5CEIA 4FV9A 3R22A 3QGWA 4M0ZA 3ZEWA 3QQGA 1GAGA 1SMHA 2J50A 3LIJA 3ROYA 5AR2A 4EEVA 5IDNA 4MXZA 2VWYA 2EXCX 4R7IA 1UNHA 2QOOA 4BTMA 3BV2A 4D9UA 3F88A 2WQNA 3DQXA 3A62A 3OCSA 4JR3A 4M3QA 2P4IA 4WA9A 2VTOA 2X7GA 2G9XA 4K1BA 5C8NA 4WNPA 2JBOA 2UZTA 4EHZA 3RM7A 1FINA 1K2PA 4IAAA 4D4RA 4YJSA 5K5XA 2W9FB 4JOAA 4ZSJA 3V8WA 4BCHA 3NYNA 2GCDA 3FZPA 2OXYA 3FBVA 3OD6X 3Q4CA 2V5QA 4M68A 1FBNA 3N4VA 3OEFX 4IWQA 1YVJA 3D7ZA 1OIRA 4HVIA 1ZYSA 5BMMA 3TTJA 4O38A 3ZTXA 5AUUA 4U40A 4MD9E 2XM9A 4MXYA 4S34A 4TYGA 3PWDA 1URCA 3O71A 4FTLA 3Q2MA 4EWQA 3P4KA 3VJNA 3ZO1A 3HMIA 4WD5A 5E91A 3R7IA 3AXWA 2YISA 3RTPA 5L2SA 2JKMA 5EYMA 2O65A 3P23A 4B8LA 4LUDA 4ANOA 3HRBA 4L42A 5E9EA 5AEPA 2WMVA 3KXNA 4ZTRA 5IPJA 2UV2A 4L67A 2ZV9A 4CQEA 4FUYA 4TRLA 4ZZNA 5IQHA 1YDRE 2XK9A 2JIUA 2YIQA 3HECA 3MH1A 3R1SA 4YZDA 5IA2A 4X6QC 1XH6A 1YXVA 4TNDA 2UZBA 3BI6A 2ZYBA 3DKFA 3JUHA 2REIA 2UZUE 3IW8A 2B7AA 3MWUA 3FXXA 3CKWA 1GIHA 2OH0E 4GUEA 2CGUA 5BVOA 2W4OA 2PUIA 2X9FA 4H1JA 4KIQA 5L8LA 4UV0A 5F94A 3I5ZA 5I0BA 3D9VA 3CGFA 2WXVA 2PMOX 5BUEA 1Q8TA 2PZ5A 4I6QA 4G5PA 3IECA 4G31A 3RWQA 3UG2A 4OTPA 5JQ8A 4GG5A 4EZ5A 4ASZA 3MVMA 4K8AA 4YC6A 3HMMA 2G01A 1KV2A 1NY3A 2J0KA 4UY9A 5HCZA 5HU3A 1AQ1A 3KXXA 3QQHA 5FEEA 2R3LA 4C4IA 5AA9A 4MVFA 2R7BA 3ZUUA 2VWBA 4PDPA 4USEA 4W4WA 1V0OA 2PUPA 4PMMA 4DEEA 4UMRA 4I3ZA 2BRHA 3CY3A 3FPMA 1PYEA 2J51A 4GMYA 1ZY4A 3R8ZA 4OUCA 3F3ZA 4KUJA 1QPJA 1TQMA 5B7VA 4V04A 5KMJA 3EQCA 2Q0NA 5J5SA 4L7SA 1OUYA 4EH6A 3FKLA 3OZ6A 4FSYA 1XJDA 4C35A 1BL6A 4BDAA 3DKOA 1B38A 2DQ7X 5F9EA 2XJ1A 3BU5A 1P5EA 4AUAA 3I6UA 1UKIA 1ZYLA 2XRWA 4BI1A 5IF1A 3VN9A 4IACA 2Z2WA 4H39A 4FNWA 4BC6A 1G8AA 3AT3A 3E64A 3COKA 1Q5KA 4F7SA 4CZTA 5HG5A 5FEQA 3GFWA 4AT4A 3LCOA 2C6KA 3UQCA 4MCVA 5CTPA 3W2OA 3RAIA 3ZXZA 5HTIA 4ZY4A 4UWBA 5BYZA 3HDMA 3Q60A 2R9SA 3MW1A 3GOKA 3SQQA 4EK3A 2O8YA 4GS6A 4FA2A 5HLWA 2OJFE 2V7AA 5JMSA 4FZDB 4QPAA 5IISA 4I41A 4B8MA 2QVSE 4QP7A 3HRCA 4FTRA 4KB8A 4DGLC 1PMVA 3GC8A 3DBDA 2YM4A 3PA4A 3VULA 4FOBA 5CVFA 1KE9A 3A60A 2YM5A 4E6CA 1IAJA 2Z7SA 3QYWA 1VR2A 3G90X 3NCZA 4B99A 5D41A 2GU8A 4FKPA 4QMVA 2X4ZA 4NW5A 3R63A 4CKIA 2BHEA 3BGPA 4W8EA 2IW6A 4O7NA 2YHVA 1H8FA 3G9NA 1GOLA 3NGAA 4C38A 3P78A 4I23A 3UGCA 4LV8A 4PDOA 3LM5A 3PZEA 4K6ZA 3F69A 2FSOX 2WQMA 4YO4A 4YBJA 5CZHA 2XNEA 1QL6A 4FTIA 5CEQA 3VUDA 4MD8E 5M4IA 5BVFA 3I79A 1ZYDA 3A99A 1R0PA 4OLIA 5JT2A 3U55A 5EKNA 1M17A 3ORTA 4FK3A 1H1PA 1KV1A 4U80A 3MFUA 3ORNA 4D2VA 5KMIA 2IWIA 3BZ3A 4OBQA 3W8LA 4DTAA 4DTBA 3Q4ZA 5JFWA 4LMUA 3MY1A 2PVYA 4S32A 2P33A 3P9JA 1WAKA 4HPUE 3WZKA 3NIZA 3L9PA 3ERKA 4KS8A 2Q83A 4MXCA 4PDSA 4D1ZA 2QU6A 3D5XA 3TCPA 3LJ1A 4XRLA 4C59A 5J1VA 4O2ZA 4BY9E 4CRLA 3IG7A 4XJ0A 4JDHA 1PXMA 4F63A 3R8VA 2W1GA 3GU5A 3PVGA 5E4HA 2WFYA 2AYPA 4O81A 4EQMA 2ZM1A 3AGLA 5DIAA 3II5A 4OR5A 4ARKA 4ZTMA 3HA8A 2SRCA 3CPCA 5B2MA 1Q61A 4UXLA 3P1AA 3IDPA 4V0GB 1U5QA 3ZCLA 3TUDA 1ZY5A 2RL5A 3M42A 1OM1A 4RRVA 3V5PA 4BGQA 4Q9SA 3ULIA 4BVUA 1KOBA 1ZMVA 3EQDA 5FXQA 3QCXA 5CXHA 4RLKA 3RZBA 1PYXA 4D5KA 4FT5A 2QG7A 4IEBA 4ZSEA 4Y5HA 5LCJA 2C3IB 3C7QA 4NK9A 4M14A 3VHEA 4MQ2A 5I9ZA 5M07A 3IONA 1WBWA 1YQJA 2C30A 2F7EE 5AP5A 4YZMA 3VS6A 2XP2A 1PMUA 1YI3A 4ZMEA 1S9IA 3A7FA 3CQUA 3F5PA 2ITZA 3G0FA 3G6GA 5LCKA 4DLJA 2BAKA 1J7UA 1LEZA 2R5TA 3CE3A 3AMAA 3AD4A 1GJOA 1XR1A 3OEZA 5HO8A 1ZLTA 2P2IA 4O86A 4FX3A 1J1BA 1IG1A 2OSCA 1Y8YA 4XUFA 3PIZA 4EOMA 2R0UA 4FSWA 4J99A 3AOXA 3BIZA 4F99A 1PXKA 2ETRA 4BZOA 4PL4A 4K77A 5CNNA 4EK4A 2GNIA 3JVSA 2C5NA 3KXMA 3OBGA 2Y6OA 3TUBA 3TNHA 1PXJA 2OZOA 1Z57A 2C6IA 3AD5A 4MNEA 4R78A 3R9NA 1UU9A 2PZPA 2WTVA 4GJ2A 4RX8A 3BQCA 4F70A 4CFVA 2GFSA 4XOZA 1ZYJA 4RQKA 5HGIA 3IGOA 5I3OA 3VUGA 4APCA 1F0QA 4JG8A 2PWLA 5TO8A 3OTVA 2B55A 3GU6A 5HCYA 4AGUA 1OL6A 2IVUA 2J2IB 4ZTNA 2F2CB 4FZFB 4C36A 3I0QA 4PP7A 4UZDA 3ZSIA 2ETMA 1H1WA 5CEMA 4MWIA 3UBDA 2VN9A 4YJPA 3FZOA 5ANGA 3DFAA 5T68A 4RX7A 3Q6WA 4LGGA 1BUHA 5IA5A 1Q3WA 3MPMA 3Q32A 3FC1X 4YTCA 5I9YA 4ANBA 3FKOA 3BHVA 4C4JA 3C4CA 1UU8A 3FHIA 1SVGA 4IWPA 1WBNA 2XIKA 3KEXA 3QUEA 3I81A 3TV7A 4J95A 3VWAA 5L6PA 3MV5A 4I24A 5BUJA 2NO3A 4ZXTA 5EM7A 4Y85A 3R9OA 3QWKA 5FM3A 5M06A 3MA3A 3DJ5A 4CCBA 5CYIA 5EHLA 3IDBA 1UU7A 2RG5A 3BYSA 4IJPA 5CU0A 2ZMCA 2CHLA 1B39A 1J91A 1P4FA 2QU5A 3NR9A 3M2WA 4CZYB 3BU3A 4RWKA 1DAWA 2UW8A 3JYAA 3PPJA 1OL5A 4M67A 4FZAB 4CV8A 1BX6A 2EXMA 3QQLA 3IW7A 4BB4A 3LCSA 2YIXA 1OPJA 2X1NA 2QODA 3VRZA 4TYEA 3S1HA 4ZTSA 3CSVA 3KL8A 5CF5A 5D11A 5IEVA 4IH8A 4AW1A 3FI8A 4RZWA 4DGGA 1STCE 4HVHA 1Q3DA 3TT0A 4UB7A 4ZS4A 5HKMA 3PLAE 4M12A 1ZXEA 5JZJA 3QRTA 1YW2A 1KE7A 3IDCA 4RFZA 4JS8A 3WE4A 5E8UA 3FC2A 4F9CA 2CSNA 4KABA 2C5VA 3SOAA 3E7OA 1OL7A 4S31A 3V6RA 3HMOA 4IAYA 3ZO2A 4D55A 5DMZA 2ZDUA 4KAOA 2BDFA 4I94A 3BYOA 4IHPA 1A06A 1IA9A 2VTTA 3A61A 3DAKA 2GTMA 3WOWA 4JBOA 3BGQA 3SXRA 3UIMA 4YURA 3AC5A 5FQDC 4C62A 4MXOA 5BQ0A 1Y6AA 3E5AA 3W2QA 3DNEA 3V5WA 4TT7A 3Q9YA 2YWPA 4ANNA 3T8OA 3M11A 4FG7A 4E93A 4QTCA 4AE9A 4DLIA 4LRKA 4EH5A 1NW1A 4IZYA 3U6IA 3ALOA 2ZDTA 2C6TA 1FVVA 3QRUA 5B0XA 4AW2A 1U54B 3QKLA 3MYGA 2J0MB 3D15A 4DG3E 4CFUA 1XHAA 2XM8A 3AG9A 4X2JA 3U9CA 3HL7A 4OTGA 5CNOA 3UJGA 3V04A 5E8YA 5CVHA 2C3LA 2E9UA 2UVZA 4DFNA 3G9LX 4RJ5A 2WTKB 4P5ZA 5DR2A 2ZOQA 4JR7A 4RIWB 2I6LA 4U0IA 5CU4A 1NVRA 3MVJA 5D10A 4YTIA 4DCEA 4O83A 2A0CX 3QLGA 4ORKA 4L3LA 3NYVA 3DB8A 1PF8A 1JSVA 4X6RA 4O6LA 2OFUA 1DI9A 5M53A 4I6HA 4QP6A 1F3MC 2BALA 2KTYA 2YM3A 1W98A 3LLTA 4DEIA 4EOPA 3Q5IA 5CF8A 1BI7A 1CKJA 5AP0A 1W82A 4A4OA 3CD8A 3EQFA 2W1DA 2O63A 4L53A 3WF9A 1VYZA 1H4LA 3KXZA 3QUDA 2IZTA 1ZYCA 2HZ4A 2WQBA 5AR3A 3NUAA 4GIIA 4FYOA 4ZJIA 4NKSA 4F6UA 4JG6A 2J9MA 3ZFMA 5HIBA 4NCTA 2KULA 3NVMB 3TNQB 3ZBXA 3GC7A 3JVRA 4JDJA 2PVJA 4LQMA 4UEUA 3ZM4A 4BICA 4I22A 3P7CA 4IB3A 4PTCA 3UYTA 5AAEA 5EYDA 4OBOA 3RPOA 4E5AX 3EMGA 3QQFA 3NUNA 4G1WA 1R78A 4RVLA 1PXLA 3ZLWA 4D0XA 3ENMA 3TM0A 4BRXA 4BTJA 2YITA 4K11A 3UODA 5KHXA 2B53A 4F7JA 1UV5A 5HESA 5JFXA 2WU6A 3VS4A 5LOHA 4FSRA 2C6LA 5HO7A 4H3BA 5D7AA 1Y8GA 2NPQA 4ZOGA 4DH3A 4ERKA 4FTCA 5AX3A 1VJYA 3RPRA 5AFVA 2YIYA 1SNXA 1OL2A 4QP2A 3IK3A 5F20A 4KKHA 5CASA 2G2HA 5JH6A 2EB2A 3D0EA 4WG3A 2VTMA 3ZU7A 4F7LA 1BL7A 3F9NA 5AADA 4XG6A 4YPSA 5KBQA 3FI2A 3GOPA 3Q04A 4G6NA 4MYGA 1M2RA 4YPDA 1SYKA 4XLVA 3EQIA 4TWCA 2I1MA 3KREA 4HNIA 4XV1A 4WNKA 5CQWA 4GT5A 3E8NA 5AP2A 1PXIA 2R64A 4FGBA 2B52A 2FSMX 4B0GA 4X2KA 3QU0A 5KZIA 4BDHA 3NNVA 2RF9A 4FTUA 4G3DA 5HLPA 2CCHA 2YEXA 1LR4A 5TR6A 2ZAZA 3WZDA 3E87A 3DK7A 4DT9A 4TYHA 2HYYA 2NNWB 3BGZA 3A7JA 5BVDA 5KMMA 2V7OA 4UMUA 3SA0A 3RJCA 1GZOA 1PKDA 2HW7A 2NRYA 2VWIA 4MWHA 5DE2A 3D5WA 5JGDA 2BZJA 3Q4UA 4GK4A 3QAME 4I5CA 1QMZA 2HOGA 2QD9A 2XNGA 3QL8A 4RJ7A 4RX9A 4FTMA 4JIAA 3EFKA 4GEOA 1E9HA 3PPKA 5C03A 4GFMA 4B7TA 2DS1A 4FV5A 3VJOA 4EOKA 1KE8A 3KK9A 3VS0A 2UW5A 2E9OA 2R3HA 3H10A 4QYFA 4U43A 3KK8A 4C2WA 1JKSA 3FDNA 3KRWA 4X21A 4IXPA 4RGJA 4RIXB 2W0JA 3SHEA 3MN3A 4TNBA 4FKTA 1M2PA 4B4LA 4BFMA 1GZKA 5AAFA 4GYGA 3TN8A 2WMWA 2UW4A 2WD1A 4XHKB 5DFPA 3QGYA 5C4KA 4U44A 3FJQE 5DEYA 2I0YA 4FZ7A 4RA5A 4E1ZA 3BHHA 4LI5A 2CKEA 4QQCA 5IA0A 5KBRA 5KCVA 3HMPA 1G3NA 1Q97A 5AP4A 2IZUA 2ZM3A 4ZLZA 4O7YA 3OXTA 5H8EA 5IEYA 4FL1A 4O7SA 3PSBA 4WG4A 3MGYA 5A9UA 4KRDA 3R0TA 4PL5A 4BDGA 1RW8A 4FTKA 4OW8A 4D2PA 4FKSA 1PY5A 1CDKA 4B6LA 3NNWA 2X8IA 3ANRA 2HELA 3QA8A 4G5JA 4IM0A 4QMNA 2F2UA 3B8RA 3PVBA 3T9TA 2YZAA 5L2TA 5CU6A 4J97A 3VQUA 2Y9QA 4CLIA 3BE9A 4ACCA 4FVQA 2B9JA 4QTBA 4O7RA 4LL0A 4ENXA 5AM7A 2GQSA 5JGAA 3QZHA 1NA7A 5CSXA 3VRYA 3NNXA 4ITIA 2X8EA 3DXPA 4HGLA 3M1SA 3WF5A 4BDBA 3G0EA 4E6DA 3ZUVA 4WRGA 5CEPA 5IG1A 3DBEA 3LZBA 2VTAA 3CY2A 5BVKA 3BBWA 3D2KA 5CAOA 3U4WA 4PNKA 5LVMA 3KCFA 4U7ZA 5AWMA 3TXOA 2VAGA 5AUWA 3PE2A 3R1QA 4KSPA 1RJBA 2X81A 2BKKA 3FYJX 1IEPA 3ZO3A 4A9SA 4Z55A 2JD5A 2IVTA 4EK6A 5CZIA 5GZ9A 4NU1A 3K54A 4BCNA 3FLZA 2PMIA 3VUMA 1FGKA 4F9YA 5C8KA 4EI4A 5HQ0A 4HOKA 2DUVA 4JAJA 1R0EA 4QMPA 4R1YA 3D2IA 3WE8A 5D7VA 3R28A 5DGZA 4ZTQA 5FG8A 3QTZA 3L9LA 4U42A 5HORA 3OT8A 3W2SA 4O0SA 1RDQE 1XBAA 2BMCA 3OBJA 3CD3A 4EC8A 3PDTA 2GNJA 4OTRA 3VUTA 2BTSA 3VW8A 2X9EA 4RT7A 5GNKA 3QLFA 4FTJA 5BVWA 3LMGA 5KZ0A 3PRIA 3Q4TA 1JWHA 4C4GA 4FTQA 4OTDA 4Y8DA 5L2WA 4J7BA 5KX8A 4BCFA 2JKOA 3Q9XA 3VF9A 5IH4A 4FKRA 4FSUA 5JFSA 1KE6A 4G9RA 5EW8A 2A2AA 3DAEA 2YACA 3PA3A 4AZEA 4WOVA 3QKMA 2VTHA 4FE2A 4RPVA 2WMSA 5LMKA 4JX3A 3HEGA 4Z7HA 4XS2A 4PPAA 4JBQA 5HE2A 1H26A 5ETCA 3BLRA 2BILB 3MSSA 3U6JA 4JG7A 4Y46A 3DZOA 5J7HA 2HWPA 5JGBA 2QG5A 3LHJA 2C5YA 3FLYA 4FV6A 3IW5A 5DT4A 3TI1A 4I4EA 4AAAA 4OAUC 2YWVA 4AOIA 4NFMA 2CGWA 3P5KA 3FSFA 4RIYB 4C37A 4XEYA 4EH7A 3H9RA 4A4LA 4V0GA 4WBBB 2JEDA 4AT3A 3IQ7A 4ZLOA 2CN5A 3N51A 3E8EA 5GJDA 4FZ6A 1OITA 2QQ7A 2BZHB 4XP0A 5HICA 4HCTA 2VGOA 3ZYAA 5E1EA 4U45A 4CVAA 1OIUA 2X7FA 4OBPA 4QP4A 3KVXA 3COHA 4ITHA 4LGHA 2VX3A 4F6WA 4APPA 3TWJA 3PY3A 3WYXA 3FMKA 4XG8A 3RALA 4YJTA 5HVKA 2G1TA 2VWXA 5HI2A 4O0RA 3D5UA 3QZFA 3EN6A 1ZWSA 3C4EA 3OXIA 2YAKA 5CI7A 4ALVA 4DCAA 3MDYA 4N0SA 4IX6A 1EH4A 3JS2A 3VC4A 3QXOA 4C4FA 2ITYA 1YRPA 4IVAA 3W10A 4IW0A 3GCPA 2OF4A 4BZNA 1O6LA 1XH5A 2QO7A 4C57A 2OJJA 5B2LA 4O27B 3HX4A 1YHWA 3CTHA 5D9HA 4BCGA 3OMVA 4DEHA 1BKXA 1Q99A 2C4GA 3RNIA 1GIJA 4AX8A 4C3RA 3NZ0A 2VO0A 1SM2A 5ITAA 4NTSA 5IUHA 2Q0BA 2F7ZE 4RBLA 3QD2B 4RMZA 3EFLA 3MPTA 3FPQA 4W8DA 4LYNA 2OIQA 3PYYA 3PG3A 1WBPA 2Y4IC 4FL2A 3KFAA 4L8MA 5I9WA 1WVWA 5CY3A 5HBHA 2W4KA 3F3UA 3LCDA 3PXYA 2CMWA 4FV1A 2JFLA 3G33A 4KNBA 3O50A 1XH7A 3RK7A 3EN4A 2GDOA 2YJSA 4IVDA 5HCXA 2BR1A 2OIBA 4RG0A 4EOJA 4EH2A 1KOAA 5HO6A 4NT4A 3H0ZA 3NEWA 2XK3A 3ZLYA 5AV4A 3UG1A 2WIPA 3IS5A 5ANEA 4UMPA 1AGWA 4A06A 5EI2A 5BUIA 3R01A 3NW7A 5IZFA 2XK7A 2R7IA 4D0WA 4EOOA 4KINA 5J79A 1OKWA 3ZLXA 1PJKA 2R0IA 3FMJA 3KRXA 5GJGA 3RP9A 4EUTA 2GS7A 2QOIA 4I21A 4UX9A 4E5BA 4EWHA 4TYHB 4D5HA 4W4VA 5L8KA 1YI6A 2BZKB 4FGRA 3SAYA 4ZTHA 4GK2A 3QZIA 2X2MA 4YUQA 5CSPA 3KRJA 3BYVA 4XV2A 3A2CA 3DXQA 3FL4A 3Q3BA 2AC5A 1ZOEA 2CDZA 4BN1A 4TYIA 4O0WA 4HYUA 5M55A 3CEKA 4WIHA 1SNUA 3PSDA 5DEWA 4DH1A 2ITOA 3HVCA 2JDSA 3I4BA 2BIKB 4IMYA 5HG7A 3S3IA 4BBMA 1CKIA 1W83A 1CTPE 3N4UA 3AMBA 3WF7A 5IQDA 4FV0A 3OCBA 3PFQA 4UBAA 3OTUA 2FO0A 3CBLA 2E2BA 3IO7A 2Z7QA 2YZLA 4DEAA 5EQEA 4RFYA 2XK4A 2YM7A 4L3JA 3N9XA 4BWKA 2R3FA 3QHRA 4NUSA 5GHVA 5CENA 2Z60A 4QTEA 3KA0A 3LKMA 2JLDA 4XG9A 1G5SA 2HXQA 3RMFA 3UIXA 3ANQA 3D4QA 4K9YA 4DITA 3FV8A 1URWA 1JOWB 2VTRA 3DCVA 3LCKA 2XNNA 4OT5A 5J95A 4U8ZA 5KNJA 3PIXA 3FL5A 5EQYA 2VNWA 4BIEA 2PY3A 2Z02A 2OJIA 4BIDA 3LXLA 2FUMA 1QCFA 2UZNA 3U8WA 3PXZA 4JVGA 5LARA 1E1XA 3FYKX 2VTLA 3FHRA 5FTQA 3WIKA 3EYHA 1ZOHA 4FSMA 2FH9A 3HV4A 1OZ1A 2J7TA 5TOZA 3C0HA 4QP9A 3F5UA 5B2KA 4AF3A 3O0GA 5K5NA 2CCIA 2P2HA 2ZJWA 4LOPA 3UNZA 3U4UA 3VS7A 3UZTA 2W1FA 5C4LA 2WQOA 3HUCA 4QOXA 1XO2B 1ZZ2A 3MY5A 3F61A 4LGDA 3FQEA 4G3CA 3FMMA 4W4YA 5AV0A 5FD2A 4H05A 4ZSLA 2CNQA 2QONA 2PVHA 4WUAA 3VS3A 4QTAA 3OWKA 3QZGA 1J7IA 4NKAA 5TT7A 4E4NA 4GUBA 2RFNA 3UVRA 4CZUA 2H96A 4XP2A 1XH8A 3MB6A 4JIKA 3H9FA 3W8QA 2W5HA 4JQ7A 4LG4A 5CS6A 3Q2JA 1M7QA 5H2UA 1U54A 4IVBA 5EYKA 4L7FA 3BKBA 2WHBA 4X2GA 2IVVA 4FIEA 4P5QA 5AR4A 3TUCA 1OMWA 3LFCA 3EL8A 1Q8YA 1RE8A 3R6XA 3F6XA 1UVRA 2R3MA 3LPBA 3F2AA 4QP3A 3ATTA 4NM3A 4XMOA 2Z8CA 3ELJA 2OW3A 4QQTA 3MESA 4DE4A 5AIKA 3G5DA 3HV3A 4O22A 4AZSA 2WEVA 5IQEA 2OIDA 3FLQA 3KULB 4KBCA 5DWRA 4CKJA 4L52A 4RIWA 2OJGA 3HMNA 5FGKA 4CD0A 3A7HA 3Q52A 3AC2A 3PP1A 3UVQA 5A46A 5HTBA 3R7UA 5EQPA 3OT3A 5J9LA 5HVYA 1ZOGA 1T46A 3F66A 5DPVA 4J8NA 3UPXA 3Q9ZA 4AWIA 3UQFA 4YJUA 2DWBA 4PV0A 4O96A 1UNLA 4F7NA 1KUTA 1UKHA 2O2UA 3DS6A 4QMXA 4QMZA 1HCKA 4BF2A 3NX8A 3PXRA 3OF0A 4CCUA 2F9GA 3AQVA 4QPSA 3G2FA 5D1JA 5KHWA 3DJ7A 2WO6A 4G3EA 1JLUE 1OBDA 2WMXA 3EYGA 3PLSA 4IAKA 4QD6A 1P14A 4WBOA 5EDQA 4EKKA 3I0OA 5JFVA 1ZRZA 3NUXA 4AOTA 4PMPA 4DBXA 2B1PA 2EB3A 3VUKA 5KKRC 3HZTA 3ITZA 5EK7A 3U51A 2J4ZA 4ACMA 5HNBA 3DBFA 2XBAA 4BCOA 4L44A 3AGMA 4ZJJA 4M15A 3BYMA 4O0YA 4BI0A 4IC8A 2VX1A 3R73A 4O0VA 4DG0E 3HDNA 4MF1A 5DR9A 3ZO4A 2WMUA 3C4ZA 3AT2A 4CFWA 2JIVA 3C50A 3REPA 3OOMA 5HX8A 3TV6A 4BDFA 3U6HA 3CGOA 4FV8A 2OKRA 4IZ7A 5FLFA 3KQ7A 2H34A 2FGIA 3EL7A 2PE1A 4L46A 4YO6A 2R3NA 2WELA 4ZY5A 1ZZLA 2XMYA 5ANKA 3RM6A 3LLAA 3TJDA 3A4OX 3C4WA 3DKCA 1GIIA 5HEZA 4CSVA 2PUNA 4U5JA 5A3XA 1NVQA 1WFCA 2ZVAA 4CXAA 4O1PA 4PPBA 4EORA 4HGTA 4YTHA 1SVHA 4FR4A 2R4BA 4KIOA 2QO9A 2WMQA 5ETFA 5E92A 3ZZEA 2YDIA 4U9AA 4CG9A 1IRKA 4EJ7A 4O7LA 2IN6A 3IGGA 4LM5A 4QRCA 3SC1A 3VBTA 3EWHA 3QD4A 4O0TA 1QPDA 4LOOA 2R2PA 5CEOA 3UQGA 4BZDA 3VBVA 4YNOA 4ANQA 3QXPA 3SW4A 5H9BA 4D4YA 1FMOE 4QYYA 1LP4A 2VTPA 5DT0A 3QCSA 4G6OA 4PDYA 4YZBA 2UZLA 3C4XA 2PE2A 2PU8A 4X2NA 1GZNA 5JZNA 3DPKA 2PZYA 1XBBA 5IA1A 4AT5A 3WZJA 2WGJA 4FIFA 4NM5A 2F7XE 1JKLA 5A54A 2QOKA 3VS5A 2R3PA 2R3GA 5EYCA 4JQ8A 3KC3A 4I5HA 3WBLA 3CTQA 5IH6A 4I0TA 4FICA 4AA4A 1M2QA 4RIXA 4I6FA 2QLUA 3UPZA 3PP0A 3UE4A 4O7ZA 3ZC6A 2HY81 3UP7A 3V8TA 4IM3A 3OY1A 4KBKA 4F09A 5JRQA 4QNAA 4ZLYA 4RA4A 4A9YA 5A4LA 2UZDA 5LQFA 2PVFA 2ITXA 3FMEA 2XBJA 3F7ZA 3MTLA 3OWPA 3QX2A 5IH5A 4PRJA 1WVYA 3KB7A 4NW6A 4JBVA 4XG3A 4QMQA 4O7VA 3GCSA 3V01A 3R9RA 2R3KA 3GNIB 1PKGA 3PY0A 3S00A 3T9IA 2VWWA 5FBNC 4FV2A 4IFGA 4PTGA 2OF2A 1GY3A 1ERKA 3RAKA 2HW6A 4YJVA 3RPYA 2YCSA 5M4FA 4FEVA 3LFEA 4I92A 4F9BA 1E1VA 1APME 4BDEA 5AR7A 3ZRMA 3DT1A 1HOWA 1I44A 1K9AA 2XS0A 4DGOA 3KXGA 4PX6A 3LFAA 4DH7A 3KKVA 3BHTA 4FG8A 4LUEA 5AJQA 3IOKA 1FMKA 3MVHA 2JITA 4Y72A 3EN5A 4YJOA 3ZRKA 4C3PA 3VIDA 2GTNA 4PMTA 4BDKA 5EH0A 4DEDA 3RCJA 1Q8UA 3KRLA 2IW8A 4MD7E 4O84A 4IX4A 4M97A 1JQHA 3GC9A 4AG8A 1RQQA 2A1AB 3F82A 3GU4A 4FKIA 4YLLA 5GZAA 2WTDA 4Y73A 2LGCA 4N70A 4KIKA 4FKLA 3E88A 3R30A 2P3GX 2XEZA 5J7BA 2Y6MA 2C0TA 4FIHA 3KN6A 4U79A 3FQHA 4U6RA 5GJFA 5FXSA 3VBXA 4RQVA 5DH3A 4J71A 1HCLA 4EQCA 2B9IA 3W2CA 1PMNA 5IMXA 3LXNA 2HENA 4GKHA 4DAWA 4EKLA 4G2FA 2VO3A 4AGCA 2V62A 3UZPA 2VZ6A 4BHZA 3BWJA 3PXFA 4JDKA 4R6VA 1OL1A 2F4JA 2QOLA 2XNOA 2VV9A 4I0RA 4ZS0A 3UDBA 2RIOA 4Z7GA 2IG7A 4D1XA 4N6YA 4C7TA 3RNYA 5HVJA 4BWXA 3DU8A 1OVEA 4JRNA 3LFBA 3BX5A 4ITJA 2BRBA 4DTKA 2JAMA 2W1ZA 4GCJA 4NH1A 3TG1A 3ZC5A 5F4NA 4RWIA 4FVRA 4RIYA 4CMUA 3LW0A 3NVKI 4F1TA 5I5ZA 3O7LB 3TKHA 2VWZA 3NCGA 2XYUA 5A14A 1O6KA 3O51A 1NVSA 4PWNA 4FOCA 3TDWA 3DTWA 5BVEA 3R9HA 3FZTA 4ZY6A 3QTWA 2WNTA 2ZB0A 4J1RA 4GSBA 4ACDA 4D4VA 4MTAA 5KKRB 3PRFA 4BYIA 3H0YA 4O2PA 2X6DA 4XOYA 4L68A 3RKBA 3L8PA 4MKCA 3SV0A 3VHKA 1OECA 3CLYA 3VS1A 4D1SA 3ZSGA 4E5WA 1DI8A 5JQ5A 2BHHA 2A4LA 2G2FA 4HVSA 1Q41A 5AM6A 5FP5A 1A9UA 2NRUA 3P08A 5LVLA 1B6CB 4FNYA 4FTAA 4BTKA 1GZ8A 5IUGA 3PSCA 3AC3A 4AN3A 4FTTA 4FT9A 4UMTA 5HOAA 1U4DA 5KO1A 4E4LA 2X7OA 3QD0A 2H6DA 5HBEA 4YTFA 2AC3A 5LVNA 1J7LA 4KA3A 3FAAA 3KMWA 2HWOA 4XG7A 5CT7A 3THBA 2AUHA 5C01A 3C4FA 3Q53A 4QMSA 1Y57A 3C0GA 5K3YA 3QX4A 4WKQA 3DXNA 3BBTB 3GT8A 2HY0A 2VGPA 2PTKA 1H25A 4RWLA 4GG7A 2FB8A 4FV3A 5BYYA 3RPSA 5EI8A 3GFEA 3CS9A 5CU2A 1PRYA 4FIIA 2Y0AA 5K4JA 4ERWA 2WMAA 4AZWA 1KE5A 2VTJA 3T3UA 3KN5A 4E4XA 4EYJA 4CNHA 4UYAA 5DNRA 4A4XA 4QYHA 3LMIA 3EFWA 2WU7A 2Y4PA 2RG6A 4F0IA 2UW9A 2P55A 3F3WA 3TEIA 1NXKA 2A27A 3CKXA 1YHSA 3OY3A 3QHWA 4AZTA 3LMHA 3ETAA 3BQRA 1K3AA 1OIQA 4BKZA 5BPYA 4U97A 3GUBA 2GNGA 2XEYA 5DBXA 4NFNA 4AW5A 2UW0A 4ONAA 4PMSA 4PF4A 3UYSA 4ENYA 4XG4A 3E63A 3RBWA 3IPHA 3MS9A 5HE1A 2FSLX 5CSWA 3O8PA 5A4TA 5CAQA 3JY0A 4H1MA 5JN2A 3JR1A 3EZVA 2J5FA 4NJ3A 3PPZA 1JSTA 2IO6A 2BZIB 4EOQA 4CYIA 2VRXA 1H01A 2OG8A 2BAJA 4PUZA 2NP8A 4KIPA 1PXPA 4IZ5A 3SLSA 4D2TA 3E3BX 2YFXA 4H36A 1IASA 5DA3A 5JK3A 2XIRA 4PQNA 2UZVA 5AV1A 2UW7A 2YCQA 2CLXA 2ONLA 1TQPA 2VX0A 2WZJA 3GCUA 2PMLX 4IADA 4QMWA 3RGFA 4QYGA 4TY1A 2YCRA 4HYSA 4AACA 4YZ9A 1YDSE 2W1EA 4E6AA 2XUUA 4DH8A 3MJ2A 2HAKA 5I3RA 4WHZA 1PXNA 3WYYA 2B9FA 4FKUA 4FNXA 4AXAA 3NUYA 2PMNX 3DAJA 4L43A 3B2WA 4EZ3A 4JXFA 4CV9A 1YWNA 1IR3A 1H1QA 4AFEA 3QRIA 2QR7A 3NUPA 5I9UA 3SX9A 4XH6A 2WB8A 3UOHA 3MH0A 4FF8A 4J98A 4JI9A 2ONLC 4OAVB 4X3FC 2PVKA 3LM0A 3CQEA 3MVLA 5E7RA 1JPAA 3LFQA 1ZAOA 4JL9A 4CFXA 4F08A 4M0YA 4QYEA 4USFA 4UALA 5D12A 5FXRA 3OCTA 3ZXTA 3PJCA 3ZBFA 4ZIMA 3ZUTA 1JBPE 2WPAA 3OP5A 4NM0A 3R21A 3L9MA 3SOCA 2CKOA 5C27A 4TN6A 2OZAB 5HNGA 1H08A 1YOJA 2XVDA 3E3PA 4QMLA 3ROCA 4BKJA 3ZOSA 1WZYA 5CU3A 4DYMA 3NUUA 4AA5A 3QUPA 3SG8A 1Z9XA 5DVRA 3OUKA 2W4JA 4LMNA 4R3PA 5I9XA 3FMNA 3KF4A 3K3IA 2GMXA 5EW9A 3VQHA 1Q4LA 4FIJA 5ETIA 4XBUA 2XRUA 3MB7A 4A9TA 4AN9A 2GPHA 3JY9A 2YDKA 2WOTA 2YIWA 4QMOA 4D28A 1DAYA 1QPCA 2ITTA 3COIA 1XQZA 4OTQA 3LFNA 2YJRA 3OFMA 4JBPA 2VD5A 2OJ9A 3DJ6A 3EJ1A 3EOCA 4IQ6A 4W9XA 2ZV7A 4DFUA 4HW7A 3LFFA 4Q5EA 3K5VA 4YC8A 3GEQA 4TKSA 3HGKA 5DHJA 5T6KA 3GU7A 2VNYA 3HV5A 5DLSA 3UC4A 4G9CA 3OWJA 3DDQA 1YXTA 4CTBA 2X8DA 4FKJA 2ITNA 5G6VA 3U87A 4AU8A 3TZ8A 4D2WA 4CT2A 2YDJA 3LFDA 4EBVA 2Z7LA 2X6EA 2WTCA 1W84A 2GQGA 2XNMA 3DZQA 4KRCA 4GFOA 5L6WL 2I0VA 4FTNA 1OUKA 3HA6A 3I5NA 3EQBA 4WUNA 4KIKB 5DR6A 4ZEGA 2XIYA 2XB7A 3O17A 1UA2A 2OXXA 3BHYA 5LVPA 2ITPA 2YA9A 3ZDUA 2XCHA 3UNKA 4S2ZA 1WBSA 4NJDA 2HZIA 3KULA 4YNEA 3ODZX 3NW5A 3C5UA 3ALNA 4EOLA 2IVSA 3W2RA 5AR8A 2CGXA 4GV1A 4FKWA 4G3FA 2QOBA 3GXLA 4L01A 4GYIA 4K2RA 3BV3A 4RSSA 3LQ5A 2BFYA 2LAVA 4R3RA 5ANDA 4N57A 1Y6BA 4ZTLA 4UWCA 3HYHA 5EHOA 3DBQA 3UC3A 2IZRA 2BTRA 4MF0A 4GVJA 4BDCA 2BCJA 2VWUA 2I7QA 2E9PA 2W05A 2JC6A 1R39A 2UUEA 4MBLA 1BI8A 4E7WA 2C6MA 3FLNC 4PNIA 3TV4A 3PJ8A 4FYNA 2QCSA 5LMBA 5AP3A 2VTNA 2CLQA 5M51A 2O3PA 2PUUA
chains in the Genus database with same CATH superfamily
3EQPA 1OI9A 5EHYA 2H9VA 3LOKA 2V55A 4ACHA 5C8MA 2J5EA 2OGVA 4AW0A 5M57A 1XKKA 3R8MA 3WI6A 3QC4A 3WF8A 2QI8A 4F64A 3HP5A 1TQIA 4J53A 4RVKA 1PW2A 3ORXA 3ET7A 4BDDA 3KVWA 3HAMA 4U41A 2ZM4A 4XV9A 3QTIA 4CGAA 3CCNA 4IB1A 4E20A 4J96A 3PJ3A 3NDMA 5H8BA 3GI3A 5IUIA 2J0JA 4QQJA 3R7YA 2QC6A 3RHKA 3ZFXA 3ZDIA 4K33A 5HG9A 1W0XC 5L2QA 4ZSGA 4OGRA 3ID6C 5GINE 3VS2A 3ZSHA 2QKRA 3QWJA 2QO2A 2UW3A 3EZRA 3SRVA 4EHEA 2ZFYA 3HRFA 4FSZA 4IX5A 3RK5A 4CFNA 5TE0A 2W1CA 2ITVA 3EQGA 3DLSA 3K2LA 4GK3A 1IAHA 2W5AA 3O8UA 4DF3A 2ERKA 4ACGA 4PY1A 2JFMA 4ZSAA 5KUPA 2CPKE 3QTRA 3V51A 4JT3A 3R8LA 3FLWA 4TL0A 4OTIA 5GZ8A 5L6OA 3LCTA 5FTOA 2PULA 2GNLA 1OGUA 5KMOA 3NYXA 2J0LA 3FKNA 1W8CA 2V0DA 3A8WA 2PVNA 2XIZA 3E93A 3F5XA 5AV3A 4DFZE 3Q5ZA 3OG7A 2UVXA 4D58A 4E73A 3UO6A 4Z3VA 3UOLA 3NFFB 1OPLA 2WKMA 2OI4X 4JRVA 3QF9A 4BGHA 5A4CA 2HZNA 5J87A 5AAGA 3FLSA 2QOCA 3H4JA 5AUVA 5JKGA 3W18A 4GL9A 4QMYA 1G8KA 1BMKA 3HV7A 4OTWA 4AZVA 4M84A 4DEGA 1CMKE 4O21A 4BCPA 3PJ2A 4FKQA 1JSUA 1JVPP 1LEWA 2C5XA 2XH5A 3ORKA 3PVUA 4QP8A 3V5TA 5BMSA 3BL7A 2W96B 4NSTA 1ST0A 1FPUA 5M44A 5LXMA 5H8GA 1YXXA 4ZMFA 3BRBA 3KF7A 4FTOA 3LQ3A 4F6SA 1XH4A 2UZEA 4X3FB 2WIHA 4BYJA 1P2AA 2Y8OA 5AP7A 3R9DA 3KMUA 4DN5A 4Y83A 3PJ1A 5ANOA 3TL8A 3TJCA 1U46A 3DK6A 4H3PA 4HGSA 3VO3A 5K9IA 3V8SA 3FI3A 2OH4A 4QNYA 2RFEA 4QPMA 5ICPA 2JDVA 3ORIA 3I6WA 4TWNA 4LRMA 4FODA 3W2PA 5FRIA 2XF0A 4IJ9A 3H3CA 1WBVA 4H58A 2WEIA 4R8QA 3FQSA 5FWKK 4JMQA 3QRJA 3EQRA 2XK8A 4JAIA 3VAPA 3LJ2A 4X7QA 3CR0A 3HV6A 1FGIA 2R3RA 3W0NA 2EXEA 4KBAA 3DFCB 3RWPA 3ZRLA 5AIRA 2QNJA 3O7LD 3W0PA 3TIYA 4O1OA 4G16A 3UVPA 2J0IA 3ZFYA 2VWVA 1DM2A 3FY2A 3QCQA 4DHFA 1REJA 2PK9A 3L9NA 5HBJA 1J1CA 3HUBA 3R7VA 3MI9A 4PPCA 3QTQA 4E8AA 5LWMA 3RZFA 5FUTA 4GT3A 3L8SA 4ASDA 4IAZA 4EK8A 5CEKA 2JAVA 4FRFA 2PSQA 2QOHA 1BYGA 4XLIA 4BCQA 3NAYA 2R3JA 1OB3A 2QHMA 5AV2A 1U59A 1ATPE 2GQRA 3BLQA 5EG3A 4AP7A 3A7GA 4R7BA 3GBZA 2C0OA 2R3IA 2WAJA 3A4PA 3UP2A 3KU2A 5AUYA 4C58A 2XJ2A 3PWYA 4UZHA 2RFSA 1OPKA 1L8TA 4DT8A 4YJRA 3FI4A 4I20A 2O64A 3DDPA 2HIWA 3BHUA 3R2BA 4IDVA 3TACA 4NL0A 2XKEA 3NUSA 4FT3A 4RC2A 3F2NA 4EYMA 2O5KA 2QOQA 2CN8A 4NZWB 4HNFA 4NWMA 5T3QA 5C26A 5HU9A 5EW3A 3DKGA 4KS7A 4AQCA 3L8XA 4A7CA 4FEWA 2C3KA 4XP3A 3ZLSA 2PHKA 3FXWA 4RC4A 5AP6A 1JAMA 4BGGA 3EKKA 3UMXA 5EOBA 2XZSA 4ZZOA 5TF9A 3MFRA 4YR8A 1Z5MA 2PZIA 3W16A 1JNKA 4I4FA 2B9HA 2OU7A 5CLPA 4O4EA 1L3RE 2AQXA 4ID7A 4BDIA 3KCKA 2E9NA 1FVTA 4H3QA 1G8SA 3BU6A 3Q96A 4V01A 3T3VA 3HAVA 4U3ZA 4FEXA 2C69A 4PL3A 4ZZMA 4CEGA 4Y95A 2ZV2A 2VO6A 3F3TA 1Q24A 3LXPA 3P7AA 3SD0A 3CP9A 3D5VA 2BAQA 5EKOA 1V0BA 2B4SB 4C61A 3DV3A 3WARA 3QRKA 3HP2A 3ZEPA 1U5RA 2BRNA 2QURA 3ENHA 4II5A 4NIFB 2XCKA 3BE2A 2OBJA 1YWRA 2JBPA 3R2YA 4R5YA 4NYEA 4TW9A 4WG5A 2BVAA 3SKCA 3FZRA 3EIDA 4AGDA 4HVDA 5HE0A 3ULZA 5AUTA 2QR8A 4I1ZA 2PVRA 4AE6A 3W55A 5IA4A 3QYZA 4DFXE 3R71A 3ATSA 3DQWA 3R02A 3SG9A 5H3QA 1VYWA 2CKQA 1FQ1B 1Q8WA 3DTCA 3ZMMA 2XYNA 2OLCA 4NM7A 3G6HA 2OICA 2WTKC 3C13A 5CI6A 4O4CA 3R7OA 3H30A 3LQ8A 3VBYA 4AFJA 4EL9A 4EC9A 2IPXA 2C3JA 4HZRA 4IVCA 5E8ZA 4R77A 2W5BA 3MFTA 3PXKA 3DB6A 4Y5QA 3OROA 5KE0A 5HNIX 4BBFA 4EHVA 3MIYA 5I4NA 3RVGA 1PMEA 5EDPA 2ETKA 4S33A 5E8SA 4ASXA 4JDIA 3PUPA 3KRRA 4RIOA 3EKNA 2JKQA 1OKVA 3DGKA 3TNPC 2YIRA 5AA8A 2WOUA 3QFVA 1TVOA 5EI6A 3U9NA 4EOSA 4BR3A 1PXOA 4PTEA 5EFQA 3SVVA 2I0EA 3R00A 3C9WA 4FKGA 2GS2A 3R7GA 3RHXA 4MAOA 2JDOA 3RK9A 4AN2A 5L2IA 2RFDA 3I7BA 3POZA 4CKRA 4YHTA 2Y4IB 1T45A 1ZARA 3DK3A 3FE3A 3SRVB 4GKIA 4IB0A 4HJOA 4FKVA 4MXAA 4WSYA 4C02A 4E3CA 4AXEA 4XBRA 4AGWA 3QA0A 3LXKA 3D94A 3TZ7A 4BI2A 4C34A 4QT1A 4DGMA 2G15A 4DH5A 3KXHA 4LOQA 4P2KA 4M66A 3JPVA 4WSQA 5IEXA 3FSKA 4CYJA 4KSQA 5BX0A 2JDRA 5IU2A 5IQIA 2HXLA 3F2RA 3V5JA 5FBOA 4C33A 1H27A 3PA5A 2UZWE 3GVUA 4AS0A 2NYAA 3D7TA 2YABA 2XNBA 1CKPA 2GS6A 2CGVA 4GIHA 2WTWA 4NEUA 2QKWB 4PP9A 3GU8A 5DG5A 2IZSA 3EN7A 5AX9A 5DI1A 3R8UA 4P7EA 1BLXA 4EH9A 1W7HA 2FVDA 3B8QA 3DNDA 2EU9A 2ITUA 4KKEA 3OOGA 4RLLA 4WO5A 2QOFA 4JNWA 2CNVA 3AKLA 4I93A 5FTGA 2XIXA 3HNGA 4HZSA 4YLJA 3SGCA 2JGZA 3EQHA 2UVYA 3I60A 3ZH8A 2BDWA 1W2FA 2WMRA 4YSJA 3MY0A 4O0XA 2I40A 3FMDA 3WZEA 2ESMA 2ZV8A 4IAIA 1H1SA 4P4CA 3PFYA 3SDJA 3LAUA 5A6OA 4TPTA 3OVVA 3PE1A 4HCUA 1VZOA 1V1KA 5M4UA 3O2MA 2BRMA 2OO8X 4TWOA 5DOSA 5DYJA 5M09A 4ANLA 5AMNA 4FC0A 4GFGA 4IBMA 4E26A 2OZAA 2GNFA 2BDJA 3BWFA 5DRBA 5E8VA 5J1WA 3PIYA 5DN3A 3W1FA 3B2TA 4ZP5A 4EK5A 3GGFA 1WBOA 3CC6A 4K0YA 1I09A 4XYFA 1DS5A 1MQ4A 3OC1A 3AT4A 5GIPE 3BLHA 4M69B 3NNUA 4R7HA 3VUIA 5A6NA 5FDXA 3EN9A 4GH2A 5LWNA 4DA5A 4FMQA 4GU9A 5ANIA 2E9VA 2Y7JA 5JSMA 3KGAA 4IB5A 4K18A 3BPRA 4G6LA 4GVAA 2OFVA 2A19B 4TXCA 3OHTA 4FT7A 2GFCA 4QMMA 3BEAA 4WNOA 4QO9A 3S95A 3VBQA 3C51A 1MRUA 4V05A 4XCUA 3NPCA 3PXQA 5EM6A 3PG1A 4BHNA 3CTJA 3NMUF 4BTFA 4F4PA 1MUOA 5ANJA 4D9TA 4I0SA 4KKGA 5ACKA 4HYHA 5ACBC 3ORLA 1MRVA 1KSWA 1PHKA 3NW6A 4U3YA 4IM2A 4Q9ZA 4Z16A 3TZ9A 5A4EA 4LV7A 5GIOE 3FEGA 5AR5A 4DFYA 3OW3A 2X4FA 4CMOA 4IX3A 3HLLA 4QTDA 1ZMWA 3KY2A 3G51A 2J90A 4KD1A 3ZONA 1YOMA 2PZRA 4HGEA 4XX9A 1VEBA 3TDVA 4FKOA 4M7IA 2GHGA 4MQ1A 2XK6A 1Q8ZA 1ZMUA 2C0IA 4G3GA 4RFMA 1P4OA 5CF4A 3OXZA 4DFBA 3Q6UA 4KWPA 5IQBA 3CQWA 3C1XA 3FMHA 3O8TA 4BDJA 4AXDA 4EH3A 2QLQA 2C47A 2XA4A 3DY7A 2EUFB 3IOPA 3QQKA 3FZ1A 4M69A 5HZNA 4RX5A 3UOJA 3F5GA 4Q2AA 4YJQA 2YLFA 4O7WA 2BPMA 3VNTA 1H0WA 3MBLA 3ZZWA 3S2PA 4YZCA 3DA6A 4RWJA 3RINA 2HK5A 2Z7RA 2OXDA 4L9IA 4CT1A 2W06A 5LMAA 4DDIA 3DBCA 2IJMA 1UU3A 3OWLA 4M13A 4QMTA 2C68A 2YCFA 4YHFA 2YM6A 3G15A 4HVGA 5JRSA 4C4HA 4IWOA 5FM2A 3UO4A 4FG9A 1H1RA 2W7XA 4LFIA 4A9UA 4W4XA 5K4IA 1MRYA 3EHAA 5F1ZA 4FL3A 3RI1A 4F1MA 4TWPA 4AOJA 3MA6A 2XJ0A 5DRDA 1SZMA 1YDTE 2BIYA 3PY1A 4RJ8A 4YHJA 1LUFA 5EDRA 2EWAA 5AUXA 5KMNA 4FEUA 1XWSA 3P7BA 2R3QA 3LJ0A 4I6BA 3ZS5A 5A4QA 2W17A 2VU3A 4FVPA 4RVMA 3ORMA 4EONA 5HLNA 1YXSA 4R5SA 4TTHB 5CSHA 4CG8A 4F9WA 4FSQA 5L3AA 3GENA 4QP1A 1TKIA 4FUXA 4CLJA 1SVEA 3E92A 1CM8A 2H8HA 4L3PA 5JEBA 4BCIA 2PL0A 3RPVA 4F65A 2J6MA 2XKDA 2QHNA 4HCVA 5E8WA 2X2LA 4EUUA 4QEBA 3ZHPC 2ZMDA 4LRJA 3FWQA 4XRJA 3R8PA 5CALA 3U54A 2ZB1A 1YHVA 2X0GA 3ORPA 3IKAA 4ZAUA 4J8MA 4O7TA 1S9JA 4QMUA 4P90A 5I9VA 3V6SA 3S4QA 5M08A 4IE9A 5J8IA 5F95A 1M7NA 1OKYA 2DYLA 3COMA 3E8CA 2WTJA 1MP8A 4YGAA 3PZHA 3ODYX 5EOLA 3ACKA 2YM8A 4XV3A 5E8TA 5HIDA 4CFFA 5HD4A 1OKZA 1WVXA 4YC3A 3QTUA 4O4DA 5CWZA 3UMWA 1YWVA 3WF6A 3BEGA 4MEDA 3SW7A 2FSTX 2VTSA 4FV4A 3RAWA 4F1OA 3GQIA 5C1QB 4DG2E 3ML1A 2PE0A 5FEDA 3PTGA 3TKIA 4RJ6A 4EH4A 1F5QA 4JQEA 2PYWA 4FSNA 4JX7A 5ETAA 5CANA 3FUPA 3TZMA 4C2VA 2V22A 3LFSA 4IZAA 2W99B 4CMTA 1KWPA 4Z9LA 3IW6A 2X0OA 4I5PA 4E4MA 4FK6A 5HIEA 3AC8A 3D14A 4MBJA 5AUZA 4B9DA 5KMKA 4O0UA 4BL1A 3O96A 2WQEA 4EBWA 3UZRA 1XH9A 4FSTA 3R04A 2GSFA 3R1NA 4YU2A 5J9YA 4EZ7A 3OW4A 4IIRA 3R83A 3UNJA 2C1AA 3CXWA 4NCTC 2EVAA 3HKOA 3NSZA 1AD5A 4MXXA 4ASEA 2R3OA 2YN8A 2JKKA 4IC7A 3TNWA 3OS3A 4O6EA 3AD6A 3CIKA 2WTIA 4C0TA 2UW6A 2BRGA 4YMJA 4D2RA 5LJJA 5K0KA 3GCVA 4D2SA 3D7TB 2G2IA 3CJFA 3NS9A 1QPEA 4X3FA 4EH8A 5HX6A 5J5TA 5CQUA 2BROA 2PVLA 1FVRA 4NTTA 5CX9A 4UN0C 2VTQA 5BNJA 4BCMA 3CPBA 4FV7A 3POOA 4E6QA 5J9ZA 4FIGA 1UWJA 5IQGA 1W2CA 5K0XA 3E7VA 3E62A 3GCQA 4MX9A 4C3FA 5BVNA 5L4QA 3R1YA 4I5MA 3WIGA 5IMEA 2RGPA 3I1AA 5M4CA 1WBTA 4XNEA 3TTIA 3DOGA 4G34A 1R1WA 4MNEB 5EM8A 3V5QA 4DINA 5LVOA 1OBGA 3R7EA 3UOKA 2BFXA 4D4SA 2C5OA 4USDA 4FT0A 4MHAA 3NWWA 5AP1A 4EJNA 4CRSA 2ITQA 1H00A 4MH7A 2WMBA 5TKDA 5G1XA 3V5LA 1NT2A 2W9ZB 2W1IA 5CT0A 4GT4A 3UTOA 3WILA 4BBEA 3QBNA 4ALWA 3UIUA 5IQAA 4N6ZA 3A7IA 4RJ4A 3UIBA 5E90A 3DLZA 3K5UA 5CVGA 3GQLA 4CQGA 1REKA 3WZUA 4ALUA 1H24A 3NIEA 3V3VA 3VF8A 4F9AA 1R3CA 3D83A 4OT6A 4DFLA 3VBWA 4BWPA 1JKTA 3BCEA 4Q5HA 4UWYA 4W9WA 3AC4A 4WNMA 4IFCA 4M8TA 4CTCA 4YLKA 4X3JA 2YERA 4BCKA 2W1HA 1IA8A 4X2FA 3MPAA 2GHLA 3I7CA 2XKFA 3MH2A 4DDGA 4ANSA 2JIIA 4FEQA 2WMTA 5CSVA 4WRSA 5L8JA 3P79A 4QQ5A 5M56A 3RCDA 5KMLA 5IA3A 2X2KA 3LVPA 3QQUA 2GHMA 4ZK5A 2YAAA 3SXSA 2HZ0A 4UMQA 4F0FA 4OTFA 2I0HA 2IW9A 3S0OA 4BKYA 3VUHA 3K3JA 4GRBA 4C4EA 4EHGA 3LE6A 2JDTA 3E8DA 3FZSA 3GP0A 2F49A 2CJMA 3MFSA 3FMLA 2C6OA 4FBXA 3O23A 2VUWA 5CXZA 4IAFA 4MBIA 4TZRA 1WCCA 4L45A 4DGNA 4MK0A 3W0RA 3AC1A 1H07A 4HPTE 2P0CA 3OCGA 3QC9A 1O9UA 3C0IA 5E8XA 3MH3A 4O91A 2C6DA 2FYSA 3W33A 3SXFA 5HE3A 3MJ1A 3VVHA 2ACXA 4L00A 3FY0A 1WMKA 3QTXA 5IQCA 4GJ3A 1UWHA 5BYLA 4U81A 4YZNA 5HD7A 3RAHA 5CF6A 1M52A 2F57A 1JKKA 4XG2A 4FI1A 3VW6A 4OTHA 4A07A 4AA0A 4GW8A 1M14A 4BIBA 2VTIA 4ANMA 2XNPA 2B0QA 1YXUA 4RC3A 4IANA 1YI4A 5EM5A 4DC2A 5CAPA 3N4TA 3BELA 2CKPA 5DT3A 3L8VA 3A8XA 2OWBA 4YSMA 3NRMA 4L6QA 1XBCA 1GNGA 4JLCA 2BUJA 3C5IA 4N4SA 3NLBA 4NIFA 4BJJB 3L1SA 5IQFA 1YOLA 3GB2A 4GU6A 4TYJA 4IWDA 1V0PA 2RKUA 2YLEA 3FXZA 3P0MA 5C9CA 1CSNA 2BKZA 2C1BA 3PVWA 2VO7A 4R3CA 2C6EA 2GNHA 2PVMA 4WT6A 1OGYA 1ND4A 3BYUA 4JJRA 1H28A 4EOIA 1OIYA 5E1SA 2B54A 2OK1A 3W32A 3OUNB 4F0GA 5FDPA 4CFMA 3CJGA 5HHWA 3NAXA 3Q9WA 4MNFA 1MQBA 3ORZA 4LL5A 4YP8A 2X39A 3JXWA 3AKJA 1Y91A 3ZM9A 3EH9A 4ZJVA 5HTCA 2ERZE 1FOTA 1YKRA 3QTSA 4C8BA 5CAUA 4RZVA 3F7WA 1LPUA 3P86A 2O0UA 4X0MA 3GC0A 4HYIA 5CAVA 5HG8A 2RSVA 2UZOA 2CNUA 1UNGA 1X8BA 3KMMA 3QKKA 3MIAA 4UXQA 4IDTA 3EFJA 3MTFA 3TNIA 4YJNA 3NYOA 3TKUA 3EB0A 2XKCA 2ITWA 4J52A 2IF8A 4YBKA 3TIZA 3IW4A 4FNZA 3H9OA 4RJ3A 3QCYA 3AMYA 3UO5A 4BCJA 4EQUA 4R1VA 4AZFA 5IDPA 3ACJA 4G17A 4DEBA 5LMKC 1H0VA 2X0QA 4DBNA 1Q62A 3QQJA 5IKWA 4UYNA 2HCKA 2FA2A 3F3VA 3QALE 4LV5A 4S30A 1J3HA 4A9RA 4RVTA 4O82A 3QD3A 1A48A 1O6YA 5FP6A 2PPQA 5CEIA 4FV9A 3R22A 3QGWA 4M0ZA 3ZEWA 3QQGA 1GAGA 1SMHA 2J50A 3LIJA 3ROYA 5AR2A 4EEVA 5IDNA 4MXZA 2VWYA 2EXCX 4R7IA 1UNHA 2QOOA 4BTMA 3BV2A 4D9UA 3F88A 2WQNA 3DQXA 3A62A 3OCSA 4JR3A 4M3QA 2P4IA 4WA9A 2VTOA 2X7GA 2G9XA 4K1BA 5C8NA 4WNPA 2JBOA 2UZTA 4EHZA 3RM7A 1FINA 1K2PA 4IAAA 4D4RA 4YJSA 5K5XA 2W9FB 4JOAA 4ZSJA 3V8WA 4BCHA 3NYNA 2GCDA 3FZPA 2OXYA 3FBVA 3OD6X 3Q4CA 2V5QA 4M68A 1FBNA 3N4VA 3OEFX 4IWQA 1YVJA 3D7ZA 1OIRA 4HVIA 1ZYSA 5BMMA 3TTJA 4O38A 3ZTXA 5AUUA 4U40A 4MD9E 2XM9A 4MXYA 4S34A 4TYGA 3PWDA 1URCA 3O71A 4FTLA 3Q2MA 4EWQA 3P4KA 3VJNA 3ZO1A 2XARA 3HMIA 4WD5A 5E91A 3R7IA 3AXWA 2YISA 3RTPA 5L2SA 3BL9A 2JKMA 3NFGB 5EYMA 2O65A 3P23A 4B8LA 4LUDA 4ANOA 3HRBA 4L42A 5E9EA 5AEPA 2WMVA 3KXNA 4ZTRA 5IPJA 2UV2A 4L67A 2ZV9A 4CQEA 4FUYA 4TRLA 4ZZNA 5IQHA 1YDRE 2XK9A 2JIUA 2YIQA 3HECA 3MH1A 3R1SA 4YZDA 5IA2A 4X6QC 1XH6A 1YXVA 4TNDA 2UZBA 3BI6A 2ZYBA 3DKFA 3JUHA 2REIA 2UZUE 3IW8A 2B7AA 3MWUA 3FXXA 3CKWA 1GIHA 2OH0E 4GUEA 2CGUA 5BVOA 2W4OA 2PUIA 2X9FA 4H1JA 4KIQA 5L8LA 4UV0A 5F94A 3I5ZA 5I0BA 3D9VA 3CGFA 2WXVA 2PMOX 5BUEA 1Q8TA 2PZ5A 4I6QA 4G5PA 3IECA 4G31A 3RWQA 3UG2A 4OTPA 5JQ8A 4GG5A 4EZ5A 4ASZA 3MVMA 4K8AA 4YC6A 3HMMA 2G01A 1KV2A 1NY3A 2J0KA 4UY9A 5HCZA 5HU3A 1AQ1A 3KXXA 3QQHA 5FEEA 2R3LA 4C4IA 5AA9A 4MVFA 2R7BA 3ZUUA 2VWBA 4PDPA 4USEA 4W4WA 1V0OA 2PUPA 4PMMA 4DEEA 4UMRA 4I3ZA 2BRHA 3CY3A 3FPMA 1PYEA 2J51A 4GMYA 1ZY4A 3R8ZA 4OUCA 3F3ZA 4KUJA 1QPJA 1TQMA 5B7VA 4V04A 5KMJA 3EQCA 2Q0NA 5J5SA 4L7SA 1OUYA 4EH6A 3FKLA 3OZ6A 4FSYA 1XJDA 4C35A 1BL6A 4BDAA 3DKOA 1B38A 2DQ7X 5F9EA 2XJ1A 3BU5A 1P5EA 4AUAA 3I6UA 1UKIA 1ZYLA 2XRWA 4BI1A 5IF1A 3VN9A 4IACA 2Z2WA 4H39A 4FNWA 4BC6A 1G8AA 3AT3A 3E64A 3COKA 1Q5KA 4F7SA 4CZTA 5HG5A 5FEQA 3GFWA 4AT4A 2XALA 3LCOA 2C6KA 3UQCA 4MCVA 5CTPA 3W2OA 3RAIA 3ZXZA 5HTIA 4I6LA 4ZY4A 4UWBA 5BYZA 3HDMA 3Q60A 2R9SA 3MW1A 3GOKA 3SQQA 4EK3A 2O8YA 4GS6A 4FA2A 5HLWA 2OJFE 2V7AA 5JMSA 4FZDB 4QPAA 5IISA 4I41A 4B8MA 2QVSE 4QP7A 3HRCA 4FTRA 4KB8A 4DGLC 1PMVA 3GC8A 3DBDA 2YM4A 3PA4A 3VULA 4FOBA 5CVFA 1KE9A 3A60A 2YM5A 4E6CA 1IAJA 2Z7SA 3QYWA 1VR2A 3G90X 3NCZA 4B99A 5D41A 2GU8A 4FKPA 4QMVA 2X4ZA 4NW5A 3R63A 4CKIA 2BHEA 3BGPA 4W8EA 2IW6A 4O7NA 2YHVA 1H8FA 3G9NA 1GOLA 3NGAA 4C38A 3P78A 4I23A 3UGCA 4LV8A 4PDOA 3LM5A 3PZEA 4K6ZA 3F69A 2FSOX 2WQMA 4YO4A 4YBJA 5CZHA 2XNEA 1QL6A 4FTIA 5CEQA 3VUDA 4MD8E 5M4IA 5BVFA 3I79A 1ZYDA 3A99A 1R0PA 4OLIA 5JT2A 3U55A 5EKNA 1M17A 3ORTA 4FK3A 1H1PA 1KV1A 4U80A 3MFUA 3ORNA 4D2VA 5KMIA 2IWIA 3BZ3A 4OBQA 3W8LA 4DTAA 4DTBA 3Q4ZA 5JFWA 4LMUA 3MY1A 2PVYA 4S32A 2P33A 3P9JA 1WAKA 4HPUE 3WZKA 3NIZA 3L9PA 3ERKA 4KS8A 2Q83A 4MXCA 4PDSA 4D1ZA 2QU6A 3D5XA 3TCPA 3LJ1A 4XRLA 4C59A 5J1VA 4O2ZA 4BY9E 4CRLA 3IG7A 4XJ0A 4JDHA 1PXMA 4F63A 3R8VA 2W1GA 3GU5A 3PVGA 5E4HA 2WFYA 2AYPA 4O81A 4EQMA 2ZM1A 3AGLA 5DIAA 3II5A 4OR5A 4ARKA 4ZTMA 3HA8A 2SRCA 3CPCA 5B2MA 1Q61A 4UXLA 3P1AA 3IDPA 4V0GB 1U5QA 4QDVA 3ZCLA 3TUDA 1ZY5A 2RL5A 3M42A 1OM1A 4RRVA 3V5PA 4BGQA 4Q9SA 3ULIA 4BVUA 1KOBA 1ZMVA 3EQDA 5FXQA 3QCXA 5CXHA 4RLKA 3RZBA 1PYXA 4D5KA 4FT5A 2QG7A 4IEBA 4ZSEA 4Y5HA 5LCJA 2C3IB 3C7QA 4NK9A 4M14A 3VHEA 4MQ2A 5I9ZA 5M07A 3IONA 1WBWA 1YQJA 2C30A 2A98A 2F7EE 4YZMA 5AP5A 3VS6A 2XP2A 1PMUA 1YI3A 4ZMEA 1S9IA 3A7FA 3CQUA 3F5PA 2ITZA 3G0FA 3G6GA 5LCKA 4DLJA 2BAKA 1J7UA 1LEZA 2R5TA 3CE3A 3AMAA 3AD4A 1GJOA 1XR1A 3OEZA 5HO8A 1ZLTA 2P2IA 4O86A 4FX3A 1J1BA 1IG1A 2OSCA 1Y8YA 4XUFA 3PIZA 4EOMA 2R0UA 4FSWA 4J99A 3AOXA 3BIZA 4F99A 1PXKA 2ETRA 4BZOA 4PL4A 4K77A 5CNNA 4EK4A 2GNIA 3JVSA 2C5NA 3KXMA 3OBGA 2Y6OA 3TUBA 3TNHA 1PXJA 2OZOA 1Z57A 2C6IA 3AD5A 4MNEA 4R78A 3R9NA 1UU9A 2PZPA 2WTVA 4GJ2A 4RX8A 3BQCA 4F70A 4CFVA 2GFSA 4XOZA 1ZYJA 4RQKA 5HGIA 3IGOA 5I3OA 3VUGA 4APCA 1F0QA 4JG8A 2PWLA 5TO8A 3OTVA 2B55A 3GU6A 5HCYA 4AGUA 1OL6A 2IVUA 2J2IB 4ZTNA 2F2CB 4FZFB 4C36A 3I0QA 4PP7A 4UZDA 3ZSIA 2ETMA 1H1WA 5CEMA 4MWIA 3UBDA 2VN9A 4YJPA 3FZOA 5ANGA 3DFAA 5T68A 4RX7A 3Q6WA 4LGGA 1BUHA 5IA5A 1Q3WA 3MPMA 3Q32A 3FC1X 4YTCA 5I9YA 4ANBA 3FKOA 3BHVA 4C4JA 3C4CA 1UU8A 3FHIA 1SVGA 4IWPA 1WBNA 2XIKA 3KEXA 3QUEA 3I81A 3TV7A 4J95A 3VWAA 5L6PA 3MV5A 4I24A 5BUJA 2NO3A 4ZXTA 5EM7A 4Y85A 3R9OA 3QWKA 5FM3A 5M06A 3MA3A 3DJ5A 4CCBA 5CYIA 5EHLA 3IDBA 1UU7A 2RG5A 3BYSA 4IJPA 5CU0A 2ZMCA 2CHLA 1B39A 1J91A 1P4FA 2QU5A 3NR9A 3M2WA 4CZYB 3BU3A