4C4IA

Structure-based design of orally bioavailable pyrrolopyridine inhibitors of the mitotic kinase mps1
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
279
structure length
253
Chain Sequence
QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMTVNYMPPEAIKDMISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Based Design of Orally Bioavailable 1H-Pyrrolo[3, 2-C]Pyridine Inhibitors of the Mitotic Kinase Monopolar Spindle 1 (Mps1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
total genus 78
structure length 253
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2013-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c4iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c4iA01
3UC3A 2W1HA 3F5XA 1ZRZA 3P9JA 4KA3A 4CKRA 2GDOA 4TRLA 1BI7A 3NMUF 1FVRA 2PWLA 5KNJA 4DG3E 4JBVA 4XS2A 3UNZA 4D2VA 3ZOSA 3CD3A 3PJ2A 4F7NA 4UMQA 2VTMA 3LFSA 4I3ZA 1MQ4A 3R73A 4RT7A 2QOFA 1FVTA 4XG8A 1U4DA 4ANQA 3QRUA 2E9OA 3HX4A 4C57A 3BHTA 2ONLA 4PL5A 4ANBA 1YXXA 1SMHA 2UW9A 4HCVA 4WNMA 3ACKA 2IVVA 5A4TA 3IGOA 4U80A 3K3IA 4GCJA 4E5AX 4FEWA 4AGCA 2WOUA 3QYWA 5H9BA 4FICA 4MBIA 4H1MA 4E73A 1ZLTA 3A7GA 3KRRA 4EJ7A 3BBTB 3DK6A 4TNBA 5HVKA 4HYUA 5AR3A 4X7QA 2YCSA 2GNGA 5IQIA 2F7EE 4KBKA 3AC2A 4TYHA 1ZMUA 5G1XA 4U42A 4FIIA 3VW6A 5IA3A 4C38A 1CTPE 4WD5A 1H1PA 5IQCA 3CC6A 4M69B 4X2FA 4YJTA 2JKMA 3WZJA 2H9VA 2BRNA 4M12A 2ONLC 3GVUA 3A60A 4DA5A 4FUYA 1UVRA 3EYHA 4CFNA 4E93A 4MH7A 4F99A 5HQ0A 3GQIA 5AUWA 1TQMA 4HYIA 4DEEA 2KTYA 4AFJA 3ULIA 3M2WA 3UIUA 3COIA 4UXLA 3MB7A 4C2VA 1JPAA 3EL7A 3IS5A 4KIOA 1FQ1B 2ZAZA 4IWPA 3W2QA 2OJ9A 2BTSA 3MTFA 4UYNA 4FUXA 3VUHA 4RA4A 3N51A 4GUBA 3WBLA 3Q96A 4XG4A 3M42A 3KULB 5CSXA 2UZBA 3H10A 1H1RA 1NA7A 3IK3A 3QZFA 2PK9A 4JL9A 4BKZA 1E1XA 2EUFB 1QPEA 3OG7A 3OW4A 4YZMA 4D4VA 5M06A 4WG3A 4F6UA 2ITNA 5HBHA 3AGMA 5J79A 3FWQA 1XH4A 2GHLA 3RAWA 2OU7A 2PVKA 4DT9A 4JS8A 2X39A 2X6DA 5JMSA 1PXJA 1XKKA 3QTWA 4QPAA 4LV5A 4YC8A 3DDQA 2W1DA 5BUIA 2WIHA 2XUUA 3NRMA 2WO6A 5H2UA 4D58A 2G2FA 2HOGA 3FXWA 4CQGA 4CEGA 1ZYJA 5FXQA 4GV1A 4A06A 3QGYA 1STCE 1WBTA 2UW3A 4CLJA 1FOTA 4IVBA 2EVAA 1RQQA 3TTJA 5HLPA 1PYXA 5CAVA 5IH5A 4G34A 1YI3A 3BU6A 4KINA 5FP6A 5AUVA 3WF7A 4UMPA 3UO6A 4NKSA 3K3JA 1OUKA 4BDEA 2OXDA 3NSZA 1PXOA 3P08A 2JD5A 2BCJA 2GS6A 4FF8A 4ZS4A 5HVJA 2GMXA 2ITWA 2C6LA 5ANJA 3R04A 2XK9A 5J1WA 3TIYA 4L3LA 3PJ3A 3JY0A 4FR4A 2F2UA 1H1QA 3EN6A 3IPHA 3LQ5A 4RFYA 2XBJA 4XJ0A 5KCVA 2F49A 1REJA 2J0KA 5E4HA 1XBCA 1K3AA 4MVFA 3SLSA 1VEBA 3R9OA 3KMWA 5LVPA 2G2HA 3TTIA 2W1ZA 4YZBA 1SVHA 2QU5A 5HO7A 3CR0A 4LRJA 3UPXA 5GZ9A 5EDRA 4BICA 5FTGA 5HG7A 1U5QA 3TACA 4QMSA 3OCGA 2P0CA 2C6KA 2PUPA 2WU6A 5EDQA 3MPAA 4UN0C 4DGOA 4APPA 1O6KA 3R71A 2ETMA 4EOOA 4YTFA 2JBOA 3QBNA 3SHEA 3KXNA 3PA3A 4NWMA 3CQWA 5AIRA 2GNFA 2V55A 1FMKA 2AYPA 4EQMA 3FZSA 2J9MA 4MXAA 4BDDA 2DQ7X 3THBA 5FTQA 4HOKA 1FINA 2X81A 4CZUA 4ACCA 4ERWA 4Y46A 4WNPA 3LFEA 4RIWA 3N4TA 3GCUA 1GIJA 3PA4A 5HD4A 4Q5HA 1IA9A 3CKWA 3KB7A 4IMYA 2GFCA 2ITOA 1Q97A 4I1ZA 4NEUA 3HP2A 4JRVA 3FPQA 4E6QA 5ITAA 3TUCA 2RFDA 3O8UA 4PDOA 4RFZA 4KKEA 4WA9A 3TZMA 3G9LX 5ANEA 1YXSA 1J91A 3LMIA 5KE0A 3LM5A 4RIYB 5DLSA 2WXVA 4ANSA 4GIIA 4QMWA 5T6KA 5J7BA 4BKYA 3ZH8A 2BAQA 2W1GA 1YDRE 1Q61A 1W8CA 2E9NA 4C02A 3Q2MA 2RIOA 2CGUA 3EIDA 5BVKA 5AUZA 1UWJA 4DGNA 4CG9A 5GIPE 5B2LA 3AMBA 2EXEA 5JH6A 2Y9QA 3DK7A 2CLQA 4BDFA 5L2WA 4RJ4A 4IBMA 5AAEA 4ZSJA 3HZTA 4QTEA 1ZMWA 2OIBA 4AGWA 1UU7A 2Y6OA 3DKOA 1Y57A 1ZOGA 4ZOGA 3G15A 2ZYBA 3W1FA 5EQPA 4FTOA 4BDAA 1Q8WA 4O0WA 2H8HA 2C6OA 4FT3A 3BQCA 2J5FA 4MD7E 1YOLA 4M0ZA 4TL0A 2A0CX 4F9AA 4AFEA 3FLQA 2XNGA 5KMOA 3UPZA 3KF4A 3QD3A 4CFVA 2P4IA 4O7TA 2I0HA 2WPAA 1P4OA 3C5IA 4GKHA 2WU7A 5H8GA 5CEIA 4L45A 4XEYA 4DGGA 4ZTMA 4MTAA 2C0IA 3DCVA 3A4OX 3KRXA 4EQUA 5HNIX 2VGPA 3UIBA 4FZ7A 3KCFA 3MVMA 4PNIA 5GJDA 1VJYA 4CMOA 2OXYA 4NKAA 1K9AA 3QAME 3Q52A 3LMGA 4GT5A 3AD4A 5L2QA 4EHGA 5HKMA 4LL5A 3U6JA 1URCA 2OF4A 2WQBA 2Y7JA 4TYEA 2WHBA 3ET7A 4HZRA 3W2PA 1WVXA 5IH6A 3GCSA 3S1HA 3U55A 3IDCA 4BY9E 3VS6A 4O0SA 4HVDA 2CGWA 3TDVA 2YDKA 4EOSA 4FKRA 3DS6A 4LL0A 4QYFA 3UVRA 3UVPA 4DH5A 3E7VA 4KIKA 4JBOA 4C62A 3W18A 3CPBA 2HZ0A 4IW0A 4ANMA 3WOWA 3SGCA 2JKQA 3IQ7A 3H30A 4LQMA 3L9PA 4U9AA 3CCNA 3ANQA 2QG7A 4AOTA 4AZTA 3SW7A 4FSYA 5IQDA 4DAWA 2FA2A 3R2BA 1XJDA 2XRWA 3QQGA 4UXQA 5B2KA 5KHWA 3BV3A 4FTKA 1NXKA 3NAYA 2XA4A 5IQAA 1Q8UA 3SOCA 3HDMA 1OGUA 3EFJA 4FV3A 4EHVA 5CEPA 3NVKI 4JLCA 4J98A 4F7JA 2HENA 3D5XA 4QTBA 1M2QA 2J0LA 3WIGA 5FDPA 3PWDA 3PVBA 3KF7A 2ITYA 2YA9A 4FTJA 5CX9A 1YHWA 2WZJA 2XCKA 4FV6A 4YJRA 3VBWA 3VJNA 5KBRA 4IWDA 5BNJA 4D4RA 2UZVA 4AW1A 3I79A 2HY81 3V5JA 3ZM4A 1G8SA 2WMSA 3Q2JA 4X3FA 2VTQA 5CEQA 4XP2A 4YURA 3ZS5A 1HCLA 4ZJJA 5C03A 5BQ0A 3HUBA 2JDTA 3OUNB 2OI4X 5LCKA 5FXSA 4EYMA 4ALWA 4BIDA 5AFVA 3RK5A 3O23A 3ZC5A 2PZ5A 2XEZA 4QQJA 3UOKA 3TDWA 3C4EA 4AOIA 2ITVA 1X8BA 2WTKC 1KE7A 3LXLA 3OF0A 4E6DA 2JLDA 3NNXA 3W55A 3E88A 1O6YA 4EH5A 2CMWA 5HTCA 4L44A 3QKLA 3R9HA 1CKIA 1UA2A 1YWNA 4YHTA 1SVGA 5ANDA 4EOQA 3UZTA 4U0IA 3ULZA 2VX3A 5L8KA 4AQCA 4NM7A 4ZEGA 3EQGA 3PJ8A 4GJ2A 4R8QA 3RKBA 3TNHA 2HXLA 1V0PA 5HESA 2UW8A 3I1AA 3BIZA 4I6FA 2NRYA 2B4SB 2GPHA 4NUSA 4RGJA 4AAAA 4EOPA 3GU4A 2CN5A 4FT9A 4OBPA 4RC2A 4YBJA 5AP1A 3CY2A 4QMQA 2VWXA 3HKOA 5AJQA 4DG0E 4EUUA 2HWPA 4EH6A 4DEAA 1PMVA 1FGIA 2OH0E 4XP3A 5CNOA 5I9UA 4KUJA 4JNWA 4F63A 3KREA 1OB3A 3P4KA 4OW8A 5I3OA 2QO2A 3EN5A 3U51A 4U7ZA 5AMNA 3MIYA 1VR2A 2BVAA 2YITA 3ORNA 2W9FB 3WILA 3TZ7A 5HTIA 2YM5A 5FEQA 4O0RA 4XV9A 5BYZA 3EWHA 5CEMA 4MF1A 1YOMA 3DBQA 3MSSA 5TE0A 4HZSA 4JG6A 3GEQA 4BRXA 4B4LA 5HU9A 4W8DA 2XEYA 1JLUE 3KMMA 3NGAA 4N70A 1BL6A 4IJPA 3OXTA 4H36A 3VHEA 4CXAA 3E3PA 1H01A 1JNKA 3EFWA 3R8LA 2IVUA 4RVLA 5M51A 3ZLWA 1F0QA 1TVOA 3A8WA 4IZ5A 2R3QA 2ZV7A 4JX7A 5EYMA 1H25A 3R9NA 3EQPA 3ZLXA 5K5NA 4ACGA 2WGJA 4FSZA 5CF8A 5D9HA 3FKLA 4DFZE 4ORKA 5LQFA 5CVFA 4YMJA 4QP8A 1GZKA 3H9RA 4K9YA 2Y4PA 4PMPA 5K0KA 4ZTLA 5HU3A 2X2KA 2XNPA 3ODZX 3BEAA 4UMTA 4FG9A 5I9XA 3BU5A 5CU2A 1EH4A 1Q62A 3DA6A 2PZPA 3UOJA 5IPJA 1G3NA 4RJ3A 2J7TA 3V5PA 1OUYA 3QRJA 4G17A 3LAUA 3EQIA 3QD2B 4FSWA 4EK3A 4I5CA 1PMUA 4WOVA 2C6MA 4R3PA 4RG0A 5FRIA 5L8JA 1YRPA 4AN3A 2AC3A 3RWQA 3OZ6A 2HK5A 3JXWA 3QZIA 3F3TA 1PHKA 3GC9A 3QLGA 4OTGA 5AA8A 3R1SA 4PMMA 3WZDA 5CWZA 4MCVA 4D9UA 3Q4UA 1J1CA 4I0TA 3UNJA 4MBJA 3DFAA 2C5OA 2OIQA 1B38A 2HY0A 4LUEA 3ALOA 5HLNA 4FKOA 2XM8A 4JRNA 2CCIA 2WTDA 4RIOA 3OXIA 5CEOA 1KV1A 2VWZA 5AM7A 1OL2A 2XK4A 2YDIA 3OBGA 3R30A 5DT0A 4AA0A 2BKKA 5E90A 2J5EA 4O0UA 3VS0A 1ZY5A 1PXMA 2YAKA 3A7JA 5TO8A 3MH0A 5J9YA 4NFMA 3GC0A 4HPTE 4CLIA 2OH4A 3ZBFA 5IQHA 5J5TA 3KA0A 5DA3A 3QTSA 1OVEA 3RK9A 3AD6A 1W7HA 4FSMA 4LMNA 3LLAA 1XH6A 3IECA 1DS5A 3LFNA 3WZUA 5AP4A 5I5ZA 4EBWA 4E7WA 4E5WA 1ZARA 2HIWA 3EH9A 4JAIA 4NTTA 4RA5A 2X8DA 5C8NA 4R77A 4NJ3A 2YM6A 5AUTA 3H0ZA 4BC6A 4G9RA 3ZDIA 1XR1A 2Y4IB 1LEWA 4DCEA 2WEIA 3SXRA 4MYGA 4XG3A 3KKVA 3QQJA 2IG7A 3GU5A 3LM0A 1ZYCA 3RJCA 3JVRA 3CXWA 3ETAA 3TKUA 4EOJA 3TUDA 2WFYA 3CE3A 3RPYA 5I3RA 4M13A 3GENA 4DBXA 4AN2A 3NLBA 2X6EA 4FTAA 5HOAA 3U6HA 5AP3A 2XIXA 3BGQA 2I6LA 3V6SA 4FODA 4IAFA 2WEVA 3R9DA 4C4HA 4DEBA 5CF5A 2PUIA 3RVGA 4O6EA 5DWRA 4Z55A 1H27A 4L8MA 1WVYA 4EZ7A 4GKIA 2J2IB 1H00A 1KE8A 2IVTA 4DHFA 2AC5A 3MFSA 1RE8A 4GK2A 3Q60A 2QVSE 3T3VA 3AXWA 1APME 2VWIA 5DG5A 3B8QA 1R39A 2VTAA 4FK6A 4W4VA 5LCJA 3TZ9A 1JVPP 3C7QA 3DKCA 3PJ1A 1OKYA 1H1SA 4ITJA 4KWPA 3F5GA 4RBLA 2VTPA 3RCDA 5JQ8A 5EYCA 4G9CA 3F5PA 4DEGA 3HNGA 3SD0A 4NTSA 4YPDA 3RHXA 4D1ZA 2XM9A 3OHTA 4XMOA 4LOPA 1PJKA 4O7YA 4H3BA 3LLTA 3N4UA 3OXZA 5E9EA 5DR2A 4ZLYA 4FKTA 2WD1A 1DAWA 3PSCA 4KAOA 1L8TA 2YWVA 3P23A 3SX9A 4CRSA 2JFMA 4O7RA 2R4BA 3D7ZA 5GHVA 5EM5A 3QRTA 3E8NA 5EYDA 2C3JA 4GUEA 3H3CA 5FG8A 1IEPA 3G0EA 2C5YA 4EK5A 4F1TA 3BWFA 3D5WA 3L1SA 3FZPA 3F88A 3VUIA 4JG7A 4Y5HA 1GZOA 3DQWA 3Q6WA 1W83A 2XS0A 4IAIA 4V04A 4X3JA 2PTKA 4YU2A 3GU7A 4YJOA 4GVAA 4M67A 4UYAA 2GFSA 3E92A 1UKIA 2ZDUA 4MK0A 1NY3A 5LARA 5A4QA 2LGCA 5HCZA 1GZ8A 4JXFA 4XG6A 5JFXA 3I81A 1J7LA 1ND4A 2OFUA 4AACA 3N4VA 2A27A 2IN6A 2YN8A 5IH4A 3KXMA 4OR5A 2BDFA 1ZZLA 4WG5A 3W2RA 4CKIA 2QI8A 4FMQA 2PE1A 4R7BA 4NU1A 4C3FA 5C27A 4L7SA 3QC4A 4YZNA 1OL1A 2CKEA 1OKWA 2WQEA 5KMJA 4W4WA 1JSVA 3V5WA 3Q6UA 3ZXZA 3Q9ZA 4LM5A 4RIXB 5EM8A 3PRIA 4YTIA 3PJCA 4ZMEA 3R8MA 4B6LA 4TKSA 3D0EA 3RCJA 4ASXA 2EXMA 5E92A 5J87A 5C1QB 4FKVA 2UVYA 5CQUA 4BI1A 3P7AA 3G2FA 4J7BA 1G5SA 5D10A 1PXNA 2OJIA 2QOBA 4FKPA 4R5SA 3BHHA 5FM2A 5L6OA 2GTMA 3FC1X 4I92A 4OT6A 4XP0A 4P90A 2NO3A 5HO8A 2QG5A 5M4CA 4IAKA 3SC1A 4MKCA 3C0HA 1CSNA 1HOWA 2V22A 3BBWA 4APCA 4DG2E 3POOA 3HAVA 3PXFA 3FHRA 2UW5A 3GOKA 3PWYA 1OL7A 4IZAA 3ZYAA 4MNEA 5J95A 4TWPA 2RG5A 2XP2A 3FKOA 2JFLA 3NYNA 5CAUA 2CKOA 5I9YA 3GOPA 3A99A 3I5ZA 3RNIA 3DKGA 1PYEA 2ITUA 3RBWA 4G3FA 2QOIA 5HX6A 4I4FA 4YTCA 1SVEA 3NNVA 5CENA 3PIYA 5J5SA 3UO5A 3OEZA 4X3FB 4XLVA 4BDKA 3LQ8A 3ZSHA 2W96B 3AC8A 2R3MA 4NM3A 5DFPA 3EQBA 1NW1A 4O7LA 4EZ3A 3CPCA 3EQHA 2B9IA 5KHXA 5LXMA 3R6XA 2XYUA 2HZIA 4FKGA 4OAUC 2UW6A 3CTQA 3RHKA 5I9ZA 2E9PA 5KMKA 4ZTSA 4EUTA 5AEPA 3E3BX 3BYMA 3HA8A 4HVIA 5A4CA 3MH2A 4NFNA 2W4JA 4G6NA 2XK6A 4FV5A 4DFYA 3FPMA 2DUVA 4AGDA 3VWAA 1Q4LA 3GUBA 4UZDA 4XOYA 4ZLOA 1PRYA 3OTVA 4J1RA 4EONA 2CPKE 3OEFX 5TOZA 3W10A 1WBPA 3LCKA 3IW4A 3PLAE 5EW3A 1JKTA 3C0GA 3UODA 4N57A 4ARKA 4M7IA 3RALA 2ETKA 4AF3A 2CNVA 3BLRA 4DFBA 3D15A 3L8PA 4AZVA 4C4FA 4ACMA 3LHJA 4DCAA 4MXCA 4F7LA 4PRJA 3AT4A 1WBVA 4FX3A 5BYLA 1SNXA 3G0FA 3PXYA 2F7XE 4GMYA 5AAFA 5LJJA 3I6WA 2CNUA 4PUZA 2C0TA 4LMUA 2JKOA 2RFEA 1P5EA 2QNJA 3TN8A 3UP2A 4G1WA 3KGAA 5T68A 1OM1A 5BVWA 3QLFA 4BHNA 3HMNA 4BN1A 3VS4A 2W9ZB 3D2IA 2FUMA 2X7GA 3JUHA 3I0OA 2VAGA 4O22A 3E93A 5TF9A 5IUGA 2WMAA 4ZSEA 2VTRA 2C4GA 3WF5A 2YIWA 3U9CA 3TIZA 3O7LB 2R2PA 3NYXA 2X4FA 1GOLA 3LFAA 4RQKA 3NUAA 2VRXA 1DI8A 2HZNA 3JPVA 3COHA 5K4JA 2PMOX 2XMYA 2GQGA 4E4NA 5GNKA 1AGWA 3F3UA 1IAHA 3OWKA 4IX6A 4S33A 2O8YA 3COKA 2G2IA 3NUUA 2QR8A 4FSQA 5EHLA 3OUKA 4Q9SA 4UEUA 5CSVA 3AT3A 4W9XA 2OWBA 4DTAA 4U6RA 2X2MA 4PMTA 4FV0A 3MA3A 3QKKA 3HMOA 2CGVA 1ZOHA 5F95A 2XNEA 3ERKA 4QMTA 4CD0A 3DBEA 4HVSA 5CXZA 2P3GX 2OF2A 2C3IB 5KMNA 3TM0A 2ITPA 2VWUA 1Y91A 2JGZA 3SKCA 3UP7A 3RPOA 5JGBA 2HCKA 3OMVA 4ZTQA 4Z16A 2A1AB 5DBXA 2GNLA 2UZEA 3ACJA 3VBYA 4PMSA 4ZXTA 4IWQA 3MJ1A 4R3RA 4XV2A 2C6IA 3FE3A 3HP5A 3WYXA 3ZDUA 4NL0A 4CFMA 2DS1A 3EZRA 4YPSA 3PSDA 5DN3A 4QRCA 3A2CA 3L9NA 3UJGA 4H39A 2JIUA 2XNBA 3BGZA 3ZUUA 4N6ZA 3QFVA 1W84A 1V0BA 3DTWA 3FHIA 4PL4A 4PDSA 4V0GA 3HVCA 1Q8YA 5FD2A 1OITA 4YO6A 4HYSA 2V7AA 4M97A 5I9VA 5CTPA 4DLIA 4OTQA 4DH7A 3H4JA 4E20A 2PPQA 4YLJA 4CYIA 5IDPA 2ZM3A 2UZTA 2V0DA 2IWIA 3BI6A 3AQVA 4FYOA 4QQCA 4CSVA 5JQ5A 5AV3A 5CAPA 5AV2A 3TNQB 4JDIA 1JKLA 4D2SA 5BMSA 4FBXA 4RJ8A 5M4UA 4G5PA 3DKFA 5GZAA 2FB8A 4BBMA 3W32A 4DEHA 5M55A 3QCYA 3KXZA 5GJGA 4A4XA 2R7IA 3BX5A 3DNDA 3DTCA 3ZO3A 2ZM1A 3ZBXA 1OL6A 3VQUA 2R3HA 2WNTA 5BVDA 4FZ6A 4FNXA 3EB0A 2E9VA 3HMPA 4GEOA 3DAKA 5AV0A 5L6WL 1PXPA 4ACHA 1XBAA 2VO6A 5CF6A 3BV2A 4NK9A 2WKMA 3UQGA 2VN9A 3P79A 2XKEA 3FY2A 2ZMCA 5H3QA 3QTQA 4CVAA 4BGHA 5IA1A 3F69A 2PHKA 4FTUA 4FG8A 5A4LA 1H07A 2EB3A 4Z7HA 2YLEA 3CP9A 5IA2A 1A9UA 3IDPA 4IE9A 3QQLA 4QMOA 2VNYA 3W16A 1WZYA 2X8EA 3H9FA 3PE1A 3PRFA 4G16A 2R3IA 2WTCA 1Q5KA 3PXRA 4EHZA 4S32A 3NDMA 3DNEA 3PPJA 1UKHA 3DV3A 2W4OA 3MV5A 4IVAA 4U3YA 3FYJX 3QUPA 5M53A 2OZOA 4O7SA 3ZHPC 3HRBA 3V3VA 3Q5IA 3OCSA 4PDPA 2C47A 4DFLA 2QHMA 2W4KA 3IW6A 3KY2A 3ENMA 3PZHA 3JVSA 3DQXA 2BIYA 2JBPA 5EOLA 2PYWA 3EQDA 4GU6A 2A19B 2XZSA 4MAOA 3ZXTA 2RFSA 3KMUA 3JR1A 4YJUA 4CT2A 3VUMA 5C8MA 2GQSA 2WMXA 2H96A 4BVUA 2XNOA 5J9ZA 3EMGA 4D2TA 1H0VA 4K77A 4HNFA 4L00A 4DGMA 4QQTA 1JAMA 1A06A 3GBZA 4O0VA 1H8FA 5HD7A 3BYUA 3POZA 3I6UA 2FSMX 4IM2A 4IZYA 3MJ2A 2ACXA 4ITHA 2PVNA 3NR9A 5AP6A 3S0OA 2PVHA 5HGIA 5DVRA 5JSMA 1MP8A 4H1JA 3OVVA 4ANNA 2Y0AA 2ZJWA 4NW6A 3Q4CA 5BUEA 4USFA 1CMKE 2JDOA 3TKHA 3TWJA 5BVOA 4RRVA 3CD8A 3NNWA 2R0UA 2RL5A 2WOTA 2XBAA 3BZ3A 3QRIA 4TWCA 3W2OA 4F6SA 2EXCX 5AADA 3LXPA 4TT7A 4BTMA 4EEVA 2PMNX 5JFVA 3D4QA 4WRSA 1ZYSA 3C13A 5TKDA 4DITA 4DH3A 4QYYA 3FQEA 4CG8A 1JOWB 4FTCA 1J7UA 4D2PA 2XK8A 2WB8A 4D1XA 4R1VA 3FUPA 2XIYA 4PV0A 4FVRA 4J8MA 2XNNA 3HV3A 4AT4A 4QP4A 3KK8A 4RIXA 4RIYA 2VTIA 4GT3A 2YJSA 5KO1A 2FSOX 3O50A 1U59A 2UW0A 3IOKA 4OTIA 3TCPA 3OP5A 3L8VA 5EH0A 2JDVA 4YZCA 4AUAA 3OS3A 4TPTA 4BBEA 3FSFA 3UIMA 3EN7A 3FMEA 3HEGA 1GIHA 4YJQA 4RC4A 4BI2A 2KULA 3LJ0A 1CDKA 4S30A 3HDNA 1U54A 4MD9E 4C35A 5AUUA 4BCFA 4E4MA 1Q3DA 2HELA 3ID6C 3ZLYA 2R9SA 4EBVA 1FMOE 1QPDA 2YM8A 4QT1A 3O71A 3NW6A 2XIZA 4MNEB 4KBCA 5K0XA 2BDWA 2GCDA 4FSNA 2OFVA 3PA5A 2C1AA 3MPTA 4QMMA 2Z60A 3FMMA 1M17A 3U6IA 4JDHA 3RMFA 2RFNA 1URWA 3WF9A 4L43A 4WO5A 3V04A 4PP9A 1YHVA 5E8SA 4D2WA 5ANIA 5IQEA 4UWYA 3VF8A 1WBWA 3PVWA 5E8YA 4ASEA 2YABA 2ZB0A 2Z02A 3E5AA 1P2AA 3FZOA 3V8TA 3BELA 5JN2A 2QR7A 3SG9A 3P7BA 2X7FA 4LGGA 1I09A 4YLKA 5CU4A 1JWHA 4F65A 3VW8A 2FH9A 3JYAA 2I0VA 4B9DA 4FV1A 5HCYA 3T9IA 3REPA 4RMZA 3MYGA 4N0SA 3DJ7A 5KKRC 4E1ZA 4O7WA 5AX9A 3F3VA 4F09A 3HYHA 1RW8A 4CV9A 4L42A 2ESMA 3H9OA 1SYKA 4XLIA 5EKOA 3ZEPA 3M1SA 3ZRLA 4DEIA 5D7AA 3FI3A 4RFMA 3R8ZA 2VZ6A 3AC5A 3F6XA 4J99A 4UBAA 5KMIA 4ZTRA 4O2ZA 3B8RA 4I93A 3HRFA 5C4LA 1YVJA 3E8CA 3E62A 3ZUVA 4Y83A 4AG8A 3FJQE 4O7ZA 3FLWA 2WQMA 4IVCA 5EM7A 3RI1A 4BZOA 3G33A 2C6EA 3SQQA 5ICPA 4FV4A 4GFOA 2GQRA 4W9WA 2BHEA 3NS9A 4CTCA 3ORLA 4UMRA 3TNIA 4BL1A 2REIA 4E4XA 4ZSAA 4EZ5A 2WQOA 4R7HA 4I0SA 5HO6A 5AAGA 3ZO4A 3Q32A 3FZTA 3KN6A 3OCBA 4L3JA 4NSTA 3FC2A 2WMBA 2J0JA 3GXLA 4U5JA 5JZNA 3WF6A 1R0PA 4E6CA 4I20A 1IA8A 3DBCA 2WTKB 1YXVA 2XVDA 2ITTA 5KUPA 3QHWA 4FIHA 3L9MA 4BKJA 5HICA 4FNZA 5AP7A 3PYYA 1MUOA 4RLLA 5L3AA 2CN8A 3MIAA 3NUXA 3P0MA 3F2NA 4ANLA 5DIAA 3C4ZA 1Z57A 4RWIA 5AX3A 5HTBA 3V8SA 4JX3A 4DINA 3DU8A 4EC9A 4BDIA 3DJ6A 3HLLA 3TUBA 3KRJA 3GGFA 4CKJA 4UMUA 3QWJA 4G6OA 2P33A 1V0OA 4RSSA 5DMZA 4QNYA 4BTJA 2XIRA 4MEDA 4AWIA 4I4EA 4LI5A 4A9TA 4FTMA 4AT3A 1W98A 2BRMA 4EHEA 2WTIA 3BLQA 1YQJA 4P5ZA 3EKNA 5JZJA 4BCKA 5EI6A 5IMEA 4YNOA 1UNGA 3TV4A 4DC2A 4MWHA 2PMLX 3QCSA 4FSRA 3QQFA 4B99A 5B7VA 3RAKA 5CSHA 5AR4A 4HPUE 2HAKA 4L3PA 4EK4A 2GSFA 2WAJA 2WTWA 4IFGA 4CCUA 4DTKA 4IM0A 4U44A 4W4YA 4D2RA 2J50A 4W4XA 5AP2A 3PXZA 2F57A 1ZYDA 3MTLA 5EKNA 5HORA 2XK3A 4ITIA 4QP7A 4RX7A 3SW4A 3QL8A 3HRCA 3AMYA 5ETAA 2OXXA 5EOBA 3R1YA 5D1JA 2QU6A 3V5QA 4ONAA 2HZ4A 1ATPE 4HVGA 4AE9A 3VS5A 4JJRA 4M0YA 4EWHA 3VC4A 3P5KA 3IW5A 5HNGA 3HUCA 5A3XA 2GS2A 2GNHA 4Y95A 2GHMA 1CKPA 4CYJA 2ZMDA 2C1BA 2R3PA 3SDJA 3ENHA 4WSQA 3RM7A 3BU3A 1WCCA 5LMKC 3R22A 2B1PA 1YXTA 2DWBA 3CLYA 4UWCA 3VIDA 2QQ7A 4KRDA 3TL8A 3G6GA 3LJ1A 3CGOA 5D12A 1LUFA 4I6BA 4ZSGA 4BYIA 4ANOA 4R1YA 3D14A 4YJVA 2BAKA 4UY9A 4O2PA 4HGTA 4C7TA 1M7NA 3HGKA 5EHOA 4WT6A 5FLFA 2YZAA 3E64A 3IOPA 5CT7A 5DGZA 3WIKA 3QQHA 4CQEA 3FQHA 5E8VA 5DI1A 1XH9A 3EQRA 3VNTA 3LCOA 3QZGA 4FKUA 3VBTA 4F0IA 4ZTHA 1LP4A 5A6NA 2WMRA 3FI8A 2F4JA 4O27B 3GNIB 3OY1A 2O64A 1J1BA 4OBQA 2PVJA 5JT2A 2PZRA 1SNUA 2Y4IC 3MVHA 4FIEA 1QMZA 4YC6A 4O84A 4ZIMA 4FI1A 3BHUA 5CU3A 5DPVA 5L2TA 2PVYA 2H6DA 4OT5A 4Z3VA 3RPVA 2XB7A 3TEIA 5HZNA 4MXYA 3QTIA 3F7WA 5CVGA 2VTLA 3FI4A 1CM8A 3NAXA 2QKRA 3PG3A 5HG8A 4FZDB 4A9YA 2W17A 1XH5A 2PZYA 3Q04A 3CJGA 1OKZA 3LFQA 1FBNA 4JOAA 5HE3A 5TR6A 5DEWA 2YM4A 3FYKX 2A4LA 5A4EA 4QP1A 4XRLA 1MQBA 3F5UA 2QONA 3E8EA 4L52A 4P7EA 3NVMB 2QOKA 5IDNA 5HIBA 2BAJA 4OTRA 1XH7A 4L7FA 4WNKA 5DT3A 4PPAA 5FQDC 3MN3A 4XBUA 3SV0A 4HW7A 3TXOA 1OPKA 4FKSA 4KS7A 4NH1A 4RQVA 4C2WA 2C69A 5IA4A 3KN5A 4WKQA 2BR1A 3D5UA 1VZOA 4IQ6A 4BDJA 2NPQA 3CQEA 4IX5A 2FO0A 3KXGA 2W5HA 4BF2A 2XRUA 4I94A 1BX6A 2GTNA 4F4PA 5M4FA 3ORZA 4FIGA 3VQHA 3FMJA 1Q99A 4RX5A 3C50A 4TZRA 5I9WA 3OC1A 4L67A 4QP3A 3SRVB 3ODYX 4YSMA 3ZO2A 5BVNA 4IB3A 5AV4A 3ROYA 3LW0A 4RVKA 5JGDA 2R64A 3LIJA 2I0EA 3I4BA 3VF9A 4EOIA 5LMKA 4BZDA 2OZAA 3ZLSA 3FI2A 4OAVB 4DBNA 2QD9A 2VX0A 4GK3A 4PY1A 4LRKA 3DLZA 3NW5A 3FL4A 2X9FA 3Q53A 2YCRA 4AS0A 3R0TA 5AWMA 3R7GA 3KXXA 5E8WA 2YCFA 4ZY4A 1Q24A 3MDYA 3GP0A 1MRUA 4FKLA 4GW8A 4CFUA 4JAJA 4M3QA 2OW3A 3I7BA 5CI7A 2ITQA 5DEYA 4FGRA 4F7SA 4GK4A 3ALNA 3R28A 3FMNA 5EI8A 3E7OA 4C3RA 3ZTXA 1DM2A 3W2SA 4NYEA 2IVSA 1GZNA 1UU3A 3FL5A 4FTLA 3R7UA 5CZHA 4QMXA 3WI6A 4QO9A 1DI9A 3PZEA 3QD0A 1OMWA 4GFGA 3VRZA 4O7NA 4G31A 5HG9A 5DRDA 2F2CB 4X6RA 4FV8A 4DE4A 4O6LA 4S31A 4AA4A 3BLHA 4WBOA 2Q0NA 1OPJA 2GU8A 4O82A 2JKKA 3TV7A 3ANRA 4BCIA 4CCBA 2PUUA 1WMKA 4CFXA 2C0OA 3L8XA 2XKFA 3MVJA 4BYJA 3PLSA 5HVYA 3ZFYA 3II5A 1W0XC 4RVMA 3LFBA 4I5MA 3MB6A 3NCZA 2HXQA 3R2YA 4L9IA 3C4XA 2HYYA 5GJFA 2IW9A 1J3HA 3HV7A 2I40A 3R8PA 3VS7A 2WMQA 4IADA 3AC1A 3TZ8A 4AZWA 3OT3A 3D7TA 3U8WA 2I7QA 3QCXA 4IFCA 3UE4A 4IH8A 2Y6MA 4QMNA 4CMTA 5JEBA 3IKAA 3RAIA 4IHPA 4KNBA 3QTZA 3COMA 4ZSLA 5AP0A 3SXSA 2ERKA 4TY1A 3I60A 3WYYA 5K9IA 4JDJA 4D9TA 4XV3A 2XKDA 4R5YA 1BL7A 2X8IA 4PP7A 4NCTA 5IF1A 4PX6A 2IZSA 4FKQA 4KS8A 1UU8A 4H05A 4HYHA 3RINA 1WVWA 5FBOA 4BGGA 5A14A 4F1OA 2B53A 5HCXA 3ZU7A 2ERZE 3PIZA 4QMZA 5BMMA 5HLWA 5IG1A 3ORPA 2NRUA 5JRQA 1B6CB 3LFDA 4RJ7A 4C59A 4O0YA 3VS3A 4RJ6A 3R7VA 2OJJA 4L53A 5EQYA 4QMLA 4XG9A 2W1FA 1M52A 2O65A 3MA6A 1YOJA 2QURA 4M84A 5AR5A 3GC8A 4QMPA 2I1MA 3U4WA 2GNJA 3BGPA 4QP2A 3LXNA 2PVFA 3F2AA 3PTGA 4RWKA 4B8MA 4C8BA 4QTCA 3CY3A 1M7QA 1REKA 2Z2WA 3KQ7A 2YFXA 2YWPA 4R3CA 5EG3A 3QYZA 3RK7A 3KFAA 3O0GA 1TKIA 1XQZA 5DHJA 4H58A 2WIPA 2X2LA 3CBLA 3F61A 3S00A 5ANOA 4GG5A 5GIOE 4V01A 3T9TA 3IW8A 5B0XA 1I44A 3IGGA 1OIYA 3PIXA 5FEDA 4FKIA 4LV8A 3TNPC 4AP7A 3ZM9A 4JIKA 3R7YA 2WELA 5F4NA 2IO6A 4DFNA 2PVLA 4O91A 2VWBA 4C34A 2WMUA 4ALVA 3D83A 2OBJA 3KRWA 3S95A 2B0QA 4KSPA 3UZRA 3GFWA 3LFFA 1ZYLA 5M09A 2BZKB 3CGFA 3E8DA 1XWSA 4NW5A 2R3FA 4YC3A 2UW7A 2IZRA 2O2UA 4EH2A 4OTDA 5BVFA 2W05A 2VWWA 4S2ZA 4C3PA 1IR3A 3NPCA 3PVGA 4KSQA 4K0YA 4I23A 2X7OA 3P7CA 4FTQA 5LMAA 3EL8A 3UOHA 5BVEA 4Z7GA 1P4FA 4JQEA 3NUNA 4P4CA 5B2MA 2VV9A 1P14A 3QRKA 3VBVA 4AW2A 1ZOEA 2XJ2A 3AC4A 3KEXA 3U9NA 3RWPA 4F70A 4FT0A 3G5DA 4U97A 3ZRMA 2BALA 2QO7A 3EYGA 4BCOA 5HE2A 5C26A 5FM3A 5J7HA 3MFUA 3QKMA 3NUYA 4QOXA 5IUIA 4M68A 3ITZA 3NZ0A 1A48A 3GU8A 2O5KA 3O96A 5EQEA 2J4ZA 4TWOA 5FXRA 3UQFA 3DB6A 4I24A 4BTKA 5IA0A 2C5VA 5AR7A 4WIHA 1BYGA 5ETCA 3OOGA 3QUDA 3FQSA 4EJNA 3KU2A 4B8LA 5BYYA 4C58A 4G3EA 3HA6A 4Y8DA 2BZIB 2HW6A 2XIKA 1OPLA 4FL3A 5DOSA 5LVLA 2IPXA 2WTJA 4G3GA 5EW9A 2W5AA 4JDKA 5K5XA 2VD5A 4W8EA 3TV6A 1NVSA 3WE8A 3C4CA 1OZ1A 3QQUA 3QALE 4U79A 1Z5MA 2XNMA 4MXXA 3V01A 4I22A 4S34A 5KMMA 2YEXA 2R3GA 3EN9A 4TYHB 4A9RA 4DF3A 2C3KA 5EDPA 4A7CA 1RDQE 4PPBA 4ZTNA 2UUEA 3GT8A 3MFTA 4B7TA 4J95A 5AIKA 1UNLA 4M69A 4ZMFA 1O9UA 3NIZA 4UALA 3KC3A 1WBOA 3TT0A 2QOLA 1XHAA 3MS9A 3LCDA 2XCHA 5DR9A 3VAPA 2B7AA 4YJSA 4IAAA 1Q41A 1R3CA 3EOCA 2DYLA 5JFWA 3LMHA 2GNIA 5CVHA 1PXIA 4FIJA 3C4FA 4A4LA 1YWVA 4X0MA 1GIIA 2CSNA 3AG9A 4FL1A 4UWBA 2C6TA 1KWPA 3V51A 3VVHA 3HMIA 5CT0A 4ACDA 4YBKA 1PMEA 4RWLA 3CSVA 2YERA 3KVWA 3SVVA 3IW7A 4XV1A 4XNEA 3MPMA 3D2KA 4FNYA 3DAJA 2ZV8A 5I4NA 2FSLX 3SOAA 4I5HA 2A2AA 2P55A 2ZB1A 3GCVA 3DFCB 3OY3A 5ETIA 3VUDA 3R9RA 2IW6A 3JS2A 2GS7A 4E6AA 3Q5ZA 4EOMA 1MRVA 2YM7A 2PE0A 3BHYA 2YAAA 4J8NA 3O8TA 4UZHA 2BTRA 3E87A 2RF9A 3CIKA 4TNDA 5HEZA 1JKSA 5CASA 5E8XA 2HW7A 3S3IA 4MD8E 2W1IA 2YJRA 2V5QA 3QTRA 3UBDA 4M14A 3R00A 3NWWA 3CTJA 3R01A 2JAVA 3BYOA 1K2PA 4IEBA 4FSTA 4KABA 1W82A 4HGEA 3ZFMA 2BFYA 2R0IA 3WZEA 5AR2A 5CF4A 4MWIA 2J0IA 1IG1A 4J53A 4C4EA 4TW9A 1JBPE 2QHNA 4QP6A 2YIRA 3ZUTA 5CY3A 2PZIA 3IO7A 3MY1A 4AW0A 1KE5A 2J90A 4L46A 2AUHA 2W1CA 1BI8A 5EI2A 2R3RA 4LGDA 5E1EA 5FDXA 1U46A 2XKCA 1E1VA 4I41A 4V0GB 2YZLA 1YKRA 4EORA 4PL3A 2JC6A 3TI1A 3EFKA 3G6HA 3GCPA 4DH1A 1LPUA 5I0BA 5JGAA 4U3ZA 3ZZWA 3LKMA 3PP1A 4HCUA 3P78A 5CSPA 3PDTA 3BE9A 3FMHA 2QOQA 4F9BA 1CKJA 1M2RA 4FEUA 4C4JA 4U81A 1M14A 3H0YA 3NCGA 5M44A 3KK9A 3SRVA 4F9YA 2UZUE 1IASA 4IXPA 4KBAA 3UVQA 4GIHA 4AE6A 5DE2A 3QCQA 4O1OA 1ZAOA 5EYKA 4RPVA 5CI6A 3QXPA 1S9IA 4IB1A 3UQCA 2OJFE 2SRCA 4YUQA 4GRBA 3JY9A 3BQRA 4GU9A 5IQBA 5CS6A 2VWVA 1XO2B 2OZAB 4J52A 3FLZA 5CZIA 3VBXA 4BCHA 3F3ZA 4FV7A 5IEVA 4ZZOA 2RGPA 5E1SA 2OGVA 3OROA 4EH3A 4EKLA 3FLNC 4K1BA 3R02A 3ORKA 4ZLZA 5H8EA 4KKGA 1U5RA 4BGQA 5FGKA 4FT7A 4MNFA 5M4IA 4P5QA 3V8WA 2PL0A 4FTRA 1AD5A 4XG7A 3GQLA 2WMVA 3WZKA 1XBBA 5L8LA 5HIEA 1PKDA 3OBJA 4OTHA 2HWOA 3OWJA 3OW3A 4IWOA 3MH3A 4PPCA 4XX9A 2YCQA 2FYSA 2G01A 4OBOA 2PSQA 4Q2AA 4O0XA 4D4SA 5ACKA 5AUYA 3GU6A 4TWNA 3EKKA 5EW8A 2FSTX 1V1KA 4II5A 4QNAA 4PDYA 3BYVA 4RIWB 5IZFA 3T8OA 3D9VA 2UV2A 4B0GA 2WTVA 4DTBA 3MY5A 1OL5A 3GCQA 4WHZA 1KOAA 3VBQA 4NT4A 1BUHA 3BEGA 4AOJA 5EK7A 2Y8OA 4JR7A 1NVQA 1Q8TA 2BFXA 5FBNC 4Y73A 1B39A 1DAYA 3QTUA 4O1PA 1H4LA 3C0IA 4M15A 5E8UA 5HNBA 1R0EA 2QC6A 5KBQA 3D5VA 3DPKA 3ZZEA 4D28A 3VRYA 2BILB 4KKHA 4EKKA 5CXHA 4XUFA 4ZY6A 3Q9YA 1BKXA 3R7OA 4CV8A 3NX8A 3BRBA 3OWPA 4P2KA 4FTIA 4HGLA 4I6QA 3FV8A 4GH2A 5IQFA 5CNNA 4FOBA 4C4GA 2ZV2A 3ZFXA 2PULA 3QQKA 2UVXA 3C4WA 1KE9A 2YISA 2R5TA 3PPZA 3A8XA 5KMLA 3HAMA 4RLKA 5C4KA 1L3RE 5T3QA 4I21A 4D4YA 3QUEA 4YZ9A 1YXUA 4KIPA 4EOKA 5LWNA 4QYEA 4CRLA 1QL6A 2BKZA 4E26A 4O96A 3F66A 2GHGA 4C4IA 4JIAA 5F20A 5LVMA 3KVXA 4IB0A 4WG4A 5BUJA 5BX0A 4YJPA 2CJMA 2YDJA 5D7VA 3GC7A 3NUSA 3EHAA 5L2SA 1KSWA 5IMXA 2F9GA 4X2NA 3ROCA 3V6RA 4JG8A 4F0FA 2ZM4A 2QLQA 1TQIA 4GT4A 4BCQA 3LPBA 3UYSA 5IU2A 3HL7A 2BRBA 3R1NA 4IZ7A 3W8QA 4AN9A 2VTSA 3QX2A 3ZMMA 3FSKA 4MBLA 3ORIA 4FC0A 4FYNA 4IDTA 3P86A 4JI9A 4RWJA 4YP8A 2IJMA 3OTUA 3RNYA 1E9HA 2R7BA 3AOXA 3FDNA 4QMYA 5BPYA 2PE2A 3PP0A 2VO3A 4GJ3A 3VS2A 5HG5A 3UO4A 3UZPA 4D5KA 4BWKA 4GG7A 1YI6A 4G2FA 3AGLA 5CSWA 3PUPA 4DYMA 4IAYA 4BWPA 2EB2A 4BIEA 3PY3A 4C36A 2YIXA 4CFWA 3R7IA 3UC4A 1R1WA 3OD6X 4ZJIA 4ASZA 2RSVA 3VO3A 3LCSA 4XOZA 3QA0A 5M08A 4FZFB 4KIQA 4EH4A 3GFEA 4KIKB 3EFLA 3R1QA 4QQ5A 4AT5A 4BWXA 2O63A 2CKPA 1Y8YA 5KZ0A 3ZC6A 3L8SA 3U54A 5IEYA 5F9EA 4X2JA 4OTWA 4BCMA 3IDBA 3DB8A 3EN4A 3VJOA 3FLYA 5CALA 5CU0A 2OJGA 5AR8A 4R7IA 5IKWA 3QA8A 3VUKA 3FBVA 4J96A 1U54B 2Z7LA 3R83A 2VTTA 4GL9A 1KV2A 5K3YA 1UV5A 2O3PA 1UU9A 2B9HA 4F0GA 5CEKA 4I5PA 4BHZA 1PF8A 5DNRA 4RZVA 1H28A 3W8LA 2Z7QA 4F9CA 4LYNA 5CAQA 2VTOA 3DZQA 4QTAA 5HE1A 5IISA 4GSBA 4FV2A 4IANA 1OBDA 2C3LA 3MFRA 1FGKA 2B54A 4HGSA 4IC8A 2W06A 3BKBA 4BZNA 3LOKA 4N6YA 4A9SA 4Z9LA 5A6OA 1UNHA 2VGOA 2RG6A 3U87A 4FVPA 2BRGA 1BLXA 2UVZA 4U8ZA 3TJDA 4CFFA 3G9NA 4DEDA 1AQ1A 3DGKA 1GAGA 3FXXA 3QXOA 4FGBA 3U4UA 2WMTA 4XH6A 3FMKA 5LVOA 4HNIA 3UYTA 5CANA 4NIFB 4XRJA 3RPSA 2FGIA 4A9UA 2OLCA 4X2GA 2VTHA 3UOLA 4OTPA 1YDSE 3E63A 4FEQA 4G3DA 3O2MA 5EFQA 3S2PA 4IB5A 3FKNA 4FZAB 3UG2A 5A9UA 4YR8A 4IX3A 4JBPA 2BPMA 2V62A 2X9EA 2ZDTA 3QTXA 4FV9A 2JIIA 4USEA 3FMDA 1SM2A 1WAKA 1OIQA 4O86A 4QTDA 2OIDA 2YIYA 3NEWA 4FTTA 4FT5A 3QU0A 3F7ZA 2OK1A 4PF4A 4E4LA 3C5UA 3KXHA 4RVTA 2NNWB 2ITXA 4PTGA 3GB2A 3W33A 4CZYB 3NYVA 4MF0A 4V05A 5L4QA 2W99B 2YM3A 5HE0A 2H34A 3Q9XA 1Q3WA 3I0QA 3TNWA 3ZONA 4X3FC 4AW5A 2C68A 2XYNA 3QZHA 3KL8A 3P1AA 4IJ9A 1ZY4A 3VN9A 2F7ZE 3DJ5A 1QCFA 3LFCA 3LXKA 3Q4ZA 4ENYA 3LCTA 4KB8A 3HMMA 4YZDA 1F3MC 4C37A 2Q0BA 4DGLC 4CNHA 2RKUA 1JSTA 3EZVA 2J6MA 4IIRA 3WE4A 4BCPA 4F1MA 4PTEA 5HX8A 2UZWE 1PXKA 1YW2A 3O7LD 4U43A 1PKGA 2OO8X 4K6ZA 1H24A 3VUGA 2XK7A 3AD5A 2J51A 3PE2A 4BCJA 4ZK5A 4TYJA 2BHHA 4ASDA 3MVLA 2E9UA 2CLXA 2VNWA 3RAHA 3FAAA 1R78A 3R7EA 1RJBA 5DR6A 1PMNA 2XF0A 4F9WA 4EH8A 4MX9A 1XH8A 4YHFA 5IA5A 4PTCA 2OSCA 1H26A 3CS9A 4GS6A 2R3NA 3DBFA 3OT8A 3R63A 4ZY5A 5FUTA 1JQHA 5LMBA 1Y8GA 3AT2A 3BPRA 2QOCA 4DLJA 2EWAA 2UZOA 1Y6BA 4AXAA 4LRMA 5EM6A 2EU9A 5E8ZA 2Q83A 2Z7RA 4PNKA 3NYOA 5C8KA 2FVDA 4BB4A 1BMKA 2P2HA 4R6VA 3VULA 5L2IA 2UZNA 4QPSA 5AM6A 5E7RA 4F08A 4Q5EA 5J8IA 1OBGA 2JEDA 3UDBA 4FEVA 1YI4A 5TT7A 5IQGA 4GVJA 3VUTA 4IAZA 4BDBA 5AUXA 4BBFA 4BDHA 4ZZNA 4RJ5A 4QP9A 4QYGA 1PXLA 1JKKA 4ZS0A 1QPJA 4QD6A 4BDCA 4OLIA 4EK8A 2XJ0A 4FL2A 2WMWA 3CEKA 3EJ1A 3ZSGA 4DT8A 4HCTA 3V5LA 4A07A 1Y6AA 4YHJA 3HV5A 3R21A 4QMUA 3M11A 4WBBB 3SAYA 3N9XA 3UIXA 2XJ1A 3F9NA 2QOHA 4YO4A 2PUNA 2QO9A 3DBDA 4GYIA 4EC8A 2R3OA 4O21A 3MY0A 4BI0A 4D55A 2C5XA 3ATSA 4O38A 5C9CA 4DH8A 4L68A 4Y72A 3RM6A 3KRLA 3RP9A 4BCNA 2C5NA 3O8PA 4FVQA 4IDVA 5M56A 4UX9A 2BZJA 1OECA 2JDSA 3OCTA 3FXZA 1M2PA 5JFSA 4IVDA 5CU6A 2ETRA 4AX8A 3I5NA 2WQNA 1SZMA 4AU8A 1NVRA 3S4QA 4A4OA 4EWQA 4C33A 1H1WA 3BE2A 1S9JA 3K2LA 4J71A 4RX9A 4FIFA 4E5BA 2B52A 4IX4A 4H3QA 5LVNA 2G1TA 2VO0A 2YLFA 3K5UA 4OTFA 5K4IA 2QCSA 2PVRA 3MESA 1OKVA 4UB7A 1QPCA 4WUNA 5A54A 3Q4TA 4BIBA 2CNQA 3KULA 4U40A 4R78A 4JQ7A 3CKXA 3MH1A 3DXPA 2OG8A 4JT3A 3W2CA 5GZ8A 3AMAA 4CZTA 4JBQA 5IEXA 4IM3A 1H0WA 2YHVA 4IC7A 4D0WA 4MXZA 4FG7A 4YJNA 5HHWA 5CLPA 5FTOA 2ZVAA 3BHVA 3MGYA 4O7VA 4ZZMA 3OFMA 4NCTC 3RZBA 4TYGA 5JK3A 5ETFA 5CQWA 4LFIA 5A46A 1VYZA 3NNUA 3OOMA 4C61A 4FKWA 1F5QA 2JITA 4M66A 4U41A 4X21A 4ZAUA 4AZFA 5DRBA 4EOLA 1LEZA 4MQ1A 4CT1A 3B2TA 3ELJA 3KCKA 3DLSA 2YACA 4TN6A 4AA5A 4KRCA 3EQCA 3HV6A 1JSUA 2IZTA 4JR3A 1KUTA 3SXFA 3LJ2A 3F2RA 4M8TA 4BCGA 4RX8A 5J9LA 3TJCA 2VWYA 3A61A 4E3CA 3VS1A 4D0XA 4U45A 2ITZA 3RZFA 4GFMA 4K33A 1OIUA 3HV4A 2R3KA 3QX4A 4FTNA 3ZCLA 3B2WA 4O0TA 4FK3A 4K11A 4DFXE 2XH5A 1ZZ2A 2JDRA 1TQPA 5DT4A 1MRYA 1ZMVA 4ID7A 4FA2A 3LVPA 3ZEWA 4Q9ZA 5LWMA 3FZ1A 3CTHA 4AZEA 1FPUA 2IW8A 4XYFA 1T45A 2BDJA 3I7CA 3ATTA 2CHLA 2BRHA 5C01A 4X6QC 2UZDA 4USDA 4O81A 3C1XA 2V7OA 3DT1A 5EHYA 4XBRA 5FP5A 4BR3A 2QLUA 4K8AA 3BWJA 1GJOA 1O6LA 4ZP5A 4N4SA 5KZIA 4YNEA 4FSUA 5LOHA 4FEXA 2UZLA 2VTJA 1ZXEA 2X1NA 4NZWB 4BFMA 3A7IA 4OUCA 3BCEA 2VX1A 3O51A 4UV0A 3DXNA 4L6QA 3K5VA 4IACA 3FMLA 2QODA 2LAVA 3TKIA 4DN5A 4I0RA 1ZWSA 2NP8A 3LZBA 1WBSA 3PSBA 5AA9A 2P2IA 1NT2A 2W5BA 2CCHA 4HJOA 2QOOA 4BTFA 4NM0A 4D5HA 4WRGA 5ACBC 3ZRKA 4L01A 3FEGA 5KKRB 4G6LA 1ERKA 5F1ZA 1GNGA 4EI4A 2VO7A 3DAEA 3PVUA 2B55A 3ORXA 1VYWA 3Q3BA 2OKRA 1IAJA 4YLLA 3IONA 3R8UA 3A7HA 4PQNA 3MW1A 1J7IA 4AGUA 3DOGA 4J97A 3ZSIA 4EL9A 4ERKA 4FE2A 2OICA 1YHSA 2BZHB 4GYGA 4X2KA 3ZO1A 1YWRA 5G6VA 3C51A 3PY1A 2G9XA 4YSJA 5FWKK 3DK3A 3L9LA 3MI9A 4EQCA 1KOBA 4ALUA 4NJDA 3C9WA 3UG1A 3SG8A 2VUWA 3OWLA 3Q9WA 3T3UA 2QKWB 3G51A 3NUPA 2I0YA 5H8BA 4MHAA 5GINE 4YGAA 4K18A 5D41A 4MQ2A 4EH9A 5KX8A 3NIEA 2W7XA 5M57A 1IRKA 3TG1A 1PY5A 3A7FA 1WFCA 5HI2A 4CMUA 2BUJA 5CAOA 3PPKA 3D7TB 5DH3A 2UW4A 4H3PA 3D94A 4FOCA 4RC3A 4FKJA 3RTPA 4LUDA 4TTHB 3LQ3A 4LG4A 5JKGA 3FLSA 2B9FA 2CDZA 2JAMA 3CJFA 3RGFA 1PW2A 3PFQA 3V5TA 3QF9A 1UWHA 4HVHA 3F3WA 3PG1A 3PY0A 4O83A 1FVVA 2C30A 2YIQA 3GI3A 4CTBA 3A62A 2PVMA 5E91A 2R3JA 3DZOA 3HECA 3DY7A 3PXKA 4NIFA 3CQUA 4D1SA 4G5JA 4NM5A 2BIKB 3QHRA 2ZV9A 4EH7A 4Y85A 4G3CA 1Z9XA 3BYSA 4F6WA 5HBEA 3VHKA 2B9JA 2CKQA 2PU8A 5ANGA 4ENXA 1YDTE 2VTNA 3RPRA 4E8AA 3FZRA 2JIVA 4AZSA 1Q8ZA 3EQFA 3A4PA 3UGCA 3DXQA 5JRSA 3QC9A 3QGWA 5E8TA 2Z7SA 3G90X 4DFUA 1OIRA 5AV1A 3K54A 4PWNA 4C0TA 4MXOA 4WUAA 4KD1A 4TXCA 4LOQA 3NW7A 5M07A 3QD4A 5DYJA 3PXQA 4EYJA 4RZWA 3R8VA 2C6DA 4I6HA 4Y5QA 3UNKA 3FY0A 2CGXA 4EK6A 3ORMA 3UMXA 3DDPA 4OGRA 4WNOA 3UMWA 3WF8A 4K2RA 5J1VA 4TYIA 2W0JA 3WARA 4XG2A 4FNWA 2BMCA 2J0MB 3LE6A 4WSYA 2ZOQA 2E2BA 2X4ZA 4YTHA 3QWKA 2BROA 2O0UA 1LR4A 4XHKB 2G15A 5D11A 2Z8CA 1H08A 5L6PA 5AP5A 4ZJVA 4JVGA 2X0GA 1HCKA 3AC3A 3ORTA 4CGAA 1OI9A 1T46A 2VU3A 3MBLA 4JQ8A 4LGHA 1WBNA 5CYIA 1KE6A 1GY3A 4QMVA 4QYHA 5FEEA 3UTOA 3F82A 1G8AA 3IG7A 2PMIA 5IUHA 4QPMA 5HIDA 4BDGA 3MWUA 3O17A 5F94A 4LOOA 2W1EA 2R3LA 4F64A 2PY3A 5HBJA 5ANKA 4XCUA 3SA0A 2IZUA
chains in the Genus database with same CATH superfamily
3UC3A 2W1HA 3F5XA 1ZRZA 3P9JA 4KA3A 4CKRA 2GDOA 4TRLA 1BI7A 3NMUF 1FVRA 2PWLA 5KNJA 4DG3E 4JBVA 4XS2A 3UNZA 4D2VA 3ZOSA 3CD3A 3PJ2A 4F7NA 4UMQA 2VTMA 3LFSA 4I3ZA 1MQ4A 3R73A 4RT7A 2QOFA 1FVTA 4XG8A 1U4DA 4ANQA 3QRUA 2E9OA 3HX4A 4C57A 3BHTA 2ONLA 4PL5A 4ANBA 1YXXA 1SMHA 2UW9A 4HCVA 4WNMA 3ACKA 2IVVA 5A4TA 3IGOA 4U80A 3K3IA 4GCJA 4E5AX 4FEWA 4AGCA 2WOUA 3QYWA 5H9BA 4FICA 4MBIA 4H1MA 4E73A 1ZLTA 3A7GA 3KRRA 4DDIA 4EJ7A 3BBTB 3DK6A 4TNBA 5HVKA 4HYUA 5AR3A 4X7QA 2YCSA 2GNGA 5IQIA 2F7EE 4KBKA 3AC2A 4TYHA 1ZMUA 5G1XA 4U42A 4FIIA 3VW6A 5IA3A 4C38A 1CTPE 4WD5A 1H1PA 5IQCA 3CC6A 4M69B 4X2FA 4YJTA 2JKMA 3WZJA 2H9VA 2BRNA 4M12A 2ONLC 3GVUA 3A60A 3NFGB 4DA5A 4FUYA 1UVRA 3EYHA 4CFNA 4E93A 4MH7A 4F99A 5HQ0A 3GQIA 5AUWA 1TQMA 4HYIA 4DEEA 2KTYA 4AFJA 3ULIA 3M2WA 3UIUA 3COIA 4UXLA 3MB7A 4C2VA 1JPAA 3EL7A 3IS5A 4KIOA 1FQ1B 2ZAZA 4IWPA 3W2QA 2OJ9A 2BTSA 3MTFA 4UYNA 4FUXA 3VUHA 4RA4A 3N51A 4GUBA 2XANA 3WBLA 3Q96A 4XG4A 3M42A 3KULB 5CSXA 2UZBA 3H10A 1H1RA 1NA7A 3IK3A 3QZFA 2PK9A 4JL9A 4BKZA 1E1XA 2EUFB 1QPEA 3OG7A 3OW4A 4YZMA 4D4VA 5M06A 4WG3A 4F6UA 2ITNA 5HBHA 3AGMA 5J79A 3FWQA 1XH4A 2GHLA 3RAWA 2XAMA 2OU7A 2PVKA 4DT9A 4JS8A 2X39A 2X6DA 5JMSA 1PXJA 1XKKA 3QTWA 4QPAA 4LV5A 4YC8A 3DDQA 2W1DA 5BUIA 2WIHA 2XUUA 3NRMA 2WO6A 5H2UA 4D58A 2G2FA 2HOGA 3FXWA 4CQGA 4CEGA 1ZYJA 5FXQA 4GV1A 4A06A 3QGYA 1STCE 1WBTA 2UW3A 4CLJA 1FOTA 3TYKA 4IVBA 2EVAA 2IF8A 1RQQA 3TTJA 5HLPA 1PYXA 5CAVA 5IH5A 4G34A 1YI3A 3BU6A 4KINA 5FP6A 5AUVA 3WF7A 4UMPA 3UO6A 4NKSA 3K3JA 1OUKA 2ZFYA 4BDEA 2OXDA 3NSZA 1PXOA 3P08A 2JD5A 2BCJA 2GS6A 4FF8A 4ZS4A 5HVJA 2GMXA 2ITWA 2C6LA 5ANJA 3R04A 2XK9A 5J1WA 3TIYA 4L3LA 3PJ3A 3JY0A 4FR4A 2F2UA 1H1QA 3EN6A 3IPHA 3LQ5A 4RFYA 2XBJA 4XJ0A 5KCVA 2F49A 1REJA 2J0KA 5E4HA 1XBCA 1K3AA 4MVFA 3SLSA 1VEBA 3R9OA 3KMWA 5LVPA 2G2HA 3TTIA 2W1ZA 4YZBA 1SVHA 2QU5A 5HO7A 3CR0A 4LRJA 3UPXA 5GZ9A 5EDRA 4BICA 5FTGA 5HG7A 1U5QA 3TACA 4QMSA 3OCGA 2P0CA 2C6KA 2PUPA 2WU6A 5EDQA 3MPAA 4UN0C 4DGOA 4APPA 1O6KA 3R71A 2ETMA 4EOOA 4YTFA 2JBOA 3QBNA 3SHEA 3KXNA 3PA3A 4NWMA 3CQWA 5AIRA 2GNFA 2V55A 1FMKA 2AYPA 4EQMA 3FZSA 2J9MA 4MXAA 4BDDA 2DQ7X 3THBA 5FTQA 4HOKA 1FINA 2X81A 4CZUA 4ACCA 4ERWA 4Y46A 4WNPA 3LFEA 4RIWA 3N4TA 3GCUA 1GIJA 3PA4A 5HD4A 4Q5HA 1IA9A 3CKWA 3KB7A 4IMYA 2GFCA 2ITOA 1Q97A 4I1ZA 4NEUA 3HP2A 4JRVA 3FPQA 4E6QA 5ITAA 3TUCA 2RFDA 3O8UA 4PDOA 4RFZA 4KKEA 4WA9A 3TZMA 3G9LX 5ANEA 1YXSA 1J91A 3LMIA 5KE0A 3LM5A 4RIYB 5DLSA 2WXVA 4ANSA 4DHZA 4GIIA 4QMWA 5T6KA 5J7BA 4BKYA 3ZH8A 2BAQA 2W1GA 1YDRE 1Q61A 1W8CA 2E9NA 4C02A 3Q2MA 2RIOA 2CGUA 3EIDA 5BVKA 5AUZA 1UWJA 4DGNA 4CG9A 5GIPE 5B2LA 3AMBA 2EXEA 5JH6A 2Y9QA 3DK7A 2CLQA 4BDFA 5L2WA 4RJ4A 4IBMA 5AAEA 4ZSJA 3HZTA 4QTEA 1ZMWA 2OIBA 4AGWA 3W0QA 1UU7A 2Y6OA 3DKOA 1Y57A 1ZOGA 4ZOGA 3G15A 2ZYBA 3W1FA 5EQPA 4FTOA 4BDAA 1Q8WA 4O0WA 2H8HA 2C6OA 4FT3A 3BQCA 2J5FA 4MD7E 1YOLA 4M0ZA 4TL0A 2A0CX 4F9AA 4AFEA 3FLQA 2XNGA 5KMOA 3UPZA 3KF4A 3QD3A 4CFVA 2P4IA 4O7TA 2I0HA 2WPAA 1P4OA 3C5IA 4GKHA 2WU7A 5H8GA 5CEIA 4L45A 4XEYA 4DGGA 4ZTMA 4MTAA 2C0IA 3DCVA 3A4OX 3KRXA 4EQUA 5HNIX 2VGPA 3UIBA 4FZ7A 3KCFA 3MVMA 4PNIA 5GJDA 1VJYA 4CMOA 2OXYA 4NKAA 1K9AA 3QAME 3Q52A 3LMGA 4GT5A 3AD4A 5L2QA 4EHGA 5HKMA 4LL5A 3TMOA 3U6JA 1URCA 2OF4A 2WQBA 2Y7JA 4TYEA 2WHBA 3ET7A 4HZRA 3W2PA 1WVXA 5IH6A 3GCSA 3S1HA 3U55A 3IDCA 4BY9E 3VS6A 4O0SA 4HVDA 2CGWA 3TDVA 2YDKA 4EOSA 4FKRA 3DS6A 4LL0A 4QYFA 3UVRA 1W2FA 3UVPA 4DH5A 3E7VA 4KIKA 4JBOA 4C62A 3W18A 3CPBA 3VONA 2HZ0A 4IW0A 4ANMA 3WOWA 3SGCA 2NYAA 2JKQA 3IQ7A 3H30A 4LQMA 3L9PA 4U9AA 3CCNA 3ANQA 2QG7A 4AOTA 4AZTA 3SW7A 4FSYA 5IQDA 4O4CA 4DAWA 2FA2A 3R2BA 1XJDA 2XRWA 3QQGA 4UXQA 5B2KA 5KHWA 3BV3A 4FTKA 1NXKA 3NAYA 2XA4A 5IQAA 1Q8UA 3SOCA 3HDMA 1OGUA 3EFJA 4FV3A 4EHVA 5CEPA 3NVKI 4JLCA 4J98A 4F7JA 2HENA 3D5XA 4QTBA 1M2QA 2J0LA 3WIGA 5FDPA 3PWDA 3PVBA 3KF7A 2ITYA 2YA9A 4FTJA 5CX9A 1YHWA 2WZJA 2XCKA 4FV6A 4YJRA 3VBWA 3VJNA 5KBRA 4IWDA 5BNJA 4D4RA 2UZVA 4AW1A 3I79A 2HY81 3V5JA 3ZM4A 1G8SA 2WMSA 3Q2JA 4X3FA 2VTQA 5CEQA 4XP2A 4YURA 3ZS5A 1HCLA 4ZJJA 5C03A 5BQ0A 3HUBA 2JDTA 3OUNB 2OI4X 5LCKA 5FXSA 4EYMA 4ALWA 4BIDA 5AFVA 3RK5A 3O23A 3ZC5A 2PZ5A 2XEZA 4QQJA 3UOKA 3TDWA 3C4EA 4AOIA 2ITVA 1X8BA 2WTKC 1KE7A 3LXLA 3OF0A 4E6DA 2JLDA 3NNXA 3W55A 3E88A 1O6YA 4EH5A 2CMWA 5HTCA 4L44A 3QKLA 3R9HA 4AXDA 1CKIA 1UA2A 1YWNA 4YHTA 1SVGA 5ANDA 4EOQA 3UZTA 4U0IA 3ULZA 2VX3A 5L8KA 4AQCA 4NM7A 4ZEGA 3EQGA 3PJ8A 4GJ2A 4R8QA 3RKBA 3TNHA 2HXLA 1V0PA 5HESA 2UW8A 3I1AA 3BIZA 4I6FA 2NRYA 2B4SB 2GPHA 4NUSA 4RGJA 4AAAA 4EOPA 3GU4A 2CN5A 4FT9A 4OBPA 4RC2A 4YBJA 5AP1A 3CY2A 4QMQA 2VWXA 3HKOA 5AJQA 4DG0E 4EUUA 2HWPA 4EH6A 4DEAA 1PMVA 1FGIA 2OH0E 4XP3A 5CNOA 5I9UA 4KUJA 4JNWA 4F63A 3KREA 1OB3A 3P4KA 4OW8A 5I3OA 2QO2A 3EN5A 3U51A 2XALA 4U7ZA 5AMNA 3MIYA 1VR2A 2BVAA 2YITA 3ORNA 2W9FB 3WILA 3TZ7A 5HTIA 2YM5A 5FEQA 4O0RA 4XV9A 5BYZA 3EWHA 5CEMA 4MF1A 1YOMA 3DBQA 3MSSA 5TE0A 4HZSA 4JG6A 3GEQA 4BRXA 4B4LA 5HU9A 4W8DA 2XEYA 1JLUE 3KMMA 3NGAA 4N70A 1BL6A 4IJPA 3OXTA 4H36A 3VHEA 4AXEA 4CXAA 3E3PA 1H01A 1JNKA 3EFWA 3R8LA 2IVUA 4RVLA 5M51A 3ZLWA 4DHJA 1F0QA 1TVOA 3A8WA 4IZ5A 2R3QA 2ZV7A 4JX7A 5EYMA 1H25A 3R9NA 3EQPA 3ZLXA 5K5NA 4ACGA 2WGJA 4FSZA 5CF8A 5D9HA 3FKLA 4DFZE 4ORKA 5LQFA 5CVFA 4YMJA 4QP8A 1GZKA 3H9RA 2IEWA 4K9YA 2Y4PA 4PMPA 5K0KA 4ZTLA 5HU3A 2X2KA 2XNPA 3ODZX 3BEAA 4UMTA 4FG9A 5I9XA 3BU5A 5CU2A 1EH4A 1Q62A 3DA6A 2PZPA 3UOJA 5IPJA 1G3NA 5BV3A 4RJ3A 2J7TA 3V5PA 1OUYA 3QRJA 4G17A 3LAUA 3EQIA 3QD2B 4FSWA 4EK3A 4I5CA 1PMUA 4WOVA 2C6MA 4R3PA 4RG0A 5FRIA 5L8JA 1YRPA 4AN3A 2AC3A 3RWQA 3OZ6A 2HK5A 3JXWA 3QZIA 3F3TA 1PHKA 3GC9A 3QLGA 4OTGA 5AA8A 3R1SA 4PMMA 3WZDA 5CWZA 4MCVA 4D9UA 3Q4UA 1J1CA 4I0TA 3UNJA 4MBJA 3DFAA 2C5OA 2OIQA 1B38A 2HY0A 4LUEA 3ALOA 5HLNA 4FKOA 2XM8A 4JRNA 2CCIA 2WTDA 4RIOA 3OXIA 5CEOA 1KV1A 2VWZA 5AM7A 1OL2A 2XK4A 2YDIA 3OBGA 3R30A 5DT0A 4AA0A 3UDTA 2BKKA 5E90A 2J5EA 3W0OA 4O0UA 3VS0A 1ZY5A 1PXMA 2YAKA 3A7JA 5TO8A 3MH0A 5J9YA 4NFMA 3GC0A 4HPTE 4CLIA 2OH4A 3ZBFA 5IQHA 5J5TA 3KA0A 5DA3A 3QTSA 1OVEA 3RK9A 3AD6A 1W7HA 4FSMA 4LMNA 3LLAA 1XH6A 3IECA 1DS5A 3LFNA 3WZUA 5AP4A 5I5ZA 4EBWA 4E7WA 4E5WA 1ZARA 2HIWA 3EH9A 4JAIA 4NTTA 4RA5A 4O4BB 2X8DA 5C8NA 4R77A 4O4DA 4NJ3A 2YM6A 5AUTA 3H0ZA 4BC6A 4G9RA 3ZDIA 1XR1A 2Y4IB 1LEWA 3BLAA 4DCEA 2WEIA 3SXRA 4MYGA 4XG3A 3KKVA 3QQJA 2IG7A 3GU5A 3LM0A 1ZYCA 3RJCA 3JVRA 3CXWA 3ETAA 3TKUA 4EOJA 3TUDA 2WFYA 3CE3A 3RPYA 5I3RA 4M13A 3GENA 4DBXA 4AN2A 3NLBA 2X6EA 4FTAA 5HOAA 3U6HA 5AP3A 2XIXA 3BGQA 2I6LA 3V6SA 4FODA 4IAFA 2WEVA 3R9DA 4C4HA 4DEBA 5CF5A 2PUIA 3RVGA 4O6EA 5DWRA 4Z55A 1H27A 4L8MA 1WVYA 4EZ7A 4GKIA 2J2IB 1H00A 1KE8A 2IVTA 4DHFA 2AC5A 3MFSA 1RE8A 4GK2A 3Q60A 2QVSE 3T3VA 3AXWA 1APME 2VWIA 5DG5A 3B8QA 1R39A 2VTAA 4FK6A 4W4VA 5LCJA 3TZ9A 1JVPP 3C7QA 3DKCA 3PJ1A 1OKYA 1H1SA 4ITJA 4KWPA 3F5GA 4RBLA 2VTPA 3RCDA 5JQ8A 5EYCA 4G9CA 3F5PA 4DEGA 4BJJB 3HNGA 3SD0A 4NTSA 4YPDA 3RHXA 4D1ZA 2XM9A 3OHTA 4XMOA 4LOPA 1PJKA 4O7YA 4H3BA 3LLTA 3N4UA 3OXZA 5E9EA 5DR2A 4ZLYA 4FKTA 2WD1A 1DAWA 3PSCA 4KAOA 1L8TA 2YWVA 3P23A 3SX9A 4CRSA 2JFMA 4O7RA 2R4BA 3D7ZA 5GHVA 5EM5A 3QRTA 3E8NA 5EYDA 2C3JA 4GUEA 3H3CA 5FG8A 1IEPA 3G0EA 2C5YA 4EK5A 4F1TA 3BWFA 3D5WA 3L1SA 3FZPA 3F88A 3VUIA 4JG7A 4Y5HA 1GZOA 3DQWA 3Q6WA 1W83A 2XS0A 4IAIA 4V04A 4X3JA 2PTKA 4YU2A 3GU7A 4YJOA 4GVAA 4M67A 4UYAA 2GFSA 3E92A 1UKIA 2ZDUA 4MK0A 1NY3A 5LARA 5A4QA 2LGCA 5HCZA 1GZ8A 4JXFA 4XG6A 5JFXA 3I81A 1J7LA 1ND4A 2OFUA 4AACA 3N4VA 2A27A 2IN6A 2YN8A 5IH4A 3KXMA 4OR5A 2BDFA 1ZZLA 4WG5A 3W2RA 4CKIA 2QI8A 4FMQA 2PE1A 4R7BA 4NU1A 4C3FA 5C27A 4L7SA 3QC4A 4YZNA 1OL1A 2CKEA 1OKWA 2WQEA 5KMJA 4W4WA 1JSVA 3V5WA 3Q6UA 3ZXZA 3Q9ZA 4LM5A 4RIXB 5EM8A 3PRIA 4YTIA 3PJCA 4ZMEA 3R8MA 4B6LA 4TKSA 3D0EA 3RCJA 4ASXA 2EXMA 5E92A 5J87A 5C1QB 4FKVA 2UVYA 5CQUA 4BI1A 3P7AA 3G2FA 4J7BA 1G5SA 5D10A 1PXNA 2OJIA 2QOBA 4FKPA 4R5SA 3BHHA 5FM2A 5L6OA 2GTMA 3FC1X 4I92A 4OT6A 4XP0A 4P90A 2NO3A 5HO8A 1TFFA 2QG5A 5M4CA 4IAKA 3SC1A 4MKCA 3C0HA 1CSNA 1HOWA 2V22A 3BBWA 4APCA 4DG2E 3POOA 3HAVA 3PXFA 3FHRA 2UW5A 3GOKA 3PWYA 1OL7A 4IZAA 3ZYAA 4MNEA 5J95A 4TWPA 2RG5A 2XP2A 3FKOA 2JFLA 3NYNA 5CAUA 3W0SA 2CKOA 5I9YA 3GOPA 3A99A 3I5ZA 3RNIA 3DKGA 1PYEA 2ITUA 3RBWA 4G3FA 2QOIA 5HX6A 4I4FA 4YTCA 1SVEA 3NNVA 5CENA 3PIYA 5J5SA 3UO5A 3OEZA 4X3FB 4XLVA 4BDKA 3LQ8A 3ZSHA 2W96B 3AC8A 2R3MA 4NM3A 5DFPA 3EQBA 1NW1A 4O7LA 4EZ3A 3CPCA 3EQHA 2B9IA 5KHXA 5LXMA 3R6XA 1XMLA 2XYUA 2HZIA 4FKGA 4OAUC 2UW6A 3CTQA 3RHKA 5I9ZA 2E9PA 5KMKA 4ZTSA 4EUTA 5AEPA 3E3BX 3BYMA 4FRFA 3HA8A 4HVIA 5A4CA 3MH2A 4NFNA 2W4JA 4G6NA 2XK6A 4FV5A 4DFYA 4F78A 3FPMA 2DUVA 4AGDA 3VWAA 1Q4LA 3GUBA 4UZDA 4XOYA 4ZLOA 1PRYA 2AEGA 3OTVA 4J1RA 4EONA 2CPKE 3OEFX 5TOZA 3W10A 1WBPA 3LCKA 3IW4A 3PLAE 5EW3A 1JKTA 3C0GA 3UODA 4N57A 4ARKA 4M7IA 3RALA 2ETKA 4AF3A 2CNVA 3BLRA 4MUQA 4DFBA 3D15A 3L8PA 4AZVA 4C4FA 4ACMA 3LHJA 4DCAA 4MXCA 4F7LA 4PRJA 3AT4A 1WBVA 4FX3A 5BYLA 1SNXA 3G0FA 3PXYA 2F7XE 4GMYA 5AAFA 5LJJA 3I6WA 2CNUA 3PUFC 4PUZA 2C0TA 4LMUA 2JKOA 2RFEA 1P5EA 2QNJA 3TN8A 3UP2A 4G1WA 3KGAA 5T68A 1OM1A 5BVWA 3QLFA 4BHNA 3HMNA 4BN1A 3VS4A 2W9ZB 3D2IA 2FUMA 2X7GA 3JUHA 3I0OA 2VAGA 4O22A 3E93A 5TF9A 5IUGA 4QEBA 2WMAA 4ZSEA 2VTRA 2C4GA 3WF5A 2YIWA 3U9CA 4DHIB 3TIZA 3O7LB 2R2PA 3NYXA 2X4FA 1GOLA 3LFAA 4RQKA 3NUAA 2VRXA 1DI8A 2HZNA 3JPVA 3COHA 5K4JA 2PMOX 2XMYA 2GQGA 4E4NA 5GNKA 1AGWA 3F3UA 1IAHA 3OWKA 4IX6A 4S33A 2O8YA 3COKA 2G2IA 3NUUA 2QR8A 4FSQA 5EHLA 3OUKA 4Q9SA 4UEUA 5CSVA 3AT3A 4W9XA 2OWBA 4DTAA 4U6RA 2X2MA 4PMTA 4FV0A 3MA3A 3QKKA 3HMOA 2CGVA 1ZOHA 5F95A 2XNEA 3ERKA 4QMTA 4CD0A 3DBEA 4HVSA 5CXZA 2P3GX 2OF2A 2C3IB 5KMNA 3TM0A 2ITPA 2VWUA 1Y91A 2JGZA 3SKCA 3UP7A 3RPOA 5JGBA 2HCKA 3OMVA 4ZTQA 4Z16A 2A1AB 5DBXA 2GNLA 2UZEA 3ACJA 3VBYA 4PMSA 4ZXTA 4IWQA 3MJ1A 4R3RA 4XV2A 2C6IA 3FE3A 3HP5A 3WYXA 3ZDUA 4NL0A 4CFMA 3UDZA 2DS1A 3EZRA 4YPSA 3PSDA 5DN3A 4QRCA 3A2CA 3L9NA 3UJGA 4H39A 2JIUA 2XNBA 3BGZA 3ZUUA 4N6ZA 3QFVA 1W84A 1V0BA 3DTWA 3FHIA 4PL4A 4PDSA 4V0GA 3HVCA 1Q8YA 5FD2A 1OITA 4YO6A 4HYSA 2V7AA 4M97A 5I9VA 5CTPA 4DLIA 4OTQA 4DH7A 3H4JA 4E20A 2PPQA 4YLJA 4CYIA 5IDPA 2ZM3A 2UZTA 2V0DA 2IWIA 3BI6A 3AQVA 4FYOA 4QQCA 4CSVA 5JQ5A 5AV3A 5CAPA 5AV2A 3TNQB 4JDIA 1JKLA 4D2SA 5BMSA 4FBXA 4RJ8A 5M4UA 4G5PA 3DKFA 5GZAA 2FB8A 4O4EA 4BBMA 3W32A 4DEHA 5M55A 3QCYA 3KXZA 5GJGA 4A4XA 2R7IA 3BX5A 3DNDA 3DTCA 3ZO3A 2ZM1A 3ZBXA 1OL6A 3VQUA 2R3HA 2WNTA 5BVDA 4FZ6A 4FNXA 3EB0A 2E9VA 3HMPA 4GEOA 3DAKA 5AV0A 5L6WL 1PXPA 4ACHA 1XBAA 2VO6A 5CF6A 3BV2A 4NK9A 2WKMA 3UQGA 2VN9A 3P79A 2XKEA 3FY2A 2ZMCA 5H3QA 3QTQA 4CVAA 4BGHA 5IA1A 3F69A 2PHKA 4FTUA 4FG8A 5A4LA 1H07A 2EB3A 4Z7HA 2YLEA 3CP9A 5IA2A 1A9UA 3IDPA 4IE9A 3QQLA 4QMOA 2VNYA 3W16A 1WZYA 2X8EA 3H9FA 3PE1A 3PRFA 4G16A 2R3IA 2WTCA 1Q5KA 3PXRA 4EHZA 4S32A 3NDMA 3DNEA 3PPJA 1UKHA 3DV3A 4FJVA 2W4OA 3MV5A 4IVAA 4U3YA 3FYJX 3QUPA 5M53A 2OZOA 4O7SA 3ZHPC 3HRBA 3V3VA 3Q5IA 3OCSA 4PDPA 2C47A 4DFLA 2QHMA 2W4KA 3IW6A 3AKJA 3KY2A 4JMQA 3ENMA 3PZHA 3JVSA 3DQXA 2BIYA 2JBPA 5EOLA 2PYWA 3EQDA 4GU6A 2A19B 2XZSA 4MAOA 3ZXTA 2RFSA 3KMUA 3JR1A 4YJUA 4CT2A 3VUMA 5C8MA 2GQSA 2WMXA 2H96A 4BVUA 2XNOA 5J9ZA 3O5AA 3EMGA 4D2TA 1H0VA 4K77A 4HNFA 4L00A 4DGMA 4QQTA 1JAMA 1A06A 3GBZA 4O0VA 1H8FA 5HD7A 3BYUA 3POZA 3I6UA 2FSMX 3W0MA 4IM2A 4IZYA 3MJ2A 2ACXA 4ITHA 2PVNA 3NR9A 5AP6A 3S0OA 2PVHA 5HGIA 5DVRA 5JSMA 1MP8A 4H1JA 3BL9A 3OVVA 4ANNA 2Y0AA 2ZJWA 4NW6A 3Q4CA 5BUEA 4USFA 1CMKE 2JDOA 3TKHA 3UDSA 3TWJA 5BVOA 4RRVA 3CD8A 3NNWA 2R0UA 2RL5A 2WOTA 2XBAA 3BZ3A 3QRIA 4TWCA 3W2OA 4F6SA 2EXCX 5AADA 3LXPA 4TT7A 4BTMA 4EEVA 2PMNX 5JFVA 3D4QA 4WRSA 1ZYSA 3C13A 5TKDA 4DITA 4DH3A 4QYYA 3FQEA 4CG8A 1JOWB 4FTCA 1J7UA 4D2PA 2XK8A 2WB8A 4D1XA 4R1VA 3FUPA 2XIYA 4PV0A 4FVRA 4J8MA 2XNNA 3HV3A 4AT4A 4QP4A 3KK8A 4RIXA 4RIYA 2VTIA 4GT3A 2YJSA 5KO1A 2FSOX 3O50A 1U59A 2UW0A 3IOKA 4OTIA 3TCPA 3OP5A 3L8VA 5EH0A 2JDVA 4YZCA 4AUAA 3OS3A 4TPTA 4BBEA 3FSFA 3UIMA 3EN7A 3FMEA 3HEGA 1GIHA 4YJQA 4RC4A 4BI2A 2KULA 3LJ0A 1CDKA 4S30A 3HDNA 1U54A 4MD9E 4C35A 5AUUA 4BCFA 4E4MA 1Q3DA 2HELA 3ID6C 3ZLYA 2R9SA 4EBVA 1FMOE 1QPDA 2YM8A 4QT1A 3O71A 3NW6A 2XIZA 4MNEB 4KBCA 5K0XA 2BDWA 2GCDA 4FSNA 2OFVA 3PA5A 2C1AA 3MPTA 4QMMA 2Z60A 3FMMA 1M17A 3U6IA 4JDHA 3RMFA 2RFNA 1URWA 3WF9A 4L43A 4WO5A 3V04A 4PP9A 1YHVA 5E8SA 4D2WA 5ANIA 5IQEA 4UWYA 3VF8A 1WBWA 3PVWA 5E8YA 2XARA 4ASEA 2YABA 2ZB0A 2Z02A 3E5AA 1P2AA 3FZOA 3V8TA 3BELA 5JN2A 2QR7A 3SG9A 3P7BA 2X7FA 4LGGA 1I09A 4YLKA 5CU4A 1JWHA 4F65A 3VW8A 2FH9A 3JYAA 2I0VA 4B9DA 4FV1A 5HCYA 3T9IA 3REPA 4RMZA 3MYGA 4N0SA 3DJ7A 5KKRC 4E1ZA 4O7WA 5AX9A 3F3VA 4F09A 3HYHA 1RW8A 4CV9A 4L42A 2ESMA 3H9OA 1SYKA 4XLIA 3W0RA 5EKOA 3ZEPA 3M1SA 3ZRLA 4DEIA 5D7AA 3FI3A 4RFMA 3R8ZA 2VZ6A 3AC5A 3F6XA 4J99A 4UBAA 5KMIA 4ZTRA 4O2ZA 3B8RA 4I93A 3HRFA 5C4LA 1YVJA 3E8CA 3E62A 3ZUVA 4Y83A 4AG8A 3FJQE 4O7ZA 3FLWA 2WQMA 4IVCA 5EM7A 3RI1A 4BZOA 3G33A 2C6EA 3SQQA 5ICPA 4FV4A 4GFOA 2GQRA 4W9WA 2BHEA 3NS9A 4CTCA 3ORLA 4UMRA 3TNIA 4BL1A 2REIA 4E4XA 4ZSAA 4EZ5A 2WQOA 4R7HA 1XMMA 4I0SA 5HO6A 5AAGA 3ZO4A 3Q32A 3FZTA 3KN6A 3OCBA 4L3JA 4NSTA 3KIOC 3FC2A 2WMBA 2J0JA 3GXLA 4U5JA 5JZNA 3WF6A 1R0PA 4E6CA 4I20A 1IA8A 3DBCA 2WTKB 1YXVA 2XVDA 2ITTA 5KUPA 3QHWA 4FIHA 3L9MA 4BKJA 5HICA 4FNZA 5AP7A 3PYYA 1MUOA 4RLLA 5L3AA 2CN8A 3MIAA 3NUXA 3P0MA 3F2NA 4ANLA 5DIAA 3C4ZA 1Z57A 4RWIA 5AX3A 5HTBA 3V8SA 4JX3A 4DINA 3DU8A 4EC9A 4BDIA 3DJ6A 3HLLA 3TUBA 3KRJA 3GGFA 4CKJA 4UMUA 3QWJA 4G6OA 2P33A 1V0OA 4RSSA 1W2CA 5DMZA 4QNYA 4BTJA 2XIRA 4MEDA 4AWIA 4I6LA 4I4EA 4LI5A 4A9TA 4FTMA 4AT3A 1W98A 2BRMA 4EHEA 2WTIA 3BLQA 1YQJA 4P5ZA 3EKNA 5JZJA 4BCKA 5EI6A 5IMEA 4YNOA 1UNGA 3TV4A 4DC2A 4MWHA 2PMLX 3QCSA 4FSRA 3QQFA 4B99A 5B7VA 3RAKA 5CSHA 5AR4A 4HPUE 2HAKA 4L3PA 4EK4A 2GSFA 2WAJA 2WTWA 4IFGA 4CCUA 4DTKA 4IM0A 4U44A 4W4YA 4D2RA 2J50A 4W4XA 5AP2A 3PXZA 2F57A 1ZYDA 3MTLA 5EKNA 5HORA 2XK3A 4ITIA 4QP7A 4RX7A 3SW4A 3QL8A 3HRCA