4C4IA

Structure-based design of orally bioavailable pyrrolopyridine inhibitors of the mitotic kinase mps1
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
279
structure length
253
Chain Sequence
QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMTVNYMPPEAIKDMISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Structure-Based Design of Orally Bioavailable 1H-Pyrrolo[3, 2-C]Pyridine Inhibitors of the Mitotic Kinase Monopolar Spindle 1 (Mps1).
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 253
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2013-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c4iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c4iA01
2J9MA 2QONA 3QXOA 2VTMA 4OLIA 4QMTA 4S34A 5CTPA 4ORKA 4MBLA 3OW3A 4BR3A 1BUHA 5J1WA 4BCNA 2XZSA 1H24A 4G3FA 4GK4A 3LJ0A 3QLFA 1YXTA 3EB0A 4FF8A 4U40A 3GC9A 2ZV2A 5AWMA 5GZ9A 4A07A 1PMVA 2JKOA 1OIYA 1R78A 2EU9A 1MRYA 3CD8A 5DT0A 1U54A 1H1RA 3GU6A 2IW6A 3VJOA 4FA2A 2H9VA 3ANRA 2J5EA 3VUMA 2C6LA 3BYMA 3VS6A 4BZOA 5LXMA 4GU6A 3QZIA 2FUMA 2Z60A 2QQ7A 4FZ6A 4NH1A 4RA4A 4E4MA 5J5TA 4G9CA 4C02A 3HZTA 4UWYA 3IPHA 3C4ZA 3MI9A 1Y6AA 2YCFA 4XP0A 4FV4A 4C36A 3DAKA 5HE0A 4D2PA 2CGVA 3KU2A 4D0WA 5KUPA 2XNEA 4FZAB 4UYAA 4WBBB 5AP7A 3SQQA 3VUIA 3BQCA 3BU3A 5DNRA 4QQCA 4OAVB 3QKLA 3RCJA 2GFCA 1IR3A 3K2LA 4V01A 3GOPA 4ALWA 4UX9A 5FEQA 5C27A 2VTQA 4OBQA 5AP2A 4E8AA 3T3VA 4JX7A 4JBOA 4CZYB 4AGCA 5HD7A 2XKDA 4OTQA 3F66A 3MFRA 5AV4A 1OECA 3I7BA 2BHEA 5FM2A 2Y6OA 4C4JA 2XJ0A 3MFTA 4DEIA 5I0BA 3H0YA 4I6QA 3VBQA 2WMVA 5KO1A 4W9XA 3UPZA 4FVQA 3ZRLA 2A2AA 2RG5A 3L8VA 2I6LA 3R01A 2V5QA 2UZUE 4HNIA 3ROYA 3TKUA 3TUBA 4FTUA 3PLSA 3A62A 3LCDA 5ANKA 2VWWA 5CYIA 4AG8A 5TT7A 5BYLA 3A4OX 3KC3A 4DA5A 1UKIA 2J0MB 4ITIA 3AC1A 3ETAA 2C47A 3MFUA 1MQ4A 3QCYA 4ASXA 4MBIA 4EZ5A 5CEMA 3EQBA 5DR2A 3UMXA 4YUQA 4QNAA 2OJFE 4UWCA 1I44A 5AM6A 2H6DA 4EH3A 5JEBA 4K9YA 4DGOA 5AP6A 1WBNA 2CPKE 4FTKA 4FT0A 4CTCA 3ENMA 4BGGA 5CAQA 4C8BA 1NVSA 5CSHA 4BHNA 5EM7A 5EYKA 5FDXA 1XH4A 5CVHA 5HO8A 3AQVA 3ZYAA 4BDEA 4BI0A 5AAGA 4MYGA 4XYFA 3ALOA 2PVFA 3P08A 2HWOA 3SXSA 2PTKA 4I6BA 1H1PA 1XWSA 2VTLA 4GS6A 3C4CA 5GIOE 5I4NA 4GW8A 2Y8OA 5DHJA 3NUSA 2C6KA 2ZOQA 5HCXA 3FI2A 2B55A 3HMMA 3KVXA 1WAKA 5CZIA 1W83A 2QU5A 1YWRA 2BFXA 4JQ8A 1VEBA 4KBCA 3ZLXA 5AV3A 3R9OA 3F3VA 1TKIA 3LCOA 4GK2A 4UZDA 3ZSGA 5FXQA 4D5HA 1G8AA 4TYHA 4FE2A 4K2RA 4RJ8A 3VHKA 2WKMA 4DGGA 1OL7A 4NJDA 4L00A 3K3JA 5AA8A 4A9UA 1TVOA 3R21A 4LMNA 4M69A 5EQPA 3HYHA 3PPJA 4O0XA 4QMMA 4R7BA 4EWQA 4G3GA 4X0MA 3PXKA 5AEPA 2BZIB 3C9WA 4CMUA 4YJUA 2ZM3A 5JFWA 4DG3E 3CE3A 4GIIA 1LUFA 4F09A 5AUTA 2X2MA 2QHNA 4D2SA 5GINE 3WE8A 2OZOA 3A2CA 4ASZA 3CPCA 4BDBA 5JZNA 5CF4A 4O7NA 1M2QA 3DXNA 1UNLA 5JN2A 2DQ7X 3Q96A 4R8QA 4HVGA 3BELA 3E88A 3SKCA 4YJNA 4BICA 5CAOA 4UV0A 4IWPA 1NXKA 1OGUA 5EFQA 3TL8A 1NW1A 4WNKA 5IEXA 3H10A 3IOKA 3CIKA 3QBNA 1OIUA 1OZ1A 4JR3A 3CGOA 2VO6A 3DV3A 3FHRA 4AOJA 1Y91A 5ETCA 3DTCA 4W9WA 4FL3A 4FKTA 3MYGA 3QCXA 5IUIA 3QA8A 4YZNA 1WZYA 4J53A 4U7ZA 4L01A 2OKRA 3HA6A 3G15A 4FYOA 2YLEA 3D5WA 3WF6A 1JSVA 1CMKE 5KMIA 4RX9A 2GTMA 4L53A 5J7HA 4Q5EA 3C5IA 5C4LA 4BC6A 3WZKA 3FI3A 1J3HA 1YXVA 3DQXA 1H25A 4KBKA 4H39A 4TN6A 2PWLA 3V01A 5JMSA 4QT1A 3KKVA 4NYEA 5HX8A 4JLCA 3WF9A 2A0CX 4J99A 4RJ6A 4G17A 3RPRA 5CASA 4CV8A 5CEPA 1FMKA 4F6UA 2LGCA 2Q0NA 2YCRA 2YCSA 3F7WA 3MDYA 4DTBA 4ZY4A 2HZ0A 2B9JA 2CN5A 4D4YA 5FUTA 2RF9A 2WMWA 4YHJA 4IB5A 3SLSA 2RGPA 5HE2A 4H36A 3OTUA 3VBXA 4L8MA 2B0QA 4M66A 2VTIA 2ZV9A 4RJ4A 4LOQA 4MQ2A 3ULZA 3P23A 4R3RA 4NWMA 3VO3A 3IW6A 4IM3A 1SVGA 3M1SA 5K0XA 3V51A 4AW5A 3IOPA 1RQQA 1UWHA 5AFVA 4DG2E 4USFA 4AW2A 5JRSA 3RM7A 2PE0A 1KE8A 2OIQA 3UP7A 3FL5A 3QALE 1GIHA 4B9DA 4ZLOA 4HGEA 4LMUA 2YHVA 3FMLA 2VTOA 1QPEA 2UZOA 4CTBA 1CKJA 4DN5A 4EH2A 4EUTA 2J0IA 4GSBA 1JBPE 4KRDA 4MAOA 2XK4A 5AX3A 4DFZE 5HI2A 3F5UA 3PPZA 3BI6A 4C3RA 4XG2A 5AAEA 3PRIA 4TW9A 2WQMA 3ATTA 5LMAA 4E4XA 5HICA 1PKDA 4XP3A 4GFMA 2VNWA 3M42A 1A9UA 2QOHA 1ZMVA 3MBLA 4R77A 1LP4A 1PXPA 3HV3A 3MJ1A 4IJ9A 5C8NA 4DFNA 5DGZA 5TKDA 2OZAA 2VTSA 5LVNA 3GENA 2C6TA 4DITA 3KRRA 4WKQA 4AE6A 2OJJA 5DYJA 4FOBA 5CY3A 4E6DA 3BLHA 2QHMA 4OTFA 3BHTA 3SW7A 1SNUA 4RJ5A 4O81A 3D2KA 4UMUA 4BF2A 4E6QA 3PDTA 2G2IA 4AFJA 4U45A 4Y95A 5HKMA 2Z7SA 3MW1A 3WF5A 4EOOA 1WVXA 3PJ2A 5IQIA 4IJPA 5BVDA 3WYXA 5IUGA 3LIJA 4GT4A 3B8QA 3UODA 2XRUA 3TIYA 3ZH8A 2WMRA 5IZFA 3FL4A 4ZMFA 3IDCA 3H4JA 3BKBA 4CFVA 2GTNA 2YM7A 1Q41A 2VTTA 3DNDA 5ACKA 3ZO2A 3ZM9A 2B9HA 3BHYA 4FV0A 1CSNA 2BR1A 5CU3A 2HCKA 4LRKA 4XV9A 5I9ZA 1CKPA 1J91A 4I20A 4J7BA 5I9YA 1WBOA 1UU8A 3QYWA 1ZOEA 2WU7A 2X4ZA 4GL9A 3LXNA 3KFAA 5AR8A 3MVMA 2Y6MA 1H27A 2HENA 2IVUA 4RX7A 3MB7A 3WF8A 4FTIA 5ETAA 2PUNA 3A60A 4XG8A 1JSUA 4F9CA 4MXZA 1V0OA 4FV1A 3V6RA 4DINA 4IHPA 1PXKA 5CF6A 3G0FA 3UVPA 2UW7A 2ITQA 5F4NA 3NNWA 1MUOA 3QTQA 4FUXA 4BDKA 2J90A 4GCJA 4P2KA 3E62A 3R1NA 2VWZA 2UW5A 4RJ3A 3QQUA 4W4WA 5J95A 4BWXA 2R3RA 4CFFA 4O2PA 5TE0A 1NY3A 3UOJA 3G6HA 3QHRA 5DG5A 2CLQA 4FL2A 3W2RA 5DOSA 4BL1A 3RK9A 5EI2A 3V6SA 4FTQA 4AP7A 2X81A 5M4FA 2OG8A 5FTQA 1H0VA 3GXLA 4LV5A 1JWHA 4MK0A 5HIEA 2Z8CA 5AX9A 3A8WA 4BKJA 1IG1A 4BBMA 1LEWA 5I3RA 1WBWA 5AP0A 4L52A 2I7QA 3KREA 1ZOGA 5LVOA 4DE4A 2C0TA 2WTCA 2QG7A 2WO6A 2XEYA 4FNYA 4I5PA 5BVEA 2R3KA 3P9JA 2IW9A 1Y6BA 5FG8A 4Z3VA 3PY1A 2QLUA 3FMEA 2YLFA 5DE2A 4B8MA 2C6OA 4FKSA 2DUVA 3DXPA 4FKJA 3UIXA 4EOKA 2NP8A 2QO7A 2WTVA 5IQHA 2WQEA 4BDDA 4R3CA 5A4LA 5AR7A 3KA0A 1KE5A 5LQFA 4TWNA 2BZJA 3ZUTA 5CVGA 3OT3A 4LL0A 4D2RA 1H00A 3Q2MA 4I0SA 5HBEA 3SC1A 1BKXA 3II5A 3KY2A 4IZYA 4ZJIA 3O51A 1XH9A 4WG3A 4U81A 1H07A 2CGUA 3B2WA 3U87A 3HV5A 3KULB 3O96A 2FB8A 5M08A 4G1WA 5DEWA 5J5SA 5HNGA 4QQTA 3TNIA 5HU9A 5IH6A 2Z7QA 2W5BA 3MV5A 4M97A 4AA5A 3NUXA 1U5QA 3E92A 1WFCA 3D0EA 4KRCA 2NRYA 4DH8A 3GEQA 2P33A 3SD0A 5AV2A 4CKRA 4RSSA 5IEYA 1ND4A 2ZYBA 5DPVA 1O9UA 1Z57A 3CY2A 4FGRA 1WBPA 2WQBA 2QC6A 4MQ1A 4O0VA 4RA5A 2FVDA 1GNGA 3DFCB 3QTWA 2VWIA 3FMNA 4X21A 2PVKA 3TNQB 4N4SA 3AGLA 1PMNA 4ZS4A 2BRBA 3AD6A 1KE7A 2J0LA 4XS2A 2VWXA 1BYGA 2OGVA 4ZTNA 4FKGA 3UGCA 3MGYA 2OI4X 4U43A 2VZ6A 2GQGA 4JDIA 3F5GA 5GJGA 4J8NA 4LG4A 4RC4A 3ORPA 2WD1A 4IWOA 3HRCA 3PJCA 5EM5A 5I5ZA 5CVFA 3NRMA 4K0YA 2HELA 4FI1A 3C13A 3OTVA 3C51A 2OW3A 3A7GA 2CKPA 1SZMA 2YIYA 4FZDB 4NKSA 5JFVA 5AP4A 4P7EA 3Q5ZA 4F63A 3O2MA 4IW0A 4YZMA 4DAWA 3CC6A 5CT0A 4F65A 1YI4A 4O7SA 2PMLX 4CFNA 4ANMA 3HMOA 1K9AA 1U54B 2UZLA 4JQ7A 4KIQA 3FYJX 2XH5A 1JVPP 3FJQE 4C62A 4CFXA 4O91A 2XK7A 5M53A 3IK3A 4I6HA 4BBFA 5HBJA 4KD1A 3MH0A 2XIKA 3MVLA 3L9NA 4G6NA 4ZTRA 3VIDA 1DAWA 2E9VA 3LM0A 4GMYA 4ZY6A 1FMOE 4F9BA 4JNWA 4O96A 4NM7A 3RK5A 3DB8A 1S9JA 4YJVA 2RG6A 5EHOA 2JIIA 4RWLA 2ZV8A 2PYWA 4GVJA 4YGAA 4ACDA 4U41A 1QMZA 4F1MA 4L42A 3ZBXA 4IAKA 3NIZA 4D9TA 1OBDA 4M3QA 1JOWB 2ZM1A 3VW6A 4A4LA 4CRLA 2Y4IB 5I9VA 3ATSA 1NT2A 3BZ3A 4D1XA 2XP2A 2WU6A 4CLJA 3FKOA 4BHZA 1P2AA 2VAGA 3K54A 3G2FA 3DKFA 3O8UA 4QMUA 4MF0A 3DJ5A 4MXOA 5KZIA 5BPYA 2UZVA 2EUFB 2GU8A 3ELJA 3KN5A 1W98A 5BYZA 3L9MA 5K9IA 2LAVA 4MH7A 2IVTA 1F3MC 5E8YA 4A9TA 3DY7A 4LL5A 2OXDA 3CTHA 4JX3A 5ANOA 4QYFA 4D5KA 2DYLA 4Y5HA 3R7YA 5HVJA 3ACJA 3PSCA 4GKIA 1H8FA 1GOLA 3A8XA 4WNOA 3MFSA 2OH0E 3PWDA 2WPAA 2J5FA 2UZBA 4FOCA 5IEVA 3QKMA 3W2OA 4KUJA 3EN7A 5CX9A 3F2AA 3W32A 3U4UA 1OUKA 5JRQA 3UZTA 3DJ7A 3RTPA 3QTZA 5FBOA 5AR4A 2R64A 4EONA 4QTDA 1PW2A 1Q3DA 3FPMA 2B52A 5JH6A 2J7TA 2OBJA 2VWBA 1PHKA 3ODYX 2C68A 3IO7A 4MVFA 4BGHA 1Q8TA 4FEXA 4HZRA 3P7BA 2YN8A 5DEYA 1YXUA 4ZSJA 3P0MA 3U8WA 1H1SA 4CT1A 3RPVA 3QXPA 3LOKA 2WQOA 3OS3A 4FTCA 4G34A 1PXLA 3FSKA 2B9FA 2WIPA 3VUGA 5CXZA 4CFWA 5HU3A 2CNQA 1RJBA 2NRUA 2HZNA 4XRJA 5E8SA 4EKLA 2OXXA 1Q4LA 2BHHA 3KXZA 3MA3A 3OVVA 2YA9A 4TYHB 5FM3A 4JBPA 3F2NA 4AGUA 5DMZA 2JITA 1KUTA 5KMLA 5KMMA 2ESMA 1WBSA 4M69B 4FKVA 2VNYA 3N9XA 4S31A 4WHZA 5EI6A 4DLJA 4IMYA 4FTNA 3C4EA 4ANNA 3NUYA 3QUPA 2PMOX 3QRUA 2R4BA 3SG8A 4NU1A 4FSRA 5EDPA 1DS5A 1YKRA 3E63A 3NYVA 2OF4A 2IVSA 3G6GA 4IE9A 4A9SA 4BKYA 4F0FA 4NIFA 1OBGA 3PA4A 5DFPA 5BUJA 5FBNC 4ZXTA 3BU6A 1URCA 1XJDA 3VJNA 4AZTA 3ORIA 4QTBA 4XUFA 3IQ7A 5M06A 2PVHA 4NT4A 2P2IA 4RT7A 2DWBA 3V04A 1ZZLA 5GHVA 4AACA 4IWDA 3TWJA 4I21A 2FSLX 3P4KA 4EOQA 4AE9A 4XEYA 3UPXA 4HCVA 4O21A 2CN8A 3REPA 2C30A 3EQFA 3AMAA 3LFEA 2BRMA 4QD6A 2R7BA 2HOGA 2GDOA 2Q0BA 5IQBA 3CJFA 2UW0A 3FZPA 5HHWA 3FQHA 4TZRA 5E8UA 3TIZA 4DBXA 4DH3A 4YHTA 4F4PA 2F4JA 4EK8A 5L8LA 3I7CA 4C4IA 4ALVA 2C3KA 5IU2A 1YDSE 3CGFA 3HAMA 2HW6A 3F5PA 2R2PA 2X9EA 3DTWA 1SYKA 5HEZA 3D9VA 4AUAA 3ZFYA 4GT5A 4XMOA 4I22A 4CT2A 3ORXA 3HV7A 3QRKA 2WB8A 4E93A 2R3NA 5AR5A 3WIGA 1S9IA 3NW6A 4GEOA 4KSQA 4M67A 3VS3A 2IG7A 4RG0A 4FV6A 2O8YA 4MNEA 4G3EA 2XNPA 5H9BA 2CLXA 4I5HA 2WMBA 4FKWA 5H8EA 3ZHPC 4UALA 3NGAA 4G2FA 2PZRA 1G8SA 2FSOX 5EW3A 2Q83A 4FTJA 3VWAA 2QOIA 2XJ2A 4L9IA 2XCKA 3LFNA 3G90X 3EZRA 5CNNA 3ZLYA 4BZDA 4D55A 4YO4A 1E9HA 4X2KA 4GG7A 4FSUA 3NIEA 4U42A 4WUAA 5IKWA 1LR4A 5H8BA 2ITUA 4LQMA 5J8IA 2Y4IC 4AOIA 3THBA 3KXXA 1H28A 3LCTA 3S4QA 4E6AA 3JUHA 3EQCA 4K1BA 3VHEA 5CU0A 2BAKA 4IAYA 3D4QA 2OICA 4TRLA 2OIBA 4FSYA 3ITZA 4YLJA 4DEHA 3OWKA 4MHAA 2R3JA 4PDPA 4AZVA 3MSSA 3VRZA 2XIXA 4FIEA 3TJDA 1E1VA 3KULA 4MXXA 1R1WA 4IC7A 2XJ1A 3E87A 4NW6A 4O22A 2PK9A 1GZ8A 3LFBA 4B4LA 3HAVA 3SVVA 4OR5A 3DKCA 2VD5A 3I0OA 4H3BA 2PPQA 4YZCA 4F1OA 5DT3A 3ZLSA 3PXFA 3R28A 2OZAB 4EQCA 3PWYA 3Q4CA 3ZONA 3EN6A 1SM2A 2W0JA 4E4LA 2F2CB 3F3UA 1UA2A 3NLBA 4R7HA 5BNJA 4G6LA 4PV0A 5CAVA 5K4JA 3QGWA 2F7XE 3I60A 3O50A 4ANLA 5HBHA 2VO0A 3PSDA 4X2FA 3DZOA 5IPJA 2J50A 3MH2A 3OC1A 4AN2A 2RFDA 2F7EE 4O0YA 2XKCA 4EK6A 3GC8A 5CALA 4ZEGA 3EWHA 5AR3A 4J98A 3CQUA 4DTAA 4JDHA 3CBLA 3EN5A 4DLIA 5BMSA 2XYNA 2YFXA 5FQDC 2SRCA 4DYMA 3O7LD 3FAAA 2C5YA 3CLYA 5B0XA 3BWFA 4C34A 4E6CA 3IW7A 1ERKA 1YXSA 3BWJA 1TQIA 3QQLA 2WMTA 3QKKA 1IAHA 3UZPA 3LQ5A 4YTIA 4MD9E 4AZFA 5CI7A 4O6EA 3IW8A 2R0UA 1Y57A 3ZTXA 3QTUA 2QLQA 4BWPA 1KOBA 3LFQA 3HRFA 3MY0A 3GCQA 2GSFA 4NTTA 3C50A 2ZM4A 3QFVA 4FIGA 3L9LA 3O71A 4C2VA 2H34A 3DA6A 3KRXA 3L8PA 4OTPA 4RBLA 5LWNA 4EC9A 3WF7A 4CZUA 2BTRA 5EKOA 5KNJA 3PVBA 2UZDA 4WRSA 5IQFA 4XG6A 4FV3A 4CZTA 3IS5A 3S3IA 5K4IA 3GI3A 3CKXA 4OW8A 1STCE 5HNIX 3O8TA 3F69A 5JT2A 1PMEA 1X8BA 3FLNC 4F64A 3VC4A 5EDQA 4YJOA 1FBNA 2JDSA 3HL7A 4QMOA 3GQLA 4FKQA 4BZNA 3PPKA 1XH6A 3D5VA 5EK7A 4Q9ZA 1OL2A 3CJGA 2UZTA 5HESA 4PMPA 5LMKA 2VTJA 3OG7A 3SGCA 3CQWA 2QOCA 2GNIA 1OITA 3BGPA 2QVSE 3EKKA 3QCSA 4P4CA 3N4UA 3HA8A 4V05A 3ZEWA 5KKRB 4FKPA 3ZZWA 4ARKA 4OTDA 4HPTE 4ZY5A 3BEGA 3U6HA 5B7VA 1M7QA 2WMAA 1XH5A 3GC0A 4K18A 4EK5A 1DI9A 3R30A 4OGRA 4YJQA 4I93A 5GZ8A 4RZVA 5FP6A 3CQEA 4LGGA 4LI5A 4FKOA 5EM8A 3ZFMA 2WMXA 4IBMA 2ITZA 3ORNA 3ACKA 5E8VA 3R8UA 4B6LA 5FTOA 4AWIA 4HNFA 3R0TA 4QTCA 1SMHA 2C1AA 3ID6C 3RPYA 4UMRA 2X2KA 5E8WA 4BDFA 3EKNA 5CEOA 3TV4A 1H1QA 4YSJA 4FVRA 2Z7LA 3GT8A 3RAHA 4A7CA 3OFMA 4Z55A 3UNKA 2R0IA 3F82A 1XBCA 2QKRA 4AX8A 2X1NA 3VS2A 2ZJWA 1AQ1A 1DI8A 2QR7A 2W4JA 4AF3A 3GB2A 2J51A 3CCNA 4UBAA 4D2WA 4YTCA 2IJMA 2JAVA 3COIA 5CU6A 2WGJA 3UG2A 4WO5A 3OWPA 4ZJJA 4E7WA 3Q4ZA 5A4CA 4YC6A 1WMKA 3NUUA 4M68A 4Y85A 3RNYA 3ERKA 3NDMA 4FUYA 3PA3A 2IN6A 3E93A 4XNEA 2R3PA 4P5ZA 3VN9A 5E8TA 4QP9A 2XNBA 3UBDA 4C57A 2OU7A 4PY1A 5A46A 5D1JA 4C33A 4RIWA 4ALUA 3JXWA 4N0SA 3D83A 4DFYA 4E5AX 3BV3A 1B39A 4XG7A 3DXQA 3LMIA 3P7AA 4GUEA 4L43A 2JAMA 2HZ4A 3W2QA 3VS1A 3CTQA 3O23A 2YABA 4JRNA 2WELA 1PY5A 5TF9A 4AXAA 4S32A 4UEUA 2FH9A 4N6YA 4YJSA 2ZMCA 3ULIA 4ACGA 5KBRA 2C0IA 4CRSA 3WZUA 4BCMA 2R3MA 4U5JA 5CZHA 2WTJA 2WEVA 2C5OA 3C0HA 1FOTA 1JNKA 1CDKA 3FMDA 3TTIA 2GHLA 3UOKA 2XM9A 2WZJA 2PZYA 3W2CA 2I0EA 4QPAA 5FEDA 4E3CA 5GZAA 3ROCA 3MJ2A 3KVWA 3ZO3A 3UZRA 3N4VA 4M13A 2IO6A 1WCCA 2YDKA 4AGDA 4BCKA 5JQ5A 3QTIA 4XG4A 3WZJA 4QQJA 4DCEA 4TL0A 4O7LA 5M09A 3EFWA 4RQVA 4ZOGA 3V8SA 3ZC5A 1KSWA 4AOTA 3ZRKA 5E4HA 3C7QA 4Y8DA 2CCIA 2CGXA 3DFAA 4C61A 4UXLA 3AMBA 5AP1A 4K8AA 2R3LA 3NNVA 4GK3A 5IMXA 3RAKA 4IX3A 3R8MA 2HXQA 2NO3A 4L67A 4UB7A 5AM7A 2VRXA 3F9NA 4Z9LA 2E9OA 4M7IA 2CMWA 3ORMA 3R04A 4Z7HA 3KCFA 4I6FA 4F70A 5M57A 4YURA 4BTKA 3NCZA 4PL5A 4BDCA 5L6OA 4EOLA 5BVNA 3K5UA 3TI1A 4EOJA 3NUPA 5IG1A 4AZSA 4C2WA 4FKRA 4UZHA 2XF0A 4WSQA 5G1XA 5HIDA 3G0EA 3I6WA 4EHGA 4HYSA 2Z7RA 4IB1A 2RFNA 4AFEA 4NJ3A 1R3CA 1UNHA 2B4SB 4OTWA 2OH4A 2CCHA 4TT7A 4O0WA 1YWVA 2R5TA 2W17A 3DKGA 4YJRA 2V0DA 5JFSA 4UY9A 1J7UA 5IA1A 3EQGA 1R0EA 3V5LA 4BN1A 2BRNA 3R1QA 5TR6A 3BIZA 3E8NA 4TNBA 5EH0A 3SHEA 5M56A 2VV9A 3FI8A 3FEGA 3SW4A 2JIVA 2W96B 4BTFA 4PP7A 2HAKA 3F3TA 4BVUA 4JL9A 2ERKA 3RGFA 3HV4A 3KK8A 1ZYCA 3L8SA 4TYJA 3P78A 1GAGA 3NPCA 4FV9A 1UKHA 2C6DA 4Q9SA 5CEIA 5FXRA 2C6IA 1TQPA 4LUEA 4MEDA 3HX4A 5HX6A 4EH6A 4U97A 4AN3A 3DK3A 3MWUA 3U51A 4DFLA 4FSMA 5HVKA 3SX9A 5AAFA 3QX2A 4EL9A 4ZLYA 4E5BA 1UU3A 3QWJA 3TZMA 1GY3A 4ZZNA 4U0IA 3RHXA 2WAJA 3SOAA 2YISA 3L9PA 4ZIMA 3EJ1A 3QQKA 3R2YA 5EOLA 4C58A 3C1XA 4RLLA 4F9AA 5CF8A 1P5EA 3T3UA 1QPDA 5J7BA 3MY5A 1OIRA 2Y4PA 4O0SA 5D12A 4HCUA 4A9YA 3NVMB 3QWKA 1L3RE 3PXQA 4RZWA 3OEZA 1ZXEA 4H1MA 5A4TA 4O7WA 1BLXA 5HCYA 2YIWA 3FLWA 4LGHA 3FE3A 4AQCA 2V7AA 3GQIA 1IRKA 4PPBA 2VTNA 3LCKA 3GCVA 4HYUA 4B99A 3BHHA 5EKNA 2OJ9A 5CSWA 2IW8A 3CTJA 3TDVA 3WILA 4FK3A 3UNZA 4ACCA 3EQPA 3UIBA 2JDOA 4AS0A 2X0GA 4EOPA 4I1ZA 1IA9A 2YZLA 2YM4A 2IZUA 3F7ZA 3RJCA 3FPQA 4FV8A 4NIFB 4LOPA 1Q99A 4WNMA 3W1FA 1NA7A 4GKHA 2XIYA 2UZNA 4RFMA 4FEVA 1Z5MA 4BI1A 3I5ZA 5F94A 3R63A 3HDNA 3SV0A 1OKZA 2BDWA 3KMMA 1JQHA 2B1PA 2PE1A 5L2QA 4ANOA 3UYTA 4I5CA 2WNTA 4QMVA 4RWIA 4C38A 4QOXA 2JKMA 5HQ0A 2GFSA 2WTWA 3FXXA 4YJPA 3PVWA 5M4IA 2UZEA 4CVAA 3LW0A 3VRYA 3OOGA 4IVBA 3QD3A 2XUUA 2O2UA 3I81A 4IFGA 5H3QA 1J7IA 5E9EA 4RX5A 1W0XC 5HVYA 3DAJA 4D1ZA 3DDPA 5JGDA 3JS2A 1B38A 2OFVA 3R8PA 3FLSA 3P5KA 2ZDUA 4OT6A 1IASA 2GQRA 2VX0A 3TT0A 3A4PA 1PYEA 3PYYA 4MWHA 3CPBA 3FWQA 3Q53A 5L8JA 4JXFA 4X2NA 3RPSA 3OCGA 3QAME 4ZSLA 2AC5A 2Y7JA 3FUPA 4MNEB 3TZ8A 4IX6A 5IA4A 4ZSEA 2E9UA 4NZWB 5IMEA 2JFMA 4QP7A 4EQMA 1TQMA 3K5VA 3NYOA 3F3WA 5CT7A 3W18A 4CSVA 4I5MA 2VO3A 4MD8E 2W4KA 3HMIA 4FEWA 3QLGA 3Q9YA 3AGMA 2CGWA 3ORKA 3KF7A 3R00A 1OL5A 4G5PA 4IB0A 5ANJA 3KB7A 5JGBA 3GOKA 3MH3A 4HVHA 3ORLA 4O2ZA 3HLLA 1MP8A 3MTFA 4J52A 3DS6A 3KRLA 2ITTA 3EQIA 3FLZA 4FTOA 2YWPA 4GYIA 5DIAA 4EK3A 4D4SA 5J9LA 2C4GA 5AMNA 5FWKK 3Q60A 5E7RA 3UQCA 3LJ1A 1AGWA 3UIUA 1UVRA 1O6YA 4U3YA 1HCKA 3LFCA 2VGPA 4O84A 3C4FA 4MXCA 4ZSAA 5LARA 4RVLA 4JG6A 4HJOA 4PMSA 3W16A 5KCVA 3SAYA 4FTLA 3GCSA 3OW4A 3UYSA 4WA9A 3VAPA 2YM8A 3ET7A 4CQGA 3OWJA 5IISA 1ZMUA 3DU8A 3OUNB 4BCPA 1BX6A 3BCEA 4EI4A 3BGZA 4EUUA 3Q2JA 3GVUA 3QZFA 4YP8A 3OEFX 4AAAA 4XOZA 4DG0E 1PXNA 3DLSA 4FBXA 4L6QA 3WYYA 4U79A 3TN8A 4Y83A 2X7FA 4YZBA 2PU8A 4DH1A 4MD7E 2EVAA 2VN9A 4BIDA 1OL1A 3MN3A 2WQNA 3Q6UA 2IZTA 4HCTA 4XX9A 5AR2A 2W1ZA 3VUTA 3R7VA 3R7IA 5HO6A 3SXFA 3FZTA 2QURA 3NAXA 3V5WA 2P4IA 5J87A 2IZSA 2YIRA 3TG1A 5LVPA 3QC4A 3W2PA 4ANQA 4HGSA 4W4YA 3TV7A 4QPMA 1EH4A 4NM5A 2HW7A 3FQEA 2ZMDA 4GFOA 2GS6A 2F57A 3H3CA 3LE6A 3UE4A 2G2HA 4PMTA 1K3AA 2Z02A 4PNIA 4KIPA 5LJJA 4ZK5A 4TWPA 4H3PA 4F7JA 3NX8A 3R73A 2BVAA 4ASEA 3ORZA 3DBDA 5DA3A 2X2LA 3NS9A 4ITJA 3GC7A 5C8MA 1H1WA 1XBBA 3QQGA 3ZC6A 5IA2A 3BYUA 3COHA 3KL8A 2UUEA 5AUWA 4TYGA 4YJTA 3LFDA 4TKSA 4BB4A 3FKNA 2W5AA 3TJCA 4CCUA 5C8KA 3R8VA 3ENHA 3NNXA 3QRIA 2PY3A 4EYMA 3D5UA 5K3YA 4XBUA 4CEGA 3AT4A 3O17A 4R5SA 1ZLTA 3OF0A 4FEQA 4NSTA 3PXYA 4QNYA 4XJ0A 4PDOA 3R02A 4M14A 3I79A 4ITHA 4LM5A 3RAWA 3CSVA 5CSPA 2C1BA 2BTSA 2VGOA 3OHTA 3V5QA 5ANIA 1M7NA 2GHGA 4XV1A 3UOLA 3OY1A 3ZDUA 5J9YA 2E2BA 1JPAA 4ANSA 1Q61A 3FI4A 5IDPA 2VTHA 1DAYA 2X6DA 4KIKA 4A06A 4OAUC 3TM0A 2W05A 2G15A 5DI1A 4X2GA 2Y9QA 4X3JA 3C4WA 3FBVA 3SRVA 2QI8A 1IEPA 3WZEA 2G1TA 3OXZA 1YXXA 4IZ7A 3HMPA 4L3PA 1FGKA 5CAPA 1YOLA 4HVSA 3DCVA 3GBZA 2PUPA 4JAIA 4A4OA 4M84A 4O38A 1MQBA 5HLPA 5IQCA 5D11A 3IG7A 3QTXA 5HO7A 1R39A 4YZ9A 4IACA 3GGFA 4OBPA 4O0TA 3T9TA 3PE2A 3JY9A 3E64A 3Q52A 4DEGA 2R9SA 5HD4A 1M14A 3GU5A 2X7GA 3C0IA 3QQJA 3QRJA 3NVKI 3QD0A 2BAJA 3HGKA 3POZA 4ZTSA 2WHBA 4IVAA 5C03A 2ONLA 1NVRA 2XIRA 3KGAA 3ODZX 3S95A 4Z7GA 2BILB 3ORTA 1J1BA 2BKZA 2XRWA 4RWKA 3BV2A 4PQNA 2C5XA 3VVHA 5DH3A 4CCBA 3TKHA 3R7EA 2WMUA 3JVRA 2QOLA 2JKKA 5FEEA 3H9OA 5JQ8A 5L2SA 3NW5A 4BIEA 4FK6A 4UWBA 2ZB0A 5KMOA 3HMNA 1I09A 3WI6A 3OY3A 4U9AA 4W8DA 3SOCA 5A4QA 1T46A 4HYIA 3BE9A 4FT3A 2XBAA 5GJDA 4D58A 2BPMA 3I4BA 5CXHA 5FRIA 3BLQA 3LJ2A 3TV6A 1JKKA 4ID7A 4YO6A 4O7RA 5IQDA 3BBWA 3EN9A 4RIWB 3DBEA 2NNWB 4OTHA 5HG9A 3C0GA 4KABA 4L3JA 5CI6A 3W8QA 3ZO1A 4WBOA 3BRBA 1VJYA 3D5XA 2GS7A 3K3IA 5AUZA 4KKEA 2X7OA 3PIZA 5KX8A 2R7IA 4PMMA 2CNUA 4HOKA 5D10A 1Q8WA 3NCGA 3TEIA 1XHAA 1XH7A 4QMSA 4XP2A 5AIKA 3Q4UA 1Y8GA 5M4CA 4FL1A 4FMQA 2F9GA 3DZQA 1Q8YA 3BU5A 4RVKA 2QO2A 3G9LX 2BDJA 3U6JA 4FC0A 4L7SA 3AC8A 3OP5A 1PYXA 2H96A 3V5TA 2G9XA 3D2IA 2VO7A 5CWZA 2CKEA 4V0GB 3E8CA 2OXYA 3RPOA 4ZZMA 4CQEA 3Q9ZA 3A61A 4IAIA 4Z16A 3U9NA 2GS2A 4RFYA 4C3PA 4PDYA 1F0QA 3QC9A 2FSMX 3MS9A 1KV2A 4R3PA 3Q6WA 4U8ZA 2XVDA 2HWPA 4QP6A 5AUUA 1SNXA 2XNOA 4YTFA 3MVJA 4E20A 3GNIB 4W8EA 5IH5A 1SVEA 3I6UA 4IAZA 4FTMA 3DJ6A 4IC8A 4QP3A 2I0YA 1K2PA 1ZRZA 4S33A 4R5YA 5HG8A 4AW0A 3VQHA 5IA3A 1LEZA 3W2SA 3R9NA 2ETRA 3HRBA 5EQYA 2PE2A 5I9XA 4FR4A 5ITAA 4N57A 1OPJA 5IA5A 3R9RA 2OJGA 3ZXTA 1W8CA 4KKGA 5AV0A 5CSVA 1CKIA 4MCVA 3DBFA 4I92A 3BLRA 1ZYSA 3EQDA 5BVKA 3H9RA 2PUUA 4JQEA 5HZNA 4JRVA 2WIHA 4OBOA 5FGKA 1FINA 3DKOA 3BYOA 5GJFA 2ITXA 2OSCA 3CKWA 2XNGA 4AT4A 2CNVA 4ZMEA 1OB3A 3EL8A 2J4ZA 2O0UA 3VS5A 4AN9A 2F7ZE 2C6EA 4N70A 4O7ZA 4IEBA 2OWBA 3A7FA 3PXRA 4CV9A 3A99A 3LXPA 3IDBA 4J1RA 5EW9A 3EFKA 3EQHA 4Y72A 2X9FA 4LOOA 1GJOA 3QD4A 3UQGA 4JI9A 5JKGA 5LMKC 3AT2A 3PRFA 4F0IA 3UO5A 4LUDA 4M0YA 3I5NA 4FGBA 4NW5A 4YC8A 3PG1A 4FV5A 4YMJA 2QKWB 4IFCA 4A9RA 2GNGA 3V8TA 4E73A 4RMZA 3I0QA 4QTEA 3F3ZA 5DBXA 3TZ7A 4F9YA 5C26A 2W5HA 5KMNA 5BQ0A 4HPUE 2GMXA 2XK6A 4PPCA 4WG4A 5DWRA 5L2TA 3WARA 3E8EA 2JGZA 4HVDA 3FC1X 5AP3A 4R1YA 2BFYA 2JDVA 3RZBA 2P0CA 3RALA 2JDRA 3ZZEA 3UVQA 4WG5A 3GFWA 3GCUA 5EG3A 2PZ5A 4FG9A 4GT3A 2OK1A 1RE8A 3A7HA 2HIWA 1U46A 4LRJA 4BDIA 3R7GA 5J79A 3D7TA 4K33A 2WMQA 4F0GA 3SXRA 4M15A 5CF5A 2HY81 1FGIA 3P86A 3R2BA 1BI8A 3VULA 3RBWA 3ZFXA 4BCFA 4E26A 2WMSA 3TTJA 2GQSA 3UO4A 4L3LA 3TXOA 4EH4A 1PXJA 1Q97A 1VR2A 2BZHB 2HZIA 1WBVA 3EOCA 2WFYA 3GFEA 4FSWA 3ZBFA 4R1VA 4ACHA 4C59A 4BCJA 1H26A 1OVEA 4QP2A 4DGNA 2QOBA 1OKWA 3POOA 4OUCA 4BYIA 1YOJA 3PZEA 4V04A 2UW6A 2EXMA 3H0ZA 1ZAOA 1ZY5A 3HDMA 2RL5A 5E1EA 2GNHA 4RIOA 3NUNA 2X4FA 3QU0A 3MESA 5EM6A 3R9DA 1V0PA 3W8LA 2RIOA 4TYIA 4YBKA 4H05A 3GP0A 2YWVA 4ZLZA 5C9CA 1PRYA 3QL8A 4C4FA 1CTPE 3G9NA 3R22A 5HG7A 3KXGA 3GUBA 3OXIA 2AUHA 4BKZA 3B8RA 4IB3A 3AD5A 4WSYA 3WOWA 3KRWA 4KS8A 5EYMA 4JAJA 3VBTA 1ZOHA 3ZRMA 3PTGA 2QD9A 4R7IA 2GNLA 2ITVA 5HNBA 1KWPA 3T9IA 3FV8A 2R3HA 4BBEA 5TOZA 4CGAA 4EJ7A 3MPMA 4FG7A 2XNNA 2YM3A 5IUHA 2XEZA 5FD2A 4ENYA 3R83A 4DGLC 4AU8A 4EH5A 3KXNA 1U4DA 4JT3A 4OT5A 3T8OA 4EC8A 5FDPA 2OFUA 4BCQA 2YCQA 3PIYA 3HP2A 4JJRA 3VS4A 3SA0A 4G31A 2IWIA 1OKYA 1MRUA 3UP2A 4U3ZA 2ITWA 4PX6A 2BKKA 2CKQA 4PP9A 4IANA 1E1XA 1VZOA 4FIHA 4FKLA 4G3DA 4BDHA 2A27A 4FIIA 4EH7A 1KE6A 4PTCA 4USEA 1ZMWA 3FLQA 2RSVA 4CMTA 3LFFA 5LWMA 4YPDA 3TZ9A 1PF8A 2E9PA 3CY3A 2VTPA 3PSBA 3QRTA 4HGTA 3VF8A 4D4RA 2ZB1A 4HZSA 5I3OA 5HTCA 1KV1A 4UMQA 1UWJA 3LQ8A 2W1CA 2C5NA 4TWCA 4C4HA 4OTIA 1YRPA 2QO9A 4O0UA 4RFZA 4N6ZA 5T68A 4ERKA 3DGKA 5A54A 3MIYA 1MRVA 2RKUA 3O0GA 4YZDA 3QA0A 1KE9A 5C01A 3DPKA 3ZMMA 2R3OA 4QP4A 3RI1A 4DFXE 3HUBA 4KSPA 5FLFA 3E3BX 3G5DA 4S30A 4W4XA 3FLYA 5H2UA 2UVZA 2JKQA 3DK6A 3FQSA 4RIYA 2QR8A 4QMXA 4Q5HA 3HV6A 2X39A 4GJ2A 5L8KA 2V22A 3OCSA 5T3QA 2FGIA 4NTSA 4YLKA 2W06A 4OTRA 3DQWA 4QYGA 5L2IA 2PZIA 3TNWA 2G2FA 2W1EA 3ALNA 2WEIA 2YERA 2JC6A 4XLIA 4EYJA 4ZAUA 5I9WA 5KHWA 3PIXA 4XG3A 4BCGA 1OPLA 3HECA 4RQKA 1T45A 2YM6A 3JYAA 4L46A 5AADA 3RZFA 5KMJA 5GNKA 4X2JA 5CEQA 2YITA 4NL0A 1XO2B 3PG3A 4PNKA 4ZSGA 1YWNA 4K77A 4YPSA 3GU8A 4EJNA 4GVAA 2B7AA 2R3QA 2CSNA 5AP5A 3TDWA 4XV2A 4QMLA 3V3VA 5E8ZA 3M11A 4DF3A 2P2HA 3UNJA 4O6LA 2QOFA 3COMA 4J97A 1WBTA 1ZARA 4JDJA 5LCJA 4IX5A 3AG9A 2W1FA 2PHKA 2YIQA 3AMYA 4K6ZA 4L44A 5EI8A 4UXQA 3VNTA 4DEEA 5CSXA 3U54A 1JAMA 4L45A 4C35A 3WBLA 4C4GA 3HP5A 1PKGA 2WTKB 4FT7A 4PTGA 5KZ0A 5IQGA 3N4TA 4V0GA 2P3GX 3DLZA 3QTRA 4NM3A 3DBQA 5AUYA 2VTAA 5L6WL 2BIYA 5CAUA 5AV1A 5DR9A 3R8ZA 3PLAE 3BYSA 5LMBA 2YZAA 3ZXZA 3FMJA 4Y5QA 2PUIA 4PRJA 3QHWA 1XBAA 4KBAA 4TYEA 4RIXA 5BYYA 5DRBA 1Q8ZA 4PDSA 2BCJA 4U80A 5DVRA 4D9UA 4YLLA 3RNIA 2V62A 4DFBA 2BRGA 3EIDA 4ZTLA 2V7OA 4L68A 3IKAA 1VYZA 4QMWA 2BAQA 2X8EA 4II5A 3NAYA 1WVWA 2YJRA 1ATPE 5DR6A 1Y8YA 4ZTMA 2WXVA 4DGMA 5BVWA 3TNHA 3RWQA 1Q3WA 1U5RA 3IGGA 3LHJA 4Y73A 3P7CA 4JBQA 5M51A 2XA4A 4KINA 1BL6A 2YDIA 3CXWA 3L1SA 5EYCA 4L7FA 3UG1A 3H9FA 4UMPA 2PVYA 3WIKA 4YC3A 3EH9A 3BEAA 1H08A 3Q3BA 1J1CA 4I24A 5ACBC 2C3LA 4BTMA 2W1GA 3LMGA 4EH9A 3UQFA 2CJMA 3FC2A 2BUJA 5E90A 2C5VA 3U6IA 1U59A 2QODA 4KIKB 3W33A 1M17A 2QOKA 3SRVB 2PVJA 3N51A 3DAEA 1H01A 2PVRA 4ONAA 4BIBA 3LLAA 5HCZA 2UZWE 2XKFA 3EN4A 4BCIA 3FMKA 3F5XA 3OT8A 4EKKA 4QYYA 3FHIA 4J96A 4FV2A 4C37A 5KKRC 3PY0A 4DH7A 4EBWA 5HTIA 4O0RA 4X3FB 3ZU7A 2A4LA 5HIBA 3P1AA 4EEVA 3EQRA 5C4KA 3BPRA 4U6RA 4QMQA 4BWKA 4ZTHA 2WOUA 3ZCLA 5IQEA 5A4EA 3PA5A 1UU9A 3FY2A 4IDTA 4XRLA 5BUEA 4PPAA 4YTHA 4FTTA 2O65A 2UV2A 5K5XA 1FVVA 4CG9A 4E4NA 3RINA 3ZEPA 2QOQA 3KN6A 4DCAA 4HVIA 1OKVA 5H8GA 2ITOA 4HGLA 4PF4A 4CXAA 1YHWA 4IZAA 3SDJA 3WE4A 5D9HA 4DEAA 4O1OA 3VUKA 3KEXA 3UC3A 4EOMA 4BI2A 1URWA 4LGDA 2O3PA 3E8DA 3DT1A 3A7JA 1YQJA 3ANQA 4EH8A 4MF1A 5CNOA 3M2WA 1UNGA 4JOAA 5DLSA 4PWNA 3V5PA 1JKSA 1P4OA 3PVGA 5B2MA 4LYNA 4AT5A 5KMKA 2XBJA 2UW8A 2FSTX 4I23A 4CD0A 3VF9A 2PMIA 3C5UA 2OF2A 4FKUA 2ITPA 4JBVA 4EZ7A 5BUIA 1YOMA 5AUXA 3ZLWA 3CS9A 3JY0A 4BTJA 1JKLA 4CMOA 3VUDA 3BHUA 3JPVA 4KKHA 4PL4A 4UYNA 5CENA 3QCQA 5HGIA 5TO8A 4UMTA 4EQUA 3GU4A 2AC3A 2UW9A 2W4OA 2XM8A 4G16A 5E1SA 3W10A 4D2VA 3LZBA 4MX9A 4QYEA 3Q32A 1ZY4A 3D7ZA 2A19B 3DBCA 3EYGA 4CYJA 2ITYA 4IDVA 4MXAA 2YIXA 4USDA 1O6LA 1W7HA 4XCUA 1XKKA 4LFIA 3HEGA 4K11A 3IECA 5EHYA 3LLTA 4IVCA 4I94A 3Q4TA 3QUEA 3QF9A 5D41A 4TNDA 5AUVA 4AW1A 3OCTA 4EHEA 3OBJA 4BCOA 1UV5A 3ZSIA 1YVJA 4F9WA 4DT8A 4RVTA 3S00A 1RW8A 2W9FB 3RMFA 2VWVA 3E3PA 3PFQA 3CR0A 4IADA 4QO9A 2G01A 2JFLA 5ICPA 2KULA 5ETFA 3RM6A 2BMCA 2C0OA 4FTRA 3EL7A 2ERZE 2C3IB 3AD4A 3AXWA 4QPSA 3UOHA 4F7NA 2WTKC 3MB6A 4HYHA 3EMGA 4RC2A 2UW3A 2KTYA 3FZRA 3LXLA 4GU9A 3VS7A 4M12A 4BCHA 4IM2A 3V5JA 3HUCA 4GJ3A 4AA0A 5HORA 5M4UA 5EYDA 1OIQA 2BZKB 4F99A 2WTIA 1JSTA 4RWJA 4XHKB 1XH8A 4X6QC 2W1HA 4I3ZA 2ZVAA 2PMNX 3U55A 4TWOA 3E7OA 3C4XA 2OLCA 4FKIA 4IIRA 2ACXA 4BDAA 5LVMA 1Q24A 2BROA 4ZZOA 4FNXA 2QG5A 3E5AA 4FVPA 3R1YA 3BGQA 4O83A 3FYKX 2VWUA 4FTAA 5E92A 3PJ3A 3OMVA 3IW4A 5EW8A 4CYIA 3AC5A 1Q62A 5A3XA 5IDNA 4CKJA 4IWQA 5IQAA 1W84A 5K0KA 4O27B 4O82A 2XKEA 3NMUF 3TKIA 4ANBA 4Y46A 1FQ1B 2QCSA 3NWWA 4I41A 5F95A 5HLWA 3IDPA 4QTAA 3PVUA 5DT4A 1M52A 3NNUA 2J6MA 4Q2AA 5G6VA 4MTAA 3RK7A 4WD5A 1GIIA 3OZ6A 3BQRA 5AJQA 4J95A 4H58A 1FPUA 3PXZA 4RC3A 1PXMA 4QQ5A 1HOWA 1XR1A 3KMUA 4AT3A 4A4XA 4B0GA 1WVYA 3O7LB 1V0BA 3MY1A 5ETIA 1JKTA 2UVXA 1B6CB 2RFEA 2V55A 3OXTA 3LQ3A 1HCLA 2XNMA 4M8TA 3NYNA 4AZWA 3EYHA 4B7TA 3TUCA 2Z2WA 3MPAA 3R71A 3ZOSA 4QRCA 4LRMA 4P90A 1G5SA 5AIRA 3OROA 4ZTQA 4WIHA 3OBGA 3RKBA 2P55A 3IONA 2C3JA 2O64A 3COKA 4IVDA 3FKLA 4DHFA 4DH5A 5K5NA 4X3FC 5CLPA 4NKAA 2REIA 4YSMA 5EOBA 2ITNA 2W1DA 2IVVA 2NPQA 2W9ZB 4BDJA 1OPKA 3QTSA 4FIFA 4FSTA 3QD2B 2ONLC 3MIAA 1UU7A 5DRDA 4TY1A 4DBNA 2PVMA 1H4LA 5KE0A 1IA8A 3KXHA 4F7SA 3D7TB 3ZM4A 3EZVA 1R0PA 4MKCA 3BYVA 1SVHA 1YHSA 3CP9A 3P79A 3EHAA 3QGYA 3VUHA 1OMWA 4FSQA 4ZP5A 3NW7A 4BDGA 4FIJA 2OJIA 3UVRA 3F6XA 3U9CA 5HG5A 4D1SA 1YW2A 3FSFA 4D2TA 3NUAA 1REJA 4MNFA 2GPHA 4G9RA 5FTGA 4EORA 4S2ZA 4I4EA 3OD6X 1PXIA 5JFXA 3WZDA 3AC4A 5F9EA 2I40A 4WUNA 3MVHA 1BL7A 4TXCA 4X7QA 3S1HA 2CKOA 4O7VA 2O5KA 2HYYA 3MPTA 2XK3A 4FT9A 3OCBA 2JDTA 3G33A 4WT6A 4I0RA 3RWPA 2ZAZA 1A48A 4G6OA 3VW8A 5HOAA 1REKA 3PZHA 5EQEA 5M55A 4X6RA 4ASDA 2GHMA 4AGWA 5F20A 5L2WA 4NCTC 3UJGA 3FXWA 5CU2A 2QU6A 2ZV7A 3BX5A 4RX8A 1YDRE 5KBQA 3UTOA 1YHVA 4ZJVA 4IX4A 3NZ0A 2XK8A 4G5JA 1GZKA 4KAOA 3FMHA 4EK4A 3LAUA 4QMZA 4FICA 1QPJA 5B2KA 2X8IA 3MA6A 3QZHA 1G3NA 1ZZ2A 4GYGA 4I4FA 2EXCX 4YNOA 5F1ZA 4BY9E 1V1KA 4PUZA 2XIZA 3AC2A 5GIPE 4D28A 4RPVA 3FMMA 4BGQA 2XYUA 4D4VA 4MXYA 2XB7A 2BRHA 5C1QB 4C4EA 4QP1A 1P14A 3RHKA 4JVGA 3QX4A 4RRVA 4RJ7A 4DTKA 2EWAA 3BHVA 3FZOA 4BFMA 1QL6A 4NEUA 3GCPA 5A6NA 4M0ZA 3VBYA 1OI9A 4TTHB 5E8XA 2EB3A 4WNPA 3HNGA 1BI7A 1AD5A 2YJSA 5E91A 4PL3A 4RVMA 1XQZA 4FYNA 2R3GA 3B2TA 1YI6A 4KNBA 3KQ7A 1M2RA 2YAAA 4E1ZA 4JDKA 4O1PA 4X3FA 2ETMA 4APCA 1NVQA 3L8XA 3BE2A 2YAKA 2VX1A 2YACA 2IZRA 3LCSA 3LVPA 2Y0AA 3NSZA 2F49A 2JIUA 4JIKA 1QPCA 4QMPA 5IF1A 3LKMA 3PE1A 3FZ1A 3IGOA 4G3CA 4KB8A 2B54A 2X8DA 3AC3A 4MWIA 3ZO4A 2YDJA 5HLNA 4O86A 1O6KA 4E5WA 4FEUA 3R1SA 2FO0A 3EFJA 3FDNA 3QYZA 5HTBA 4QMYA 3HKOA 4AA4A 2EXEA 1ZWSA 3KMWA 3LM5A 4RIYB 4APPA 5CU4A 2I0VA 4XV3A 1W82A 2JD5A 4LV8A 1GIJA 1H0WA 2PVLA 2CHLA 3D15A 3DK7A 2QNJA 3TNPC 4EOSA 4MBJA 2HXLA 4H1JA 5HE1A 1QCFA 3SG9A 2AYPA 2JBPA 3HVCA 4UN0C 5JK3A 5ANGA 3D14A 4O7YA 2HK5A 3UO6A 3RAIA 4EZ3A 5JZJA 1A06A 1KOAA 2BIKB 2H8HA 4QMNA 2GNFA 3KF4A 4BYJA 4DEBA 3E7VA 3LMHA 2W99B 3Q5IA 2YEXA 4F6WA 4EHZA 4NCTA 1BMKA 2C6MA 2WTDA 1LPUA 5D7AA 5CANA 1FVTA 2XMYA 1Q8UA 3PJ1A 3UC4A 4NM0A 2J0KA 4FSNA 3DNEA 4QYHA 4CLIA 1PJKA 4GG5A 3O8PA 5L3AA 2ETKA 4FNWA 4FZFB 4GIHA 5CQWA 4FZ7A 2B53A 2A1AB 2BDFA 2PVNA 4W4VA 1VYWA 4KIOA 4YNEA 4FT5A 1OUYA 4R78A 4KWPA 4IZ5A 5CQUA 3QUDA 5L6PA 3TUDA 4U44A 3FZSA 4CFUA 4CG8A 4EWHA 4XBRA 4F08A 1JLUE 2HY0A 1OM1A 3OUKA 1FVRA 3KXMA 3VBWA 4EOIA 5A6OA 3H30A 2R3FA 4I0TA 4RIXB 5JGAA 3DOGA 3S2PA 3JR1A 5M44A 2J0JA 4F1TA 2VUWA 4IAFA 3NR9A 4IAAA 4DFUA 3VQUA 2UW4A 5J1VA 4P5QA 4YR8A 2C69A 3FY0A 4IM0A 1RDQE 3R6XA 5J9ZA 1CM8A 3PJ8A 4IQ6A 1PMUA 3UDBA 1ZYJA 3W55A 4GH2A 3NYXA 4F6SA 5L4QA 3F2RA 4FNZA 1IAJA 2BALA 1J7LA 3BBTB 5HE3A 2F2UA 4WOVA 3ZUUA 4TPTA 3CEKA 2PL0A 1YDTE 3R7OA 4D0XA 2IPXA 5M07A 3AT3A 4GFGA 4GV1A 2DS1A 2RFSA 5T6KA 2E9NA 4NFMA 2O63A 4FODA 5LCKA 2ZDTA 3RVGA 5KHXA 5EHLA 4FX3A 4RGJA 4DEDA 4DC2A 4JG7A 5EDRA 3V8WA 4WRGA 5LOHA 4YU2A 3S0OA 2XCHA 3LFSA 4FG8A 3G51A 4JR7A 4NUSA 5IA0A 1PXOA 3AOXA 5D7VA 2W1IA 1DM2A 3ZSHA 4O7TA 5LVLA 3OWLA 3OOMA 5BMMA 3JVSA 4ERWA 4JIAA 4R6VA 2W7XA 5CS6A 3TACA 3NEWA 3GU7A 4XOYA 5A9UA 4CNHA 1APME 5ANDA 3LPBA 3ZUVA 3ZS5A 1Q5KA 1ZYLA 3LXKA 3U4WA 2R3IA 2OO8X 4EBVA 4YHFA 1P4FA 3A7IA 3PP0A 2PULA 1OL6A 5FP5A 5A14A 5ANEA 5I9UA 3EFLA 4F7LA 3PUPA 2X6EA 4JS8A 2JBOA 3TCPA 3Q04A 4GRBA 4C3FA 3VBVA 3CD3A 3PY3A 4ENXA 2PZPA 2EB2A 5AA9A 5BVOA 3PP1A 3ZDIA 3QZGA 4H3QA 2WOTA 3DDQA 3R8LA 3UIMA 3D94A 4OTGA 2GNJA 3KRJA 4NK9A 4XG9A 3MH1A 2CDZA 4PTEA 2PSQA 4J8MA 1F5QA 5FXSA 3Q9WA 1GZNA 3RCDA 4J71A 4IXPA 1ZYDA 4XLVA 2GCDA 2XK9A 3I1AA 4IH8A 4KS7A 4FSZA 1L8TA 2FYSA 5BVFA 5B2LA 5BX0A 3KK9A 4FV7A 4DT9A 5DN3A 3MTLA 3R7UA 4B8LA 4YBJA 5IH4A 4EHVA 2I1MA 4BRXA 4ZS0A 3IW5A 4ACMA 2J2IB 2VWYA 2JLDA 3F88A 3KCKA 2B9IA 2XS0A 2JEDA 3DB6A 4RLKA 4C0TA 2YM5A 4GUBA 1GZOA 2I0HA 3Q9XA 3FXZA 4AZEA 1M2PA 2VX3A 3VS0A 3UMWA 5CEKA 2QOOA 1Z9XA 2VU3A 3F61A 4C7TA 5JSMA 2VTRA 4HW7A 3R9HA 4NFNA 2OIDA 3LFAA 4QP8A 4JG8A 3QQFA 4CFMA 2FA2A 4CKIA 3QQHA 1YI3A 3RP9A 4XH6A 4KA3A 2UVYA
chains in the Genus database with same CATH superfamily
2J9MA 2QONA 3QXOA 2VTMA 4OLIA 4QMTA 4S34A 5CTPA 4ORKA 4MBLA 3OW3A 4BR3A 1BUHA 5J1WA 4BCNA 3TYKA 2XZSA 1H24A 4G3FA 4GK4A 3LJ0A 3QLFA 1YXTA 3EB0A 4FF8A 4U40A 3GC9A 2ZV2A 5AWMA 5GZ9A 4A07A 1PMVA 2JKOA 1OIYA 1R78A 2EU9A 1MRYA 3CD8A 5DT0A 1U54A 1H1RA 3GU6A 2IW6A 3VJOA 4FA2A 3W0PA 4F78A 2H9VA 3ANRA 2J5EA 3VUMA 2C6LA 3BYMA 3VS6A 4BZOA 5LXMA 4GU6A 3QZIA 2FUMA 2Z60A 2QQ7A 4FZ6A 4NH1A 4RA4A 4E4MA 5J5TA 4G9CA 4C02A 3HZTA 4UWYA 3IPHA 3C4ZA 3MI9A 1Y6AA 2YCFA 4XP0A 4FV4A 4C36A 3DAKA 5HE0A 4D2PA 2CGVA 3KU2A 4D0WA 5KUPA 2XNEA 4FZAB 4UYAA 4WBBB 5AP7A 3SQQA 3VUIA 3BQCA 3BU3A 5DNRA 4QQCA 4OAVB 3QKLA 3RCJA 2GFCA 1IR3A 3K2LA 4V01A 3GOPA 4ALWA 4UX9A 5FEQA 5C27A 2VTQA 4OBQA 5AP2A 4E8AA 3T3VA 4JX7A 4JBOA 4CZYB 4AGCA 5HD7A 2XKDA 4OTQA 3F66A 3MFRA 5AV4A 1OECA 3I7BA 2BHEA 5FM2A 2Y6OA 4C4JA 2XJ0A 3MFTA 4DEIA 5I0BA 3H0YA 4I6QA 3VBQA 2WMVA 5KO1A 4W9XA 3UPZA 4FVQA 3ZRLA 2A2AA 2RG5A 3L8VA 2I6LA 3R01A 2V5QA 2UZUE 4HNIA 3ROYA 3TKUA 3TUBA 4QDEA 4FTUA 3PLSA 3A62A 3LCDA 5ANKA 2VWWA 5CYIA 4AG8A 5TT7A 3AKJA 3A4OX 3KC3A 5BYLA 4DA5A 1UKIA 2J0MB 4ITIA 3AC1A 3ETAA 2C47A 3MFUA 1MQ4A 3QCYA 4ASXA 4BJJB 4MBIA 4EZ5A 5CEMA 3EQBA 5DR2A 3UMXA 4YUQA 4QNAA 2OJFE 4UWCA 2XAOA 1I44A 5AM6A 2H6DA 4EH3A 5JEBA 4K9YA 4DGOA 5AP6A 3VONA 1WBNA 2CPKE 4FTKA 4FT0A 4CTCA 3ENMA 4BGGA 5CAQA 4C8BA 1NVSA 5CSHA 4BHNA 5EM7A 5EYKA 5FDXA 1XH4A 5CVHA 5HO8A 3AQVA 3ZYAA 4BDEA 4BI0A 5AAGA 4MYGA 4XYFA 3ALOA 2PVFA 3P08A 2HWOA 3SXSA 2PTKA 4I6BA 1H1PA 1XWSA 2VTLA 4GS6A 3C4CA 5GIOE 5I4NA 4GW8A 2Y8OA 5DHJA 3NUSA 2C6KA 2ZOQA 5HCXA 3FI2A 2B55A 3HMMA 3KVXA 1WAKA 5CZIA 1W83A 2QU5A 1YWRA 2BFXA 4JQ8A 1VEBA 4KBCA 3ZLXA 5AV3A 3R9OA 3F3VA 1TKIA 3LCOA 4GK2A 4UZDA 3ZSGA 5FXQA 4D5HA 1G8AA 4TYHA 4FE2A 4K2RA 4RJ8A 3VHKA 2WKMA 4DGGA 1OL7A 4NJDA 4L00A 3K3JA 5AA8A 4A9UA 1TVOA 3R21A 4LMNA 4M69A 5EQPA 3HYHA 3PPJA 4O0XA 4QMMA 4R7BA 4EWQA 4G3GA 4X0MA 3PXKA 5AEPA 2BZIB 3C9WA 4CMUA 4YJUA 2ZM3A 5JFWA 4DG3E 3CE3A 4GIIA 1LUFA 4F09A 5AUTA 2X2MA 2QHNA 4D2SA 5GINE 3WE8A 2OZOA 3A2CA 4ASZA 3CPCA 4BDBA 5JZNA 5CF4A 4O7NA 1M2QA 3DXNA 1UNLA 5JN2A 2DQ7X 3Q96A 4R8QA 4HVGA 3BELA 3E88A 3SKCA 4YJNA 4BICA 5CAOA 4UV0A 4IWPA 1NXKA 1OGUA 5EFQA 3TL8A 1NW1A 4WNKA 5IEXA 3H10A 3IOKA 3CIKA 3QBNA 1OIUA 1OZ1A 4JR3A 3CGOA 2VO6A 3DV3A 3FHRA 3PUFC 4AOJA 1Y91A 5ETCA 3DTCA 4W9WA 4FL3A 4FKTA 3MYGA 3QCXA 5IUIA 3QA8A 4YZNA 1WZYA 4J53A 4U7ZA 4L01A 2OKRA 3HA6A 3G15A 4FYOA 2YLEA 3D5WA 3WF6A 1JSVA 1CMKE 5KMIA 4RX9A 2GTMA 4L53A 5J7HA 4Q5EA 3C5IA 5C4LA 4BC6A 3WZKA 3FI3A 1J3HA 1YXVA 3DQXA 1H25A 4KBKA 4H39A 4TN6A 2PWLA 3V01A 5JMSA 4QT1A 3KKVA 4NYEA 5HX8A 4JLCA 3WF9A 2A0CX 4J99A 4RJ6A 4G17A 3RPRA 5CASA 4CV8A 5CEPA 1FMKA 4F6UA 2LGCA 2Q0NA 2YCRA 2YCSA 3F7WA 3MDYA 4DTBA 4ZY4A 2HZ0A 2B9JA 2CN5A 4D4YA 5FUTA 2RF9A 2WMWA 4YHJA 4IB5A 3SLSA 2RGPA 5HE2A 4H36A 3OTUA 3VBXA 4L8MA 2B0QA 4M66A 2VTIA 2ZV9A 4RJ4A 4LOQA 4MQ2A 3ULZA 3P23A 4R3RA 4NWMA 3VO3A 3IW6A 4IM3A 1SVGA 3M1SA 5K0XA 3V51A 4AW5A 3IOPA 1RQQA 1UWHA 5AFVA 4DG2E 4USFA 4AW2A 5JRSA 3RM7A 2PE0A 5BV3A 1KE8A 2OIQA 3UP7A 3FL5A 3QALE 1GIHA 4B9DA 4ZLOA 4HGEA 4LMUA 2YHVA 3FMLA 2VTOA 1QPEA 2UZOA 4CTBA 1CKJA 4AXEA 4DN5A 4EH2A 4EUTA 2J0IA 4GSBA 1JBPE 4KRDA 4MAOA 2XK4A 5AX3A 4DFZE 5HI2A 3F5UA 3PPZA 3BI6A 4C3RA 4XG2A 5AAEA 3PRIA 4TW9A 2WQMA 3ATTA 5LMAA 4E4XA 5HICA 1PKDA 4XP3A 4GFMA 2VNWA 3M42A 1A9UA 2QOHA 1ZMVA 3MBLA 4R77A 1LP4A 1PXPA 3HV3A 3MJ1A 4IJ9A 5C8NA 4DFNA 5DGZA 5TKDA 2OZAA 2VTSA 5LVNA 3GENA 2C6TA 4DITA 3KRRA 4WKQA 4AE6A 2OJJA 5DYJA 4FOBA 5CY3A 4E6DA 3BLHA 2QHMA 4OTFA 3BHTA 3SW7A 1SNUA 4RJ5A 4O81A 3D2KA 4UMUA 4BF2A 4E6QA 3PDTA 2G2IA 4AFJA 4U45A 4Y95A 5HKMA 2Z7SA 3MW1A 1TZDA 3WF5A 4EOOA 1WVXA 3PJ2A 5IQIA 4IJPA 5BVDA 3WYXA 5IUGA 3LIJA 4GT4A 3B8QA 3UODA 2XRUA 3TIYA 3ZH8A 2WMRA 5IZFA 3FL4A 4ZMFA 3IDCA 3H4JA 3BKBA 4CFVA 2GTNA 2YM7A 1Q41A 2VTTA 3DNDA 5ACKA 3ZO2A 3ZM9A 2B9HA 3BHYA 4FV0A 1CSNA 2BR1A 5CU3A 2HCKA 4LRKA 4XV9A 5I9ZA 1CKPA 1J91A 4I20A 4J7BA 5I9YA 1WBOA 1UU8A 3QYWA 1ZOEA 2WU7A 2X4ZA 4GL9A 3LXNA 3KFAA 5AR8A 3MVMA 2Y6MA 1H27A 2HENA 2IVUA 4RX7A 3MB7A 3WF8A 4FTIA 5ETAA 2PUNA 3A60A 4XG8A 1JSUA 4F9CA 4MXZA 1V0OA 4FV1A 3V6RA 4DINA 4IHPA 1PXKA 5CF6A 3G0FA 3UVPA 2UW7A 2ITQA 5F4NA 3NNWA 1MUOA 3QTQA 4FUXA 4BDKA 3UDZA 2J90A 4GCJA 4P2KA 3E62A 3R1NA 2VWZA 2UW5A 4RJ3A 3QQUA 4W4WA 5J95A 4BWXA 2R3RA 4CFFA 4O2PA 5TE0A 1NY3A 3UOJA 3G6HA 3QHRA 5DG5A 2CLQA 4FL2A 3W2RA 5DOSA 4BL1A 3RK9A 5EI2A 3BLAA 3V6SA 4FTQA 4AP7A 2X81A 5M4FA 2OG8A 5FTQA 1H0VA 3GXLA 4LV5A 1JWHA 4MK0A 5HIEA 2Z8CA 5AX9A 3A8WA 4BKJA 1IG1A 4BBMA 1LEWA 5I3RA 1WBWA 5AP0A 4L52A 2I7QA 3KREA 1ZOGA 5LVOA 4DE4A 2C0TA 4BJJA 2WTCA 2QG7A 2WO6A 2XEYA 4FNYA 4I5PA 5BVEA 2R3KA 3P9JA 2IW9A 1Y6BA 5FG8A 4Z3VA 3W0OA 3PY1A 2QLUA 3FMEA 2YLFA 5DE2A 4B8MA 2C6OA 4FKSA 2DUVA 3DXPA 4FKJA 3UIXA 4EOKA 2NP8A 2QO7A 2WTVA 5IQHA 2WQEA 4BDDA 4R3CA 5A4LA 5AR7A 3KA0A 1KE5A 5LQFA 4TWNA 2BZJA 3ZUTA 5CVGA 3OT3A 4LL0A 4D2RA 1H00A 3Q2MA 4I0SA 5HBEA 3SC1A 1BKXA 3II5A 3KY2A 4IZYA 4ZJIA 3O51A 1XH9A 4WG3A 4U81A 1H07A 2CGUA 3B2WA 3U87A 3HV5A 3KULB 3O96A 2FB8A 5M08A 1ST0A 4G1WA 5DEWA 5J5SA 5HNGA 4QQTA 3TNIA 5HU9A 5IH6A 2Z7QA 2W5BA 3MV5A 4M97A 4AA5A 3NUXA 1U5QA 3E92A 1WFCA 3D0EA 4KRCA 2NRYA 4DH8A 3GEQA 2P33A 3SD0A 5AV2A 4CKRA 4RSSA 5IEYA 1ND4A 2ZYBA 5DPVA 1O9UA 1Z57A 3CY2A 4FGRA 1WBPA 2WQBA 2QC6A 4MQ1A 4O0VA 4RA5A 2FVDA 1GNGA 3DFCB 3QTWA 2VWIA 3FMNA 4X21A 2PVKA 3TNQB 4N4SA 3AGLA 1PMNA 4ZS4A 2BRBA 3AD6A 1KE7A 2J0LA 4XS2A 2VWXA 1BYGA 2OGVA 4ZTNA 4FKGA 3UGCA 3MGYA 2OI4X 4U43A 2VZ6A 2GQGA 4JDIA 3F5GA 5GJGA 4J8NA 4LG4A 4RC4A 3ORPA 2WD1A 4IWOA 3HRCA 3PJCA 5EM5A 5I5ZA 5CVFA 3NRMA 4K0YA 2HELA 4FI1A 3C13A 3OTVA 3C51A 2OW3A 4DDIA 3A7GA 2CKPA 1SZMA 2YIYA 4FZDB 4NKSA 5JFVA 5AP4A 4P7EA 3Q5ZA 4F63A 3O2MA 4IW0A 4YZMA 4DAWA 3CC6A 5CT0A 4F65A 1YI4A 4O7SA 2PMLX 4CFNA 4ANMA 3HMOA 1K9AA 1U54B 2UZLA 4JQ7A 4KIQA 3FYJX 2XH5A 1JVPP 3FJQE 4C62A 4CFXA 4O91A 2XK7A 5M53A 3IK3A 4I6HA 4BBFA 5HBJA 3BL7A 4KD1A 3MH0A 2XIKA 3MVLA 3L9NA 4G6NA 4ZTRA 3VIDA 1DAWA 2E9VA 3LM0A 4GMYA 4ZY6A 1FMOE 4F9BA 4JNWA 4O96A 4NM7A 3RK5A 3DB8A 1S9JA 4YJVA 2RG6A 5EHOA 2JIIA 4RWLA 2ZV8A 2PYWA 4GVJA 4YGAA 4ACDA 4U41A 1QMZA 4F1MA 3W0MA 4L42A 3ZBXA 4IAKA 3NIZA 4D9TA 1OBDA 4M3QA 1JOWB 4DDGA 2ZM1A 3VW6A 4A4LA 4CRLA 2Y4IB 5I9VA 3ATSA 1NT2A 3BZ3A 4D1XA 2XP2A 2WU6A 4CLJA 3FKOA 4BHZA 1P2AA 2VAGA 3K54A 2XARA 3G2FA 3DKFA 3O8UA 4QMUA 4MF0A 3DJ5A 4MXOA 5KZIA 5BPYA 2UZVA 2EUFB 2GU8A 3ELJA 3KN5A 1W98A 5BYZA 3L9MA 5K9IA 2LAVA 4MH7A 2IVTA 1F3MC 5E8YA 4A9TA 3DY7A 4LL5A 2OXDA 3CTHA 4JX3A 5ANOA 4QYFA 4D5KA 2DYLA 4Y5HA 3R7YA 5HVJA 3ACJA 3PSCA 4GKIA 1H8FA 1GOLA 2IF8A 3A8XA 4WNOA 3MFSA 2OH0E 3PWDA 2WPAA 2J5FA 2UZBA 4FOCA 5IEVA 3QKMA 3W2OA 3PFYA 4KUJA 3EN7A 5CX9A 3F2AA 3W32A 3U4UA 1OUKA 5JRQA 3UZTA 3DJ7A 3RTPA 3QTZA 5FBOA 5AR4A 2R64A 4EONA 4QTDA 1PW2A 1Q3DA 3FPMA 2B52A 5JH6A 2J7TA 2OBJA 2VWBA 1PHKA 3ODYX 2C68A 3IO7A 4MVFA 4BGHA 1Q8TA 4FEXA 4HZRA 3P7BA 2YN8A 5DEYA 1YXUA 4ZSJA 3P0MA 3U8WA 1H1SA 4CT1A 3RPVA 3QXPA 3LOKA 2WQOA 3OS3A 4FTCA 4G34A 1PXLA 3FSKA 2B9FA 2WIPA 3VUGA 5CXZA 4CFWA 5HU3A 2CNQA 1RJBA 2NRUA 2HZNA 4XRJA 5E8SA 4EKLA 2OXXA 1Q4LA 2BHHA 3KXZA 3MA3A 3OVVA 3W0SA 2YA9A 4TYHB 5FM3A 4JBPA 3F2NA 4AGUA 5DMZA 2JITA 1KUTA 5KMLA 5KMMA 2ESMA 1WBSA 4M69B 4FKVA 2VNYA 3N9XA 4S31A 4WHZA 5EI6A 4DLJA 3W0QA 4IMYA 4FTNA 3C4EA 4ANNA 3NUYA 3QUPA 2PMOX 3QRUA 2R4BA 3SG8A 2AQXA 4NU1A 4FSRA 5EDPA 1DS5A 1YKRA 3E63A 3NYVA 2OF4A 2IVSA 3G6GA 4IE9A 4A9SA 4BKYA 4F0FA 4NIFA 1OBGA 3PA4A 5DFPA 5BUJA 5FBNC 4ZXTA 3BU6A 1URCA 1XJDA 3VJNA 4AZTA 3ORIA 4QTBA 4XUFA 3IQ7A 5M06A 2PVHA 4NT4A 3UDSA 2P2IA 4RT7A 2DWBA 3V04A 1ZZLA 5GHVA 4AACA 4IWDA 3TWJA 4I21A 2FSLX 3P4KA 4EOQA 4AE9A 4XEYA 3UPXA 4HCVA 4O21A 2CN8A 3REPA 4MUQA 2C30A 3EQFA 3AMAA 3LFEA 2BRMA 4QD6A 2R7BA 2HOGA 2GDOA 2Q0BA 5IQBA 3CJFA 2UW0A 3FZPA 5HHWA 3FQHA 4TZRA 5E8UA 3TIZA 4DBXA 4DH3A 4YHTA 4F4PA 2F4JA 4EK8A 5L8LA 3I7CA 4C4IA 4ALVA 4AXDA 2C3KA 5IU2A 1YDSE 3CGFA 3HAMA 2HW6A 3F5PA 2R2PA 2X9EA 3DTWA 1SYKA 5HEZA 3P5JC 3D9VA 4AUAA 3ZFYA 4GT5A 4XMOA 4I22A 4CT2A 3ORXA 3HV7A 3QRKA 2WB8A 4E93A 2R3NA 5AR5A 3WIGA 1S9IA 3NW6A 4GEOA 4KSQA 4M67A 3VS3A 2IG7A 4RG0A 4FV6A 2O8YA 4MNEA 4G3EA 2XNPA 5H9BA 2CLXA 4I5HA 2WMBA 4FKWA 5H8EA 3ZHPC 4JMQA 4UALA 3NGAA 4G2FA 2PZRA 1G8SA 2FSOX 5EW3A 2Q83A 4FTJA 3VWAA 2QOIA 2XJ2A 4L9IA 2XCKA 3LFNA 3G90X 3EZRA 5CNNA 3ZLYA 4BZDA 4D55A 4YO4A 1E9HA 4X2KA 4GG7A 4FSUA 3NIEA 4U42A 4WUAA 5IKWA 1LR4A 5H8BA 2ITUA 4LQMA 5J8IA 2Y4IC 4AOIA 3THBA 3KXXA 1H28A 3LCTA 3S4QA 4E6AA 3JUHA 3EQCA 4K1BA 3VHEA 5CU0A 2BAKA 4IAYA 3D4QA 2OICA 4TRLA 2OIBA 4FSYA 3ITZA 4YLJA 4DEHA 3OWKA 4MHAA 2R3JA 4PDPA 4AZVA 3MSSA 3VRZA 2XIXA 4FIEA 3TJDA 1E1VA 3KULA 4MXXA 1R1WA 4IC7A 2XJ1A 3E87A 4NW6A 4O22A 2PK9A 1GZ8A 3LFBA 4B4LA 3HAVA 3SVVA 4OR5A 3DKCA 2VD5A 3I0OA 4H3BA 2PPQA 4YZCA 4F1OA 5DT3A 3ZLSA 3PXFA 3R28A 2OZAB 4EQCA 3PWYA 3Q4CA 3ZONA 3EN6A 1SM2A 2W0JA 4E4LA 2F2CB 3F3UA 1UA2A 3NLBA 4R7HA 5BNJA 4G6LA 4PV0A 5CAVA 5K4JA 3QGWA 2F7XE 3I60A 3O50A 4ANLA 5HBHA 2VO0A 3PSDA 4X2FA 3DZOA 5IPJA 2J50A 3MH2A 3OC1A 4AN2A 2RFDA 2F7EE 1W2CA 4O0YA 2XKCA 4EK6A 3GC8A 5CALA 4ZEGA 3EWHA 5AR3A 4J98A 3CQUA 4DTAA 4JDHA 3CBLA 3EN5A 4DLIA 5BMSA 2XYNA 2YFXA 5FQDC 2SRCA 4DYMA 3O7LD 3FAAA 2C5YA 3CLYA 4FRFA 5B0XA 3BWFA 4C34A 3IW7A 4E6CA 1ERKA 1YXSA 3BWJA 1TQIA 2A98A 3QQLA 2WMTA 3QKKA 1IAHA 3UZPA 3LQ5A 4YTIA 4MD9E 4AZFA 5CI7A 4O6EA 3IW8A 2R0UA 1Y57A 3ZTXA 3QTUA 2QLQA 4BWPA 1KOBA 3LFQA 3HRFA 3MY0A 3GCQA 2GSFA 4NTTA 3C50A 2ZM4A 3QFVA 4FIGA 3L9LA 3O71A 4C2VA 2H34A 3DA6A 3KRXA 3L8PA 4OTPA 4RBLA 5LWNA 4EC9A 3WF7A 4CZUA 2BTRA 5EKOA 5KNJA 3PVBA 2UZDA 4WRSA 5IQFA 4XG6A 4FV3A 4CZTA 3IS5A 3S3IA 5K4IA 3GI3A 3CKXA 4OW8A 1STCE 5HNIX 3O8TA 3F69A 5JT2A 1PMEA 1X8BA 3FLNC 4F64A 3VC4A 5EDQA 4YJOA 1FBNA 2JDSA 3HL7A 4QMOA 3GQLA 4FKQA 4BZNA 3PPKA 1XH6A 3D5VA 5EK7A 4Q9ZA 1OL2A 3CJGA 2UZTA 5HESA 4PMPA 5LMKA 2VTJA 3OG7A 3SGCA 3CQWA 2QOCA 2GNIA 2X0QA 1OITA 3BGPA 2QVSE 3EKKA 3QCSA 4P4CA 3N4UA 3HA8A 4V05A 3ZEWA 5KKRB 4FKPA 3ZZWA 4ARKA 4OTDA 4HPTE 4ZY5A 3BEGA 3U6HA 5B7VA 1M7QA 2WMAA 4QEBA 1XH5A 3GC0A 4K18A 4EK5A 1DI9A 3R30A 4OGRA 4YJQA 4I93A 5GZ8A 4RZVA 5FP6A 3CQEA 4LGGA 4LI5A 4FKOA 5EM8A 3ZFMA 2WMXA 4IBMA 2ITZA 3ORNA 3ACKA 5E8VA 3R8UA 4B6LA 5FTOA 2X0PA 4AWIA 4HNFA 3R0TA 4QTCA 1SMHA 2C1AA 3UDTA 3ID6C 3RPYA 4UMRA 2X2KA 5E8WA 4BDFA 3EKNA 2XAMA 5CEOA 3TV4A 1H1QA 4YSJA 4FVRA 2Z7LA 3GT8A 3RAHA 4A7CA 3OFMA 4Z55A 3UNKA 2R0IA 3F82A 1XBCA 2QKRA 4AX8A 2X1NA 3VS2A 2ZJWA 1AQ1A 1DI8A 2QR7A 2W4JA 4AF3A 3GB2A 2J51A 3CCNA 4UBAA 4D2WA 4YTCA 2IJMA 2JAVA 3COIA 5CU6A 2WGJA 3UG2A 4WO5A 1OGYA 3OWPA 4ZJJA 4E7WA 3Q4ZA 4O4FA 5A4CA 4YC6A 1WMKA 3NUUA 4M68A 4FJVA 4Y85A 3RNYA 3ERKA 3NDMA 4FUYA 3PA3A 2IN6A 3E93A 4XNEA 2R3PA 4P5ZA 3VN9A 5E8TA 4QP9A 2XNBA 3UBDA 4C57A 2OU7A 4PY1A 5A46A 5D1JA 4C33A 4RIWA 4ALUA 3JXWA 4N0SA 3D83A 4DFYA 2IEWA 4E5AX 3BV3A 1B39A 4XG7A 3DXQA 3LMIA 3P7AA 4GUEA 4L43A 2JAMA 2HZ4A 3W2QA 3VS1A 3CTQA 3AKKA 3O23A 2YABA 4JRNA 2WELA 1PY5A 5TF9A 4AXAA 4S32A 4UEUA 2FH9A 4N6YA 4YJSA 2ZMCA 3ULIA 4ACGA 5KBRA 2C0IA 4CRSA 3WZUA 4BCMA 2R3MA 4U5JA 5CZHA 2WTJA 2WEVA 2C5OA 3C0HA 1FOTA 1JNKA 1CDKA 3FMDA 3TTIA 2GHLA 3UOKA 2XM9A 2WZJA 2PZYA 3W2CA 2I0EA 4QPAA 5FEDA 4E3CA 5GZAA 3W0RA 3ROCA 3MJ2A 3NFFB 3KVWA 3ZO3A 3UZRA 3N4VA 4M13A 2IO6A 1WCCA 2YDKA 4AGDA 4BCKA 5JQ5A 3QTIA 4XG4A 3WZJA 4QQJA 4DCEA 4TL0A 4O7LA 5M09A 3EFWA 4RQVA 4ZOGA 3V8SA 3ZC5A 1KSWA 4AOTA 3ZRKA 5E4HA 3C7QA 4Y8DA 2CCIA 2CGXA 3DFAA 4C61A 4UXLA 3AMBA 5AP1A 4K8AA 2R3LA 3NNVA 4GK3A 5IMXA 3RAKA 4IX3A 3R8MA 2HXQA 2NO3A 4L67A 4UB7A 5AM7A 2VRXA 3F9NA 4Z9LA 2E9OA 4M7IA 2CMWA 3ORMA 3R04A 4Z7HA 3KCFA 4I6FA 4F70A 5M57A 4YURA 4BTKA 3NCZA 4PL5A 4BDCA 5L6OA 4EOLA 5BVNA 3K5UA 3TI1A 4EOJA 3NUPA 5IG1A 4AZSA 4C2WA 4FKRA 4UZHA 2XF0A 4WSQA 5G1XA 5HIDA 3G0EA 3I6WA 4EHGA 4HYSA 2Z7RA 4IB1A 2RFNA 4AFEA 4NJ3A 1R3CA 1UNHA 2B4SB 4OTWA 2OH4A 2CCHA 4TT7A 4O0WA 4AXFA 1YWVA 2R5TA 2W17A 3DKGA 4YJRA 2V0DA 5JFSA 4UY9A 1J7UA 5IA1A 3EQGA 1R0EA 3V5LA 4BN1A 2BRNA 3R1QA 5TR6A 3BIZA 3E8NA 4TNBA 5EH0A 3SHEA 5M56A 2VV9A 3FI8A 3FEGA 3SW4A 2JIVA 2W96B 4BTFA 4PP7A 2HAKA 3F3TA 4BVUA 4JL9A 2ERKA 3RGFA 3HV4A 3KK8A 1ZYCA 3L8SA 4O4DA 3P78A 1GAGA 3NPCA 4FV9A 4TYJA 1UKHA 2C6DA 4Q9SA 5CEIA 5FXRA 2C6IA 1TQPA 4LUEA 4MEDA 3HX4A 5HX6A 4EH6A 4U97A 4AN3A 3DK3A 3MWUA 3U51A 4DFLA 4FSMA 5HVKA 3SX9A 5AAFA 3QX2A 4EL9A 4ZLYA 4E5BA 1UU3A 3QWJA 3TZMA 1GY3A 4ZZNA 4U0IA 3RHXA 2WAJA 3SOAA 2YISA 3L9PA 4ZIMA 3EJ1A 3QQKA 3R2YA 5EOLA 4C58A 3C1XA 4RLLA 4F9AA 5CF8A 1P5EA 3T3UA 1QPDA 5J7BA 1TFFA 3MY5A 1OIRA 2Y4PA 4O0SA 5D12A 4HCUA 4A9YA 3NVMB 3QWKA 1L3RE 3PXQA 4RZWA 3OEZA 1ZXEA 4H1MA 5A4TA 4O7WA 1BLXA 5HCYA 2YIWA 3FLWA 4LGHA 3FE3A 4AQCA 2V7AA 3GQIA 1IRKA 4PPBA 2VTNA 3LCKA 3GCVA 4HYUA 4B99A 3BHHA 5EKNA 2OJ9A 5CSWA 2IW8A 3CTJA 3TDVA 3WILA 4FK3A 3UNZA 4ACCA 3EQPA 3UIBA 2JDOA 4AS0A 2X0GA 4EOPA 4I1ZA 1IA9A 2YZLA 2YM4A 2IZUA 1XMMA 3F7ZA 3RJCA 3FPQA 4FV8A 4NIFB 4LOPA 1Q99A 4WNMA 3W1FA 1NA7A 4GKHA 2XIYA 2UZNA 4RFMA 4FEVA 1Z5MA 4BI1A 3I5ZA 5F94A 3R63A 3HDNA 3SV0A 1OKZA 2BDWA 3KMMA 1JQHA 2B1PA 2PE1A 5L2QA 4ANOA 3UYTA 4I5CA 2WNTA 4QMVA 4RWIA 4C38A 4QOXA 2JKMA 5HQ0A 2GFSA 2WTWA 3FXXA 4YJPA 3PVWA 5M4IA 2UZEA 4CVAA 3LW0A 3VRYA 3OOGA 4IVBA 3QD3A 2XUUA 2O2UA 3I81A 4IFGA 5H3QA 1J7IA 5E9EA 4RX5A 1W0XC 5HVYA 3DAJA 4D1ZA 3DDPA 5JGDA 3JS2A 1B38A 2OFVA 3R8PA 4LDTA 3FLSA 3P5KA 2ZDUA 4OT6A 1IASA 2GQRA 2VX0A 3TT0A 3A4PA 1PYEA 3PYYA 4MWHA 3CPBA 3FWQA 3Q53A 5L8JA 4JXFA 4X2NA 3RPSA 3OCGA 3QAME 4ZSLA 2AC5A 2Y7JA 3FUPA 4MNEB 3TZ8A 4IX6A 5IA4A 4ZSEA 2E9UA 4NZWB 5IMEA 2JFMA 4QP7A 4EQMA 4O4CA 1TQMA 3K5VA 3NYOA 3F3WA 5CT7A 3W18A 4CSVA 4I5MA 2VO3A 4MD8E 2W4KA 3HMIA 4FEWA 3QLGA 3Q9YA 3AGMA 2CGWA 3ORKA 3KF7A 3R00A 1OL5A 4G5PA 4IB0A 1G8KA 5ANJA 3KB7A 5JGBA 3GOKA 3MH3A 4HVHA 3ORLA 4O2ZA 3HLLA 1MP8A 3MTFA 4J52A 3DS6A 3KRLA 2ITTA 3EQIA 3FLZA 4FTOA 2YWPA 4GYIA 5DIAA 4EK3A 4D4SA 5J9LA 2C4GA 5AMNA 5FWKK 3Q60A 5E7RA