4C4IA

Structure-based design of orally bioavailable pyrrolopyridine inhibitors of the mitotic kinase mps1
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
279
structure length
253
Chain Sequence
QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMTVNYMPPEAIKDMISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Structure-Based Design of Orally Bioavailable 1H-Pyrrolo[3, 2-C]Pyridine Inhibitors of the Mitotic Kinase Monopolar Spindle 1 (Mps1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 253
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2013-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c4iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c4iA01
4FE2A 3UVPA 2BDWA 3R7IA 2VO0A 2UW4A 4ZAUA 4FNZA 4R3RA 4EORA 5GIOE 4NTSA 5FEQA 3ID6C 4RJ3A 4GL9A 2XK8A 2WMWA 4AOJA 4DINA 2UZWE 3L8VA 2R3JA 5M08A 4HGTA 2E2BA 4OR5A 3R01A 4RX7A 4IC7A 3UTOA 4OGRA 4Q9ZA 3JUHA 2PPQA 3OF0A 3HKOA 2A2AA 5BUEA 3LQ8A 4HPTE 4WUNA 4IAYA 4C4JA 3GU4A 2E9VA 2UZTA 4G5JA 5J95A 4IX6A 5HCYA 1HOWA 3EL7A 3MFUA 3AGMA 4KIKB 3NUAA 4O91A 1U4DA 3W8LA 2WMVA 3WOWA 2JKMA 3DFCB 3E8EA 5J9YA 3V8SA 2QQ7A 5IMEA 2YIYA 2C5XA 3EQIA 3F66A 2C6TA 4RC4A 3KXNA 1ZOHA 4DEGA 2ITTA 2BZHB 3VS0A 2HOGA 3RINA 5M07A 3B8RA 2QOCA 5CY3A 2VWUA 4KBKA 3R9RA 1JOWB 3DTCA 4P5ZA 4PPBA 2VZ6A 2YDKA 2UZEA 3GCPA 4D2VA 4FKSA 5CVGA 5CF6A 4ZOGA 2F7EE 3DB8A 5AV4A 4G6NA 5M51A 3TDVA 4DFUA 1R39A 2BZJA 2WTKC 3OUNB 3OTUA 4J7BA 4LMNA 5CU4A 3R8VA 5GZ9A 5A14A 1RJBA 5IPJA 3D14A 2XNGA 3MTLA 4KSPA 4JBOA 1P5EA 2BFYA 3C5UA 5AM6A 3LXNA 5T3QA 1W7HA 3BV2A 5LVLA 4FI1A 4BDKA 3BE2A 1CKPA 2JBPA 3C4XA 3PJ1A 5B7VA 4W9WA 4AACA 3LW0A 3ITZA 2PK9A 4JQ8A 5BYLA 1OUKA 1FGIA 2HXLA 3ORNA 4J52A 2BZIB 1UNHA 2YIQA 3CEKA 3TUBA 4QMXA 3Q2MA 4J98A 2FVDA 3RAKA 3QRJA 4FIJA 3LFEA 4O6EA 4YHFA 4DCEA 4X21A 1JKSA 5IEYA 4IX5A 3QGYA 4Z9LA 5EHLA 4PTGA 3TG1A 3MVLA 4EK6A 4L53A 4A4LA 4LUDA 3DOGA 5IA4A 2Z7SA 2DQ7X 3R30A 3ENHA 3QUPA 4I5CA 4DEAA 2JLDA 3CGFA 4NW5A 3MA3A 2VTJA 1OIYA 4JR3A 4FKOA 4O21A 4EOLA 5EK7A 4DBXA 3IW4A 4X2JA 3TIZA 4BHZA 4TNBA 5C26A 4YTCA 3R1NA 4R6VA 2XK6A 4EC9A 2BMCA 3KMUA 3GB2A 3QLGA 1M17A 4IXPA 5AMNA 3UPZA 4R3PA 1GZ8A 4IE9A 2QHNA 4PMTA 4A9RA 2ZV8A 4CXAA 3PRIA 4L67A 4UMUA 3C4WA 3GQLA 3QAME 5A6NA 4FGRA 4EUUA 2ZM4A 3PPZA 5HBJA 5EOLA 1U54A 1O9UA 4FTOA 2R2PA 4YJUA 1U5QA 4H3PA 4BCGA 2QHMA 4FUYA 5HKMA 4BKJA 1M52A 3FJQE 2A1AB 1UU3A 3OWPA 4FZDB 2UW9A 3QBNA 1DI9A 4JAJA 3O51A 2ITUA 3BBWA 3R9NA 3DDQA 4IANA 2JFMA 2R3LA 2BAQA 3OG7A 3ORKA 2JGZA 4HNIA 5DR9A 3FMJA 3ZBFA 3FE3A 3F5UA 5KHXA 3SXSA 4R78A 3FBVA 2R3RA 4I0SA 1JNKA 3KULB 3TNQB 4OTRA 3GFEA 5AV2A 5E8XA 3IPHA 4MTAA 2ZB1A 2AC3A 3C51A 4S31A 3BE9A 2AYPA 4GT4A 1Y8YA 4I3ZA 4OUCA 4YGAA 1FVVA 2HAKA 4FKLA 4FL1A 1TVOA 3MBLA 2QD9A 2IVTA 5DR6A 3U8WA 3LIJA 2ERZE 5D12A 1KV2A 3D5UA 4ERKA 5HLPA 3MVMA 1L3RE 3PJ2A 4NM7A 2OF2A 2C1AA 4YJVA 3TJDA 5HZNA 5CT0A 5ANDA 1DM2A 2FSLX 4O7VA 3A8XA 3B2TA 5IQDA 3C0GA 1Q8YA 4I93A 4PNIA 3D7TB 4RVTA 5E91A 4PDYA 3L9NA 4DTAA 5ETFA 5K4IA 3OP5A 4R3CA 4BCIA 3IW6A 3TUDA 4L3PA 5A4QA 3A7HA 5CNOA 1ERKA 4YBKA 2QURA 3DS6A 4DFNA 1NA7A 2PULA 2BDJA 2R3FA 5ANKA 2W0JA 3PA3A 3MA6A 4U3ZA 3RGFA 3ZDIA 4YLJA 4K33A 4MF1A 1Q4LA 3MIAA 4BDDA 4KKGA 1R1WA 3V51A 5KMNA 5KUPA 1TQIA 3O8TA 2XBAA 4E6CA 1YKRA 2J0KA 4TKSA 5HG7A 5KMKA 1XR1A 2P0CA 2UW7A 2G2HA 1YHWA 3MFRA 4F9YA 5HO7A 5AUZA 3DLZA 3VAPA 4CRSA 4UBAA 3EQGA 4PP7A 3HA8A 4IC8A 2JKOA 2WELA 2YAKA 5IQEA 2FSOX 2X0GA 4NH1A 4ZIMA 3P7AA 3I6UA 5F95A 4EOKA 1BKXA 5JKGA 2W17A 3LFSA 3EN7A 3IDPA 3N51A 4YJOA 5ANGA 3LCSA 1UU9A 4LV5A 2VV9A 3LM5A 4FIGA 3HECA 4DFLA 3AT4A 4B8LA 5CZIA 2FH9A 1SYKA 4DBNA 4D0XA 4O81A 3GNIB 3RAIA 2G2FA 1G3NA 2A27A 3D2IA 5L6PA 2UZUE 2WZJA 4ZMFA 4F99A 3SOCA 3UVRA 4RJ5A 3DQXA 3EIDA 3PVBA 4AF3A 4AZFA 3NEWA 1A48A 3OHTA 2C5YA 3CTHA 3LMHA 2WHBA 5CLPA 4IB0A 4BBMA 4QP9A 5AR7A 2VTIA 3WZEA 2W1EA 1JBPE 3FKOA 3OCGA 5KMJA 2WQOA 3TACA 3C1XA 4JX3A 2Y8OA 1SNUA 2YLFA 4Z7GA 5EQYA 5ACKA 3HRBA 4LRJA 2R3MA 5J8IA 1XQZA 2IW9A 3IW5A 4V0GA 5DMZA 2RFSA 3LCTA 5DIAA 2B9FA 4M84A 3HMPA 3E7VA 3GOKA 1ZZ2A 4U79A 3VWAA 3UP7A 4D2WA 4MVFA 4NKAA 3ZDUA 3COKA 1YW2A 5LARA 1GZNA 4TWCA 4NWMA 4EWHA 4EBVA 2R3PA 4G3EA 2OJIA 1UV5A 3N9XA 4UXLA 3PG3A 3RM7A 2UV2A 4FODA 2QOBA 3PIZA 4Z16A 5F9EA 5IA0A 4G3DA 3A7FA 4EEVA 2Y7JA 3D4QA 1O6KA 3TM0A 4C02A 4FICA 2HCKA 4NFMA 4A4OA 4QYFA 2UW5A 2PVYA 3PJ8A 2YACA 3R9HA 3OCBA 3KCKA 3WZJA 4XLVA 4CKRA 3CS9A 4RIWA 5GZAA 2GNGA 4G3GA 1LP4A 2O0UA 2Z7RA 5FBNC 3FLWA 4IAFA 4ZY5A 4PL3A 2E9OA 5IQIA 3IOPA 2PVLA 1IEPA 5I3OA 4UY9A 4QPSA 5J87A 2WTKB 3FXZA 4MD9E 2BHEA 3COHA 4D5HA 4TZRA 2VX3A 2R0UA 3FC1X 2F4JA 4RJ6A 3KU2A 3KRWA 4HOKA 3VVHA 5L2IA 4FKIA 3S00A 4L7SA 1XHAA 2PMIA 5BUIA 3FPMA 5K9IA 5KMOA 3C0HA 3CQEA 4PWNA 3DTWA 2NPQA 3MIYA 5DVRA 3IW7A 3UPXA 5BMMA 4D2RA 4BCHA 1DAWA 2ZV9A 4FV5A 3W1FA 4B6LA 4C59A 5IQFA 5C27A 2LAVA 3MVJA 2GNFA 4C2VA 3MYGA 2WTJA 3RNIA 4C61A 5JGDA 4HYUA 3TXOA 2VX1A 3W2QA 3T9IA 5FXQA 3UZPA 2CKEA 3R83A 4E73A 5EW8A 2BAKA 3KMMA 4ACCA 4EZ3A 4F7LA 2B4SB 2R3GA 2HELA 4JQ7A 4OTQA 2PUNA 3RNYA 3U4UA 3SRVB 4CNHA 3PLAE 3BCEA 2XA4A 3WF5A 1JLUE 5CXHA 2ZMDA 4WG3A 1OMWA 3FY0A 4Z55A 3DKGA 2O3PA 5BYZA 3EQBA 4ACDA 3G0FA 3EN6A 4D1SA 3V8WA 2FB8A 4XNEA 4FUXA 2J2IB 4BKYA 4D5KA 4ZTSA 5IMXA 5IZFA 5GJFA 4IZAA 3LCOA 4CV9A 4GKIA 4CT1A 3TTIA 2X7GA 3I4BA 3CCNA 2R3KA 4BB4A 2YJSA 4DEBA 3O96A 5HG5A 3UMXA 4IJ9A 5D41A 3A2CA 2QNJA 4Q2AA 4M13A 2WQEA 1JQHA 2OF4A 4ZTNA 3EQRA 4H3BA 4BCMA 4D9TA 5CALA 3TV7A 4QQTA 3COIA 4A9TA 2XEZA 1GIIA 4UZDA 3SX9A 5AUUA 3HUCA 5JEBA 3ODYX 4XV1A 2Q83A 3GU7A 3QQGA 3KXZA 5HHWA 2EB2A 3WIGA 4UXQA 2R3OA 2R9SA 2ZDTA 3SW7A 4N4SA 4EOIA 2OZAA 3I5ZA 3R7VA 4FTNA 3LCKA 4ANMA 3R71A 3HRFA 4MNEB 3ZLXA 4E6DA 2HWOA 4Y8DA 4U9AA 2P3GX 4FSRA 4YBJA 1ZOEA 3R1SA 3CBLA 4IM3A 4M69B 4MD7E 4U42A 4WNOA 3G33A 4I4FA 5GIPE 2WEIA 4EH5A 4I94A 2QONA 3QQKA 3FSFA 4W4VA 3KF4A 4GIIA 2WGJA 3B2WA 3PRFA 4C58A 4QYHA 2HW7A 4BI2A 4F7JA 5AP3A 5FUTA 2GNJA 2IO6A 2X2MA 3VN9A 2A0CX 3P0MA 2R5TA 2UUEA 2WQNA 4QP3A 3VUTA 2W06A 3ORMA 3D5XA 3Q3BA 2ITOA 4FF8A 2XK3A 4N0SA 4BY9E 3PJ3A 4BTFA 3FXXA 4JOAA 1HCLA 3Q4TA 2J0IA 2REIA 1QPDA 3JVSA 3EFKA 4JBPA 3DQWA 4IX4A 2JEDA 3OWLA 4FT5A 1MP8A 3QWJA 3JY0A 4KWPA 4YP8A 5IQGA 1J1BA 2YM5A 3NYNA 1PYXA 1UNGA 4AOTA 4DGOA 4KRCA 5LXMA 4FV6A 3QTUA 1BMKA 4NEUA 4BDFA 5HLNA 2PTKA 1RQQA 3JS2A 2X9FA 4DYMA 2C6KA 2OG8A 3DKOA 3MI9A 5A3XA 4EWQA 3F82A 5HG8A 4QMZA 5BVEA 1OBGA 3EN4A 3QZIA 2W4KA 3AC8A 1RE8A 3L9MA 4I5HA 4EH4A 3KREA 5FTGA 2GNHA 2HZ0A 4HCTA 1DAYA 1GAGA 4A9YA 3BHHA 2BCJA 4IB1A 1IRKA 2CGVA 3DBQA 4BDBA 3F2RA 1I09A 1NY3A 5A6OA 4QPAA 3SXRA 5JK3A 3QXPA 4MBJA 4X6RA 5AIKA 4PQNA 2C69A 4GYGA 1GOLA 1ZLTA 3DNEA 4KIQA 5I9UA 2XJ1A 3VJOA 3EYHA 4FT7A 5G1XA 2YDIA 1K3AA 3Q5ZA 2BKKA 3PXKA 4TYGA 5HICA 4FYOA 3CC6A 1DS5A 3ELJA 5DOSA 5EM8A 5LVPA 4ZTMA 3JYAA 4DN5A 5E8VA 3FZPA 3OW3A 3EZRA 2YIRA 1WMKA 5A54A 4CMTA 2RFNA 3OUKA 4O7TA 4XBRA 2ZMCA 3OCTA 5EW3A 3C4CA 3CJFA 5HO8A 3TNHA 3H4JA 4NIFA 4AFJA 3UQFA 5IQCA 3QRKA 2F57A 2IZUA 4ZTHA 5CU3A 5D7AA 4QQ5A 2NNWB 5IU2A 2E9NA 3EHAA 4L68A 1PXIA 4KB8A 4CLJA 1RDQE 3A61A 2BRGA 2UVZA 4K11A 4O27B 4FTQA 2QO7A 4FEVA 4OTIA 4TYJA 5IUHA 2X8IA 4RWIA 1B6CB 3F5XA 2GTNA 3P23A 2BALA 4ENYA 2UZNA 4PL5A 4OBOA 2C3IB 4QD6A 3IK3A 4MCVA 4RJ7A 2YITA 3AMYA 4YLLA 5AUVA 1SZMA 2CN5A 2IZSA 4YZBA 5HIDA 3Q53A 2WMSA 2W1CA 3MDYA 4IFGA 2IVSA 2PZPA 4KAOA 5EW9A 5TF9A 4ZLOA 4P7EA 4DG3E 3SC1A 1V1KA 1BI7A 1OGUA 1YWVA 3EL8A 4L01A 5EFQA 4ZSGA 5KE0A 4YU2A 4YMJA 1YDRE 2XF0A 1XWSA 1WVWA 4QTBA 1W0XC 2JDVA 3JR1A 4ARKA 5FXRA 3FQSA 1YI4A 5FRIA 4C35A 3IKAA 3DJ7A 3KKVA 1YI3A 4ANSA 3P4KA 1PMUA 1ZMUA 4YZCA 4GFGA 4FSWA 3ZZEA 4FKJA 4ID7A 4TYHB 4U40A 3KFAA 4ZZNA 4MF0A 3TZMA 2QLUA 4YHJA 4S33A 3QCSA 4U41A 4U80A 4BWXA 4MXCA 5JGAA 4I0TA 3V5PA 5ICPA 2V7OA 5CT7A 4YSMA 5EHYA 3KY2A 3ACKA 4F4PA 4UN0C 3U54A 4FNXA 5F4NA 3BHUA 4MXYA 4NT4A 2W5BA 3PY3A 4I20A 3P08A 5DG5A 4GJ3A 4EH8A 4GUBA 2KULA 2VU3A 3KXGA 2XNMA 5DYJA 5K3YA 1KE7A 1ZYCA 3CXWA 5CSWA 4AP7A 4V05A 5BMSA 2WMQA 5BUJA 1IAJA 4UMTA 5C8MA 4I6QA 3R63A 4E26A 4O6LA 4C4FA 4B0GA 2VTOA 4XP0A 2XEYA 1U46A 4BCFA 2HYYA 4E4NA 3C4FA 2ZV2A 4FT9A 5AAGA 5B2MA 4ZTQA 3BV3A 5KHWA 2Z02A 3HAVA 1WZYA 3ETAA 3B8QA 4JAIA 2OW3A 4Q9SA 4DTBA 3ZMMA 2VTNA 2V7AA 5KCVA 2X7FA 2QOQA 4IB5A 3H30A 4F0FA 1OZ1A 3QX4A 4OBPA 1ZZLA 2ZOQA 3PA4A 4FTCA 2VTTA 4GW8A 2ITWA 3FV8A 5HLWA 3R7EA 1OPJA 3DK6A 5I9YA 5CI7A 3DGKA 4FYNA 4F1OA 1H4LA 4XG4A 2VWBA 3ZC6A 4AQCA 3FLZA 4UYAA 2WAJA 3BU6A 3KQ7A 2UZBA 3DKFA 4L3JA 1YDTE 3W2RA 4BDHA 3QTRA 5L2QA 3VBTA 1M2PA 2WTVA 5HOAA 4CG9A 3E3BX 1CMKE 5FP6A 3R8ZA 5ETAA 1CM8A 4JX7A 3PDTA 2QLQA 4GK3A 3NX8A 2GU8A 4G17A 1W8CA 4OTFA 2GS6A 3MY1A 1VEBA 3UOKA 4C7TA 3GC8A 3QD4A 3QLFA 5IA3A 4YJPA 3G2FA 5CAVA 4GT3A 3VBXA 3PE2A 1JSUA 1W98A 1IR3A 4YPSA 3CPCA 4CV8A 4AW2A 4CFUA 1WBVA 4NTTA 3LPBA 4XOZA 3AD4A 2GFSA 2QOOA 2WMRA 4LL0A 3RAWA 5IQBA 3NSZA 2O64A 3VRYA 4AT5A 4CFNA 2QOKA 3UIXA 2XH5A 4L6QA 3EQHA 4BBFA 1FOTA 4UALA 4AOIA 3U6IA 5JH6A 3L8PA 3BEGA 2B55A 2HIWA 2HZIA 3NAXA 3O7LD 4RVLA 5EM6A 4ACHA 3E64A 4FKWA 3F2NA 4USFA 5AAEA 3FAAA 3ORXA 4YC3A 3DA6A 4CQEA 2DUVA 4XG2A 2CJMA 2YERA 4A9SA 3Q4UA 4HGSA 5E8YA 3VS1A 3OD6X 1ZYSA 2JDRA 4LM5A 5AEPA 5EQPA 1UU8A 2JDTA 4FIEA 2W1FA 4IAIA 3P9JA 5AV1A 4DA5A 5HE2A 4RT7A 3DXNA 4FG9A 2F7ZE 3QA0A 3PXQA 4O86A 4IADA 3POOA 3EFWA 2P55A 4EYJA 4U44A 3BYMA 3BHVA 4M12A 4Y72A 4DC2A 1Q97A 4AE9A 3QGWA 2EB3A 2VWIA 1U54B 3P7BA 3V04A 3G51A 5HIEA 4DE4A 3ZH8A 1SVGA 2VNYA 5D10A 2QKRA 3D5WA 3KA0A 3ZEWA 5BPYA 1STCE 3FZRA 4I5PA 2CLXA 5ANOA 5HEZA 2W4OA 1ZOGA 1S9JA 2IZRA 1SNXA 3EFJA 3KRXA 3T3VA 3PVUA 4IVBA 4IZYA 3RM6A 3V5WA 3RPVA 2XB7A 1W82A 5CYIA 4U7ZA 2IPXA 5ANEA 2W4JA 4WBOA 1U5RA 2I0VA 4ZXTA 4PNKA 4O7ZA 3CY3A 5DGZA 2CKQA 3NLBA 3TIYA 3HYHA 5HVJA 4D4RA 2VGPA 2F2UA 4DT8A 2VTAA 4FIFA 2W1DA 2BRMA 4QPMA 4GIHA 1WVXA 5EM7A 5TT7A 4BZOA 2RFDA 4GH2A 4JDJA 3VBWA 1J7IA 4I22A 2XKFA 4BGHA 1ZY4A 4K18A 3PP1A 4YO4A 1FVRA 2YWPA 3LFAA 4G5PA 4O7SA 1M7QA 2QOIA 3FLNC 3QTIA 3AOXA 3O17A 1M2QA 4ERWA 4LMUA 3OBJA 3ZUTA 3U6JA 4PF4A 2JITA 3U9CA 3BGQA 4HVHA 2VAGA 4RFZA 3P79A 3R73A 5EDRA 4F09A 1WBOA 3VW6A 4CFMA 4FC0A 4K6ZA 3I5NA 1YWRA 3RAHA 1JKTA 3AC3A 3VUDA 2V62A 1H28A 3UQGA 3LHJA 4WRSA 2QOFA 5KX8A 5AA8A 1KV1A 1GZKA 1Z5MA 3VF9A 3ZHPC 1NW1A 4O0TA 5CVHA 3ZC5A 4EQMA 2XKDA 4RIYB 2C1BA 4HCUA 4HJOA 5TO8A 3RBWA 3GC7A 4CMUA 3OVVA 3ZO4A 3IOKA 4E4XA 3CD3A 5FTOA 2J6MA 5AP1A 2C68A 3RHXA 1HCKA 2JIVA 2HW6A 4X2KA 3VS3A 3HDMA 4CCBA 3CQWA 3BWFA 4DHFA 5I0BA 1ZYDA 3VS7A 4A7CA 3QQFA 4O22A 3UQCA 2XK7A 3IS5A 4L8MA 4D1ZA 4GK2A 3OW4A 1YXUA 3ORLA 3QCXA 1KOBA 2F49A 3TZ7A 1URWA 4QTDA 4S30A 1FGKA 5AX3A 4BBEA 3NMUF 4W9XA 1ND4A 1P14A 3GP0A 4C57A 5HGIA 1YXXA 1BYGA 2UZVA 4FX3A 4HZRA 2I0EA 5BVFA 4XX9A 3UP2A 3WARA 3ORZA 4JT3A 4XV2A 4Y46A 5M06A 1J7UA 2BRBA 5M57A 2CGUA 3N4TA 1LPUA 1V0OA 3PY0A 3S2PA 5TOZA 3K5UA 2VO3A 4YNEA 2BUJA 1OKYA 4F70A 4N70A 3EJ1A 4FZAB 5A4TA 3NW5A 3RK9A 5AR4A 2BKZA 3C9WA 4RZVA 3ODZX 3IONA 3F3TA 1I44A 3OC1A 4MQ1A 3AQVA 4BZDA 4RC3A 4FTRA 1B39A 1WBPA 4XEYA 3PWYA 4V0GB 3ZSIA 3BLRA 4EYMA 3S1HA 3NCGA 2XZSA 3LMIA 4J71A 3ACJA 1OITA 5EYKA 2C6EA 1NVQA 2YWVA 4QOXA 4UWBA 2BILB 4FZ6A 4CZTA 3R9DA 4DEEA 3BIZA 5K0KA 2C6OA 3FI3A 4MXOA 5I9XA 2UZOA 5HE1A 3MWUA 4EK5A 2XIXA 3PA5A 4IM0A 4W8EA 3HX4A 5AR5A 3V8TA 5EDPA 3Q52A 4K0YA 3SKCA 3A4PA 3QTZA 5D9HA 4JG6A 1YRPA 3TKHA 4EH2A 4QP4A 5L6OA 4FKGA 4F9CA 4FGBA 4L52A 1ZY5A 2C47A 3PSBA 2XBJA 3G90X 4GSBA 3FKNA 3TNPC 4R1YA 3VUHA 1XH6A 3BRBA 5AUXA 4QMNA 3E87A 3PLSA 3KEXA 4ANLA 3DAJA 3FLSA 2WU6A 2XNNA 4J97A 5AJQA 1H1WA 5I3RA 5L6WL 4FL2A 3QQHA 3R7OA 4AN2A 3CD8A 3WIKA 3N4VA 3EOCA 4II5A 1UKIA 2QOHA 3NVKI 5KZ0A 3BYVA 3GT8A 4NCTC 2Y0AA 4O82A 1Q3WA 4X2NA 1B38A 4E8AA 2GNLA 1OBDA 3G15A 4ASXA 4QRCA 3UNZA 3MH2A 3BGZA 3P7CA 3W2OA 4CGAA 5G6VA 2O2UA 1KSWA 4I1ZA 4UX9A 2ZYBA 3FL5A 4FA2A 5JQ5A 1KUTA 2IJMA 3DZOA 4X3FC 3UG2A 4BCJA 3DAKA 4ZJVA 2OWBA 2QU5A 4TW9A 3DB6A 4A9UA 4FIHA 2PHKA 3F3WA 3D83A 3BWJA 2RG5A 1BUHA 1WVYA 4FMQA 4MBLA 4F0GA 1G8SA 4HGLA 4H3QA 3TEIA 4Q5HA 2PYWA 1OKWA 2XMYA 3Q5IA 2R0IA 3VS6A 4BGQA 5HCZA 5E1SA 4NYEA 4U3YA 2C6LA 2PMLX 4F6UA 5JFVA 1AQ1A 2JD5A 4LOOA 3F7WA 3KK9A 4TY1A 4DFBA 3U4WA 1REKA 2I0YA 3FHRA 3QUEA 3DDPA 3DT1A 4FTIA 3K3JA 4BTKA 4IAKA 3HLLA 5LMKC 4S32A 1JPAA 3DBDA 2C5NA 3HMMA 4FNWA 4GU9A 3EQCA 4IVCA 5C03A 2BIKB 1OPLA 4YJSA 2ITXA 3ZO2A 3ALNA 4XYFA 4YPDA 2ONLA 3ZONA 2J0LA 3VUKA 4D4YA 1OL6A 2ERKA 2W1HA 4U45A 4AZTA 5C8NA 2O5KA 2NO3A 3PXZA 3MJ1A 4OTGA 2GCDA 4IH8A 3NIEA 4G6LA 4RX9A 3MPAA 2VO7A 3VQUA 4IBMA 5CF8A 4IVAA 2YLEA 5HD4A 4YUQA 3VW8A 4CFXA 3MW1A 1OM1A 1F0QA 1XBAA 2OO8X 1QPCA 3FQHA 4MWHA 4G9RA 2IW8A 2LGCA 3Q2JA 5ETCA 1REJA 5HI2A 4AZVA 4BC6A 3JPVA 3D9VA 4IJPA 2OJFE 4UWCA 3MH1A 4ZSAA 1BL7A 5AWMA 5BVKA 4QMLA 3LOKA 5GZ8A 3UYSA 4ZLYA 3UC4A 3H10A 3QQLA 3LVPA 5H9BA 1WCCA 4RIXB 1AD5A 4P90A 4CTBA 3QRUA 1W83A 3DK3A 3UIBA 5E8ZA 2BRNA 3TZ9A 1H26A 1FQ1B 4NK9A 4UB7A 3Q60A 3VIDA 1Y6BA 4JXFA 1OB3A 2I7QA 3C0IA 3CPBA 3HMNA 3RPOA 3THBA 2R3QA 3I7CA 4H05A 3KXXA 4X0MA 5HE3A 4C4IA 5CEIA 4ANQA 5I9VA 2VTQA 1Q61A 2XKEA 3COMA 3I1AA 5HG9A 3R2YA 4ZZMA 3W33A 2PVRA 3QCYA 3ZYAA 2J90A 2C0IA 2WIHA 4NM0A 4PRJA 4FSUA 3T8OA 4D2SA 3NCZA 4U97A 4CFVA 3EQPA 2ZAZA 3OY3A 2PMNX 4FOCA 3ZO1A 4TYIA 2BR1A 2O63A 2E9UA 3NS9A 3KULA 4FOBA 2VO6A 2XIYA 4PPCA 3VBQA 3W16A 4AZEA 2BRHA 4J8MA 2W5HA 3KRLA 5HVYA 3MPTA 3AGLA 4M67A 5HU9A 5M4FA 2BHHA 4EH9A 3DZQA 3F88A 2AC5A 1FMKA 3DCVA 5FTQA 2WTDA 3ZZWA 4C36A 3QZFA 1GZOA 4YTIA 4EH7A 2IG7A 3GU6A 4JDKA 3S95A 4ZY4A 5BVWA 4UYNA 3LQ5A 2CPKE 2ZVAA 2Y4PA 2QR8A 3HUBA 3NYOA 4NJDA 4RPVA 2X2KA 5CQUA 4MWIA 3R04A 4YNOA 1Q24A 3W2PA 3AD6A 3HL7A 3UJGA 3CKWA 4EKLA 1G8AA 5EQEA 1UU7A 3OXIA 4J99A 4APCA 4BI0A 2OIBA 5HVKA 1XH8A 1E1VA 4BDEA 3LFDA 3V6RA 5LJJA 5HTCA 3VHKA 3O0GA 4NL0A 3UMWA 4PTCA 1H01A 4HYHA 4BIEA 4C3FA 1YI6A 5AR8A 3F3ZA 4FBXA 3WI6A 3ZLSA 4FV0A 1MRYA 3G9LX 1FVTA 3UODA 1O6LA 2QI8A 1O6YA 2B7AA 3RVGA 5HX8A 4QYGA 4M66A 4BCQA 5DN3A 2GQRA 5T6KA 4TYEA 4ZY6A 4KSQA 4PMPA 2YCSA 4PP9A 3FSKA 5FGKA 5HTIA 5IH4A 2YA9A 4IEBA 5CAQA 1IASA 3ANQA 3WILA 5J1VA 3OWJA 5HESA 4O7LA 4D4VA 3PE1A 1OPKA 1W84A 4WD5A 1SVHA 2WD1A 3PWDA 2WMXA 1QPEA 3F3UA 1A06A 4MH7A 3BPRA 4XG9A 5H8BA 4CFFA 3QCQA 4GG5A 4OT6A 4FVQA 4BCOA 3MV5A 4I6FA 4QMWA 5CSXA 4E6AA 3WZKA 3VRZA 3S4QA 1YWNA 4WSQA 4IACA 2QU6A 5LWMA 4B9DA 5HNGA 5AX9A 3GU8A 3RP9A 2YCQA 4E7WA 2UVXA 4FTUA 4FSMA 5F94A 3EZVA 3IW8A 4AN9A 3FWQA 2OIDA 3RCDA 3HP5A 3H9FA 3A62A 4O2PA 3VHEA 2ESMA 4P2KA 1Q3DA 1VZOA 4Z7HA 5IDNA 1ZARA 3L8XA 4ZJJA 1PY5A 4M14A 4L46A 4FTMA 4HYSA 5H3QA 4DTKA 3N4UA 4HVIA 5FQDC 4DEDA 4JDHA 2OLCA 5IA5A 3KC3A 2YEXA 2YFXA 5K5NA 2OU7A 4APPA 1F3MC 3QYZA 4IIRA 5DH3A 2JAVA 4GUEA 4N6ZA 3TKIA 2YABA 2IVUA 4LV8A 5KO1A 3FEGA 5GJGA 4WG5A 2JC6A 3F9NA 4QQCA 4AAAA 4ASZA 4F9BA 4R1VA 3NRMA 3KF7A 1Q8ZA 3TV6A 3MJ2A 4OTWA 2QKWB 5EYDA 3QL8A 5CEMA 1Q8UA 5HE0A 5KMIA 3GFWA 2PMOX 5HCXA 1LR4A 4R7BA 2X6DA 4R5SA 4AGWA 3GBZA 4FG8A 3SAYA 2VN9A 2ITVA 3UO5A 3CGOA 5J79A 4KKEA 2GHGA 3VS5A 3PIYA 3E7OA 2R3HA 2UW0A 3E92A 3GCVA 1UKHA 3BQRA 2PVKA 3V6SA 4ZEGA 3RWPA 3W2SA 3MB6A 4GFOA 3UOLA 2OFVA 3QU0A 3WF7A 5ANIA 4AW1A 4UMPA 5J9LA 4I6HA 1OVEA 3G6HA 5AP2A 1CTPE 2G9XA 5B0XA 5FWKK 3SHEA 3ZTXA 4DH7A 4UWYA 4RRVA 1PXOA 2EVAA 4G31A 4ANNA 3E8DA 3WBLA 2XK4A 4JG7A 5KBRA 4DAWA 3DFAA 4WG4A 4RFYA 5E9EA 4X3FB 5L2SA 4DGLC 1XBCA 4L45A 4WRGA 3FMNA 5IF1A 3KRRA 2GS2A 3NUXA 4I5MA 5AA9A 1JSVA 3BELA 4DH3A 3RMFA 4CTCA 4E5WA 4FG7A 4FKUA 5AV3A 4RMZA 2Z60A 2CLQA 3DBEA 3I79A 1Y91A 4FSYA 3PVWA 4BTJA 2EU9A 1Q62A 3KB7A 3NW6A 2C3KA 3E5AA 5M44A 2W5AA 4PTEA 3FI2A 3EKKA 3OEFX 3ULZA 1GIJA 2ETKA 4FTLA 4BDCA 2Y6OA 4TPTA 3R7UA 4BHNA 2RF9A 3ORPA 5FM3A 5IUIA 4OTDA 2OFUA 3DJ5A 3LJ1A 3UG1A 3ORIA 1PMVA 4CZYB 4H39A 3NVMB 4KD1A 3DY7A 4IAZA 3TI1A 4DF3A 3MN3A 4RZWA 4XRLA 3LFBA 2ZB0A 4O0XA 3GUBA 2NRUA 1PXLA 2PUPA 3CKXA 3TL8A 1MQ4A 3R22A 3ALOA 4EBWA 4KBAA 4EH6A 4F63A 2GSFA 2YM6A 2UW3A 3UYTA 4O0WA 4FTKA 4NFNA 3RZFA 1ZMVA 1YOLA 4ANBA 5CEPA 4LRKA 1BLXA 2H96A 3K3IA 4RQKA 5LMAA 4M97A 4D4SA 4QNAA 4EHGA 4NM5A 3FL4A 4NKSA 5ETIA 4AXAA 1YOJA 2RGPA 4UEUA 3G6GA 3L9LA 3FZ1A 4X7QA 4RBLA 1UVRA 2R4BA 3CE3A 3F7ZA 4YJNA 2Y6MA 3NAYA 4Y95A 4ZTRA 4K77A 2VTSA 4GMYA 3SW4A 2WB8A 2QC6A 2X7OA 3MESA 2Z8CA 3OY1A 5CXZA 2VWXA 2R3NA 3R7GA 3KVXA 4KS8A 5AP6A 4DFZE 2WPAA 5JRSA 2X4ZA 5CNNA 1DI8A 4Y5HA 4BDGA 5L2TA 4O7RA 5FLFA 3NUUA 4FEWA 4E3CA 3SQQA 5BQ0A 3EB0A 4MKCA 1ZRZA 4R8QA 3DBCA 4C62A 4DFYA 3R8MA 3LM0A 2GHMA 3BQCA 5EYMA 2GNIA 4PMSA 3FZSA 3H9RA 2X9EA 5DRBA 4MNEA 3IDBA 3VUMA 3GC0A 5AP0A 5CANA 4RFMA 3D94A 4CD0A 3D5VA 2ITNA 2P2HA 2C0TA 5JFWA 3SGCA 4I21A 3OEZA 4F9WA 3Q6UA 4GV1A 4M69A 3ULIA 3MFSA 3UVQA 2VUWA 3PXRA 4E20A 1URCA 4H36A 4JI9A 5LWNA 4FT0A 3ZXZA 4DH1A 5M09A 4BRXA 4XV9A 4Z3VA 3OT3A 4BDJA 2BROA 3POZA 2CKPA 4YC6A 4PPAA 5FEEA 4QYEA 3O23A 3HGKA 3PZHA 4IAAA 4ANOA 3QKKA 3QXOA 4I23A 4IZ7A 1GY3A 4Y5QA 3FYJX 4O1OA 4F1TA 4S2ZA 4QP2A 3ENMA 1E9HA 2UVYA 4TRLA 5CF5A 2VNWA 3Q9XA 3RJCA 4F1MA 4CG8A 2JFLA 2XVDA 2XNPA 3KCFA 4K1BA 5AIRA 5HBHA 5BYYA 2B9HA 3E8NA 1XH7A 2CGWA 4KA3A 3WF9A 4EKKA 5HU3A 2B53A 5DWRA 4Y73A 5BVNA 5H8EA 2V5QA 1R78A 2A4LA 3GU5A 2OXYA 3IG7A 2YJRA 3QC9A 3QFVA 4FSNA 4RWKA 3VO3A 5TR6A 3ZS5A 4C37A 5HORA 2PVHA 1H0VA 4B4LA 1M14A 5A4EA 3LQ3A 2WOTA 2UZDA 4MK0A 3EH9A 4DH5A 5HNIX 5TE0A 3S3IA 3UIUA 1XKKA 3ZUUA 4WA9A 4A06A 2IN6A 2XYNA 4HGEA 2OXXA 5CENA 2XS0A 1NT2A 4L42A 4RJ4A 2YDJA 4RWJA 3FLYA 4EI4A 4FKPA 2Q0BA 2VWVA 1P2AA 4R77A 2V22A 5JFXA 5CF4A 2NP8A 5ACBC 4YC8A 5ITAA 4IWPA 4FZ7A 4Y83A 1P4FA 4QO9A 3QX2A 1KE8A 5JZNA 2UW8A 4O38A 1TQMA 1ZMWA 5CEKA 5M4UA 1V0PA 5L3AA 4QP7A 1ZYJA 5DEYA 5HQ0A 2F2CB 2OICA 4YZ9A 4GG7A 2B0QA 3HP2A 4K2RA 1L8TA 2Z7LA 3SLSA 1YDSE 2WMTA 5L2WA 1J7LA 3R21A 4JIKA 3NUYA 3O8UA 5AP7A 3A7JA 4D2PA 5IH6A 1FMOE 4XV3A 4WNKA 3F3VA 3LFQA 4FTTA 3R8LA 2FA2A 4I24A 3R28A 3ZFMA 4FZFB 3BHYA 4QYYA 4CCUA 3BHTA 4F7SA 3ZOSA 3LLAA 1JSTA 2XCHA 3QKLA 4IWOA 4C3RA 3V5JA 2YM4A 4ZZOA 5AFVA 4WNPA 5DLSA 4AG8A 3GENA 3Q9WA 2W96B 1PXKA 2V0DA 2XIZA 4BN1A 4EZ7A 3AXWA 2C0OA 3DNDA 2HY81 2W1ZA 3UZTA 2DYLA 1NVRA 2H6DA 5D11A 3BU5A 3IQ7A 2FO0A 5E92A 4CFWA 1CSNA 5C9CA 5IISA 4MEDA 5HIBA 3ROYA 4KUJA 2YM8A 3HV6A 4RIOA 4KBCA 4AU8A 3UE4A 3V01A 4JRVA 5AP5A 4O0YA 4EJNA 4ZMEA 3RPSA 2W1GA 3KGAA 4QMOA 2PVNA 3VS4A 4I4EA 2OIQA 3BU3A 4FR4A 2GS7A 4FK3A 3SOAA 1IG1A 2X8DA 1H1RA 4X2GA 4ONAA 3GVUA 3HV4A 4FNYA 2O8YA 2X1NA 4ITHA 3W10A 4R7IA 4WT6A 4FV7A 1PYEA 3R1QA 3OWKA 4R5YA 1NVSA 3UO4A 5JMSA 2IVVA 4CSVA 5I9WA 1OL7A 4YJQA 3FPQA 1GNGA 3SXFA 3QD3A 4O96A 4QMVA 1PKGA 4H1JA 4QP1A 3SA0A 4WO5A 1JKKA 3AMBA 3PP0A 4GU6A 4CKJA 2ZM1A 2FGIA 4X3JA 2CSNA 4YHTA 5EOBA 3BKBA 4ITIA 5CEOA 2CN8A 5IEVA 4BF2A 2YAAA 4JVGA 3T9TA 4K9YA 4X2FA 2JDSA 5IA1A 5HX6A 2UZLA 3A99A 4BL1A 4KABA 5DEWA 1WFCA 4LOPA 3CTJA 4DH8A 5IQAA 2NRYA 4OW8A 3ZRMA 3SVVA 1QPJA 1H0WA 3BLHA 2V55A 3P78A 4PDOA 1ZWSA 5JQ8A 1OECA 3HV3A 3AT2A 5CAOA 1UA2A 2X8EA 2J9MA 3II5A 2B1PA 4ZSEA 2WU7A 3ZLYA 4JS8A 1IAHA 2WTIA 4G3FA 4MNFA 5FM2A 5CTPA 5F20A 4D0WA 4MYGA 4BDIA 3V3VA 4MBIA 2VWWA 1VYZA 5FBOA 1Q8TA 4Y85A 4IM2A 2J4ZA 2BVAA 3FUPA 3G9NA 3CQUA 4RJ8A 3BEAA 2DS1A 3BGPA 4MXAA 4EOJA 4JR7A 3F5PA 3VULA 2GQGA 4W8DA 4RC2A 4O0VA 3ZSGA 4C34A 2OH4A 2BTRA 4O7NA 4DLJA 2HZ4A 4EOSA 5E4HA 3CTQA 4M0ZA 4RGJA 4YJRA 5K4JA 5IQHA 4G34A 4TTHB 2VWZA 4FSZA 3TZ8A 1WBSA 2VTRA 3KXHA 5CAPA 3D0EA 3LXPA 4IDVA 5KKRB 3OXTA 3UZRA 3AT3A 5DT4A 2CNUA 2C3LA 5EKOA 4LI5A 3LKMA 3RHKA 5IDPA 3FYKX 4FKTA 5HD7A 4RVKA 2W9FB 4U81A 4BFMA 2YHVA 1ZXEA 2EXEA 3K5VA 4CT2A 1TKIA 3SDJA 5AUTA 2B54A 4WOVA 1OKZA 3PFQA 1XBBA 2BPMA 4DT9A 4ORKA 2GPHA 4XH6A 2I1MA 3RPRA 3CIKA 2HENA 4ZS0A 1JWHA 3JY9A 3V5QA 4IMYA 5GHVA 2Z2WA 3OOGA 4WNMA 4EHVA 3LJ0A 4BIDA 3TWJA 3PSDA 2J5FA 4LQMA 1UWJA 5DA3A 4DGNA 4OBQA 1V0BA 5JZJA 2JIUA 4HW7A 3REPA 4FV9A 1YXVA 3A8WA 5E8UA 2WMBA 2YZLA 3NGAA 2WMUA 2BTSA 4AA5A 3FZOA 4FEXA 2OJ9A 2YIXA 3WF8A 3FY2A 4MXXA 4KINA 1H1PA 4FV8A 3C13A 2PE1A 3QTXA 4M8TA 4QT1A 5CSPA 2WQBA 3SV0A 3VF8A 4ZS4A 3Q04A 5LVNA 4EC8A 3ZU7A 2W7XA 1JKLA 1UNLA 3O71A 4QTCA 1E1XA 2OXDA 1XH4A 4AGCA 3OTVA 4TN6A 3MFTA 3UNJA 4BCKA 4YTFA 5AAFA 3NWWA 2RL5A 3I81A 4XG7A 4WUAA 2QR7A 4CKIA 5CASA 1Y6AA 2XKCA 3HAMA 4BVUA 5D1JA 1KE6A 3ZXTA 2W99B 2FSMX 3LXLA 3FC2A 5KZIA 2WKMA 1YXSA 3RK5A 2RFEA 4AX8A 5CAUA 4JLCA 4GJ2A 4YZNA 3UOHA 5M4IA 4NM3A 4F64A 4N57A 3HRCA 3QRTA 2X81A 2C6IA 1GIHA 3OFMA 3R2BA 4W4XA 5L8JA 2OGVA 5LCKA 4EONA 5JT2A 3KMWA 2OJGA 3LFCA 4H1MA 3VBYA 2PU8A 3M11A 3AC4A 3FMDA 3E88A 3PJCA 5HBEA 4B7TA 4F08A 2ITPA 5CU2A 4BYIA 3Q32A 1Z9XA 2FYSA 3AMAA 3PPJA 4KRDA 4ACGA 5A46A 1IA9A 4RA5A 4RX5A 3E8CA 1K9AA 5E8WA 4BI1A 2C5VA 3PIXA 3KL8A 4FV4A 4AW5A 2HZNA 5E1EA 4QMMA 1WAKA 5DRDA 3G5DA 3RPYA 2J7TA 3RALA 4AT4A 3O2MA 4J96A 4C4HA 3KN6A 2X2LA 1PKDA 3UBDA 4QMQA 5LMBA 1R0EA 2ACXA 4RIWB 2XJ0A 5EI2A 5I9ZA 2OSCA 3QALE 3VC4A 4KIKA 4OTPA 2PZRA 4E4LA 1H00A 4HVGA 2QO9A 2XM8A 4JNWA 1S9IA 5AUWA 4XJ0A 1M2RA 3UDBA 3Q9ZA 4DITA 3R00A 4C3PA 5JSMA 1QMZA 2XJ2A 4IHPA 4FV2A 5CVFA 4R7HA 4YLKA 1Y57A 4U0IA 3HVCA 4AT3A 3R1YA 3Q9YA 3QHRA 4G9CA 4IW0A 2IW6A 2C4GA 3QQJA 5C4KA 4XUFA 1T45A 4ZJIA 4BCPA 4DCAA 3D2KA 4BWKA 4XP2A 3ZFYA 1KWPA 1ZAOA 2C5OA 2VGOA 4I92A 3H0ZA 5HTBA 2G1TA 2J0MB 4KNBA 1Z57A 3ZFXA 2PZYA 1H24A 3W55A 4WSYA 3E62A 3NNUA 1OKVA 3QA8A 5EI6A 2QOLA 1PJKA 3R02A 2CKOA 2HY0A 3K2LA 3S0OA 2XP2A 3ET7A 4AE6A 3VNTA 3FI8A 3MY5A 4O84A 2WTCA 2PZ5A 4PL4A 1OL1A 4XOYA 2P4IA 1PHKA 4L7FA 4E1ZA 5J7HA 4JIAA 3EN9A 4RIYA 4M7IA 2CDZA 4CYJA 3RZBA 4EH3A 4XMOA 4MQ2A 3FMMA 1YHVA 2F9GA 2OI4X 3H9OA 3ZLWA 5CX9A 4DEIA 1VYWA 3U9NA 3HMIA 2Z7QA 4P5QA 4F7NA 1EH4A 4BICA 3O50A 4QMSA 4M3QA 2A19B 4TXCA 4XCUA 4QP6A 5CEQA 3W18A 3ZO3A 4A07A 3UOJA 2X6EA 1P4OA 4MD8E 4HNFA 3NUSA 4N6YA 3AC1A 4OAUC 2OJJA 2RKUA 3MH0A 2BAJA 3NIZA 4JRNA 3LE6A 3QC4A 5FDXA 3LCDA 5A9UA 1SMHA 4YJTA 5IEXA 2WXVA 4CLIA 4UMRA 5K0XA 3PG1A 3QF9A 4JQEA 5DBXA 2WNTA 4MXZA 4O1PA 3U6HA 4IQ6A 2OZAB 4USDA 3NUNA 4O83A 4UV0A 2QO2A 5HNBA 3M1SA 4WHZA 3L1SA 5A4LA 3DLSA 2FSTX 3Q4CA 4EHZA 2UW6A 4LL5A 5CWZA 4BKZA 3F2AA 4D58A 4V01A 5E8TA 2ZV7A 1Q99A 2QCSA 5DE2A 3O8PA 4O2ZA 4BTMA 2CCHA 1LUFA 1G5SA 3V5LA 1K2PA 5AR2A 4EUTA 4QMYA 2E9PA 3W8QA 1CKIA 3GEQA 2I0HA 2XK9A 2RSVA 4YZDA 4HZSA 3VUIA 3I0QA 3DXQA 3MPMA 5IG1A 2CHLA 4LYNA 5L4QA 4D28A 3CLYA 3MS9A 4J8NA 4M68A 3MVHA 4F6SA 2C6DA 4YO6A 3WE4A 2HWPA 4DGMA 4X6QC 1OI9A 2VD5A 2YCRA 3H0YA 1OUYA 2RG6A 3HV7A 2ZDUA 3LFFA 3BBTB 3TNIA 2CGXA 5CI6A 4TNDA 3QKMA 3IECA 3VBVA 1MRVA 2GHLA 3MTFA 3I0OA 3JVRA 4P4CA 4AZSA 3E63A 2VRXA 5C01A 5ANJA 5BVOA 4G3CA 2OKRA 3P1AA 4RA4A 5J5SA 2XYUA 4C33A 4ALUA 1H07A 3R6XA 3ORTA 3OBGA 4EHEA 4LGHA 3NYXA 3LZBA 3CR0A 2YCFA 4PX6A 2GTMA 3QTQA 3FQEA 4F9AA 4WIHA 2PVMA 3FI4A 3SG9A 4D2TA 4GCJA 3FMEA 3NDMA 3MB7A 4GYIA 4U8ZA 4FK6A 4GT5A 4DG0E 1XO2B 2VWYA 3D7TA 4RX8A 1XH9A 5KBQA 2RIOA 3KXMA 4QMTA 4YURA 2PVJA 4ENXA 3PTGA 3AD5A 2YM7A 1PRYA 1YXTA 5LOHA 4YR8A 4J95A 5KMLA 3VS2A 3GCUA 3I7BA 4I6BA 3R7YA 5H8GA 5EM5A 1J1CA 4F6WA 1PXPA 2QG5A 5DT3A 2EXMA 4OTHA 4LGGA 5EHOA 5CZHA 4JL9A 2PVFA 1H27A 2YM3A 4A4XA 1H25A 3WYYA 4U6RA 4LUEA 3ZCLA 2OH0E 3ERKA 1M7NA 2R7BA 4O0SA 2QG7A 4FL3A 3L9PA 1XJDA 4NIFB 2SRCA 3RWQA 5J1WA 3OT8A 2VTMA 3IGGA 4L3LA 3WYXA 4EOQA 5A4CA 5K5XA 4XBUA 4CQGA 4C4GA 5AUYA 2GFCA 1OIQA 2QVSE 1Q41A 3EYGA 4PV0A 4EK8A 3ZM9A 2C6MA 4B8MA 3HMOA 3RTPA 1PXMA 4FTJA 4OAVB 2WIPA 4JBVA 4UMQA 4HPUE 4IB3A 1OIUA 3MSSA 3LLTA 5DI1A 5GINE 4WKQA 4JJRA 3PXYA 3EKNA 3PUPA 4LG4A 4QQJA 2J5EA 1PMNA 5CU6A 5E7RA 2YIWA 3F5GA 4W4YA 3QTSA 3EWHA 4IZ5A 3UGCA 3ZM4A 4XG6A 5LCJA 4BR3A 3U87A 1QL6A 4I0RA 5DFPA 2R3IA 3DK7A 2EWAA 3H3CA 3QD0A 1BX6A 2Y9QA 3GOPA 2ETMA 3FXWA 3FLQA 5I4NA 5GNKA 2JIIA 2VTLA 1OL2A 4B99A 2X39A 2XRWA 3QZHA 5M4CA 5J7BA 2WOUA 2OZOA 4TWPA 4KIOA 3PVGA 4OT5A 4EOPA 4EOMA 1R3CA 5TKDA 4AA4A 4J1RA 4RLLA 3ZRKA 4XLIA 3A60A 3WF6A 3ATTA 2XIKA 4LFIA 3F61A 4ITJA 2H34A 1AGWA 4AGUA 2PE0A 2IWIA 4CEGA 2YISA 3QQUA 1CKJA 4AS0A 1WBTA 2Y4IC 3MH3A 4RQVA 4EOOA 3UIMA 2CNQA 4V04A 1WBWA 5D7VA 3TN8A 4M15A 3NUPA 4Q5EA 4AGDA 4ASEA 4RIXA 3PY1A 3ANRA 2PY3A 4G16A 2BDFA 4KS7A 4W4WA 4QTEA 5FDPA 4U43A 3OMVA 3GXLA 2VX0A 3PSCA 3LAUA 2FUMA 3HNGA 3ROCA 3I60A 1Q5KA 3QZGA 4JDIA 1JAMA 4O0UA 4XP3A 5AP4A 3I6WA 3VJNA 3KN5A 1IA8A 4PDSA 4XHKB 3V5TA 5C4LA 3OXZA 2XIRA 3A7GA 2I40A 1UWHA 4LGDA 2JDOA 4MAOA 4BZNA 4BIBA 4JBQA 2PE2A 4E93A 3SG8A 3M42A 1X8BA 4RVMA 3HDNA 3FZTA 5DT0A 4I41A 4AUAA 1RW8A 2C3JA 3TUCA 1ZYLA 1FPUA 4DGGA 4KKHA 3ZEPA 4NUSA 3BYOA 4FSTA 3VUGA 4NW6A 1MUOA 3F6XA 4AA0A 2B52A 3C5IA 2G2IA 4CRLA 3NW7A 1H8FA 5EYCA 4C38A 3BI6A 3HZTA 5DPVA 4ACMA 4TT7A 3Q96A 1JVPP 3E3PA 1MQBA 3D15A 1KOAA 2ITQA 3IO7A 3UC3A 5C1QB 5IH5A 3TJCA 4ZSJA 4YZMA 3RK7A 4IFCA 5BVDA 3KK8A 3QHWA 4HCVA 5HO6A 4FKQA 2CCIA 4FVPA 5DHJA 3SD0A 5F1ZA 3TDWA 1YOMA 3P86A 5IUGA 5AM7A 3EMGA 4XG3A 2P2IA 3WE8A 4FKRA 3OROA 2JKQA 4GK4A 2WMAA 4QTAA 3CY2A 3DXPA 3SRVA 4G6OA 2CNVA 1H08A 4AW0A 1U59A 4C4EA 5AV0A 5J5TA 4RWLA 2GMXA 4NU1A 3WZDA 3FKLA 4HVSA 1VR2A 2ZM3A 3CJGA 3LXKA 5KKRC 4DG2E 3ZUVA 3FDNA 3GI3A 2EXCX 3PXFA 2R7IA 3HEGA 4EQUA 4EZ5A 1BL6A 3EQFA 5IKWA 4MX9A 5I5ZA 1T46A 3W32A 2H8HA 3GGFA 4AFEA 4PUZA 5KMMA 1PMEA 2PUUA 2WFYA 3Q6WA 3LFNA 1Y8GA 2QODA 3F69A 4M0YA 1FBNA 4H58A 3KRJA 2WEVA 3QUDA 4S34A 5CQWA 5EDQA 5CSVA 3BZ3A 3C7QA 2VTPA 1CDKA 3TT0A 4QNYA 3W2CA 4G2FA 4ZLZA 2XNBA 4G1WA 4ALWA 3BYSA 3QTWA 4LOQA 3GQIA 2XCKA 4FIIA 1PXNA 4GRBA 4NZWB 4O0RA 2PSQA 2JBOA 3R8PA 3TCPA 2WO6A 2F7XE 4PMMA 3WZUA 4EK4A 3BLQA 3TNWA 4QMUA 4FEUA 4GEOA 4L43A 4QP8A 2PZIA 2P33A 3M2WA 3PZEA 3R8UA 1YVJA 4KIPA 5EI8A 5FG8A 2O65A 4BWPA 3IDCA 5BNJA 3AG9A 4AZWA 3CSVA 1VJYA 1YQJA 2ONLC 3EFLA 3DU8A 3HV5A 2W1IA 2ITYA 4NJ3A 5L8LA 1PF8A 3DPKA 1APME 5LQFA 4FT3A 1FINA 3DBFA 4LRMA 4ZK5A 3L8SA 2OBJA 3NNVA 4D55A 3GC9A 3PYYA 3QYWA 3NNXA 5E8SA 3CP9A 5LVMA 3P5KA 4HVDA 4D9UA 2X4FA 2CMWA 4FV1A 4C8BA 3HA6A 3TTJA 3VQHA 4DEHA 4ALVA 1F5QA 1YHSA 4FTAA 2XNEA 3FMHA 3NYVA 4YTHA 4E5AX 5M53A 1SVEA 4BYJA 2XRUA 3A7IA 4DFXE 3C4EA 3Q4ZA 2G01A 2XNOA 4NCTA 1OL5A 4GS6A 4IWQA 2IZTA 4UZHA 4C2WA 5M55A 4FVRA 3OOMA 2VTHA 2GDOA 4XS2A 2ZJWA 4E5BA 4IX3A 5E90A 4X3FA 4FV3A 4RG0A 1Q8WA 3FMLA 5EKNA 5KNJA 2B9JA 5B2KA 4RSSA 3DV3A 4CMOA 4GKHA 4DLIA 2JAMA 5JN2A 5CSHA 2EUFB 5JFSA 3ATSA 4JG8A 4HYIA 5FD2A 1J3HA 4AWIA 5BX0A 3FHIA 3ZSHA 3C50A 3NR9A 4ZP5A 4O7WA 3EN5A 4IDTA 2B9IA 3MGYA 4MHAA 3QRIA 4NSTA 3DAEA 3UO6A 3MY0A 4EQCA 5LVOA 4CYIA 2WTWA 1GJOA 1LEZA 2XUUA 2Q0NA 1J91A 3FMKA 1PW2A 2J50A 3G0EA 3IGOA 3E93A 4IWDA 1LEWA 2BIYA 2C30A 2GQSA 1BI8A 4L00A 5C8KA 5T68A 3NPCA 4FSQA 4U5JA 4F0IA 4USEA 3EQDA 1WBNA 2HK5A 4YSJA 5LMKA 4EK3A 4L9IA 3RKBA 4ZSLA 4AN3A 3QWKA 4TWNA 1ATPE 4BCNA 4PY1A 5B2LA 2ITZA 5L8KA 4WBBB 5J9ZA 1H1SA 5DR2A 5M56A 5FXSA 4C0TA 4BGGA 2PUIA 4RLKA 5GJDA 3R9OA 2R64A 3BYUA 4QMPA 5EG3A 1R0PA 3TKUA 4XG8A 1MRUA 3DJ6A 5CU0A 1OIRA 5JGBA 3PPKA 5DNRA 1TQPA 4OLIA 2KTYA 2J51A 3RCJA 2XM9A 4FEQA 3NNWA 3LJ2A 2PL0A 3BX5A 3R0TA 2BFXA 2HXQA 3AC5A 2AUHA 4GVJA 5IA2A 4EL9A 3DKCA 3GCSA 3OZ6A 4J53A 3OCSA 1SM2A 1H1QA 4F65A 2Y4IB 3C4ZA 3LMGA 5EH0A 3AC2A 1KE9A 2OK1A 2W05A 3GCQA 4FKVA 4K8AA 3ZRLA 5H2UA 3ZBXA 2DWBA 1KE5A 3A4OX 1XH5A 5CS6A 3RI1A 4ZTLA 3T3UA 3O7LB 4E4MA 4O7YA 4E6QA 2ETRA 3TV4A 3NZ0A 2WQMA 3OS3A 4TWOA 2H9VA 3U51A 5FEDA 4PDPA 3D7ZA 2YZAA 5AADA 2PWLA 4BDAA 4EJ7A 4CZUA 2JKKA 4TL0A 3U55A 3QD2B 2I6LA 2G15A 4GVAA 2W9ZB 2J0JA 4TYHA 4IVDA 5AR3A 1QCFA 5JRQA 3UNKA 1NXKA 4ASDA 2BZKB 1A9UA 4GFMA 4CVAA 1PXJA 2YN8A 3JXWA 3K54A 4D1XA 3KVWA 4XRJA 5FP5A 4L44A
chains in the Genus database with same CATH superfamily
4FE2A 3UVPA 2BDWA 3R7IA 2VO0A 2UW4A 4ZAUA 4FNZA 4R3RA 4EORA 5GIOE 4NTSA 5FEQA 3ID6C 4RJ3A 4GL9A 2XK8A 2WMWA 4AOJA 4DINA 2UZWE 3L8VA 2R3JA 5M08A 4HGTA 2E2BA 4OR5A 4JMQA 3R01A 4RX7A 4IC7A 3UTOA 4OGRA 4Q9ZA 3JUHA 2PPQA 3OF0A 3HKOA 2A2AA 5BUEA 3LQ8A 4HPTE 1TFFA 4WUNA 4IAYA 4C4JA 3GU4A 2E9VA 2UZTA 4G5JA 5J95A 4IX6A 5HCYA 1HOWA 3EL7A 3MFUA 3AGMA 4KIKB 3NUAA 4O91A 3UDZA 1U4DA 3W8LA 2WMVA 3WOWA 2JKMA 3DFCB 3E8EA 5J9YA 3V8SA 2QQ7A 5IMEA 2YIYA 2C5XA 3EQIA 4BJJB 3F66A 2C6TA 4DHZA 4RC4A 3KXNA 1ZOHA 4DEGA 2ITTA 2BZHB 3VS0A 2HOGA 3RINA 5M07A 3B8RA 2QOCA 5CY3A 2VWUA 4KBKA 3R9RA 1JOWB 3DTCA 4P5ZA 4PPBA 2VZ6A 2YDKA 2UZEA 3GCPA 4D2VA 4FKSA 5CVGA 5CF6A 4ZOGA 2F7EE 3DB8A 5AV4A 4G6NA 5M51A 3TDVA 4DFUA 1R39A 2BZJA 2WTKC 3OUNB 3OTUA 4J7BA 4LMNA 5CU4A 3R8VA 5GZ9A 5A14A 1RJBA 5IPJA 3D14A 2XNGA 3MTLA 4KSPA 4JBOA 1P5EA 2BFYA 3C5UA 5AM6A 3LXNA 5T3QA 1W7HA 3BV2A 5LVLA 4FI1A 4BDKA 3BE2A 1CKPA 2JBPA 3C4XA 3PJ1A 5B7VA 4W9WA 4AACA 3LW0A 3ITZA 2PK9A 4JQ8A 5BYLA 1OUKA 1FGIA 2HXLA 3ORNA 4J52A 4O4EA 2BZIB 1UNHA 2YIQA 3CEKA 3TUBA 4QMXA 3Q2MA 4J98A 2FVDA 3RAKA 3QRJA 4FIJA 3LFEA 4O6EA 4YHFA 4DCEA 4X21A 1JKSA 5IEYA 4IX5A 4AXEA 3QGYA 4Z9LA 5EHLA 4PTGA 3TG1A 3MVLA 4EK6A 4L53A 4A4LA 4LUDA 3DOGA 5IA4A 2Z7SA 2DQ7X 3R30A 3W0MA 3ENHA 3QUPA 4I5CA 4DEAA 2JLDA 3CGFA 4NW5A 3MA3A 2VTJA 1OIYA 4JR3A 4FKOA 4O21A 4EOLA 5EK7A 4DBXA 3IW4A 4X2JA 3TIZA 4BHZA 4TNBA 5C26A 4YTCA 3R1NA 4R6VA 2XK6A 4EC9A 2BMCA 3KMUA 3GB2A 3QLGA 1M17A 4IXPA 5AMNA 3UPZA 4R3PA 1GZ8A 4IE9A 2QHNA 4PMTA 4A9RA 2ZV8A 4CXAA 3PRIA 4L67A 4UMUA 3C4WA 3GQLA 3QAME 5A6NA 4FGRA 4EUUA 2ZM4A 3PPZA 5HBJA 4O4DA 5EOLA 1U54A 1O9UA 4FTOA 2R2PA 4YJUA 1U5QA 4H3PA 4BCGA 2QHMA 4FUYA 5HKMA 4BKJA 1M52A 3FJQE 2A1AB 1UU3A 3OWPA 4FZDB 2UW9A 3QBNA 1DI9A 4JAJA 3O51A 2ITUA 3BBWA 3R9NA 3DDQA 4IANA 2JFMA 2R3LA 2BAQA 3OG7A 3ORKA 2JGZA 4HNIA 5DR9A 3FMJA 3ZBFA 3FE3A 3F5UA 5KHXA 3SXSA 4R78A 2IEWA 3FBVA 2R3RA 4I0SA 1JNKA 3KULB 3TNQB 4OTRA 3GFEA 5AV2A 5E8XA 3IPHA 4MTAA 2ZB1A 2AC3A 3C51A 4S31A 3BE9A 2AYPA 4GT4A 1Y8YA 4I3ZA 4OUCA 4YGAA 1FVVA 2HAKA 4FKLA 4FL1A 1TVOA 3MBLA 2QD9A 2IVTA 5DR6A 3U8WA 3LIJA 2ERZE 5D12A 1KV2A 3D5UA 4ERKA 5HLPA 3MVMA 1L3RE 3PJ2A 4NM7A 2OF2A 2C1AA 4YJVA 3TJDA 5HZNA 5CT0A 5BV3A 5ANDA 1DM2A 2FSLX 4O7VA 3A8XA 3B2TA 3BL9A 5IQDA 3C0GA 1Q8YA 4I93A 4PNIA 3D7TB 4RVTA 5E91A 4PDYA 3L9NA 4DTAA 5ETFA 5K4IA 3OP5A 4R3CA 4BCIA 3IW6A 3TUDA 4L3PA 5A4QA 3A7HA 5CNOA 1ERKA 4YBKA 2QURA 3DS6A 4DFNA 1NA7A 2PULA 2BDJA 2R3FA 5ANKA 2W0JA 3PA3A 3MA6A 4U3ZA 3RGFA 3ZDIA 4YLJA 4K33A 4MF1A 1Q4LA 3MIAA 4BDDA 4KKGA 1R1WA 3V51A 5KMNA 5KUPA 1TQIA 3O8TA 2XBAA 4E6CA 1YKRA 2J0KA 4TKSA 5HG7A 5KMKA 1XR1A 2P0CA 2UW7A 2G2HA 1YHWA 3MFRA 4F9YA 5HO7A 5AUZA 3DLZA 3VAPA 4CRSA 4UBAA 3EQGA 4PP7A 3HA8A 4IC8A 2JKOA 2WELA 2YAKA 5IQEA 2FSOX 2X0GA 4NH1A 4ZIMA 3P7AA 3I6UA 5F95A 4EOKA 1BKXA 5JKGA 2W17A 3LFSA 3EN7A 3IDPA 3N51A 4YJOA 5ANGA 3LCSA 1UU9A 4LV5A 2VV9A 3LM5A 4FIGA 3HECA 4DFLA 3AT4A 4B8LA 5CZIA 2FH9A 1SYKA 4DBNA 4D0XA 4O81A 3GNIB 3RAIA 2G2FA 1G3NA 2A27A 3D2IA 5L6PA 2UZUE 2WZJA 4ZMFA 4F99A 3SOCA 3UVRA 4RJ5A 3DQXA 3EIDA 3PVBA 4AF3A 4AZFA 3NEWA 1A48A 3OHTA 2C5YA 3CTHA 3LMHA 2WHBA 5CLPA 4IB0A 4BBMA 4QP9A 5AR7A 2VTIA 3WZEA 2W1EA 1JBPE 3FKOA 3OCGA 5KMJA 2WQOA 3TACA 3C1XA 4JX3A 2Y8OA 1SNUA 2XAMA 2YLFA 4Z7GA 5EQYA 5ACKA 3HRBA 4LRJA 2R3MA 5J8IA 1XQZA 2IW9A 3IW5A 4V0GA 5DMZA 2RFSA 3LCTA 5DIAA 2B9FA 4M84A 3HMPA 3E7VA 3GOKA 1ZZ2A 4U79A 3VWAA 3UP7A 4D2WA 4MVFA 4NKAA 3ZDUA 3COKA 4AXCA 1YW2A 5LARA 1GZNA 4TWCA 4NWMA 4DDGA 4EWHA 4EBVA 2R3PA 4G3EA 2OJIA 1UV5A 3N9XA 4UXLA 3PG3A 3RM7A 2UV2A 4FODA 2QOBA 3PIZA 4Z16A 5F9EA 5IA0A 4G3DA 3A7FA 4EEVA 2Y7JA 3D4QA 1O6KA 3TM0A 4O4FA 4C02A 4LV7A 4FICA 2HCKA 4NFMA 4A4OA 4QYFA 2UW5A 2PVYA 3PJ8A 2YACA 3R9HA 3OCBA 3KCKA 3WZJA 4XLVA 4CKRA 3CS9A 4RIWA 5GZAA 2GNGA 4G3GA 1LP4A 2O0UA 2Z7RA 5FBNC 3FLWA 4IAFA 4ZY5A 4PL3A 2E9OA 5IQIA 3IOPA 2PVLA 1IEPA 5I3OA 4UY9A 4QPSA 5J87A 2WTKB 3FXZA 4MD9E 2BHEA 3COHA 4D5HA 4TZRA 2VX3A 2R0UA 3FC1X 2F4JA 4RJ6A 3KU2A 3KRWA 4HOKA 3VVHA 5L2IA 4FKIA 3S00A 4L7SA 1XHAA 2PMIA 5BUIA 3FPMA 5K9IA 5KMOA 3C0HA 3CQEA 4PWNA 3PUFC 3DTWA 2NPQA 3MIYA 5DVRA 3IW7A 3UPXA 5BMMA 4D2RA 4BCHA 1DAWA 2ZV9A 4FV5A 3W1FA 4B6LA 4C59A 5IQFA 5C27A 2LAVA 3MVJA 2GNFA 4C2VA 3MYGA 2WTJA 3RNIA 4C61A 5JGDA 4HYUA 3TXOA 2VX1A 3W2QA 3T9IA 5FXQA 3UZPA 2CKEA 3R83A 4E73A 5EW8A 2BAKA 3KMMA 4ACCA 4EZ3A 4F7LA 2B4SB 2R3GA 2HELA 4JQ7A 4OTQA 2PUNA 3NFGB 3RNYA 3U4UA 3SRVB 4CNHA 3PLAE 3BCEA 2XA4A 3WF5A 1JLUE 5CXHA 2ZMDA 4WG3A 1OMWA 3FY0A 4Z55A 3DKGA 2O3PA 5BYZA 3EQBA 4ACDA 3G0FA 3EN6A 4D1SA 3V8WA 2FB8A 4XNEA 4FUXA 2J2IB 4BKYA 4D5KA 4ZTSA 5IMXA 5IZFA 5GJFA 4IZAA 3LCOA 4CV9A 4GKIA 4CT1A 3TTIA 2X7GA 3I4BA 3CCNA 2R3KA 4BB4A 2YJSA 4DEBA 3O96A 5HG5A 3UMXA 4IJ9A 5D41A 3A2CA 2QNJA 4Q2AA 4M13A 2WQEA 1JQHA 2OF4A 4ZTNA 3EQRA 4H3BA 4BCMA 4D9TA 5CALA 3TV7A 4QQTA 3COIA 4A9TA 2XEZA 1GIIA 4UZDA 3SX9A 5AUUA 3HUCA 5JEBA 3ODYX 4XV1A 2Q83A 3GU7A 3QQGA 3KXZA 4DHJA 5HHWA 2EB2A 3WIGA 4UXQA 2R3OA 2R9SA 2ZDTA 3SW7A 4N4SA 4EOIA 2OZAA 3I5ZA 3R7VA 4FTNA 3LCKA 4ANMA 3R71A 3HRFA 4MNEB 3ZLXA 4E6DA 2HWOA 4Y8DA 4U9AA 2P3GX 4FSRA 4YBJA 1ZOEA 3R1SA 3CBLA 4IM3A 4M69B 4MD7E 4U42A 4WNOA 3G33A 4I4FA 5GIPE 2WEIA 4EH5A 4I94A 2QONA 3QQKA 3FSFA 4W4VA 3KF4A 4GIIA 2WGJA 3B2WA 3PRFA 4C58A 4QYHA 2HW7A 4BI2A 4F7JA 5AP3A 5FUTA 2GNJA 2IO6A 2X2MA 3VN9A 2A0CX 3P0MA 2R5TA 2UUEA 2WQNA 4QP3A 3VUTA 2W06A 3ORMA 3D5XA 3Q3BA 2ITOA 4FF8A 2XK3A 4N0SA 4BY9E 3PJ3A 4BTFA 3FXXA 4JOAA 1HCLA 3Q4TA 2J0IA 2REIA 1QPDA 3JVSA 3EFKA 4QDEA 4JBPA 3DQWA 4IX4A 2JEDA 3OWLA 4FT5A 1MP8A 3QWJA 3JY0A 4KWPA 4YP8A 5IQGA 1J1BA 2YM5A 3NYNA 1PYXA 1UNGA 4AOTA 4DGOA 4KRCA 5LXMA 4FV6A 1G8JA 3QTUA 1BMKA 4NEUA 4BDFA 5HLNA 2PTKA 1RQQA 3JS2A 2X9FA 4DYMA 2C6KA 2OG8A 3DKOA 3MI9A 5A3XA 4EWQA 3F82A 5HG8A 4QMZA 5BVEA 1OBGA 3EN4A 3QZIA 2W4KA 3AC8A 1RE8A 3L9MA 4I5HA 4EH4A 3KREA 5FTGA 2GNHA 2HZ0A 4HCTA 1DAYA 1GAGA 4A9YA 3BHHA 2BCJA 4IB1A 1IRKA 2CGVA 3DBQA 4BDBA 3F2RA 1I09A 1NY3A 5A6OA 4QPAA 3SXRA 5JK3A 3QXPA 4MBJA 4X6RA 5AIKA 4PQNA 2C69A 4GYGA 1GOLA 1ZLTA 3DNEA 4KIQA 5I9UA 2XJ1A 3VJOA 3EYHA 3UDTA 4FT7A 5G1XA 2YDIA 1K3AA 3Q5ZA 2BKKA 3PXKA 2XARA 4TYGA 5HICA 4FYOA 3CC6A 1DS5A 1W2CA 3ELJA 5DOSA 5EM8A 5LVPA 4ZTMA 3JYAA 4DN5A 5E8VA 3FZPA 3OW3A 3EZRA 2YIRA 1WMKA 5A54A 4CMTA 2RFNA 3OUKA 4O7TA 4XBRA 2ZMCA 3OCTA 5EW3A 3C4CA 3CJFA 5HO8A 3TNHA 3H4JA 4NIFA 4AFJA 3UQFA 5IQCA 3QRKA 2F57A 2IZUA 4ZTHA 5CU3A 5D7AA 4QQ5A 2NNWB 5IU2A 2E9NA 3EHAA 4L68A 1PXIA 4KB8A 4CLJA 1RDQE 3A61A 2BRGA 2UVZA 4K11A 4O27B 4FTQA 2QO7A 4FEVA 4OTIA 4TYJA 5IUHA 2X8IA 4RWIA 1B6CB 3F5XA 2GTNA 2X0OA 3P23A 2BALA 4ENYA 2UZNA 4PL5A 4OBOA 2C3IB 4QD6A 3IK3A 4MCVA 4RJ7A 2YITA 3AMYA 4YLLA 5AUVA 1SZMA 2CN5A 2IZSA 4YZBA 5HIDA 3Q53A 2WMSA 2W1CA 3MDYA 4IFGA 2IVSA 2PZPA 4KAOA 5EW9A 5TF9A 4ZLOA 4P7EA 4DG3E 3SC1A 1V1KA 1BI7A 1OGUA 1YWVA 3EL8A 4L01A 5EFQA 4ZSGA 5KE0A 4YU2A 4YMJA 1YDRE 2XF0A 1XWSA 1WVWA 4QTBA 1W0XC 2JDVA 3JR1A 4ARKA 5FXRA 3FQSA 1YI4A 5FRIA 4C35A 3IKAA 3DJ7A 3KKVA 3UDSA 1YI3A 4ANSA 3P4KA 1PMUA 1ZMUA 4YZCA 4GFGA 4FSWA 3ZZEA 4FKJA 4ID7A 4TYHB 4U40A 3KFAA 4ZZNA 4MF0A 1ST0A 3TZMA 2QLUA 4YHJA 4S33A 3QCSA 4U41A 4U80A 4BWXA 4MXCA 5JGAA 4I0TA 3V5PA 5ICPA 2V7OA 5CT7A 4YSMA 5EHYA 3KY2A 3ACKA 4F4PA 4UN0C 3U54A 4FNXA 5F4NA 3BHUA 4MXYA 4NT4A 2W5BA 3PY3A 4I20A 3P08A 5DG5A 4GJ3A 4EH8A 4GUBA 2KULA 2VU3A 3KXGA 2XNMA 5DYJA 5K3YA 1KE7A 1ZYCA 3CXWA 5CSWA 4AP7A 4V05A 5BMSA 2WMQA 5BUJA 1IAJA 4UMTA 5C8MA 4I6QA 3R63A 4E26A 4O6LA 4C4FA 4B0GA 2VTOA 4XP0A 2XEYA 1U46A 4BCFA 2HYYA 4E4NA 3C4FA 2ZV2A 4FT9A 5AAGA 5B2MA 4ZTQA 3BV3A 5KHWA 2Z02A 3HAVA 1WZYA 3ETAA 3B8QA 4JAIA 2OW3A 4Q9SA 4DTBA 3ZMMA 2VTNA 2V7AA 5KCVA 1XMMA 2X7FA 2QOQA 4IB5A 3H30A 4F0FA 1OZ1A 3QX4A 4OBPA 1ZZLA 2ZOQA 3PA4A 4FTCA 2VTTA 4GW8A 2ITWA 3FV8A 5HLWA 3R7EA 1OPJA 3DK6A 5I9YA 5CI7A 3DGKA 4FYNA 4F1OA 1H4LA 4XG4A 2VWBA 3ZC6A 4AQCA 3FLZA 4UYAA 2WAJA 3BU6A 3KQ7A 2UZBA 3DKFA 4L3JA 1YDTE 3W2RA 4BDHA 3QTRA 5L2QA 3VBTA 1M2PA 2WTVA 5HOAA 4CG9A 3E3BX 1CMKE 5FP6A 3R8ZA 5ETAA 1CM8A 4JX7A 3PDTA 2QLQA 4GK3A 3NX8A 2GU8A 4G17A 1W8CA 4OTFA 2GS6A 3MY1A 1VEBA 3UOKA 4C7TA 3GC8A 3QD4A 3QLFA 5IA3A 4YJPA 3G2FA 5CAVA 4GT3A 3VBXA 3PE2A 1JSUA 1W98A 1IR3A 4YPSA 3CPCA 4CV8A 4AW2A 4CFUA 1WBVA 4NTTA 3LPBA 4XOZA 3AD4A 2GFSA 2QOOA 2WMRA 4LL0A 3RAWA 5IQBA 3NSZA 2O64A 3VRYA 4AT5A 4CFNA 2QOKA 3UIXA 2XH5A 4L6QA 3EQHA 4BBFA 1FOTA 4UALA 4AOIA 3U6IA 5JH6A 3L8PA 3BEGA 2B55A 2HIWA 2HZIA 3NAXA 3O7LD 4RVLA 5EM6A 4ACHA 3E64A 4FKWA 3F2NA 4USFA 5AAEA 3FAAA 3ORXA 4YC3A 3DA6A 4CQEA 2DUVA 2X0QA 4XG2A 2CJMA 2YERA 4A9SA 3Q4UA 4HGSA 5E8YA 3VS1A 3OD6X 1ZYSA 2JDRA 4LM5A 5AEPA 5EQPA 1UU8A 2JDTA 4FIEA 2W1FA 4IAIA 3P9JA 5AV1A 4DA5A 5HE2A 4RT7A 3DXNA 4FG9A 2F7ZE 3QA0A 3PXQA 3BL7A 4O86A 4IADA 3POOA 3EFWA 2P55A 4EYJA 4U44A 3BYMA 3BHVA 4M12A 4Y72A 4DC2A 1Q97A 4AE9A 3QGWA 2EB3A 2VWIA 1U54B 3P7BA 3V04A 3G51A 5HIEA 4DE4A 3ZH8A 1SVGA 2VNYA 5D10A 2QKRA 3D5WA 3KA0A 3ZEWA 5BPYA 1STCE 3FZRA 4I5PA 2CLXA 5ANOA 5HEZA 2NYAA 2W4OA 1ZOGA 1S9JA 2IZRA 1SNXA 3EFJA 3KRXA 3T3VA 3PVUA 4IVBA 4IZYA 3RM6A 3V5WA 3RPVA 2XB7A 1W82A 5CYIA 4U7ZA 2IPXA 5ANEA 2W4JA 4WBOA 1U5RA 2I0VA 4ZXTA 4PNKA 4O7ZA 3CY3A 5DGZA 2CKQA 3NLBA 3TIYA 3HYHA 5HVJA 4D4RA 2VGPA 2F2UA 4DT8A 2VTAA 4FIFA 2W1DA 2BRMA 4QPMA 4GIHA 1WVXA 5EM7A 5TT7A 4BZOA 2RFDA 4GH2A 4JDJA 3VBWA 1J7IA 4I22A 2XKFA 4BGHA 1ZY4A 4K18A 1OGYA 3PP1A 4YO4A 1FVRA 2YWPA 3LFAA 4G5PA 4O7SA 1M7QA 2QOIA 3FLNC 3QTIA 3AOXA 3O17A 1M2QA 4ERWA 4LMUA 3OBJA 3ZUTA 3U6JA 4PF4A 2JITA 3U9CA 3BGQA 4HVHA 2VAGA 4RFZA 3P79A 3R73A 5EDRA 4F09A 1WBOA 3VW6A 4CFMA 4FC0A 4K6ZA 3I5NA 4AXDA 1YWRA 3RAHA 1JKTA 3AC3A 3VUDA 2V62A 1H28A 3UQGA 3LHJA 4WRSA 2QOFA 5KX8A 5AA8A 1KV1A 1GZKA 1Z5MA 3VF9A 3ZHPC 1NW1A 4O0TA 5CVHA 3ZC5A 4EQMA 2XKDA 4RIYB 2C1BA 4HCUA 4HJOA 5TO8A 3RBWA 3GC7A 4CMUA 3OVVA 3ZO4A 3IOKA 4E4XA 3CD3A 5FTOA 2J6MA 5AP1A 2C68A 3RHXA 1HCKA 2JIVA 2HW6A 4X2KA 3TYKA 3VS3A 3HDMA 4CCBA 3CQWA 3BWFA 4DHFA 5I0BA 1ZYDA 3VS7A 4A7CA 3QQFA 4O22A 3UQCA 2XK7A 3IS5A 4L8MA 4D1ZA 4GK2A 3OW4A 1YXUA 3ORLA 3QCXA 1KOBA 2F49A 3TZ7A 1URWA 4QTDA 4S30A 1FGKA 5AX3A 4BBEA 3NMUF 4W9XA 3PFYA 1ND4A 1P14A 3GP0A 4C57A 5HGIA 1YXXA 1BYGA 2UZVA 4FX3A 4HZRA 2I0EA 5BVFA 4XX9A 3UP2A 3WARA 3ORZA 4JT3A 4XV2A 4Y46A 5M06A 1J7UA 2BRBA 5M57A 2CGUA 3N4TA 1LPUA 1V0OA 3PY0A 3S2PA 5TOZA 3K5UA 2VO3A 4YNEA 2BUJA 1OKYA 4F70A 4N70A 3EJ1A 4FZAB 5A4TA 3NW5A 3RK9A 5AR4A 2BKZA 3C9WA 4RZVA 3ODZX 3IONA 3F3TA 1I44A 3OC1A 4MQ1A 3AQVA 4BZDA 4RC3A 4FTRA 1B39A 1WBPA 4XEYA 3PWYA 4V0GB 3ZSIA 3BLRA 4EYMA 3S1HA 3NCGA 2XZSA 3LMIA 4J71A 3ACJA 1OITA 5EYKA 2C6EA 1NVQA 2YWVA 4QOXA 4UWBA 2BILB 4FZ6A 4CZTA 3R9DA 4DEEA 3BIZA 5K0KA 2C6OA 3FI3A 4MXOA 5I9XA 2UZOA 5HE1A 3MWUA 4EK5A 2XIXA 3PA5A 4IM0A 4W8EA 3HX4A 5AR5A 3V8TA 5EDPA 3Q52A 4K0YA 3SKCA 3A4PA 3QTZA 5D9HA 4JG6A 1YRPA 3TKHA 4EH2A 4QP4A 5L6OA 4FKGA 4F9CA 4FGBA 4L52A 1ZY5A 2C47A 3PSBA 2XBJA 3G90X 4GSBA 3FKNA 3TNPC 4R1YA 3VUHA 1XH6A 3BRBA 5AUXA 4QMNA 3E87A 3PLSA 3KEXA 4ANLA 3DAJA 3FLSA 2WU6A 2XNNA 4J97A 5AJQA 1H1WA 5I3RA 5L6WL 4FL2A 3QQHA 3R7OA 4AN2A 3CD8A 3WIKA 3N4VA 3EOCA 4II5A 1UKIA 2QOHA 3NVKI 5KZ0A 3BYVA 3GT8A 4NCTC 2Y0AA 4O82A 1Q3WA 4X2NA 1B38A 4E8AA 2GNLA 1OBDA 3G15A 4BJJA 4ASXA 4QRCA 3UNZA 3MH2A 3BGZA 3P7CA 3W2OA 4CGAA 5G6VA 2O2UA 1KSWA 4I1ZA 4UX9A 2ZYBA 3FL5A 4FA2A 5JQ5A 1KUTA 2IJMA 3DZOA 4X3FC 3UG2A 4BCJA 3DAKA 4ZJVA 2OWBA 2QU5A 4TW9A 3DB6A 4A9UA 4FIHA 2PHKA 3F3WA 3D83A 3BWJA 2RG5A 1BUHA 1WVYA 4FMQA 4MBLA 4F0GA 1G8SA 4HGLA 4H3QA 3TEIA 4Q5HA 2PYWA 1OKWA 2XMYA 3Q5IA 2R0IA 3AKLA 3VS6A 4BGQA 5HCZA 5E1SA 4NYEA 4U3YA 2C6LA 2PMLX 4F6UA 5JFVA 1AQ1A 2JD5A 4LOOA 3F7WA 3KK9A 4TY1A 4DFBA 3U4WA 1REKA 2I0YA 3FHRA 3QUEA 3DDPA 3DT1A 4FTIA 3K3JA 4BTKA 4IAKA 3HLLA 5LMKC 4S32A 1JPAA 3DBDA 2C5NA 3HMMA 4FNWA 4GU9A 3EQCA 4IVCA 5C03A 2BIKB 1OPLA 4YJSA 2ITXA 3ZO2A 3ALNA 4XYFA 4YPDA 3W0OA 2ONLA 3ZONA 2J0LA 3VUKA 4D4YA 1OL6A 2ERKA 2W1HA 4U45A 4AZTA 5C8NA 2O5KA 2NO3A 3PXZA 3MJ1A 4OTGA 2GCDA 4IH8A 3NIEA 4G6LA 4RX9A 3MPAA 4AAYA 2VO7A 3VQUA 4IBMA 5CF8A 4IVAA 2YLEA 5HD4A 4YUQA 3VW8A 4CFXA 3MW1A 1OM1A 1F0QA 2ZFYA 1XBAA 2OO8X 1QPCA 3FQHA 4MWHA 4G9RA 2IW8A 2LGCA 3Q2JA 5ETCA 1REJA 5HI2A 4AZVA 4BC6A 3JPVA 3D9VA 4IJPA 2OJFE 4UWCA 3MH1A 4ZSAA 1BL7A 5AWMA 5BVKA 4QMLA 3LOKA 5GZ8A 3UYSA 4ZLYA 3UC4A 3H10A 3QQLA 3LVPA 5H9BA 1WCCA 4RIXB 1AD5A 4P90A 4CTBA 3QRUA 1W83A 3DK3A 3UIBA 5E8ZA 2BRNA 3TZ9A 1H26A 1FQ1B 4NK9A 4UB7A 3Q60A 3VIDA 1Y6BA 4JXFA 1OB3A 2I7QA 3C0IA 3CPBA 3HMNA 3RPOA 3THBA 2R3QA 3I7CA 4H05A 3KXXA 4X0MA 5HE3A 4C4IA 5CEIA 4ANQA 5I9VA 2VTQA 1Q61A 2XKEA 3COMA 3I1AA 5HG9A 3R2YA 4ZZMA 3W33A 2PVRA 3QCYA 3ZYAA 2J90A 2C0IA 2WIHA 4NM0A 4PRJA 4FSUA 3T8OA 4D2SA 3NCZA 4U97A 4CFVA 3EQPA 2ZAZA 3OY3A 2PMNX 4FOCA 3ZO1A 4TYIA 2BR1A 2O63A 2E9UA 3NS9A 3KULA 4FOBA 2VO6A 2XIYA 4PPCA 3VBQA 3W16A 4AZEA 2BRHA 4J8MA 2W5HA 3KRLA 5HVYA 3MPTA 3AGLA 4M67A 5HU9A 5M4FA 2BHHA 4EH9A 3DZQA 3F88A 2AC5A 1FMKA 3DCVA 5FTQA 2WTDA 3ZZWA 4C36A 3QZFA 1GZOA 4FRFA 4YTIA 4EH7A 2IG7A 3GU6A 4JDKA 3S95A 4ZY4A 5BVWA 4UYNA 3LQ5A 2CPKE 2ZVAA 2Y4PA 2QR8A 3HUBA 3NYOA 4NJDA 4RPVA 2X2KA 5CQUA 4MWIA 3R04A 4YNOA 1Q24A 3W2PA 3AD6A 3HL7A 3UJGA 3CKWA 4EKLA 1G8AA 5EQEA 1UU7A 3OXIA 4J99A 4APCA 4BI0A 2OIBA 5HVKA 1XH8A 1E1VA 4BDEA 3LFDA 3V6RA 5LJJA 5HTCA 3VHKA 3O0GA 4NL0A 3UMWA 4PTCA 1H01A 4HYHA 4BIEA 4C3FA 1YI6A 5AR8A 3F3ZA 4FBXA 3WI6A 3ZLSA 4FV0A 1MRYA 3G9LX 1FVTA 3UODA 1O6LA 2QI8A 1O6YA 2B7AA 3RVGA 5HX8A 4QYGA 4M66A 4BCQA 5DN3A 2GQRA 5T6KA 4TYEA 4ZY6A 4KSQA 4PMPA 2YCSA 4PP9A 3FSKA 5FGKA 5HTIA 5IH4A 2YA9A 4IEBA 5CAQA 1IASA 3ANQA 3WILA 5J1VA 3OWJA 5HESA 4O7LA 4D4VA 3PE1A 1OPKA 1W84A 4WD5A 1SVHA 2WD1A 3PWDA 2WMXA 1QPEA 3F3UA 1A06A 4MH7A 3BPRA 4XG9A 5H8BA 4CFFA 3QCQA 4GG5A 4OT6A 4FVQA 4BCOA 3MV5A 1TZDA 4I6FA 4QMWA 5CSXA 4E6AA 3WZKA 3VRZA 3S4QA 1YWNA 4WSQA 4IACA 2QU6A 5LWMA 4DDIA 4B9DA 5HNGA 5AX9A 3GU8A 3RP9A 2YCQA 4E7WA 2UVXA 4FTUA