3DBEA

Crystal structure of an activated (thr->asp) polo-like kinase 1 (plk1) catalytic domain in complex with compound 557
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
287
structure length
284
Chain Sequence
KEIPDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVFAGKVVPKSMLLKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMRQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIEFDGERKKDLPNYIAPEVLCKKGHSFEVDIWSLGCILYTLLVGKPPFETSCLKETYIRIKKNEYSVPRHINPVASALIRRMLHADPTLRPSVAELLTDEFFTSGYAPMRLPTSCLTVPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polo-like kinase 1
publication title Design and synthesis of 2-amino-pyrazolopyridines as Polo-like kinase 1 inhibitors.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase
total genus 73
structure length 284
sequence length 287
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2008-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dbeA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dbeA01
1I09A 4E6CA 3EQCA 2YWPA 4FTAA 3WF5A 4FOCA 3ZO4A 4UMPA 3R1NA 1FQ1B 3W32A 5LVNA 1XH6A 3Q4TA 4O27B 4RX8A 1Q41A 5FDXA 5CENA 4O7VA 4D55A 4TWPA 3BLRA 4J8MA 3VIDA 1ZMVA 5E8YA 3GCVA 2QKRA 3UNKA 3CQWA 4TYGA 2PUUA 1RDQE 4EZ5A 4OTGA 5AM6A 2WTIA 3PJ8A 4IB3A 1CKPA 3CC6A 4Z7GA 4YO4A 4C4IA 4IVCA 4GK3A 2OO8X 4CRSA 4GU6A 2B52A 5L2TA 3VS6A 3ZU7A 4W4YA 3R8VA 5J9LA 4D4YA 2X4ZA 3HP2A 1Q61A 3Q4ZA 5LMKA 2CKQA 4HGTA 3VJNA 5AUVA 4O0YA 1YOJA 4G2FA 5H3QA 3EZRA 5CEQA 5E8UA 5CX9A 5LCJA 4JX7A 2IW8A 1NXKA 4UXLA 3QTZA 3HMIA 4IXPA 4CZYB 4GRBA 2YAAA 4O0XA 4OTIA 2YFXA 5DR6A 3AD4A 3WIKA 5AX9A 3CPBA 3AT4A 5IEXA 3G0FA 2BCJA 2YM6A 1UU3A 3DGKA 3D5XA 4BWKA 5FEQA 3LAUA 3PVUA 3ZDIA 3EFKA 3WE4A 4Q2AA 1YHWA 3FHRA 4CFUA 3HUBA 3R21A 2CKOA 4M13A 2XBJA 1OVEA 5AX3A 3SX9A 4WNPA 5BVEA 3QQHA 4QP3A 1ZXEA 2V0DA 5H8EA 2OJJA 4TL0A 3QZHA 4CMOA 5BVDA 3PSCA 2C5NA 5JT2A 4CCUA 1JPAA 5IA5A 2KULA 3RINA 2BZHB 2XBAA 4I5HA 2NPQA 3NNUA 3RAHA 4RJ5A 4CEGA 2O3PA 3UOJA 5I9WA 4IAFA 2XYNA 5CQWA 4KIOA 4BKYA 3FZOA 1W83A 1E9HA 1K2PA 4TPTA 4C7TA 1OECA 3E7OA 2VWIA 2QI8A 2WQOA 4K18A 4TYEA 5IH4A 4O0TA 4IAZA 1QPCA 3WZUA 2J2IB 4JS8A 3QD0A 1YXSA 2HIWA 4KA3A 4MBIA 3UG2A 4DCEA 5A14A 5F94A 1XQZA 3UODA 3QD4A 5CU3A 4YZDA 2PVYA 1H01A 4FTMA 4FV5A 2ITWA 4XCUA 3V3VA 1ZZ2A 5CVFA 2PVJA 3QBNA 2P0CA 3QQGA 3VUHA 4GS6A 4UBAA 5CSXA 3FL5A 4X3FC 3VRYA 3EFWA 3ODYX 1NVRA 4FTQA 4CT1A 1ZY4A 4J96A 5IA2A 5JK3A 5EQYA 4M66A 3EQDA 5CU0A 5EHYA 4HVIA 1OITA 3HX4A 2GS2A 2UZUE 3PTGA 4IWOA 1M7QA 2QU5A 4DGGA 3LXPA 1KE5A 4G5JA 2QNJA 4AQCA 1JVPP 4XBUA 4AS0A 1OL5A 4TN6A 4FVQA 2X6EA 3JS2A 1YDRE 4LV8A 4D2WA 2PE1A 3R01A 3LQ5A 2AC5A 4RC2A 4XNEA 3GU7A 2BUJA 2OZOA 2ERKA 4BWXA 3ORIA 4JG6A 4BF2A 4TT7A 2JD5A 3ZHPC 3DB6A 2DYLA 2PULA 2R7BA 4C4FA 4GYGA 1VYWA 2X2KA 5IF1A 5C26A 4WHZA 5DH3A 1H8FA 3UIBA 5JKGA 2UW0A 5A3XA 4YHFA 1E1XA 4M84A 4YC6A 1GZNA 4ERKA 5ETAA 1CKIA 4YJTA 3U87A 4YC3A 2RG5A 5H8BA 4HYHA 3TV7A 5BYLA 4JQ7A 3P5KA 3DAKA 1TQIA 4W8DA 4D0XA 5GZ8A 1BLXA 2IG7A 4L6QA 3ORTA 4RFMA 5HIEA 2UW5A 5CXHA 4BDJA 4D1XA 2YAKA 4AP7A 1K9AA 2RFDA 3ZZWA 4F1TA 2O65A 4ZTQA 1U5RA 4O1PA 3KRXA 1U5QA 2JBOA 3AGMA 4AT3A 3D0EA 4QMZA 2HOGA 2QURA 2WIPA 4Y46A 2QQ7A 3ORZA 4R7HA 2ITOA 5C27A 3B8QA 4FZAB 4LRKA 4RJ3A 3ZLWA 1UKIA 2VO3A 5M53A 2IWIA 3FZTA 3QYZA 4K0YA 4FTNA 4NZWB 4X0MA 4A9UA 2UZVA 4QTEA 4K2RA 5C8MA 5HE1A 4R3RA 1UNHA 4CCBA 2FSTX 2HK5A 4FTTA 4KIPA 5JZNA 1SNUA 5IZFA 2WTDA 2HCKA 1WBVA 5K5NA 5IA4A 5KMJA 5CI6A 3A61A 5HIBA 4O7TA 3G51A 3VS7A 3D83A 4XP0A 5D12A 2GHMA 2JKKA 3POZA 5BX0A 4FKJA 4OT6A 3EN6A 3O8PA 4QOXA 3TIZA 3QTUA 4QP2A 4XV3A 2R3KA 5DPVA 3HKOA 4F4PA 4XG3A 2J0JA 3LFFA 5EQPA 3I7BA 1SNXA 4TNBA 4EHGA 2I1MA 3F5PA 1FVVA 5KKRC 2J6MA 4UMTA 4EOMA 5J79A 4RA4A 2HW6A 4FTOA 4FV9A 2ZB1A 3A7IA 1PXJA 4Y5HA 3JPVA 3LE6A 2QO7A 4MD7E 2VTJA 3RGFA 4U80A 5CAOA 3QX4A 5FM3A 3TT0A 3UC3A 2CGWA 3TNIA 4LGGA 4FE2A 5AR2A 4O82A 2RFSA 4RC4A 2FA2A 2VNWA 2J9MA 4IB5A 5C9CA 3FY2A 3OW3A 4NW6A 3VULA 1IEPA 3S3IA 3V5QA 4CFMA 4NFMA 4J71A 3FLZA 4H3QA 5EK7A 5HX6A 3N4VA 4O2PA 4FMQA 5L6WL 4WIHA 3NGAA 4FICA 5M56A 2ITXA 1B39A 1ATPE 2ITQA 2ZMCA 4QQJA 4ZTRA 4II5A 5FD2A 3KGAA 3P08A 1CTPE 3D5UA 3QD2B 4FV1A 2B4SB 4RWIA 3GU6A 4AXAA 3LM0A 3ETAA 5CVHA 3KEXA 4X3FB 1QPDA 4O7RA 3HYHA 4N6YA 1JBPE 4XG6A 5CU4A 1Q8WA 2YIWA 4FODA 5AM7A 3GQIA 4U6RA 3CCNA 5ANDA 4EK8A 2JKOA 3QTXA 2ZJWA 4JDHA 2XCHA 4JIAA 3S95A 1YI6A 4CFVA 4KBAA 4AACA 3U54A 3RWPA 3PPZA 3W8QA 2QLQA 4R5YA 4RJ4A 2XCKA 4QMSA 4XV2A 4DN5A 5A9UA 1DI9A 3U9NA 2I0EA 3VC4A 4XBRA 2Z8CA 3KCFA 2ZB0A 3H9OA 1OIYA 4NWMA 3DA6A 3FLNC 4NSTA 3RK7A 2GFSA 2C0OA 4FTJA 3QRIA 3ACKA 2CMWA 4FKIA 4HGEA 3E63A 4I21A 4RQVA 4FBXA 1ZMWA 2UZLA 3BYVA 3ZCLA 4C2VA 4EZ7A 5AP3A 3LCTA 3N4UA 4UXQA 3VO3A 2RFNA 2PMNX 3OMVA 4DH3A 2OICA 3DBEA 3LJ1A 2XZSA 4RFZA 4ZTSA 3QLGA 4BL1A 3OBGA 3SRVB 4W9WA 4QYFA 2PVNA 4FGBA 4OGRA 3L9PA 3WBLA 4ZSGA 2G2IA 3DBQA 1WBTA 1JLUE 3MBLA 4U5JA 4DEDA 4PP7A 4ACCA 2WMAA 4OTRA 4D5HA 1X8BA 3R1QA 5TKDA 4FEUA 3DKFA 1GNGA 3COHA 2PWLA 2WTKC 4F6SA 2X6DA 3DLZA 4G3FA 5CAVA 1DS5A 1XHAA 2OXDA 2OJFE 5AP1A 3FHIA 3ZBFA 3LFAA 1SVEA 4BCOA 4FKPA 3KVWA 3AQVA 3QZFA 4GUBA 4YGAA 5BVNA 2QCSA 5HLWA 2BMCA 4DGLC 4FK3A 2XKCA 3HZTA 4E4XA 5JZJA 2WMWA 2R0UA 3E62A 4O1OA 1H4LA 4NTTA 3GOKA 1Y6AA 5AR4A 4BI1A 2J51A 4S31A 1F0QA 4ENXA 3F6XA 3KULB 4F0IA 2DUVA 3EZVA 3RPYA 4GFGA 3VBVA 4MXAA 5B2KA 4DFBA 3KK8A 3LFEA 5CVGA 4RVKA 3OT3A 4I24A 4DLIA 4UMUA 3O8UA 2Z2WA 3BHYA 2EXCX 2XEYA 2WMXA 4TY1A 4WSQA 2YLFA 1OZ1A 5E1EA 2REIA 1PXMA 3MVLA 3SRVA 2F49A 3QQKA 3FI2A 5IH6A 3DXNA 5DIAA 3F2RA 4CD0A 5AUXA 4IX6A 3O0GA 5LCKA 3QL8A 4RMZA 3KVXA 1XH7A 3DXPA 4CMTA 3MA3A 3R04A 5JQ8A 3EN7A 3QA0A 5D1JA 4ZTLA 3VNTA 4ZTMA 4KBCA 5HCZA 4H36A 4IH8A 5KKRB 1O6KA 5HX8A 3D7TB 3QF9A 4FSZA 4X2FA 1MP8A 2OF4A 1GIHA 4LOOA 4FIHA 4JRNA 3PLAE 1KE6A 2CSNA 3TDWA 2OLCA 3EFLA 4G31A 1PXNA 2XH5A 4I6QA 3KY2A 5HHWA 4W4XA 4FZ6A 2IW9A 3ZXZA 3HAVA 4V04A 4RRVA 1OI9A 3IDBA 4JRVA 4G1WA 3D2KA 2JKQA 3EIDA 3HRCA 3WZJA 3KULA 2BKKA 2OXYA 3PXQA 3V8SA 4EBVA 2BALA 2WMBA 4FV0A 4APCA 3M1SA 2ZYBA 1PXOA 3HVCA 4BTKA 1JQHA 4CMUA 3FKNA 4L44A 2GNJA 4V0GA 3W55A 1M2QA 4TYIA 3L8SA 5JGDA 4DFYA 3BCEA 5IA3A 4M0ZA 2XRUA 4D2TA 4LGDA 4QQTA 3S2PA 4RIWA 2QODA 5EYDA 3IQ7A 4TTHB 2ITVA 3M11A 4RJ7A 4MXXA 2BHEA 4K33A 4GIIA 3TKIA 2PZRA 2Y0AA 5HQ0A 2Y4IC 2BTRA 2VTQA 5A4QA 2OIBA 4D4RA 5BNJA 3AD6A 5FXSA 4HPTE 2PZ5A 3E8CA 4KKHA 3A7FA 3HUCA 1QPJA 4UEUA 3KREA 2QHNA 2XJ1A 3UNZA 3ITZA 2E9UA 3BELA 3R2YA 3EQHA 5C1QB 3DDQA 3DFAA 2I40A 5KCVA 1KV2A 3RM6A 3D7ZA 4AN3A 3Q52A 5C4KA 2Q0NA 3MWUA 5DI1A 5CF6A 4E6QA 3F2AA 4NL0A 4FNXA 4W8EA 1OL2A 4IZ5A 4KBKA 3W18A 3ZSHA 1M2RA 3C5UA 1R0PA 2QOKA 3F3TA 2CPKE 2RKUA 3LCOA 5GNKA 3RZBA 1PXIA 2IW6A 2FSLX 1YXVA 4X7QA 4G16A 3PSDA 4RLLA 4IFCA 4F09A 2XA4A 4Y85A 5ICPA 2WTKB 3BBTB 4OTFA 2A2AA 3S0OA 3BBWA 3ZUTA 4EI4A 2C3JA 5A4TA 1JSUA 4OAVB 3I7CA 2UZBA 4XG2A 1P4FA 3OUNB 3IG7A 2XNEA 4EUTA 3PY1A 3FMJA 3OROA 4JBPA 3ORKA 3QQFA 3CTQA 2HY81 2Y7JA 3OFMA 5L2IA 3MDYA 4TYJA 2ETKA 2H34A 3SKCA 4P4CA 3EN9A 3OCTA 2UZNA 2QR7A 5IA0A 1J91A 3GC7A 2QONA 4QP7A 3UIMA 2BZIB 5HG7A 3F69A 4EOLA 4TWCA 3D4QA 3BIZA 3PA4A 3QCQA 4U42A 4IAYA 2V62A 3PIZA 2PE2A 2OWBA 3QKLA 2IVUA 1GZOA 2W17A 1NVSA 1PXPA 3PZEA 2J5FA 4FKVA 3ULZA 3EKNA 5HD4A 2ITTA 4MWHA 5LVLA 3QAME 5BVWA 3G90X 3ATSA 1SVHA 2R3PA 3G15A 3C0IA 2C6KA 3BHHA 3D5VA 4ANMA 4M97A 2WTCA 4C4EA 3ZFXA 5CU6A 3MA6A 2QD9A 4ANNA 3CY3A 5CEMA 4LYNA 2BFYA 4YUQA 1PKDA 3AMYA 3SDJA 4APPA 4L8MA 2VO0A 1XR1A 3H0YA 3KRLA 4FIIA 5ACBC 2C5OA 2YDKA 4PMMA 5TR6A 3U9CA 4ACGA 1URCA 3JY0A 2J7TA 3EN4A 2GS7A 3FV8A 4Y72A 4O7YA 4BDEA 3PVGA 4X21A 4E26A 4PDYA 4AU8A 5IQIA 4YPDA 5HG5A 3SW4A 4CYJA 3GQLA 5D9HA 4DEBA 1PMNA 4PL4A 5A6NA 1FINA 4FSMA 4KKGA 3CTHA 3NSZA 4GYIA 5C8NA 4QMMA 5EHLA 4C0TA 3ZONA 5HCXA 3F82A 3ZO1A 2BAQA 5EW9A 3VF9A 3PE2A 4B7TA 1OIRA 2JDTA 3A8XA 4PMSA 3R9OA 2C5YA 3PPKA 4EOSA 3HGKA 1DI8A 5E9EA 3R9RA 3OW4A 1H0WA 1SVGA 3OEFX 4LMUA 4C34A 4HCVA 5I9VA 5KBRA 2W9FB 3DDPA 4YC8A 4NYEA 3S4QA 4EUUA 3KB7A 3L8VA 3NS9A 1XKKA 1VZOA 2Y4IB 3R00A 4J52A 5F20A 3TN8A 4A7CA 5E92A 5DHJA 1W8CA 4KSQA 1YOMA 1GAGA 2ACXA 4F64A 4EQCA 2WOTA 4DH8A 3W2SA 4ZJVA 4AW1A 4C3RA 4R3CA 5M08A 4EH4A 2OZAA 2VGPA 4KABA 4IB0A 2QOFA 2G2HA 3PXFA 4S34A 2X7FA 3P0MA 4IW0A 4RIYB 5C8KA 3BLQA 4LRMA 4IWDA 2BHHA 4CG8A 5FTOA 3I0OA 3W1FA 3PWYA 4H1MA 3LMIA 2C6OA 3CTJA 5FTGA 2J4ZA 4RIXB 2QG7A 2X8DA 1JOWB 4AW0A 4M69A 5L4QA 4NKAA 3UNJA 1OPLA 2C3IB 2CKEA 3MS9A 4O38A 4WRGA 2JDVA 1V0OA 3BHTA 2GTNA 1YVJA 4KSPA 3ENMA 4U3YA 4FEQA 2BAJA 1DAWA 3W2OA 1H08A 2X9EA 4G9CA 3MIAA 3C4XA 5FBNC 3KK9A 5HE3A 4PDSA 2JDRA 5EKOA 4FTIA 3ZM4A 5AP7A 5AUTA 4PPBA 3VBWA 2YJSA 4XMOA 3ZDUA 3NUSA 2Q83A 3FXXA 2B9HA 4JQ8A 3R7OA 2HY0A 3ZO3A 3DK3A 5CSWA 1M17A 5HLNA 3BKBA 3IONA 5CU2A 5IMXA 5ANIA 3PA5A 4ACDA 4DINA 4MEDA 3JVSA 4U8ZA 1H07A 2YN8A 2DS1A 3GC9A 4BI2A 2CDZA 4JL9A 3CJFA 4H3PA 1UKHA 4FT5A 4ASZA 2G2FA 2WOUA 2YM5A 4MQ2A 3ROYA 1GIIA 3DKCA 4U40A 5DT3A 2OJGA 3G2FA 3BYMA 4OTWA 2A4LA 4I20A 3U4UA 2JEDA 3DZOA 3OS3A 4ZLZA 2F4JA 1V0PA 4ALWA 3E88A 3OCGA 3QQLA 3PY0A 4LUEA 2Z7QA 4FNZA 2V7AA 1UU8A 2B7AA 4EHZA 2BRGA 3RAKA 2YZLA 3R71A 2CCIA 4EEVA 1ERKA 2PUPA 3P7BA 3QD3A 3K54A 2OJIA 5KHXA 4WO5A 3AC2A 1YQJA 4A4XA 4BHZA 4D9UA 3UVPA 5I9YA 5JSMA 2NRUA 4FNWA 3R7VA 1VJYA 1BL6A 2GQRA 5FWKK 3PRIA 3Q60A 4J53A 3ALOA 3UVQA 5ANKA 5CF4A 3ORPA 5CEIA 3Q04A 4PPCA 1H0VA 4IB1A 5L2QA 3FXZA 4UZDA 4NK9A 4K1BA 4MK0A 2UV2A 2YJRA 4RGJA 4RWKA 4IHPA 3LLAA 2C1BA 4BDAA 3R9DA 4D9TA 5M4UA 2IN6A 2PVRA 2XYUA 4D58A 3BHUA 3KMWA 4QRCA 2C30A 3UP7A 3NUUA 2X39A 5J5SA 3P9JA 4WT6A 2GHLA 4HZSA 4AT5A 3D15A 4KD1A 3R8ZA 2PVHA 5AV3A 3CSVA 5IPJA 1BUHA 2PZIA 4CVAA 5CAPA 5J95A 4LM5A 1KOBA 2JFLA 4YBJA 3F3WA 3H0ZA 3QCSA 4BYJA 3GNIB 4UALA 1NW1A 3PVWA 2PVMA 4DEGA 4JVGA 3UO6A 4PTEA 2XNNA 3Q9WA 4U9AA 4UZHA 2VAGA 2NRYA 2XIZA 3OHTA 3HEGA 5D7VA 3BGQA 4C8BA 4F9YA 2V55A 5BMSA 2B54A 4QNAA 5LVPA 4D2VA 3CXWA 4U81A 3IW4A 3VF8A 3R8MA 2R3NA 4G17A 1WBSA 4PDOA 1GIJA 1M2PA 1FVTA 1ZYCA 2DWBA 3ZUUA 4ALVA 4XS2A 3NYNA 3ZS5A 3HECA 5BUIA 2GNGA 3OBJA 4DTAA 5FRIA 4ZJIA 2C6TA 4FSQA 5E8XA 5AA8A 4B8LA 4OLIA 1Y8GA 2RG6A 2C4GA 5L2WA 1M14A 2F7EE 3NNWA 2C5VA 2V5QA 3FMMA 3OC1A 1JKTA 5HOAA 4ZMEA 4AOIA 4FKOA 5EDPA 2F2UA 4DT8A 1FPUA 4FC0A 5I9XA 5LMBA 1TVOA 4MTAA 4QP1A 1IA9A 1H26A 2JIUA 4FA2A 4R1YA 2ZV8A 3D14A 4XV1A 3Q9XA 3ULIA 3VUDA 3DCVA 3UQCA 4FI1A 5HESA 4XUFA 3HAMA 3PXZA 4HZRA 1RQQA 4D2PA 4U41A 3OCBA 4WKQA 5DVRA 3I60A 4AA0A 4L46A 3TACA 2WMQA 4A4LA 1G8SA 2C6EA 3L8PA 5ETCA 4CRLA 3C4CA 4UY9A 5T68A 3SLSA 4LMNA 5IQDA 5KX8A 4DEIA 4JJRA 4ZK5A 1UWHA 3OZ6A 4GU9A 4ZTNA 4ZY6A 2BRMA 2BDJA 3HL7A 4I6FA 2GNIA 4RLKA 4EYJA 4YURA 5LQFA 1Q4LA 4R7IA 4KS8A 4H1JA 4GJ3A 2YACA 4ANSA 4F65A 4MF1A 2PVFA 4AA5A 5IU2A 3MESA 4B99A 2BTSA 5C4LA 4YP8A 4ITHA 1NA7A 4RBLA 5DR9A 5M06A 2R2PA 5DE2A 4PQNA 2XM9A 2W99B 4JI9A 4CLIA 5HNBA 3MTLA 2UZWE 5A6OA 4GT4A 4O7ZA 5ANOA 2OXXA 4RT7A 4E4MA 4ANLA 5L6PA 3H10A 5CY3A 2WO6A 2XMYA 4FKGA 4DYMA 5BVFA 3FMLA 3RPOA 5TE0A 3OP5A 4JOAA 4R5SA 4RVTA 4R78A 3GXLA 2IO6A 3DU8A 1Y6BA 3ZFYA 2YM8A 3O8TA 3UOKA 4F7NA 4OTPA 1OPJA 3Q9ZA 3IW7A 1OGUA 2CGXA 2X81A 3R2BA 4DF3A 1OIUA 4DGOA 4HVDA 3RZFA 1WBOA 4TWNA 2BZKB 4TW9A 4WRSA 2WFYA 1BI8A 4GK2A 2GQGA 4ZXTA 5FBOA 3PLSA 4AAAA 4BCNA 3K3JA 5JN2A 3U55A 4Y83A 4FG9A 3VS2A 2X2MA 4L52A 2XIYA 3DXQA 2J0IA 1G8AA 1DAYA 2B55A 2CNVA 3VS3A 3K5VA 5I5ZA 3ROCA 4XG9A 3LCDA 2YM3A 2Y9QA 2XJ0A 2VO7A 4AGCA 3VUGA 4YTIA 5DYJA 3RTPA 3ODZX 4OBQA 3HMPA 4MAOA 4P90A 4BIBA 4QMNA 3UOHA 3EQFA 3F88A 5GJFA 4E6DA 1GZKA 1F5QA 4WD5A 4Q5EA 5DA3A 1UU9A 4TKSA 3PY3A 3TKUA 4BFMA 5GZAA 4X3JA 3CPCA 2RIOA 4PRJA 3FMNA 2XNBA 2OKRA 5AR8A 4EHVA 5JQ5A 3RM7A 4F9CA 2BIYA 2VTPA 3PG3A 3RCJA 4D5KA 5AP0A 3F7WA 3EJ1A 4ZMFA 4CG9A 3WF7A 4S2ZA 4ZSLA 3A8WA 3ORMA 2W5BA 2XK4A 3NYVA 2WD1A 4O7LA 4X2NA 4YJSA 3R6XA 3PJ1A 4MNEA 2PY3A 4MXCA 2H6DA 4R6VA 4ZOGA 5F95A 5AWMA 4ZEGA 5L8JA 2J0MB 2J0KA 3TWJA 3O7LB 3IW6A 4EOKA 4IZAA 3NEWA 2YLEA 2UW3A 3SXRA 2RGPA 3R7YA 5AP2A 2YZAA 4WA9A 3PJCA 3ZLSA 5DWRA 5EDQA 5KNJA 4EQMA 4GW8A 5E8SA 2WXVA 5M07A 4BTFA 5E8ZA 4ENYA 3VUMA 1WVWA 2I7QA 2X9FA 4R77A 5JRSA 2IJMA 4FV8A 5L8LA 3V8TA 1PKGA 4G3GA 4M3QA 2XNMA 5J5TA 3IS5A 4LV5A 2ERZE 2R5TA 3HDNA 3VW6A 3F5UA 5IA1A 3NVKI 3CJGA 4WBOA 3NUYA 4L45A 3NW7A 1YI4A 3QTWA 5CALA 3BWFA 2BIKB 5D11A 5TOZA 2WPAA 5CSHA 4F1OA 1MRYA 2WELA 1R39A 3M2WA 5I3OA 4F9BA 1SYKA 3ZXTA 3HDMA 2A1AB 3NMUF 4MX9A 3O50A 1ZOEA 2WTJA 3HV3A 4GCJA 4ANQA 3P4KA 5LWNA 4ASXA 3F5XA 3GC0A 4G9RA 5B2LA 4PNIA 2VTAA 3R7EA 4GT5A 4OUCA 5FM2A 3FJQE 5T3QA 2XS0A 3NRMA 3O96A 4FX3A 4JG7A 3V51A 4BWPA 3W8LA 3QZGA 4IDVA 3TTIA 3OG7A 3BEGA 3MGYA 3LFQA 1UU7A 2P2HA 3CY2A 3DBDA 3KXXA 3O23A 3HV7A 3KMUA 3OWJA 4FVPA 1W7HA 2F7XE 4YJNA 3PDTA 3G6GA 1LP4A 2VO6A 4QYHA 4EZ3A 4ITJA 2PVKA 3MH0A 3V5WA 1OMWA 1Q8UA 5KMLA 1Q62A 4RVMA 4YSJA 5EHOA 1WBWA 1T45A 2XUUA 1OBGA 1WBNA 3BV3A 5E90A 1J7UA 4BCHA 1LR4A 4JBOA 5EM8A 3C9WA 3NCGA 2WMUA 4XG4A 1DM2A 5EM6A 3LMHA 3HA8A 5BVOA 4JR3A 3EL8A 3G0EA 3RPRA 4FTLA 2QU6A 3C5IA 4K6ZA 3NZ0A 4FL3A 2XIRA 3MI9A 2HZ4A 2EU9A 4O6LA 3C51A 4E4LA 4MF0A 3CS9A 2ONLC 4AZTA 3FPQA 5C03A 4MH7A 4AZWA 5J1WA 3KXZA 3ZRLA 4BVUA 1PRYA 3WF9A 3R8PA 4YR8A 1IAHA 2HAKA 3HV6A 3R1SA 2Z7LA 4DH5A 3BI6A 5AAEA 4AW2A 1W82A 3P79A 5EM5A 5A46A 3CQEA 4PL3A 3ZUVA 4BDFA 3DTCA 5DRBA 5AP4A 2UVYA 2WMSA 1FMKA 1PHKA 2EB2A 4OT5A 3T9TA 4CTBA 3R7GA 2JC6A 4EBWA 4CFFA 3P78A 3UP2A 5CNOA 3EHAA 3MW1A 4F9AA 3DAJA 2W0JA 3TUDA 2VWXA 3DK6A 3DY7A 1ZY5A 2QOHA 3LFSA 3A7JA 4YPSA 3QWKA 4BIDA 3C4EA 4J97A 5LXMA 1XBBA 3T9IA 4OBOA 2UZDA 2W96B 5GJDA 1YWRA 1P2AA 3V5LA 4MYGA 4RZVA 3UZPA 1WMKA 3BE2A 3F61A 4IWPA 3TNHA 4E3CA 1R0EA 4AOJA 4F6WA 4FKSA 3JR1A 2ZMDA 3HMNA 4KAOA 4B6LA 2KTYA 2PMOX 3TUBA 4YJVA 4A9SA 4DEEA 1OL7A 4BCQA 1MUOA 4JNWA 4XLVA 4NCTC 1Q97A 3A2CA 3CLYA 4WOVA 3PIXA 2UZEA 5EI6A 1F3MC 2XKDA 4FZ7A 4O86A 2PYWA 3QTSA 5TF9A 4L7FA 3C7QA 1R78A 5DEWA 5CEOA 5I9ZA 3IDCA 5H8GA 3B8RA 3DFCB 3NUNA 4W4WA 3LFDA 1UA2A 3LXNA 5DOSA 3NYXA 4E73A 2IZTA 1OBDA 3FMKA 4Q9ZA 4FSUA 4FSWA 2GPHA 4J99A 4D2SA 2R3JA 5ACKA 1XH8A 4YJPA 1WCCA 3F5GA 4H39A 4HOKA 3CIKA 4C02A 2CN8A 4DCAA 1ZARA 3GC8A 4QP8A 3FDNA 4A9RA 2J0LA 4JBVA 4QMLA 3CGFA 2R3GA 2LAVA 4JG8A 4ZZOA 3DB8A 1R1WA 3JUHA 2PK9A 4YU2A 4WSYA 4ASDA 3PXKA 4BDCA 4IAKA 4V0GB 2JFMA 2JIVA 4R7BA 3Q6UA 4GFOA 4MHAA 4XHKB 3RNYA 3ZC6A 3NAYA 4RIWB 3GU8A 3PA3A 4C4GA 3L9NA 4ZP5A 2HW7A 3JY9A 2ESMA 4IVBA 3A4OX 2DQ7X 5DR2A 5AUZA 5JH6A 2QKWB 5FP5A 2FH9A 4FNYA 4MBLA 2IZRA 2JIIA 3TIYA 2WB8A 3DZQA 4QMPA 5IKWA 3TV6A 3NIZA 2X7GA 3QYWA 3WZEA 1STCE 2Y6OA 2ZV7A 1WBPA 3FYJX 2R7IA 3GBZA 4PX6A 3DBCA 5AV4A 2AUHA 5K5XA 4NH1A 2JAVA 4JXFA 1NVQA 4PDPA 4PUZA 4BY9E 4N4SA 5ITAA 3W2PA 1J7IA 4FEXA 5IQEA 4QD6A 2B9FA 5KE0A 1Z57A 3HMOA 4BBMA 3Q2JA 2GMXA 2VWYA 5EDRA 4EK3A 1PXLA 2I0HA 3CD3A 3COKA 5L2SA 2R9SA 4QMUA 4QTAA 3FQHA 3NLBA 3AOXA 3RJCA 4UMRA 3P7CA 3MH1A 4WNOA 1H00A 1OUKA 3AC8A 4RA5A 4X6QC 4EJ7A 2X1NA 4QNYA 3IGGA 5HD7A 3GCQA 5L3AA 3TNQB 2VWWA 3ZLXA 4AOTA 2VN9A 3ALNA 2OU7A 1HCLA 2XRWA 3OWLA 3V6RA 2X2LA 1VYZA 3QHWA 4LUDA 5AADA 2R3QA 4FKQA 5EYMA 4OAUC 2W1DA 4WNKA 3M42A 4DTBA 2OG8A 2WTWA 3EL7A 1ZZLA 4O21A 4WG5A 4XEYA 4LG4A 5K4JA 4IIRA 4CKRA 3UE4A 1YXXA 5BVKA 2UVZA 4DHFA 2EVAA 5D7AA 3DK7A 3EN5A 4TZRA 3MIYA 3QXPA 2GCDA 2VTNA 3MFRA 4GVJA 3OEZA 5HTBA 4BI0A 3MVJA 2Z7SA 4QQCA 4CQEA 1OKZA 5BMMA 1SMHA 4U0IA 4E20A 1FBNA 3BHVA 4A9TA 4ARKA 4ZZMA 2IZSA 2CLXA 4MD9E 3W2CA 4O22A 4M68A 4FTRA 4FZDB 2VNYA 3UIXA 4KRCA 3SQQA 2ONLA 4P5ZA 5J87A 3NR9A 3L9MA 4AX8A 4A9YA 4BZNA 4DH1A 4AE6A 5E8WA 4EWQA 2JITA 2VWBA 3R22A 3U6IA 2VWVA 4YZ9A 1Q99A 2OFVA 3QRTA 1OPKA 4IJ9A 4ORKA 3QHRA 1V1KA 1KOAA 2OIDA 4E5AX 1H24A 2OW3A 4XYFA 2W4OA 4C2WA 3N51A 2QC6A 3ZC5A 4O83A 1ZRZA 2WMRA 2B1PA 3NX8A 3VQHA 2Y6MA 4IJPA 3SOAA 4EC9A 4C4JA 2C6LA 4GL9A 3E3PA 5AUYA 1GY3A 2GHGA 4O7WA 4BGGA 3I4BA 5L8KA 4FL1A 3LKMA 2P33A 3QKKA 4DGMA 4QPAA 2PUIA 4NIFA 3GP0A 4L9IA 3KL8A 5L6OA 3DS6A 4I41A 4YJUA 4J7BA 4E1ZA 5CS6A 3HNGA 4FV4A 3QGYA 1XH9A 2VGOA 1JKLA 4E4NA 4F6UA 3PZHA 4DEHA 5B2MA 3FWQA 1YXTA 4EL9A 3HRFA 4BDHA 5CEKA 5IEYA 4IWQA 1CMKE 4I94A 4EOJA 3KRWA 5EYKA 2C69A 3IDPA 5HBEA 5HG8A 3T3UA 4Z3VA 5AEPA 4XG7A 1J3HA 5KMOA 5A4EA 2CNQA 4BHNA 4J95A 3ZZEA 4FT0A 4IX4A 3O71A 1W84A 5GZ9A 1IR3A 3AC4A 4K77A 2VX0A 5KO1A 4R1VA 4NCTA 3OD6X 1A06A 2ITYA 2YEXA 3LFNA 1LUFA 3UIUA 4I22A 2BR1A 5J7HA 5HTCA 4BIEA 3FSKA 2OZAB 2J50A 4DFNA 1MRUA 2IVSA 2W1HA 5HKMA 3TZ8A 2WQNA 2YIQA 2A27A 3R9HA 2PE0A 2ITZA 3I81A 5CAUA 3G9NA 3SV0A 3ZO2A 4IVDA 4KUJA 3SHEA 4IC8A 3FZSA 3QALE 3N4TA 3H3CA 5M4FA 3VUIA 2RSVA 1APME 2YDIA 3FMEA 3LHJA 5C01A 4XRLA 5HORA 3WF8A 2C68A 3FQEA 3PG1A 2P3GX 3NDMA 2NP8A 4M69B 4EORA 4NJDA 3QC4A 5BUEA 4AN9A 3FMDA 2W9ZB 1V0BA 4RG0A 4QP9A 1ZYSA 5A4CA 4FEWA 4IMYA 1PY5A 2CHLA 2G1TA 3NAXA 1Q3WA 4MXOA 3ZSIA 4USEA 3SGCA 4M15A 4JX3A 3UC4A 1JSVA 4C62A 4YZCA 4QPSA 3VAPA 5EKNA 3QRJA 5HTIA 2C0IA 1BMKA 3CR0A 3GFWA 4KB8A 5AAFA 3DLSA 5J9YA 3SW7A 2YCRA 3AT3A 3ZTXA 3C13A 5KMKA 4ZS0A 4BRXA 4ACHA 4FKWA 4A07A 4F7JA 2VX3A 4AGDA 4QYYA 4IZYA 3MFUA 2W1GA 5AIRA 3QA8A 2R3LA 3L8XA 4XX9A 3DNEA 2ETMA 5HE0A 3TUCA 4FKLA 3DKOA 3FAAA 4FSTA 5EW3A 2OF2A 4YNEA 4Z55A 2BILB 2GSFA 2GTMA 3FXWA 3RK5A 4ANBA 4AZFA 3DNDA 4BGHA 3U8WA 2XJ2A 2WKMA 5HO6A 5CF5A 1O6YA 4XJ0A 1UVRA 1B6CB 4FIFA 3V01A 3R7UA 5EH0A 3SAYA 3FQSA 4JR7A 2BRBA 1YWNA 4LFIA 2BROA 3BGZA 3KF4A 1Z5MA 1S9IA 3KXNA 4MWIA 1JSTA 3NVMB 3TG1A 1Q8YA 2PSQA 5CWZA 2A0CX 4XP3A 2C47A 3A4PA 3UYTA 3FE3A 4G6LA 4N70A 2F57A 3D9VA 5IQGA 4I5PA 4IDTA 1Q5KA 2GNLA 3G33A 5LMAA 3PYYA 1JWHA 4V01A 2BRHA 1BI7A 4K9YA 1BX6A 4BCJA 1KE8A 3CD8A 3EQGA 4Z16A 5DGZA 4KIQA 1WFCA 1PXKA 2W5AA 3R28A 4YO6A 4DBNA 5E4HA 2XK6A 4F0GA 4EONA 4NEUA 3UMXA 4DAWA 3LFBA 4X2JA 2SRCA 3MJ2A 3II5A 3L1SA 4GG7A 4L3PA 3ZEPA 5F4NA 3B2TA 1QMZA 3MH2A 5AA9A 3COIA 4M0YA 2H96A 1EH4A 3FZPA 1H25A 4FSNA 4HNIA 3FZRA 2UW9A 4BCIA 5IUIA 4J1RA 3S1HA 3FEGA 3QTIA 5E8VA 3AC3A 4HCTA 5G1XA 2B9IA 4D1SA 3TDVA 4I1ZA 3QUDA 2W05A 3QU0A 3VHKA 3GCUA 5DLSA 3R0TA 3C4ZA 1PW2A 2VTIA 4X6RA 3LMGA 3AMBA 3BQCA 2ZV2A 4ONAA 4YTHA 4O81A 1KWPA 1XJDA 1OUYA 5F1ZA 5LARA 4FV3A 2ZDTA 4BCPA 1G3NA 2W1FA 3IW5A 1U46A 1H1SA 2HXLA 4NFNA 3GB2A 3RI1A 5IQAA 3UGCA 1TQMA 3VN9A 1S9JA 4YBKA 4E6AA 1O6LA 1XH5A 2WZJA 3F2NA 3R73A 5BUJA 5IDPA 2E9OA 1NT2A 1MQ4A 5CYIA 4L53A 4GG5A 5CQUA 3BX5A 3MTFA 3FBVA 5K3YA 4B4LA 5FGKA 3ANRA 4FKUA 4YLKA 2V22A 2OFUA 1UV5A 2HENA 1UWJA 3GI3A 3IW8A 2CCHA 4GT3A 5I0BA 2UW4A 3TI1A 3TM0A 3BEAA 4O7NA 5J8IA 4ZLYA 4KKEA 4JQEA 5CT7A 5K0XA 3MY1A 1MQBA 1XWSA 2HWPA 2W7XA 2JAMA 5DFPA 4PL5A 4Y73A 3T3VA 5CLPA 5JFXA 4PV0A 4EH3A 5FUTA 4NUSA 3BU3A 3ZLYA 4DG0E 2GNFA 3QXOA 4FV7A 1WZYA 3OY1A 3U6JA 4MXZA 1YHSA 3PXRA 3QRKA 4ZJJA 3TXOA 4E7WA 3Q96A 1ZLTA 4FUXA 4JT3A 2C3KA 3IECA 2O63A 2BPMA 2VV9A 4FUYA 5KMMA 3TCPA 2CKPA 3FC1X 3TEIA 5CEPA 3E8NA 2IVVA 2YERA 1ZAOA 4BDKA 4HYSA 4G3CA 1Z9XA 4O0SA 2EWAA 1A9UA 4BDGA 4HVHA 3HLLA 2AYPA 3SXFA 5IQHA 4O96A 5HE2A 1M52A 3ORLA 4O7SA 2QOQA 4FSRA 3UZRA 2PHKA 3DJ7A 4QYGA 4FV2A 1XH4A 3KFAA 3TZ9A 3NPCA 4U44A 5E91A 2QOOA 2UW6A 2W06A 2VWZA 3ZSGA 5AV2A 5FEEA 3F3ZA 4O0WA 4BCMA 3MSSA 4BCFA 3I79A 3E8DA 3DKGA 3RPSA 3SOCA 5K9IA 4IVAA 5EW8A 4Y8DA 2HZIA 1UNLA 2JDSA 4OBPA 4TNDA 5LOHA 3QQJA 5M44A 3P7AA 1O9UA 3CEKA 4JDIA 4L67A 4L68A 3VVHA 3GUBA 2J5EA 4CQGA 2X8IA 4DBXA 2IZUA 3GOPA 4RX9A 4X2GA 3BYOA 3RMFA 4BKJA 2VTRA 2F9GA 4I6HA 4AGUA 4CGAA 3PP1A 5AAGA 1YDSE 4FIJA 3KMMA 4BBFA 4I3ZA 4FT3A 3C0GA 1PJKA 3QLFA 4OR5A 4EJNA 4F9WA 3LQ8A 2GQSA 5HZNA 5GINE 3F3VA 4U45A 4FYOA 3KXHA 1HOWA 5CSPA 1IAJA 2QOIA 4FEVA 4FTUA 4HGSA 4L7SA 1OB3A 2O2UA 5CAQA 1YW2A 4FG8A 5EQEA 1ND4A 4D4VA 3E87A 3FLQA 3NNXA 4G6OA 4EHEA 2XNPA 4IM3A 3P86A 4C4HA 2I0VA 4QMQA 4MKCA 3MY5A 4O0RA 4EOQA 3OXTA 2GU8A 4IC7A 4XOYA 3BRBA 1KSWA 3RAWA 4E93A 4F08A 2QG5A 4IBMA 5GHVA 4UWYA 2HZ0A 2XNGA 1PMVA 4QMOA 3F66A 5DRDA 4QT1A 4KINA 4EQUA 3COMA 2ZOQA 4C35A 1URWA 3E64A 3HRBA 2XEZA 3KA0A 4FIEA 1IG1A 4UYNA 4WNMA 3C4WA 5FP6A 4UN0C 4QPMA 4ZZNA 4D4SA 4UWBA 4YHJA 5HLPA 4CV9A 5IQBA 4A06A 3FL4A 4GK4A 5AUWA 3N9XA 1PYEA 1M7NA 2CJMA 2V7OA 3PJ3A 2XNOA 3O2MA 4MNEB 4B8MA 5IQCA 4BTMA 3PRFA 4ZIMA 2AC3A 2XK3A 3U4WA 3QX2A 3R8LA 3DQWA 4XRJA 4DITA 4CT2A 4EYMA 3EYGA 4GFMA 1OL6A 2R3HA 2VU3A 5CANA 2YHVA 4BC6A 4ID7A 3LCSA 4N6ZA 4YHTA 4C36A 4CFXA 4WG4A 4ZSEA 3AGLA 5HBHA 2W1CA 4ACMA 1Q3DA 3NNVA 4W9XA 1Q8ZA 2F2CB 1PMEA 4U3ZA 3KU2A 3MPTA 2YIXA 4BZOA 4I6BA 3LFCA 1KE7A 4NT4A 4C38A 3ID6C 4TYHB 3OUKA 1SZMA 3LW0A 4L43A 4C59A 3ENHA 3HV5A 4S33A 1J1BA 3ET7A 2C0TA 3LVPA 2P2IA 3EKKA 3NW6A 5DNRA 4KNBA 3UPXA 3EQRA 4EK4A 5HICA 5LWMA 4I0SA 2ZM3A 3E93A 4EKKA 5M57A 4BR3A 4BN1A 3RPVA 4QP6A 1FVRA 4CFWA 4LL5A 3K2LA 4BCGA 4Y95A 4BDIA 4NM0A 2PPQA 2YIRA 4IZ7A 2FUMA 5CI7A 4AF3A 5HO7A 3O17A 1BL7A 3BLHA 4ANOA 2FSOX 2PZPA 3OWPA 4MQ1A 5FEDA 4KWPA 3WZKA 2PMIA 1WVXA 4W4VA 2C1AA 1R3CA 3P1AA 4ZTHA 3AC5A 4H58A 4NTSA 3V5JA 2ZAZA 2GFCA 4L3JA 4L01A 4GV1A 5CXZA 2UW8A 4FOBA 5K4IA 3NUAA 3TZ7A 2QVSE 4IADA 2W4KA 5FG8A 5BQ0A 2E9PA 4F1MA 3AD5A 4U79A 4BTJA 4YNOA 4EK6A 4LI5A 4GKHA 3O7LD 3W2QA 3Q5ZA 1VR2A 2C5XA 4RC3A 4TYHA 4F0FA 5I4NA 1JNKA 2FGIA 3MY0A 5AFVA 2ITUA 3MFTA 2VTHA 3UO5A 4JAIA 3A60A 2PTKA 4BDDA 4TRLA 2NNWB 2IVTA 4IACA 1MRVA 3WILA 1REKA 3NYOA 2O64A 3V5PA 1B38A 5BPYA 1AQ1A 3MJ1A 3QRUA 4O0VA 3MB6A 3LJ2A 5I9UA 1OL1A 2OH0E 5ETFA 3T8OA 4P2KA 1ZYJA 4CTCA 4OTHA 2WMVA 5G6VA 1ZWSA 3KXMA 4F63A 5A4LA 3WZDA 3DOGA 3VS0A 5DN3A 3ZYAA 1BKXA 3EWHA 3UMWA 3Q3BA 5DBXA 1KE9A 2UVXA 3Q4CA 4I93A 5E8TA 2WMTA 2QOLA 3CGOA 3UVRA 4B9DA 4AE9A 4I4EA 4O84A 1ZOGA 2Q0BA 2VTSA 3SA0A 4XV9A 4LOPA 3R1YA 3CP9A 4JAJA 1YXUA 1H1RA 2VTOA 2VUWA 3R63A 3GEQA 2EXEA 2YM4A 4G34A 5EOLA 2WIHA 4IQ6A 4LRJA 3W33A 4PMPA 5IEVA 2OJ9A 4YJOA 1Q8TA 4DFLA 4USDA 2VX1A 4DFUA 3SD0A 1OM1A 3UTOA 4IEBA 2YIYA 3UZTA 2WQEA 4HYIA 4EH2A 3SG8A 2BZJA 3LJ0A 3C0HA 4YTCA 2QOBA 2O0UA 3A99A 3DQXA 1IA8A 2W4JA 3IO7A 3KCKA 4CV8A 4K11A 3CE3A 4UMQA 4IAAA 2EB3A 3H4JA 3R02A 3R9NA 4EH9A 5HVKA 3EQBA 3CKXA 3NUPA 5CF8A 3KKVA 4BGQA 2QO9A 3WOWA 1OKWA 2P4IA 3QGWA 3RHXA 3QFVA 4YMJA 5BYZA 1K3AA 3O51A 1ZYDA 4G5PA 4NKSA 1QCFA 2WGJA 4G3DA 2JDOA 3ORXA 2RF9A 3CQUA 3OOMA 3LOKA 3ZRMA 4XP2A 4BB4A 3IPHA 1PF8A 2XKEA 4UX9A 4FT9A 3VW8A 3UPZA 3SC1A 5D41A 3VWAA 5I3RA 3RAIA 1RW8A 4FVRA 4XLIA 4F99A 4AA4A 4BBEA 4A4OA 5CNNA 3OVVA 4NU1A 4DA5A 4U43A 1REJA 3A7HA 3B2WA 4Z7HA 3HMMA 4PPAA 3W16A 2WAJA 2WEVA 2CGVA 3GCSA 3VBYA 5HU3A 2ZDUA 1GZ8A 3OWKA 3VS1A 5F9EA 3LQ3A 4BKZA 4LQMA 4I92A 3Q53A 1KV1A 2CN5A 4LGHA 3RBWA 3TJDA 2Z02A 4ZS4A 4M67A 2R3MA 4GIHA 4XH6A 4L3LA 3DT1A 5IUGA 2R3RA 5LJJA 4NM7A 4QMYA 5AR5A 3Q6WA 3CBLA 3KRJA 5AP6A 4I23A 4NM3A 4EOPA 2R64A 2WU7A 3L9LA 3QWJA 4GH2A 5HIDA 3F3UA 2YA9A 4FT7A 4CZUA 3EB0A 3DTWA 4EH5A 2W1ZA 2XK9A 3BGPA 2C6DA 5BYYA 2BDWA 3RALA 4RWLA 4F7LA 4YLLA 4EOOA 5M55A 3EMGA 2YWVA 4X2KA 1WVYA 3C50A 3V8WA 3WARA 4WUNA 3WF6A 3BYSA 3LPBA 3PIYA 4O0UA 5ANEA 2UZTA 2WTVA 4BCKA 2ITNA 2YCQA 4E5WA 1Y91A 4X3FA 2UUEA 4FZFB 2XK7A 2CNUA 3LLTA 3UBDA 2VWUA 3ZRKA 4RFYA 4DC2A 4M7IA 2LGCA 1TQPA 5HI2A 3TNWA 4OTDA 4FR4A 4RQKA 3HV4A 2E2BA 1YOLA 1CDKA 4C61A 4WUAA 3FKLA 2QR8A 5JRQA 4DT9A 1BYGA 1IRKA 1JKSA 4CNHA 2YCFA 3EH9A 4C33A 2OGVA 1J1CA 4JBQA 3GFEA 1FGKA 3OY3A 5CT0A 1ZMUA 4EH6A 3EYHA 3FUPA 4YZMA 2GDOA 1H1QA 3W2RA 4EOIA 2G15A 2HWOA 4JDJA 3DJ5A 4KIKB 5E7RA 1RJBA 2OK1A 4M12A 2XKFA 3E5AA 3KC3A 3MB7A 1CKJA 3FYKX 4ZSAA 5EFQA 1H1PA 5JGAA 4ALUA 4IE9A 5DMZA 2WHBA 4IX5A 4AZEA 5AP5A 2OI4X 3DAEA 2Y4PA 3QC9A 1P4OA 3RVGA 4EK5A 1H28A 2VRXA 4RPVA 4AZSA 4DFZE 4FYNA 3FMHA 5CZIA 5DT0A 2B53A 5HO8A 5J1VA 1U54B 5CSVA 4GUEA 4AG8A 5AR3A 2CLQA 4F70A 4PMTA 5E1SA 2XIKA 3RNIA 3F9NA 3AMAA 1LEZA 3MPAA 5HBJA 4DG2E 1YKRA 4IX3A 4PWNA 4IM0A 4AWIA 2PL0A 2BKZA 2R0IA 4QO9A 4PNKA 1FGIA 4GVAA 2XF0A 5A54A 2B9JA 4FF8A 2X7OA 1ZYLA 3KRRA 4PTCA 5CTPA 4CZTA 2HYYA 4AUAA 2ITPA 4YSMA 3OT8A 3HP5A 3RKBA 4CSVA 4HJOA 4KIKA 3RP9A 3BU5A 2BAKA 3UO4A 4DLJA 5JEBA 5FLFA 4NW5A 2FSMX 1VEBA 2VZ6A 3VQUA 2BFXA 3JXWA 4FTCA 4NIFB 5DT4A 3TTJA 3ZMMA 4D2RA 3D94A 2UZOA 4YJRA 3FSFA 5KZ0A 3VBXA 3NW5A 4MNFA 3KN6A 4CLJA 4QMVA 4UV0A 1CSNA 3BWJA 4E5BA 5FTQA 3FKOA 1PYXA 4G3EA 4EH8A 4ZLOA 3FI4A 4HGLA 3EFJA 4RX5A 1U54A 5J7BA 3FC2A 3D7TA 1XO2B 3FZ1A 1TKIA 3LXKA 3OCSA 4IAIA 5HG9A 2ZM4A 3DJ6A 2OSCA 2WU6A 3QCYA 2FVDA 5K0KA 2EXMA 1QL6A 5DEYA 3QTQA 3W10A 3LIJA 1UNGA 4RJ6A 2W5HA 4AT4A 3G9LX 4C57A 5IQFA 1AGWA 4AFJA 5ETIA 3C1XA 4CXAA 3R83A 4Q5HA 3NCZA 5HCYA 2G9XA 4NJ3A 4D0WA 2PMLX 1W98A 4IFGA 4O91A 1J7LA 3GT8A 2BDFA 2RL5A 3MVMA 4D28A 1YDTE 5EI8A 4QTBA 3E7VA 2OBJA 3GU4A 1I44A 2YM7A 3ORNA 5M09A 3U6HA 3KF7A 5J9ZA 3RHKA 1FOTA 4ZY5A 3TKHA 4XOZA 2R4BA 3BE9A 2R3OA 2W1EA 3LCKA 5AUUA 3VBQA 4DGNA 3IKAA 2O8YA 4AW5A 4QTDA 4OW8A 5HGIA 1LEWA 1CM8A 2JGZA 2O5KA 4TWOA 5AV0A 4CKIA 5LVOA 3IOKA 3TZMA 3VHEA 1Q24A 2YITA 2Z7RA 1GJOA 4L42A 4WBBB 2XP2A 4C3PA 3I1AA 3QUPA 5M51A 1WAKA 2ZM1A 4GJ2A 4YZBA 3I5ZA 3A62A 4FKTA 2ZVAA 5HVJA 5HNIX 3TJCA 3QKMA 4C3FA 2UW7A 4GKIA 3R30A 4QQ5A 5HU9A 1KUTA 5GJGA 3POOA 5IMEA 5H9BA 3WYYA 3VUTA 2XK8A 2FO0A 3D5WA 4R8QA 4N0SA 4EC8A 4HYUA 4HVSA 2P55A 2WQBA 3ZM9A 4M8TA 3V5TA 3BU6A 3PXYA 1T46A 1A48A 1L8TA 4FG7A 4YTFA 5T6KA 4I0TA 3DV3A 4AZVA 4Y5QA 4U97A 3NUXA 1XBAA 3FLWA 3BYUA 4BZDA 3A7GA 3JVRA 4EWHA 1GOLA 1ZOHA 4ITIA 4D1ZA 4UYAA 3LM5A 1HCKA 1H27A 3ZBXA 4AFEA 2PUNA 4TXCA 2GS6A 3OXZA 4NM5A 4RSSA 5D10A 3R7IA 1SM2A 4LOQA 2HELA 4YZNA 5EG3A 3WIGA 2YDJA 4PY1A 5FDPA 5KMNA 3Q2MA 5IDNA 4FV6A 3ELJA 4JLCA 3JYAA 4ZSJA 2YABA 5ANGA 4Q9SA 5HVYA 4C58A 1RE8A 4YLJA 3FI8A 4CFNA 2E9VA 2R3IA 3PJ2A 4QMTA 1YI3A 3ANQA 2FB8A 2GNHA 3FPMA 3MVHA 3WI6A 4ZY4A 3H9RA 3K3IA 3BQRA 3IOPA 3IK3A 1LPUA 5M4IA 4ERWA 3GGFA 2PZYA 4H3BA 4LL0A 4RJ8A 3TV4A 2JLDA 5JFSA 3F7ZA 3PFQA 3PUPA 1YWVA 2C3LA 3H30A 3PPJA 3Q5IA 4JDKA 4MCVA 3AXWA 3QCXA 4K8AA 4KS7A 1YRPA 4RIOA 1U4DA 5CASA 2XM8A 4PP9A 3AT2A 5B7VA 5LMKC 3BZ3A 1W0XC 1G5SA 2X4FA 4JIKA 3EQPA 4PTGA 2HXQA 2RFEA 4ASEA 1OKYA 2A19B 3GCPA 1QPEA 4I0RA 4XG8A 3VS5A 4C37A 5FQDC 3UYSA 3EQIA 4FK6A 3MFSA 1OIQA 3BPRA 3PWDA 3Q4UA 3FLYA 4GSBA 4Z9LA 5EM7A 4DH7A 4CYIA 2B0QA 2VTTA 3SVVA 5ANJA 3OOGA 3EOCA 3V6SA 5LVMA 2E9NA 5IH5A 3UQFA 3Q9YA 4HW7A 4PF4A 3V04A 4BYIA 4GEOA 2PU8A 3I6UA 2Y8OA 2H8HA 2X0GA 5IISA 2ETRA 5HNGA 2QOCA 5KBQA 3ERKA 3VS4A 3I0QA 3MPMA 4KRDA 4M14A 1FMOE 4V05A 5JFWA 4QMXA 3E92A 4S32A 4I5CA 4P7EA 3FI3A 3RK9A 2XB7A 2OIQA 3AC1A 4RWJA 2NO3A 5FXQA 2QHMA 4J98A 1JAMA 3I5NA 2QO2A 4MVFA 5DG5A 3Q32A 3BV2A 4F7SA 5KUPA 2F7ZE 3I6WA 1P5EA 4G6NA 3RWQA 4IM2A 5EOBA 4FKRA 3ZOSA 1L3RE 5JGBA 3WE8A 4RVLA 3GU5A 3FY0A 3ZH8A 5KZIA 2VTLA 4FIGA 2OH4A 5AMNA 5AJQA 5JFVA 3RCDA 3K5UA 3MV5A 3C4FA 3QUEA 5AV1A 5TO8A 1Y8YA 3MN3A 4FL2A 3E8EA 4QYEA 2BVAA 4RIYA 3UDBA 4AGWA 4BICA 4E8AA 3CKWA 3E3BX 1XBCA 3NWWA 4RZWA 3D2IA 4HPUE 3WYXA 1Y57A 4H05A 3PE1A 5HEZA 2C6IA 3UOLA 2I6LA 3KN5A 2FYSA 3REPA 3MYGA 4QMWA 5GIOE 3OTVA 4RIXA 2JBPA 3GVUA 2QLUA 3VBTA 1YHVA 4HCUA 1PMUA 2C6MA 3OF0A 1E1VA 2JKMA 3S00A 3DBFA 3TL8A 2EUFB 1U59A 2IPXA 1NY3A 3VUKA 1OKVA 3NIEA 4O6EA 3VJOA 2CGUA 3UJGA 3VRZA 4OTQA 4DE4A 5TT7A 2XIXA 2I0YA 4O2ZA 5CZHA 3HA6A 4YJQA 4USFA 3P23A 5AR7A 4WG3A 3H9FA 2HZNA 2PVLA 4MBJA 1IASA 2J90A 2WEIA 2X8EA 3QQUA 4CKJA 4QP4A 3G5DA 3KXGA 4BDBA 2WNTA 4I5MA 2WQMA 4MXYA 4EH7A 5IUHA 4B0GA 3ATTA 4I4FA 3ACJA 1JKKA 2XVDA 2VD5A 4MD8E 4AN2A 4FSYA 4DG3E 5GIPE 3GENA 4GMYA 2H9VA 3OTUA 4HVGA 3DPKA 3UQGA 4J8NA 3ZEWA 4L00A 3PSBA 3LZBA 2Z60A 4HNFA 4UB7A 2YISA 2W1IA 4U7ZA 3U51A 5IG1A 5EYCA 4EKLA 1AD5A 3ZFMA 4S30A 5AIKA 1H1WA 5H2UA 4FGRA 5FXRA 3AG9A 2YCSA 4P5QA 4R3PA 3QZIA 3OXIA 4FTKA 3PP0A 3LXLA 3MH3A 3IGOA 3UG1A 4IANA 4RX7A 3SXSA 5KMIA 3KQ7A 3THBA 2R3FA 2VTMA 3QTRA 4DEAA 2BRNA 5JMSA 3G6HA 5EI2A 2ZV9A 3R8UA 3PVBA 2G01A 4ZAUA 5KHWA 5M4CA 3FLSA 3SG9A 1P14A 4UWCA 4QTCA 3TNPC 4DFXE 5B0XA 4DTKA 4N57A
chains in the Genus database with same CATH superfamily
1I09A 4E6CA 3EQCA 2YWPA 4FTAA 3WF5A 4FOCA 3ZO4A 4UMPA 3R1NA 1FQ1B 3W32A 5LVNA 1XH6A 3Q4TA 4O27B 4RX8A 1Q41A 5FDXA 5CENA 4O7VA 4D55A 4TWPA 3BLRA 4J8MA 3VIDA 1ZMVA 5E8YA 3GCVA 2QKRA 3UNKA 3CQWA 4TYGA 2IF8A 2PUUA 1RDQE 4EZ5A 4OTGA 5AM6A 2WTIA 3PJ8A 4IB3A 1CKPA 3CC6A 4Z7GA 4YO4A 4C4IA 4IVCA 4GK3A 2OO8X 4CRSA 4GU6A 2B52A 5L2TA 3VS6A 3ZU7A 3W0QA 4W4YA 3R8VA 5J9LA 4D4YA 2X4ZA 3HP2A 1Q61A 3Q4ZA 5LMKA 2CKQA 4HGTA 3VJNA 5AUVA 4O0YA 1YOJA 4G2FA 5H3QA 3EZRA 5CEQA 5E8UA 5CX9A 5LCJA 4JX7A 2IW8A 1NXKA 4UXLA 3QTZA 3HMIA 4IXPA 4CZYB 4GRBA 2YAAA 4O0XA 4OTIA 2YFXA 5DR6A 3AD4A 3WIKA 5AX9A 3CPBA 4O4EA 3AT4A 5IEXA 3G0FA 2BCJA 2YM6A 1UU3A 3DGKA 3D5XA 4BWKA 5FEQA 3LAUA 3PVUA 3ZDIA 3EFKA 3WE4A 4Q2AA 1YHWA 3FHRA 4CFUA 3HUBA 3R21A 2CKOA 4M13A 2XBJA 1OVEA 5AX3A 3SX9A 4WNPA 5BVEA 3QQHA 4QP3A 1ZXEA 2V0DA 5H8EA 2OJJA 4TL0A 3QZHA 4CMOA 5BVDA 3PSCA 2C5NA 5JT2A 4CCUA 1JPAA 5IA5A 2KULA 3RINA 2BZHB 2XBAA 4I5HA 2NPQA 3NNUA 3RAHA 4RJ5A 4CEGA 2O3PA 3UOJA 5I9WA 4DHJA 4IAFA 2XYNA 5CQWA 4KIOA 4BKYA 3FZOA 1W83A 1E9HA 1K2PA 4TPTA 4C7TA 1OECA 3E7OA 2VWIA 2QI8A 2WQOA 4K18A 4TYEA 5IH4A 4O0TA 4IAZA 1QPCA 3WZUA 2J2IB 4JS8A 3QD0A 1YXSA 2HIWA 4KA3A 4MBIA 3UG2A 4DCEA 5A14A 5F94A 1XQZA 3UODA 3QD4A 5CU3A 4YZDA 2PVYA 1H01A 4FTMA 4FV5A 2ITWA 4XCUA 3V3VA 1ZZ2A 5CVFA 2PVJA 3QBNA 2P0CA 3QQGA 3VUHA 4GS6A 4UBAA 5CSXA 3FL5A 4X3FC 3VRYA 3EFWA 3ODYX 1NVRA 4FTQA 4CT1A 1ZY4A 4J96A 5IA2A 5JK3A 5EQYA 4M66A 3EQDA 5CU0A 4LDTA 5EHYA 4HVIA 1OITA 3HX4A 2GS2A 2UZUE 3PTGA 4IWOA 1M7QA 2QU5A 4DGGA 3LXPA 1KE5A 4G5JA 2QNJA 4AQCA 1JVPP 4XBUA 4AS0A 1OL5A 4TN6A 4FVQA 2X6EA 3JS2A 1YDRE 4LV8A 4D2WA 2PE1A 3R01A 3LQ5A 2AC5A 4RC2A 4XNEA 3GU7A 2BUJA 2OZOA 2ERKA 4BWXA 3ORIA 4JG6A 4BF2A 4TT7A 2JD5A 3ZHPC 3DB6A 2DYLA 2PULA 2R7BA 4C4FA 4GYGA 1VYWA 2X2KA 5IF1A 5C26A 4WHZA 5DH3A 1H8FA 3UIBA 5JKGA 2UW0A 5A3XA 4YHFA 1E1XA 4M84A 4YC6A 1GZNA 4ERKA 5ETAA 1CKIA 4YJTA 3U87A 4YC3A 2RG5A 5H8BA 4HYHA 3TV7A 5BYLA 4JQ7A 3P5KA 3DAKA 1TQIA 4W8DA 4D0XA 5GZ8A 1BLXA 2IG7A 4L6QA 3ORTA 4RFMA 5HIEA 2UW5A 5CXHA 4BDJA 4D1XA 2YAKA 4AP7A 1K9AA 2RFDA 3ZZWA 4F1TA 2O65A 4ZTQA 1U5RA 4O1PA 3KRXA 1U5QA 2JBOA 3AGMA 4AT3A 3D0EA 4QMZA 2HOGA 2QURA 2WIPA 4Y46A 2QQ7A 3ORZA 4R7HA 2ITOA 5C27A 3B8QA 4FZAB 4LRKA 4RJ3A 3ZLWA 1UKIA 2VO3A 5M53A 2IWIA 3FZTA 3QYZA 4K0YA 4FTNA 4NZWB 4X0MA 4A9UA 2UZVA 4QTEA 4K2RA 5C8MA 5HE1A 4R3RA 1UNHA 4CCBA 2FSTX 2HK5A 4FTTA 4KIPA 5JZNA 1SNUA 5IZFA 2WTDA 2HCKA 1WBVA 5K5NA 5IA4A 5KMJA 5CI6A 3A61A 5HIBA 4O7TA 3G51A 3VS7A 3D83A 4XP0A 5D12A 2GHMA 2JKKA 3POZA 5BX0A 4FKJA 4OT6A 3EN6A 3O8PA 4QOXA 3TIZA 3QTUA 4QP2A 4XV3A 2R3KA 5DPVA 3HKOA 3TMOA 4F4PA 4XG3A 2J0JA 3LFFA 5EQPA 3I7BA 1SNXA 4TNBA 4EHGA 2I1MA 3F5PA 1FVVA 5KKRC 2J6MA 4UMTA 4EOMA 5J79A 4RA4A 2HW6A 4FTOA 4FV9A 2ZB1A 3A7IA 1PXJA 4Y5HA 3JPVA 3LE6A 2QO7A 4MD7E 2VTJA 3RGFA 4U80A 5CAOA 3QX4A 5FM3A 3TT0A 3UC3A 2CGWA 3TNIA 4LGGA 4FE2A 5AR2A 4O82A 2RFSA 4RC4A 2FA2A 2VNWA 2J9MA 4IB5A 5C9CA 3FY2A 3OW3A 4NW6A 3VULA 1IEPA 3S3IA 3V5QA 4CFMA 4NFMA 4J71A 3FLZA 4H3QA 5EK7A 5HX6A 3N4VA 4O2PA 4FMQA 5L6WL 4WIHA 3NGAA 4FICA 5M56A 2ITXA 1B39A 1ATPE 2ITQA 2ZMCA 4QQJA 4ZTRA 4II5A 5FD2A 3KGAA 3P08A 1CTPE 3D5UA 3QD2B 4FV1A 2B4SB 4RWIA 3GU6A 4AXAA 3LM0A 3ETAA 5CVHA 4AXDA 3KEXA 4X3FB 1QPDA 4O7RA 3HYHA 4N6YA 1JBPE 4XG6A 5CU4A 1Q8WA 2YIWA 4FODA 5AM7A 3GQIA 4U6RA 3CCNA 5ANDA 4EK8A 2JKOA 3QTXA 2ZJWA 4JDHA 2XCHA 4JIAA 3S95A 1YI6A 4CFVA 4KBAA 4AACA 3U54A 3RWPA 3PPZA 3W8QA 2QLQA 4R5YA 4RJ4A 2XCKA 4QMSA 4XV2A 4DN5A 5A9UA 1DI9A 3U9NA 2I0EA 3VC4A 4XBRA 2Z8CA 3KCFA 2ZB0A 3H9OA 1OIYA 4NWMA 3DA6A 3FLNC 4NSTA 3RK7A 2GFSA 2C0OA 4FTJA 3QRIA 3ACKA 2CMWA 4FKIA 4HGEA 3E63A 4I21A 4RQVA 4FBXA 1ZMWA 2UZLA 3BYVA 3ZCLA 4C2VA 4EZ7A 5AP3A 1ST4A 3LCTA 3N4UA 4UXQA 3VO3A 2RFNA 2PMNX 3OMVA 4DH3A 2OICA 3DBEA 3LJ1A 2XZSA 4RFZA 4ZTSA 3QLGA 4BL1A 3OBGA 3SRVB 4W9WA 4QYFA 2PVNA 4FGBA 4OGRA 4QDEA 3L9PA 3WBLA 4ZSGA 2G2IA 3DBQA 1WBTA 1JLUE 3MBLA 4U5JA 4DEDA 4PP7A 4ACCA 2WMAA 4OTRA 4D5HA 1X8BA 3R1QA 5TKDA 4FEUA 3DKFA 1GNGA 3COHA 2PWLA 2WTKC 4F6SA 2X6DA 3DLZA 4G3FA 5CAVA 1DS5A 1XHAA 2OXDA 2OJFE 5AP1A 3FHIA 3ZBFA 3LFAA 1SVEA 4BCOA 4FKPA 3KVWA 3AQVA 3QZFA 4GUBA 4YGAA 5BVNA 2QCSA 5HLWA 2BMCA 4DGLC 4FK3A 2XKCA 3HZTA 4E4XA 5JZJA 2WMWA 2R0UA 3E62A 4O1OA 1H4LA 4NTTA 3GOKA 1Y6AA 5AR4A 4BI1A 2J51A 4S31A 1F0QA 4ENXA 3F6XA 3KULB 4F0IA 2DUVA 3EZVA 3RPYA 4GFGA 4AXFA 3VBVA 4MXAA 5B2KA 1TFFA 4DFBA 3KK8A 3LFEA 5CVGA 4RVKA 3OT3A 4I24A 4DLIA 4UMUA 3O8UA 2Z2WA 3BHYA 2EXCX 2XEYA 2WMXA 4TY1A 4WSQA 2YLFA 1OZ1A 5E1EA 2REIA 1PXMA 3MVLA 3SRVA 2F49A 3QQKA 3FI2A 5IH6A 3DXNA 5DIAA 3F2RA 4CD0A 5AUXA 4IX6A 3O0GA 5LCKA 3QL8A 4RMZA 3KVXA 1XH7A 3DXPA 4CMTA 3MA3A 3R04A 5JQ8A 3EN7A 3QA0A 5D1JA 4ZTLA 3VNTA 4ZTMA 4KBCA 5HCZA 4H36A 4IH8A 5KKRB 1O6KA 5HX8A 3D7TB 3QF9A 4FSZA 4X2FA 1MP8A 2OF4A 1GIHA 4LOOA 4FIHA 4JRNA 3PLAE 1KE6A 2CSNA 3TDWA 2OLCA 3EFLA 4G31A 1PXNA 2XH5A 4I6QA 3KY2A 5HHWA 4W4XA 4FZ6A 2IW9A 3ZXZA 3HAVA 4V04A 4RRVA 1OI9A 3IDBA 4JRVA 4G1WA 3D2KA 2JKQA 3EIDA 3HRCA 3WZJA 3KULA 2BKKA 2OXYA 3PXQA 3V8SA 4EBVA 2BALA 2WMBA 4FV0A 4APCA 3M1SA 2ZYBA 1PXOA 3HVCA 4BTKA 1JQHA 4CMUA 3FKNA 4L44A 2GNJA 4V0GA 3W55A 1M2QA 4TYIA 3L8SA 5JGDA 4DFYA 3BCEA 5IA3A 4M0ZA 2XRUA 4D2TA 4LGDA 4QQTA 3S2PA 4RIWA 2QODA 5EYDA 3IQ7A 4TTHB 2ITVA 3M11A 4RJ7A 4MXXA 2BHEA 2IEWA 4GIIA 4K33A 3TKIA 2PZRA 2Y0AA 5HQ0A 2Y4IC 2BTRA 2VTQA 5A4QA 2OIBA 4D4RA 5BNJA 3AD6A 5FXSA 4HPTE 2PZ5A 3E8CA 4KKHA 3A7FA 3HUCA 1QPJA 4UEUA 3KREA 2QHNA 2XJ1A 3UNZA 3ITZA 2E9UA 3BELA 3R2YA 3EQHA 5C1QB 3DDQA 3DFAA 2I40A 5KCVA 1KV2A 3RM6A 3D7ZA 4AN3A 3Q52A 5C4KA 2Q0NA 3MWUA 5DI1A 5CF6A 4E6QA 3F2AA 4NL0A 4FNXA 4W8EA 1OL2A 4IZ5A 4KBKA 3W18A 3ZSHA 1M2RA 3C5UA 1R0PA 2QOKA 3F3TA 2CPKE 2RKUA 3LCOA 5GNKA 3RZBA 1PXIA 2IW6A 2FSLX 1YXVA 4X7QA 4G16A 3PSDA 4RLLA 4IFCA 4F09A 2XA4A 4Y85A 5ICPA 2WTKB 3BBTB 4OTFA 2A2AA 3S0OA 3BBWA 3ZUTA 4EI4A 2C3JA 5A4TA 1JSUA 4OAVB 3I7CA 2UZBA 4XG2A 1P4FA 3OUNB 3IG7A 2XNEA 4EUTA 3PY1A 3FMJA 3OROA 4JBPA 3ORKA 3QQFA 3CTQA 2HY81 2Y7JA 3OFMA 5L2IA 3MDYA 4TYJA 2ETKA 2H34A 3SKCA 4P4CA 3EN9A 3OCTA 2UZNA 2QR7A 5IA0A 1J91A 3GC7A 2QONA 4QP7A 3UIMA 2BZIB 5HG7A 3F69A 4EOLA 4TWCA 3D4QA 3BIZA 3PA4A 3QCQA 4U42A 4F78A 4IAYA 2V62A 3PIZA 2PE2A 2OWBA 3QKLA 2IVUA 1GZOA 2W17A 1NVSA 1PXPA 3PZEA 2J5FA 4FKVA 3ULZA 3EKNA 5HD4A 2ITTA 4MWHA 5LVLA 3QAME 5BVWA 3G90X 3ATSA 1SVHA 2R3PA 3G15A 3C0IA 2C6KA 3BHHA 3D5VA 4ANMA 4M97A 2WTCA 4C4EA 3ZFXA 5CU6A 3MA6A 2QD9A 4ANNA 3CY3A 5CEMA 4LYNA 2BFYA 4YUQA 1PKDA 3AMYA 3SDJA 4APPA 4L8MA 2VO0A 1XR1A 3H0YA 3KRLA 4FIIA 5ACBC 2C5OA 2YDKA 4PMMA 5TR6A 3U9CA 4ACGA 1URCA 3JY0A 2J7TA 3EN4A 2GS7A 3FV8A 4Y72A 4O7YA 4BDEA 3PVGA 4X21A 4E26A 4PDYA 1XMMA 4AU8A 5IQIA 4YPDA 5HG5A 3SW4A 4CYJA 3GQLA 5D9HA 4DEBA 1PMNA 4PL4A 5A6NA 1FINA 4FSMA 4KKGA 3CTHA 3NSZA 4GYIA 5C8NA 4QMMA 5EHLA 4C0TA 3ZONA 5HCXA 3F82A 3ZO1A 2BAQA 5EW9A 3VF9A 3PE2A 4B7TA 1OIRA 2JDTA 3A8XA 4PMSA 3R9OA 2C5YA 3PPKA 4EOSA 3HGKA 1DI8A 5E9EA 3R9RA 3OW4A 1H0WA 1SVGA 3OEFX 4LMUA 4C34A 4HCVA 5I9VA 5KBRA 2W9FB 3DDPA 4YC8A 4NYEA 3S4QA 4EUUA 3KB7A 3L8VA 3NS9A 1XKKA 1VZOA 2Y4IB 3R00A 4J52A 5F20A 3TN8A 4A7CA 5E92A 5DHJA 1W8CA 4KSQA 1YOMA 1GAGA 2ACXA 4F64A 4EQCA 2WOTA 4DH8A 3W2SA 4ZJVA 4AW1A 4C3RA 4R3CA 5M08A 4EH4A 2OZAA 2VGPA 4KABA 4IB0A 2QOFA 2G2HA 3PXFA 4S34A 2X7FA 3P0MA 4IW0A 4RIYB 5C8KA 3BLQA 4LRMA 4IWDA 2BHHA 4CG8A 5FTOA 3I0OA 3W1FA 3PWYA 4H1MA 3LMIA 2C6OA 3CTJA 5FTGA 2J4ZA 4RIXB 2QG7A 2X8DA 1JOWB 4AW0A 4M69A 5L4QA 4NKAA 3UNJA 1OPLA 2C3IB 3VONA 2CKEA 3MS9A 4O38A 4WRGA 2JDVA 1V0OA 3BHTA 2GTNA 1YVJA 4KSPA 3ENMA 4U3YA 4FEQA 2BAJA 1DAWA 3W2OA 1H08A 2X9EA 4G9CA 3MIAA 3C4XA 5FBNC 3KK9A 5HE3A 4PDSA 2JDRA 5EKOA 4FTIA 3ZM4A 5AP7A 5AUTA 1OGYA 4PPBA 3VBWA 2YJSA 4XMOA 3ZDUA 3NUSA 2Q83A 3FXXA 2B9HA 4JQ8A 3R7OA 2HY0A 3ZO3A 3DK3A 5CSWA 1M17A 5HLNA 3BKBA 3IONA 5CU2A 5IMXA 5ANIA 3PA5A 4ACDA 4DINA 4MEDA 3JVSA 4U8ZA 1H07A 2YN8A 2DS1A 3GC9A 4BI2A 2CDZA 4JL9A 3CJFA 4H3PA 1UKHA 4FT5A 4ASZA 2G2FA 2WOUA 2YM5A 4MQ2A 3ROYA 1GIIA 3DKCA 4U40A 5DT3A 2OJGA 3G2FA 3BYMA 4OTWA 2A4LA 4I20A 3U4UA 2JEDA 3DZOA 3OS3A 4ZLZA 2F4JA 1V0PA 4ALWA 3E88A 3OCGA 3QQLA 3PY0A 4LUEA 2Z7QA 4FNZA 2V7AA 1UU8A 2B7AA 4EHZA 2BRGA 3RAKA 2YZLA 3R71A 2CCIA 4EEVA 1ERKA 2PUPA 3P7BA 3QD3A 3K54A 2OJIA 5KHXA 4WO5A 3AC2A 1YQJA 4A4XA 4BHZA 4D9UA 3UVPA 5I9YA 4FJVA 5JSMA 2NRUA 4FNWA 3R7VA 1VJYA 1BL6A 2GQRA 5FWKK 3PRIA 3Q60A 4J53A 3ALOA 3UVQA 5ANKA 5CF4A 3ORPA 5CEIA 3Q04A 4PPCA 1H0VA 4IB1A 5L2QA 3FXZA 4UZDA 4NK9A 4K1BA 4MK0A 2UV2A 2YJRA 4RGJA 4RWKA 4IHPA 3LLAA 2C1BA 4BDAA 3R9DA 4D9TA 5M4UA 2IN6A 2PVRA 2XYUA 4D58A 3BHUA 3KMWA 4QRCA 2C30A 3UP7A 3NUUA 2X39A 5J5SA 3P9JA 4WT6A 1VLRA 2GHLA 4HZSA 4AT5A 3D15A 4KD1A 3R8ZA 2PVHA 5AV3A 3CSVA 5IPJA 1BUHA 2PZIA 4CVAA 5CAPA 5J95A 4LM5A 1KOBA 2JFLA 4YBJA 3F3WA 3H0ZA 3QCSA 4BYJA 3GNIB 4UALA 1NW1A 3PVWA 2PVMA 3UDSA 4DEGA 4JVGA 3UO6A 4PTEA 2XNNA 3Q9WA 4U9AA 4UZHA 2VAGA 2NRYA 2XIZA 3OHTA 3HEGA 5D7VA 3BGQA 4C8BA 4F9YA 2V55A 5BMSA 2B54A 4QNAA 5LVPA 4D2VA 3CXWA 4U81A 3IW4A 3VF8A 3R8MA 2R3NA 4G17A 1WBSA 4PDOA 1GIJA 1M2PA 1FVTA 1ZYCA 2DWBA 3ZUUA 4ALVA 4XS2A 3NYNA 3ZS5A 3HECA 5BUIA 2GNGA 3OBJA 4DTAA 5FRIA 4ZJIA 2C6TA 4FSQA 5E8XA 5AA8A 4B8LA 4OLIA 1Y8GA 3O5AA 2RG6A 2C4GA 5L2WA 1M14A 2F7EE 3NNWA 2C5VA 2V5QA 3FMMA 3OC1A 1JKTA 5HOAA 4ZMEA 4AOIA 4FKOA 5EDPA 2F2UA 4DT8A 1FPUA 4FC0A 5I9XA 5LMBA 1TVOA 4MTAA 4QP1A 1IA9A 1H26A 2JIUA 4FA2A 4R1YA 2ZV8A 3D14A 4XV1A 3Q9XA 3ULIA 4DHIB 3VUDA 3DCVA 3UQCA 4FI1A 5HESA 4XUFA 3HAMA 3PXZA 4HZRA 1RQQA 4D2PA 4U41A 3OCBA 4WKQA 5DVRA 3I60A 4AA0A 4L46A 3TACA 2WMQA 4A4LA 1G8SA 2C6EA 3L8PA 5ETCA 4CRLA 3NFFB 3C4CA 4UY9A 5T68A 3SLSA 4LMNA 4MUQA 5IQDA 5KX8A 4DEIA 4JJRA 4ZK5A 1UWHA 3OZ6A 4GU9A 4ZTNA 4ZY6A 2BRMA 2BDJA 3HL7A 4I6FA 2GNIA 4RLKA 4EYJA 4YURA 5LQFA 1Q4LA 4R7IA 4KS8A 4H1JA 4GJ3A 2YACA 4ANSA 4F65A 4MF1A 2PVFA 4AA5A 5IU2A 3MESA 4B99A 2BTSA 5C4LA 4YP8A 4ITHA 1NA7A 4RBLA 5DR9A 5M06A 2R2PA 5DE2A 4PQNA 2XM9A 2W99B 4JI9A 4CLIA 5HNBA 3MTLA 2UZWE 5A6OA 4GT4A 4O7ZA 5ANOA 2OXXA 4RT7A 4E4MA 4ANLA 5L6PA 3H10A 5CY3A 2WO6A 2XMYA 4FKGA 4DYMA 5BVFA 3FMLA 3RPOA 5TE0A 3OP5A 4JOAA 4R5SA 4RVTA 4R78A 3GXLA 2IO6A 3DU8A 1Y6BA 3ZFYA 2YM8A 3O8TA 3UOKA 4F7NA 4OTPA 1OPJA 3Q9ZA 3IW7A 1OGUA 2CGXA 2X81A 3R2BA 4DF3A 1OIUA 4DGOA 4HVDA 3RZFA 1WBOA 4TWNA 2BZKB 4TW9A 4WRSA 2WFYA 1BI8A 3W0RA 4GK2A 2GQGA 4ZXTA 5FBOA 3PLSA 4AAAA 4BCNA 3K3JA 5JN2A 3U55A 4Y83A 4FG9A 3VS2A 2X2MA 4L52A 2XIYA 3DXQA 2J0IA 1G8AA 1DAYA 2B55A 2CNVA 3VS3A 3K5VA 5I5ZA 3ROCA 4XG9A 3LCDA 2YM3A 2Y9QA 2XJ0A 2VO7A 4AGCA 3VUGA 4YTIA 5DYJA 3RTPA 3ODZX 4OBQA 3HMPA 4MAOA 4P90A 4BIBA 4QMNA 3UOHA 3AKKA 3EQFA 3F88A 5GJFA 4E6DA 1GZKA 1F5QA 4WD5A 4Q5EA 5DA3A 1UU9A 4TKSA 3PY3A 3TKUA 4BFMA 5GZAA 4X3JA 3CPCA 2RIOA 4PRJA 3FMNA 2XNBA 2OKRA 5AR8A 4EHVA 4I6LA 5JQ5A 3RM7A 4F9CA 2BIYA 2VTPA 3PG3A 3RCJA 4D5KA 5AP0A 3F7WA 3EJ1A 4ZMFA 4CG9A 3WF7A 4S2ZA 4ZSLA 3A8WA 3ORMA 2W5BA 2XK4A 3NYVA 2WD1A 4O7LA 4X2NA 4YJSA 3R6XA 3PJ1A 4MNEA 2PY3A 4MXCA 2H6DA 4R6VA 4ZOGA 5F95A 5AWMA 4ZEGA 5L8JA 2J0MB 2J0KA 3TWJA 3O7LB 3IW6A 4EOKA 4IZAA 3NEWA 2YLEA 2UW3A 3SXRA 2RGPA 3R7YA 5AP2A 2YZAA 4WA9A 3PJCA 3ZLSA 5DWRA 5EDQA 5KNJA 4O4DA 4EQMA 4GW8A 5E8SA 2WXVA 5M07A 4BTFA 5E8ZA 4ENYA 3VUMA 1WVWA 2I7QA 2X9FA 4R77A 5JRSA 2IJMA 4FV8A 5L8LA 3V8TA 1PKGA 4G3GA 4M3QA 2XNMA 5J5TA 3IS5A 4LV5A 2ERZE 2R5TA 3HDNA 3VW6A 3F5UA 5IA1A 3NVKI 3CJGA 4WBOA 3NUYA 4L45A 3NW7A 1YI4A 3QTWA 5CALA 3BWFA 2BIKB 5D11A 5TOZA 2WPAA 5CSHA 4F1OA 1MRYA 2WELA 1R39A 3M2WA 5I3OA 4F9BA 1SYKA 3ZXTA 3HDMA 2A1AB 3NMUF 4MX9A 3O50A 1ZOEA 2WTJA 3HV3A 4GCJA 4ANQA 3P4KA 5LWNA 4ASXA 3F5XA 3GC0A 4G9RA 5B2LA 4PNIA 2VTAA 1G8KA 3R7EA 4GT5A 4OUCA 5FM2A 3FJQE 5T3QA 3PFYA 2XS0A 3NRMA 3O96A 4FX3A 4JG7A 3V51A 4BWPA 3W8LA 3QZGA 4IDVA 3TTIA 3OG7A 3BEGA 3MGYA 3LFQA 1UU7A 2P2HA 3CY2A 3DBDA 3KXXA 3O23A 3HV7A 3KMUA 3OWJA 4FVPA 1W7HA 2F7XE 4YJNA 3PDTA 3G6GA 1LP4A 2VO6A 4QYHA 4EZ3A 4ITJA 2PVKA 3MH0A 3V5WA 1OMWA 1Q8UA 5KMLA 1Q62A 4RVMA 4YSJA 5EHOA 1WBWA 1T45A 2XUUA 1OBGA 1WBNA 3BV3A 5E90A 1J7UA 4BCHA 1LR4A 4JBOA 5EM8A 3C9WA 3NCGA 4DDGA 2WMUA 4XG4A 1DM2A 3UDTA 5EM6A 3LMHA 3HA8A 5BVOA 4JR3A 3EL8A 3G0EA 1W2FA 3RPRA 4FTLA 2QU6A 3C5IA 4K6ZA 3NZ0A 4FL3A 2XIRA 3MI9A 2HZ4A 2EU9A 4O6LA 3C51A 4E4LA 4MF0A 3CS9A 2ONLC 4AZTA 3FPQA 5C03A 4MH7A 4AZWA 5J1WA 3KXZA 3ZRLA 4BVUA 1PRYA 3WF9A 3R8PA 4YR8A 1IAHA 2HAKA 3HV6A 3R1SA 2Z7LA 4DH5A 3BI6A 5AAEA 4AW2A 1W82A 3P79A 5EM5A 5A46A 3CQEA 4PL3A 3ZUVA 4BDFA 3DTCA 5DRBA 5AP4A 2UVYA 2WMSA 1FMKA 1PHKA 2EB2A 4OT5A 3T9TA 4CTBA 3R7GA 2JC6A 4EBWA 4CFFA 3P78A 3UP2A 5CNOA 3EHAA 3MW1A 4F9AA 3DAJA 1W2CA 2W0JA 3TUDA 2VWXA 3DK6A 3DY7A 1ZY5A 2QOHA 3LFSA 3A7JA 4YPSA 3QWKA 4BIDA 3C4EA 4J97A 5LXMA 1XBBA 3T9IA 4O4BB 4OBOA 2UZDA 2W96B 5GJDA 1YWRA 1P2AA 3V5LA 4MYGA 4RZVA 3UZPA 1WMKA 3BE2A 3F61A 4IWPA 3TNHA 4E3CA 1R0EA 4AOJA 4F6WA 4FKSA 3JR1A 2ZMDA 3HMNA 4KAOA 4B6LA 2KTYA 2PMOX 3TUBA 4YJVA 3BL9A 4A9SA 4DEEA 1OL7A 4BCQA 1MUOA 4JNWA 4XLVA 4NCTC 1Q97A 3A2CA 3CLYA 4WOVA 3PIXA 2UZEA 5EI6A 1F3MC 2XKDA 4FZ7A 4O86A 2PYWA 3QTSA 5TF9A 4L7FA 3C7QA 1R78A 5DEWA 5CEOA 5I9ZA 3IDCA 5H8GA 3B8RA 3DFCB 3NUNA 4W4WA 3LFDA 1UA2A 3LXNA 5DOSA 3NYXA 4E73A 2IZTA 1OBDA 3FMKA 4Q9ZA 4FSUA 4FSWA 2GPHA 4J99A 4D2SA 2R3JA 5ACKA 1XH8A 4YJPA 1WCCA 3F5GA 4H39A 4HOKA 3CIKA 4C02A 2CN8A 4DCAA 1ZARA 3GC8A 4QP8A 3FDNA 4A9RA 2J0LA 4JBVA 4QMLA 3CGFA 2R3GA 2LAVA 4JG8A 4ZZOA 3DB8A 1R1WA 3JUHA 2PK9A 4YU2A 4WSYA 4ASDA 3PXKA 4BDCA 4IAKA 4V0GB 2JFMA 2JIVA 4R7BA 3Q6UA 4GFOA 4MHAA 4XHKB 3RNYA 3ZC6A 3NAYA 4RIWB 3GU8A 3PA3A 4C4GA 4DHZA 3L9NA 4ZP5A 2HW7A 3JY9A 2ESMA 4IVBA 3A4OX 2DQ7X 5DR2A 5AUZA 5JH6A 2QKWB 5FP5A 2FH9A 4FNYA 4MBLA 2IZRA 2JIIA 3TIYA 2WB8A 3DZQA 4QMPA 5IKWA 3TV6A 3NIZA 2X7GA 3QYWA 3WZEA 1STCE 2Y6OA 2ZV7A 1WBPA 3FYJX 2R7IA 3GBZA 4PX6A 3DBCA 5AV4A 2AUHA 5K5XA 4NH1A 2JAVA 4JXFA 1NVQA 4PDPA