3DBEA

Crystal structure of an activated (thr->asp) polo-like kinase 1 (plk1) catalytic domain in complex with compound 557
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
287
structure length
284
Chain Sequence
b'KEIPDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVFAGKVVPKSMLLKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMRQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIEFDGERKKDLPNYIAPEVLCKKGHSFEVDIWSLGCILYTLLVGKPPFETSCLKETYIRIKKNEYSVPRHINPVASALIRRMLHADPTLRPSVAELLTDEFFTSGYAPMRLPTSCLTVPPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polo-like kinase 1
publication title Design and synthesis of 2-amino-pyrazolopyridines as Polo-like kinase 1 inhibitors.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase
total genus 73
structure length 284
sequence length 287
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2008-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dbeA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dbeA01
3LM5A 4C4FA 4ZK5A 3EMGA 3P79A 4G3FA 4JLCA 4XG7A 5FTQA 5HLWA 4IE9A 2C0IA 1HOWA 2WQBA 2ZM4A 3NGAA 2W99B 4F9AA 5J9ZA 4C2VA 4IC8A 2QI8A 4ANNA 4E73A 3VHEA 2P0CA 2YDIA 1OITA 1OPJA 3F2NA 4QPMA 3R21A 4UWCA 1WVWA 3TN8A 4PL3A 1EH4A 2HXQA 4X2JA 5AA9A 1GIJA 5JEBA 2A27A 1HCKA 3PA5A 3CTJA 4P5QA 3TTIA 4LOOA 4W4YA 3G51A 3QC9A 4BGHA 4DEGA 5A4CA 4KINA 2R7BA 2B4SB 1Q3WA 4IEBA 4ANMA 5FGKA 3AT4A 3CJFA 3EFJA 4YGAA 3W2RA 3ZLSA 4GKIA 2CN8A 5CU2A 2BZIB 2VWUA 4II5A 5I9WA 2PK9A 1MQBA 3Q9YA 4F1TA 3VF9A 3QF9A 3ODZX 3HGKA 3IW6A 2X9EA 3LCKA 3PIXA 3RVGA 4EOOA 3R2BA 3LOKA 3MY1A 3VJNA 4UX9A 1Q8TA 4FV6A 2BVAA 1ZAOA 4YC8A 4FE2A 3QKMA 5HTIA 4MH7A 5IQAA 4YZBA 3PG1A 2BZJA 2P33A 3KXNA 1Q8UA 2NO3A 1PYEA 2R3PA 3SD0A 4AN9A 4R3RA 4JNWA 3IOKA 4OTDA 2R3GA 4PPCA 2GCDA 3WF8A 4EKLA 5GINE 3LJ1A 4FV9A 4C3RA 2JKMA 3BHVA 4JI9A 3VO3A 3D7TA 4EL9A 3Q4CA 2DWBA 4WG4A 5BYZA 3UO6A 5CASA 5CTPA 4A9TA 5EFQA 1Y6BA 5HX8A 2R3KA 4X6RA 5M07A 3P78A 5CSXA 4FOBA 4RIWA 5K3YA 5A4TA 3I4BA 1CKPA 4WOVA 5AX3A 5IA0A 4HCTA 2XP2A 2YABA 3E64A 4TRLA 5AUUA 3F6XA 4ZLZA 4KSQA 4RJ5A 4PV0A 3UJGA 2WMXA 5HE2A 3Q6UA 4D55A 4ACDA 4K1BA 4W8EA 4FKOA 4C4IA 3AC1A 4OT5A 2F2CB 4Z3VA 4HPUE 3O7LB 2C6TA 3MB6A 4FTOA 2PZRA 3FSFA 4K0YA 4LV5A 4YSJA 5M06A 4O2ZA 4AA5A 4HZRA 4PMPA 4NZWB 4HGSA 3U9NA 3UNJA 3FL4A 4CEGA 3VUKA 5J79A 3LMIA 2XS0A 4DH8A 2WOUA 4NCTC 4EOIA 4S2ZA 4CYJA 5K4JA 3H0ZA 4FYNA 3I81A 4YU2A 4QP9A 3I0OA 4L42A 4NJ3A 4WSYA 2QKRA 4YHFA 2WOTA 3R9DA 4IDTA 4IB1A 3RPYA 3K3JA 3SV0A 5CF6A 4PMMA 5L3AA 3UQGA 4OBQA 4AOTA 4BY9E 4CMUA 3S3IA 1NT2A 1MRYA 4NW6A 5BNJA 2I1MA 3GCUA 5CAVA 3FXXA 5F94A 4JIKA 3NAXA 2YIRA 3S4QA 1SVHA 4AT5A 4ZSJA 3WF6A 1NXKA 3UIMA 4X2NA 3CPCA 5EI6A 5L2TA 2C6OA 4HVSA 3PFQA 5DRBA 5DR6A 2X39A 2PVNA 1YOJA 2WD1A 4UBAA 4BBFA 1SVGA 3NR9A 4BIEA 3PPZA 4C2WA 2WMVA 2O65A 2ITNA 2XCKA 3GXLA 4EK4A 2OO8X 4E5BA 4BCOA 3PJCA 5KMJA 5I5ZA 3QCYA 2R3QA 3QZGA 4GW8A 2W1EA 4L01A 5HEZA 2UZOA 2X1NA 3ODYX 3R9NA 5EK7A 4YLKA 4QMTA 1KE8A 3EFKA 1SNUA 3CD8A 4QMUA 4ZZOA 5HO7A 2EXMA 4TZRA 1JSUA 4MVFA 5M53A 3G9NA 4FSWA 1F0QA 4FV1A 3SC1A 3QTQA 2Q0NA 2CKOA 5EW9A 3E92A 4Y73A 4H58A 3JY9A 4EK3A 3BYOA 4RX8A 2QLQA 4GJ3A 5CEIA 3C0GA 4IWQA 4ACHA 5LVPA 1TQIA 2IPXA 1OM1A 3DKGA 2ONLA 3VS1A 4FTLA 2B52A 2UW4A 2X8EA 4Q9SA 3ZLWA 2Z8CA 5L6PA 4FI1A 2B54A 4BWXA 4ITHA 4IVCA 2GDOA 4ZSGA 4RIYA 4DG2E 2BZHB 4G1WA 2J7TA 5CLPA 4JIAA 3W2OA 5F9EA 1ZOEA 4QMZA 2BRMA 4YUQA 2RKUA 3MVLA 5CX9A 1FVTA 4DFNA 4Y5HA 4BDAA 4DA5A 3DLSA 3EQHA 3K3IA 4J95A 3FMEA 4FL3A 2BUJA 2FSTX 4A9RA 4TNDA 4PP9A 5DPVA 3HYHA 4G16A 3UPZA 3MJ2A 3QTRA 3AMYA 3VIDA 5CSWA 4AW5A 5TOZA 3FV8A 2X2LA 1P5EA 3COHA 2HY81 3DJ5A 4HGTA 3QWKA 3QLFA 3SKCA 4DGLC 5FXRA 4RSSA 2BROA 5EM6A 4FG7A 2OIDA 2G9XA 4TXCA 1PXOA 4FV4A 4NEUA 4CLJA 3FEGA 4FKRA 4TNBA 4XX9A 3R8VA 3BYVA 4ALUA 2SRCA 2OBJA 3TKHA 4O7RA 5HNBA 4GIHA 3T9TA 4JQ8A 5EYMA 3ZO1A 5L2IA 4UXQA 3RPOA 4U80A 4IAZA 1BKXA 4AGCA 4C4EA 3TV7A 2BTSA 5DR9A 5B2LA 1J1CA 2YDKA 1YQJA 2C5YA 2I40A 4PNIA 4JG8A 4QYFA 5FBOA 4ALVA 4BGQA 5L8LA 4G5PA 5KMLA 5AUZA 2WTKB 4O0XA 3ROYA 2ZV8A 2HYYA 5AADA 1IR3A 2W5BA 4BL1A 5IDPA 5LVMA 3JS2A 4BI1A 4RGJA 4R7BA 3QLGA 2W4KA 4G3EA 3ZUTA 1TQMA 4B8LA 4Q2AA 4ZS4A 3OWLA 2R3HA 4IC7A 1VEBA 5AEPA 4WRGA 4IWDA 4DN5A 2QO2A 2O64A 4PL4A 3OTVA 2Y9QA 5KCVA 4FNWA 2C30A 4FR4A 4ZZNA 2QG5A 3MFTA 4O7SA 3QD0A 1H26A 1P4OA 1YDTE 3F66A 2KTYA 2ZV9A 3Q53A 3NZ0A 5FEQA 1V0BA 2W4OA 4MNFA 1LUFA 1TKIA 3ID6C 1DS5A 3Q04A 1REKA 2P2IA 3I6UA 2XNPA 3MH0A 1GZNA 1YXTA 4IWPA 4TYHB 4M69B 5D41A 4FSTA 5CXHA 3OT8A 3DK3A 1Q41A 3EL8A 3IPHA 4K9YA 4Y72A 3ZO4A 5AAEA 3QGWA 1Z9XA 4ACGA 2R3NA 4Y95A 3BE9A 3GQIA 5AFVA 3ORTA 4O0WA 1R78A 3UZTA 1YWRA 3RPRA 3KMUA 4FVRA 2PE0A 4G17A 2X9FA 3MFUA 3W10A 3Q9ZA 1KWPA 2VAGA 2QOIA 4O7WA 4QPAA 4E3CA 2XK4A 3W2QA 3FWQA 3LCDA 2UW6A 5T6KA 1XR1A 1PJKA 3FPMA 1DAYA 4KABA 3DBDA 1JVPP 4MEDA 1XH6A 3ELJA 2V62A 4FMQA 4RA5A 3PY0A 3Q4ZA 5F4NA 5I9ZA 3D94A 2W0JA 3VRZA 2ZJWA 4A9SA 5KHXA 3UIXA 5HU3A 4F08A 2FSMX 3OCTA 4UB7A 4D1ZA 2C0OA 3GB2A 3UO4A 4CNHA 4OGRA 4FKWA 4TYJA 4I6QA 3U51A 4JOAA 3ROCA 4A07A 2F7EE 3P86A 4E4NA 4GK2A 3O96A 4AT4A 1QL6A 3ZLYA 2XEYA 4XNEA 3NMUF 4GU9A 3KRRA 1PW2A 4YZMA 4BCMA 5D7VA 3WIKA 1Z57A 2WMUA 4WG5A 5KO1A 1AD5A 4CV8A 4DITA 4RJ7A 5HQ0A 4JBVA 2BAKA 4MXAA 3EQCA 2CCIA 3C50A 5JZNA 3TIZA 4EWHA 1XH7A 1ZOGA 4PDPA 5FP5A 4BYJA 5K0XA 5L2SA 1J7IA 4X3FB 4DC2A 4EUUA 5BVEA 3ORLA 3I1AA 3KXGA 4C57A 4XLVA 2HCKA 2JBOA 1XKKA 1QPCA 1K2PA 1ZY5A 3G6HA 4RMZA 3Q4TA 2IG7A 2RL5A 2YAKA 3ORIA 3ZFXA 4EUTA 1AQ1A 3GU7A 3NNWA 3DAEA 2OGVA 2PL0A 4RT7A 2W1CA 4IW0A 4CFWA 2VWWA 5LCJA 4WNKA 4KIPA 5ETFA 3UMXA 3EQFA 5GZ8A 4FTUA 4OTHA 3OWKA 4BDEA 2WQNA 4YBJA 3UG2A 3DZOA 5K9IA 4YTHA 2PZYA 1YI4A 4H1MA 3RP9A 4O0TA 1ZRZA 4X2FA 3IGOA 4C61A 3JR1A 4GUEA 4CT1A 4GVAA 3CIKA 4YJOA 1OL2A 1YI3A 4O83A 2ZDTA 1UU7A 3ZMMA 3L9LA 3O8TA 3R63A 3UDBA 4O6LA 4BC6A 4WA9A 4BKZA 4IVDA 5IEXA 4YJUA 4FOCA 3KA0A 4YZDA 3Q5ZA 3DT1A 5IQFA 3ZHPC 3NW5A 3PLAE 2WIPA 2X6EA 5BYYA 4NWMA 2W1FA 2X81A 3FMJA 3K5VA 2PZ5A 4GCJA 2UZLA 4D58A 3AC8A 4RRVA 2Y6OA 3BLHA 2ZYBA 4XP2A 1LPUA 5CF5A 3NNUA 5KMOA 3F5GA 3QFVA 4U97A 4G3DA 4D1SA 3C0HA 3ZZWA 1IAHA 4QMPA 4I6BA 5BVWA 4XLIA 3MYGA 5E8TA 4NU1A 1KE7A 5KMMA 5M08A 2ITOA 2PVRA 2CGVA 3LHJA 3RJCA 3NDMA 3BGPA 4AZSA 4QTAA 4FSUA 4YP8A 5T3QA 2JDOA 4QP2A 3ZO3A 4QQTA 4ENYA 2QKWB 3SXFA 4JX7A 3FY2A 4QTBA 3NLBA 5GJFA 3E8DA 3HUCA 3QRUA 5M09A 3TM0A 3F82A 5JRQA 4QMQA 4RLLA 2W17A 3FLNC 4QMSA 5A6NA 5HESA 4IZ5A 2BTRA 2PU8A 4CD0A 3G0FA 4S32A 4U9AA 4QQ5A 3V6SA 4BWPA 4M67A 4BTFA 4KUJA 4IM2A 4L3PA 5CEOA 4EC9A 3LFCA 5HCXA 3CQEA 2W1IA 2WMTA 4S34A 4TWNA 4KB8A 5EOLA 3H9OA 3W32A 1BL7A 2WKMA 3PJ3A 4FA2A 3UQFA 2VWIA 4HYHA 2FGIA 4U3YA 5AV3A 3AOXA 3OEZA 4DINA 3DQXA 4GYGA 5AV4A 4LMNA 4XBRA 3W2SA 1YDSE 1JOWB 3PZEA 5GIPE 3QXPA 1O6KA 1ZYSA 5HVYA 2VNWA 3FI2A 3KRLA 4XG6A 3EHAA 3FKOA 1ZXEA 1M2RA 5FRIA 2XKDA 3ACJA 4IB3A 3RK9A 5JGDA 3IDPA 4O7ZA 3BGQA 3PXKA 3NW7A 3ORPA 4C4HA 4J96A 3OW3A 2DYLA 4F9WA 5JFVA 5HBEA 3HMPA 5BYLA 4K8AA 3E87A 3V5QA 4O22A 3OHTA 4EOKA 5AR5A 3L9PA 3EN7A 4FUYA 4IAAA 1H8FA 4C0TA 5A14A 3A60A 4O0RA 3ZSIA 1Z5MA 1WBWA 2IWIA 3QA0A 4QMNA 3JVRA 4U40A 4ZSLA 4JRVA 1CKJA 3FLSA 3MH3A 2WNTA 2JC6A 2YM5A 3AC5A 3F69A 3QX4A 2B9HA 1BYGA 2VTJA 2W7XA 3GENA 1G3NA 2R7IA 4XG9A 4O84A 5AP7A 4MBLA 2XNMA 1UU8A 5FEDA 3SG9A 5EYDA 4A9YA 4LOQA 3NUUA 4G3CA 4UMUA 4HW7A 1HCLA 1W8CA 3LFQA 4F9BA 4L00A 3HNGA 3CE3A 2PE1A 3R22A 1M7NA 5E1SA 3IK3A 3Q2MA 4FG8A 3ULZA 4UN0C 2J0LA 1B39A 3PYYA 2FA2A 3VS7A 3DXNA 5CVFA 3H3CA 3DBEA 4NIFB 1H0WA 3C4XA 3ENMA 3FSKA 2BAQA 5ANJA 5E8WA 3CY2A 5CAUA 4RFYA 1V0OA 4M66A 3ORZA 3U4UA 4EH6A 4FEQA 4RFMA 2PZIA 3GOPA 1KE5A 4OTWA 3A7HA 4Z9LA 2DS1A 4NCTA 5DIAA 3WF7A 3R7OA 4JR3A 2YJRA 3OBJA 4GU6A 2YM6A 4GFMA 5FBNC 2IW8A 2WEIA 4BN1A 3EFLA 5CEMA 5IA4A 4ZMFA 1K9AA 5DVRA 4FK6A 3R73A 1SMHA 3EZRA 5CI7A 3DNEA 4IACA 2F4JA 1Y57A 4G2FA 4RVTA 4IFCA 2UVYA 5JRSA 4QYHA 4BCNA 1BI8A 2X0GA 4I5PA 2XM9A 2CNQA 4FGRA 4LRKA 1SVEA 4J8MA 3KF4A 3ULIA 2BRNA 5ANDA 5EM7A 3KRWA 5GZAA 4IX6A 4RJ3A 2JBPA 5I9YA 4MF1A 3PVBA 5CU6A 2Z2WA 3LE6A 3R2YA 5DT3A 2XM8A 3K54A 2WQEA 4O86A 1GIIA 1J91A 5C4LA 2YIXA 4BF2A 2WZJA 2XIYA 2IJMA 3F88A 5AV1A 3ZM9A 2VO6A 3GC9A 3G6GA 5LMKA 2GHGA 1GZKA 3EYGA 2C6MA 2BR1A 3DU8A 2QNJA 3IONA 3GUBA 1H1WA 4U79A 3NVMB 3GOKA 5I0BA 4BZDA 4FIFA 1K3AA 5BVFA 3HV4A 4U5JA 4B0GA 1PKGA 3HECA 3BEAA 3I5ZA 3MIAA 2VV9A 3ZH8A 3CKWA 3U54A 4GK3A 2NNWB 3I5NA 3CQUA 2XNBA 3EB0A 4JAJA 2BDFA 2JDVA 3COIA 4PX6A 3NAYA 4O7LA 4DFXE 4H3PA 4OTFA 5CF4A 2XK7A 3LXLA 3QAME 4YC3A 5JFXA 5KUPA 1OI9A 2XK9A 4QT1A 1XH8A 3R00A 3VHKA 3NYXA 3PVWA 5FG8A 5J87A 3R7VA 1U54A 3KRJA 4YJTA 3UVQA 4RZWA 4CKJA 1YOLA 2QR7A 4CFNA 4MWHA 2P3GX 1Q97A 4UALA 3BLRA 4XYFA 3OMVA 5EG3A 3AT2A 4KBAA 2WMWA 3O17A 4FG9A 3SQQA 5TT7A 4ERKA 5BUIA 4CZTA 5CNNA 1YHSA 2WTVA 4O91A 3V5LA 5JH6A 3UVRA 5ETCA 5JKGA 4P4CA 2C0TA 4J71A 5EYKA 2VO7A 3CEKA 3F7WA 3GCVA 4KRDA 3VUMA 3FZRA 3U6JA 3DLZA 2X7FA 4FV5A 5E8ZA 2WQMA 5CXZA 4GJ2A 5DN3A 3G0EA 3LVPA 4E8AA 4GT3A 4ASDA 3NYOA 2PE2A 1H24A 4RVMA 2YCRA 4C62A 3TCPA 2OJFE 3MA3A 2XNEA 4GYIA 3VUIA 3MSSA 4RWJA 3KULA 3U9CA 2HZNA 3EJ1A 4FTTA 3WE8A 3DFAA 3RBWA 4F65A 4BKJA 2HW7A 4QP4A 4LYNA 5CSPA 4DF3A 5AP3A 3PWDA 4MKCA 4O81A 2YM4A 3DGKA 3UOLA 4CG9A 1H1RA 2UW5A 3BQCA 2X4FA 4IM3A 4L7FA 3IDCA 3UOJA 4JT3A 2RFNA 4A4OA 4L9IA 4CT2A 1U5QA 3BEGA 2HWPA 2CGXA 3BU5A 1OL6A 3DTCA 4CMOA 3V5TA 4AE9A 4M12A 3ZRMA 3R8LA 4BCPA 4Z7GA 4C59A 3KVWA 4TKSA 5EDQA 2OH4A 4R6VA 3GNIB 3VVHA 3AMBA 2VWVA 1OVEA 2ZB0A 3EQRA 4D5KA 1CKIA 3DBFA 4S33A 3OBGA 1KE9A 2GHMA 3MH2A 2WTJA 3DTWA 4O7VA 3I7BA 4DFUA 5HZNA 4JDHA 2E9NA 4AOJA 4FT5A 1H1SA 1STCE 1GJOA 2OJ9A 3CXWA 1P2AA 5FLFA 5HG5A 4CTCA 4D28A 3NVKI 1OPLA 2XK6A 3A7GA 3FPQA 4D9TA 1I44A 5HBJA 5IUHA 4PTCA 3FKNA 2CLXA 4CKIA 3DJ7A 3VS4A 1OECA 3E62A 3GC0A 3HMIA 3TDVA 4ZS0A 2O8YA 2IVSA 3D0EA 1CDKA 5ACBC 3FBVA 3DBCA 4ANSA 4BBEA 4O82A 5AJQA 4M3QA 3PZHA 5IA1A 3IG7A 3H4JA 4K6ZA 4RIXA 1SNXA 4B7TA 3WZJA 5LXMA 3UNKA 4FIGA 4GT4A 3UE4A 3WYXA 3H9RA 3SXRA 3LXNA 4JG7A 3BHYA 3Q52A 5BVOA 5AWMA 5HE0A 3E5AA 4BIDA 5CSVA 3OVVA 4MF0A 3TV4A 3MPMA 5E8SA 2F2UA 5KBQA 3MY0A 4H3BA 4IM0A 3IKAA 2B9FA 3CTQA 5AR3A 1YW2A 4WUNA 3RGFA 4XOZA 4ZAUA 1M2PA 2P2HA 3LPBA 2EUFB 3PRIA 3FJQE 3LFNA 3LLAA 2CNVA 4YJRA 1JKKA 4NM3A 4F64A 2UW3A 1OIQA 4JR7A 2AC3A 3S95A 4AACA 3VBVA 3FLWA 4W9WA 5I9UA 4KS8A 2O5KA 3D7TB 4F6WA 2C3IB 4HGLA 2QU6A 3G5DA 2OH0E 3OROA 3FQHA 4G6LA 4HOKA 4TY1A 4AG8A 4RC4A 5HKMA 3R1NA 4L44A 4OBPA 4RIWB 4YO4A 3R30A 4ARKA 5L6WL 4IBMA 1WAKA 2W9ZB 3OZ6A 3PJ1A 3C4EA 4V0GA 4BTMA 3FMHA 4EZ3A 4TT7A 2OXDA 2VTRA 2WO6A 1E1VA 2HY0A 2XA4A 3DB6A 3E7VA 3KGAA 4YLJA 2HAKA 3F3ZA 4DG0E 2YHVA 1Q61A 4LQMA 4IDVA 2VGOA 2E9OA 2J4ZA 4O1PA 5DRDA 4BKYA 2WFYA 2QG7A 4EK6A 2C5NA 3ZZEA 1E9HA 2JGZA 2WEVA 3BGZA 3CPBA 4KNBA 5BUEA 1UKHA 2VTAA 2ZDUA 3LXKA 4I1ZA 4L3JA 3EQPA 4Q5HA 4U45A 4CFUA 4DFYA 3OY1A 2OZAA 1UVRA 2VTLA 3CC6A 3R01A 4DEBA 2Y4IC 3HV3A 3PSCA 3L8PA 5LVLA 2YM7A 4TW9A 5M57A 3G33A 4YPDA 3PVGA 3D14A 3QRIA 4AGUA 2CSNA 4PWNA 2G2FA 4WO5A 4E93A 4JQ7A 2XKCA 2CMWA 3E8CA 1GZOA 1PXKA 3IW5A 5I3OA 5G1XA 4QMLA 4XP0A 1B6CB 2XRWA 3B8QA 3UZPA 2B7AA 3QGYA 4I5HA 4LUEA 3R9HA 1MRUA 3GP0A 2ZM1A 3RHXA 5D10A 4ANLA 4EONA 1T45A 5HE1A 3MDYA 3ATSA 4ITIA 3ZYAA 5EHLA 3I7CA 4KD1A 4FKPA 4B8MA 2VWYA 4FKGA 1I09A 1DM2A 5IQBA 3ZC5A 3LCSA 2QOLA 4RVLA 2FVDA 3HA6A 3F61A 3PIZA 5E4HA 5CAOA 5IH6A 4TWCA 4YZNA 3FMKA 4FV8A 2PTKA 1W83A 4C34A 2FO0A 2XYNA 3BU3A 4F6UA 1APME 3BV2A 4QTDA 4Y85A 4E4XA 4D2VA 5C8KA 1H28A 4IZYA 2J0KA 2VTHA 4AZWA 4EKKA 2R0IA 3S00A 1OKWA 2XEZA 2A4LA 4JBOA 2ETRA 3O23A 4TYEA 4Y8DA 3D83A 3LLTA 3T3VA 3AD4A 3MW1A 4RWIA 2W1ZA 2QOOA 4IFGA 3ZXTA 3MTLA 4IJPA 4USFA 4R1VA 1XHAA 4GH2A 5LMKC 3RK5A 5JQ8A 3LQ5A 3C1XA 3THBA 3V6RA 5HHWA 4DGOA 3ZCLA 4C37A 1P14A 3A8XA 4UXLA 4D2WA 4ACCA 5KZ0A 4FX3A 4BI0A 3I60A 3LCTA 1J7UA 2CNUA 2WAJA 5HU9A 1WBVA 2VTOA 1O6LA 4O0UA 4PMSA 3II5A 4HNFA 3SAYA 5JSMA 3VS6A 2W1HA 4RIYB 2VO0A 1ZYLA 4CXAA 4U42A 3HAMA 3MJ1A 4S31A 5BQ0A 5DYJA 3R7YA 3FXWA 2GHLA 2QO9A 3LM0A 3PP0A 4GV1A 4U43A 2HK5A 3KXXA 5HD7A 4PDYA 4FNXA 4Q9ZA 4RJ8A 3A7IA 3T9IA 2WMRA 2YCSA 4I93A 3TWJA 4WG3A 2GNJA 4XCUA 3VS2A 3ZUVA 3LFBA 1XBCA 3HRFA 3FZ1A 2J50A 4FV0A 3FMDA 2JFMA 3DA6A 3SOAA 2BHEA 1Y6AA 2YM3A 3UG1A 4DTBA 3NUSA 3L8VA 4PPBA 4QTCA 4J8NA 4R7HA 3R83A 5ANOA 4CQGA 5KKRC 2YJSA 5ANGA 5JFWA 2V22A 3R28A 4QOXA 2E9VA 3V8WA 3VBQA 1KOBA 5DMZA 1H01A 4XEYA 3TXOA 4BCJA 5LWMA 3RAHA 4HVGA 1YKRA 3N4VA 4FT9A 4MK0A 4MTAA 2PMOX 2V0DA 3ORNA 4L8MA 3SA0A 2CDZA 4YLLA 5HBHA 4HVDA 4I4EA 4E5AX 4BDFA 4BB4A 2OF4A 3DXQA 5C03A 3F9NA 4FT0A 3SHEA 5DT4A 4ACMA 5AP5A 4FTRA 3ZSGA 3R0TA 4N70A 5A4EA 2IZTA 5FDPA 5AV0A 2HZ0A 2PULA 4O21A 4A7CA 4CCBA 5A4QA 4GKHA 4CSVA 4MXOA 3FKLA 1FQ1B 3QCSA 3UYTA 5E1EA 4YJNA 2ZM3A 3QHWA 4BRXA 2ITTA 4NUSA 4R1YA 5FUTA 3D4QA 4C7TA 4EH8A 4I0TA 5AUXA 2V5QA 4IB0A 4PDSA 2Y8OA 3MPAA 3N9XA 5BX0A 1OGUA 2JFLA 4FZAB 4X2KA 3EFWA 3AXWA 3VRYA 2X6DA 4LV8A 4CKRA 4I24A 2VTQA 3MA6A 3ZDUA 4DLIA 5EW3A 2V7AA 2XMYA 4MNEA 4BHZA 3NUNA 4FICA 3F3UA 5E8UA 3ZTXA 3BI6A 1U46A 5H9BA 4ZLYA 3QZFA 5IKWA 5KBRA 2KULA 3C4WA 2JLDA 1KSWA 4M8TA 4BDJA 2C6EA 4HZSA 4I3ZA 4QMYA 3DOGA 4YHJA 1QPDA 4AQCA 5C1QB 5L2QA 4NL0A 1A9UA 1TVOA 4I0SA 5IF1A 3FZTA 4HNIA 5EHYA 3UQCA 3F3TA 4X0MA 5HD4A 2A19B 5E90A 4FKVA 4JDJA 1GOLA 2RG6A 3O2MA 1A06A 5M4CA 3TJCA 2R3FA 3HVCA 2XF0A 4EH7A 2ACXA 3HV5A 3KY2A 3MVMA 4YJSA 2JKQA 3UIBA 2Z7SA 4AOIA 4IIRA 3IDBA 4MQ1A 4O0YA 5C9CA 4D4VA 4YZCA 5EQEA 4WD5A 5CEKA 1SYKA 1R1WA 4C02A 4BGGA 3R6XA 2ZVAA 2ESMA 2OJIA 1M7QA 2GNHA 2CKQA 4NW5A 5K5NA 3JUHA 3F3VA 2PVYA 3L9MA 4U6RA 3HRBA 3CBLA 3CGFA 3SLSA 4CCUA 3UIUA 4BICA 1U4DA 3ORXA 5J7HA 2XKFA 5BMMA 3W2PA 3P7CA 1Q3DA 4DBXA 4J99A 4AW2A 4D1XA 5EI2A 4ZP5A 4KSPA 3B8RA 4XOYA 2RF9A 3FI3A 4YSMA 2C6KA 3D5XA 4YHTA 2B55A 3VW8A 2PPQA 4JDKA 2C6IA 4O7NA 1U5RA 4Y83A 3U87A 1OUKA 3A8WA 3EWHA 1W0XC 3PLSA 4U3ZA 3LQ3A 3EN9A 4FNYA 4BCIA 3D5UA 4WUAA 4LGDA 3P9JA 4HGEA 3ENHA 4YMJA 3NX8A 3RZBA 4I20A 4IAKA 4C4GA 3BHUA 4F1OA 3ERKA 3SXSA 5HICA 4IVBA 3HMNA 4ALWA 3OUKA 5D1JA 5E7RA 1G5SA 5AP4A 1LEWA 3DK7A 2E9PA 5B2MA 3TDWA 1L8TA 2OK1A 4KBCA 1OKYA 5M56A 4PF4A 4ASXA 3A2CA 4FZ7A 4MWIA 3REPA 2JEDA 2QODA 4EOPA 3F5PA 5DT0A 4P2KA 4XP3A 3RAKA 3O8UA 4S30A 2WMAA 4GG5A 3WOWA 5BPYA 4M14A 4UEUA 3EN4A 3PY3A 3WZKA 5AIKA 5LJJA 5KE0A 2AC5A 3D5WA 4FTCA 5LWNA 1OKVA 4KA3A 3U4WA 5JZJA 4N57A 4ID7A 4PDOA 3EQIA 3HEGA 3LW0A 4IJ9A 3V04A 3DCVA 4X6QC 3PIYA 1J7LA 4R5YA 2PVKA 2H9VA 5TKDA 3UP7A 2PVMA 4M68A 3V3VA 5L8JA 3I79A 3GGFA 4E7WA 2BDJA 2B0QA 3LAUA 2OJGA 3DAJA 5HO8A 2R3MA 1T46A 1W7HA 2YN8A 4FIJA 3ZUUA 2W05A 4EOMA 3HUBA 3QCXA 4QNAA 4WBOA 4G3GA 2E9UA 2W1GA 3OOMA 3PWYA 2PMLX 4U41A 5F20A 1JSTA 3QYZA 3Q9WA 5FTGA 4UWYA 3W16A 4AZTA 3HRCA 5CU4A 4F7LA 3QTIA 5IA5A 4IANA 2PSQA 3ZRKA 4EOSA 3AC3A 3SDJA 3ZC6A 3QTWA 3QQLA 1R0EA 3S0OA 4LL5A 4QTEA 4F7JA 1OL1A 4AA4A 4JBPA 5DGZA 3ORMA 2C1AA 3SRVA 2H96A 4BI2A 3ATTA 5HIEA 5HCZA 3QQHA 2OXXA 4FGBA 3OW4A 4WNOA 3Q2JA 1W84A 4LGGA 2BALA 4KIQA 1OPKA 4O7YA 3VAPA 4PNKA 5IMXA 4MD7E 4C38A 3BLQA 2OF2A 2QOFA 3G2FA 4WNPA 3VWAA 3ZU7A 4LL0A 1ZMVA 3QU0A 4HCVA 4LGHA 3R7GA 5LOHA 3KQ7A 4EEVA 5IISA 1UA2A 3QQKA 4WSQA 4AGDA 5EQPA 3E7OA 5IUGA 2ERZE 5DHJA 2EWAA 4KKEA 4MAOA 4CZYB 3TV6A 4Q5EA 4I4FA 5HOAA 4FKTA 1YRPA 2BRBA 3E93A 3W18A 5EM5A 4USDA 2UZDA 3ZEPA 4YTCA 5K5XA 2FUMA 2R2PA 5T68A 5BVNA 4H39A 4L67A 5FTOA 5C4KA 3VBYA 3MBLA 2YZLA 5J9YA 3SX9A 2O0UA 3EH9A 4PY1A 2R64A 2ITWA 1YHWA 1UNLA 3AD5A 2YEXA 3FZSA 3WZUA 4BZOA 5KHWA 4K33A 2EVAA 3R02A 4NKSA 1XH5A 3EN5A 4JBQA 3WE4A 1BX6A 2AUHA 3COMA 3FLYA 5FXSA 3RAIA 4FZ6A 3TG1A 4EI4A 3DXPA 3QYWA 4QPSA 2CJMA 2BDWA 2XNOA 4CMTA 3Q96A 4W4WA 1X8BA 2YLFA 4FL2A 5AR8A 1M14A 3WIGA 5ANIA 1JPAA 4FZDB 5GJGA 3R1QA 3QD4A 2I7QA 1JSVA 1ZMUA 2BHHA 2J2IB 3UC4A 1NW1A 3BCEA 3KKVA 4AFEA 3QTSA 2WMQA 2JITA 3CTHA 4IAIA 3K2LA 3HP2A 4BCKA 1WBNA 3ANQA 4JVGA 5CT0A 4F9CA 4BDHA 3M2WA 4K77A 5CAQA 4TL0A 3MI9A 3R7IA 5J1WA 3NUXA 1ZOHA 2VUWA 4QMXA 3DBQA 3P5KA 4PTGA 3GEQA 4ZSEA 3BHTA 2WMSA 3FYJX 3NCGA 3VS5A 4WBBB 2GS2A 4DEIA 2QLUA 3W55A 2XK3A 4USEA 3FE3A 3PUPA 5C8MA 2PVHA 1W98A 1ZZLA 4QYYA 2G2IA 5A46A 4OTRA 4A4LA 5HLPA 2J90A 3QUDA 1UWHA 3VJOA 2XKEA 5EM8A 5J9LA 4HYIA 4I41A 4AFJA 4D5HA 5E9EA 2EXCX 1JWHA 3G9LX 2Z7LA 4KIKA 3GBZA 3TEIA 4RG0A 4EBWA 5I9XA 2C68A 5ICPA 3QQJA 2UUEA 5HORA 3W2CA 1H00A 2IVTA 2PHKA 3BE2A 3KL8A 4QMOA 4BDKA 2W1DA 4RX9A 2VWXA 2I0YA 3FL5A 2I0HA 4JX3A 4UYAA 2ZOQA 2RFDA 4C33A 4F99A 2ZMCA 4LUDA 4NKAA 3CSVA 1WBTA 2ITQA 3HX4A 4FTMA 5GZ9A 4DEHA 3NPCA 2B1PA 1RE8A 5CU3A 2A2AA 3IQ7A 4BCFA 3KEXA 1PMEA 3O71A 4MD8E 4F7SA 2XRUA 5DOSA 4F6SA 5CAPA 3V5PA 4O7TA 5A6OA 4FKJA 4B6LA 2VWBA 3SOCA 2C4GA 5JGBA 1PXJA 4CTBA 4EHEA 3WZDA 3OXTA 1H1QA 2R5TA 3K5UA 3LFFA 1PMVA 4OTPA 4HPTE 4W4VA 2OI4X 3HV6A 4RX5A 5L8KA 4EH5A 4U7ZA 3ZLXA 1IAJA 4M15A 2JDTA 2YZAA 2R3RA 2NRUA 4J53A 5EKOA 2UZUE 4JL9A 3SG8A 3OXIA 4QQCA 2WTCA 2O63A 3QTZA 1WVXA 2G2HA 4MXZA 3JYAA 4YJVA 4C4JA 1H0VA 1ZYJA 3GQLA 3MVHA 3LIJA 5AM7A 2H8HA 2UW7A 4M13A 2AYPA 3CKXA 1UNHA 3EQBA 4OTIA 3GU4A 3Q60A 4L53A 4YJQA 4EORA 4LFIA 2JKOA 4BCQA 4L46A 2RIOA 2BRGA 4I23A 2XIXA 2REIA 3QXOA 5FDXA 3WF9A 3VBWA 4U8ZA 4FSZA 4WKQA 3V5JA 3UC3A 1U54B 5TR6A 3ZBXA 2YERA 4HCUA 5AP6A 3FMLA 4G6NA 1CMKE 4B99A 3VBXA 1JKSA 3DFCB 3IW7A 3OWJA 3P7AA 3QRTA 3U6IA 4E6AA 1M52A 4JXFA 2W4JA 5L6OA 3TJDA 2V7OA 1NVSA 5A3XA 3L8SA 4KAOA 1OBDA 4E6DA 4XG3A 2JDRA 3BV3A 5GNKA 1WBOA 4FIIA 4EQMA 1R39A 3OCGA 3KU2A 2IZSA 5D7AA 4DGNA 4ZJJA 1PRYA 2VTTA 4FKUA 2GQRA 5H8BA 1MP8A 3DDPA 3PPKA 4BDGA 4CRLA 3DKOA 3HMOA 4QO9A 3RZFA 5M4FA 1JKLA 5IMEA 1DAWA 1NA7A 4OAVB 4AW0A 3OT3A 4EJNA 3NEWA 4TWOA 3QRJA 3TTJA 3TI1A 5A9UA 3KULB 1QCFA 3VUHA 4YTFA 4AWIA 5H8GA 1YWVA 4AN2A 1NY3A 2ZV7A 3ZFMA 4TN6A 3LMGA 1GZ8A 3C4ZA 4PP7A 1OL5A 4FEUA 2UVZA 2WPAA 4GVJA 3CQWA 3QUEA 5CNOA 4G9CA 3VW6A 4DGGA 1Q8YA 2VTNA 2VZ6A 3QQUA 5LVOA 5HX6A 3PXFA 2W5HA 4NSTA 4BHNA 2PUUA 5AMNA 5BMSA 2ZV2A 4ZJIA 3TZ7A 3SVVA 4QMWA 3WARA 4EH2A 2IVUA 2VO3A 3PXRA 4I0RA 3P4KA 1XBAA 1PKDA 1F5QA 3DDQA 2YIYA 4I94A 4FV7A 2XZSA 3OY3A 2GQSA 1BI7A 1OMWA 4E5WA 4MBJA 1PXLA 4L43A 3R8UA 4O38A 3QTUA 3JPVA 5CANA 1Q24A 2P55A 4IH8A 3UO5A 1KE6A 2BIKB 3FC1X 4FKSA 3UMWA 2C69A 3EOCA 2Y4PA 2UZEA 4AP7A 5FM2A 4FSMA 2X4ZA 3I6WA 5FEEA 3O0GA 2QOBA 4YNEA 4X3FC 1XJDA 4C58A 4EZ7A 4JJRA 3VULA 4WRSA 2H6DA 4I6FA 4E26A 4EOLA 5F95A 5HE3A 5FD2A 3PSDA 2XIZA 3T8OA 4CV9A 5K4IA 4BVUA 4YZ9A 4GRBA 3TUDA 3CY3A 4GFOA 4RIXB 2C5VA 5H8EA 5AP2A 2PVLA 4I6HA 5E8VA 3Q5IA 4J7BA 4TPTA 3QC4A 1H07A 3D2IA 5AUVA 4WNMA 4DHFA 2EXEA 3NIZA 4RZVA 4X2GA 3W33A 3KXZA 2IZRA 3BU6A 5I4NA 3ZXZA 5EDPA 5BVDA 4OTQA 2YWVA 3CP9A 3PXQA 4ZMEA 2R3JA 2UZNA 3MB7A 2WXVA 4LI5A 5DEWA 2XCHA 4JRNA 5CENA 5IA2A 4FTNA 2HIWA 4XS2A 4EQCA 4XV1A 3R7UA 2CKEA 4R7IA 4UZHA 4L68A 4DFZE 4W4XA 1GNGA 3BYSA 2P4IA 3KF7A 1BMKA 1H1PA 1XO2B 3UTOA 4EH9A 5DE2A 4ZTLA 4NM5A 2BKZA 3MVJA 3OG7A 3PA3A 5IEVA 2F7ZE 4R77A 4AN3A 4KKHA 1UU3A 3AT3A 2OWBA 3A99A 3KMMA 3HZTA 3O7LD 4MXYA 4NJDA 2QQ7A 4P90A 4PRJA 4J97A 4BTKA 3QZHA 1FMOE 5D9HA 4IMYA 4IX3A 4KIOA 4NH1A 4CGAA 3EKKA 3N4TA 3C13A 3PVUA 4V0GB 4FTAA 5AA8A 2NRYA 3NNVA 4DT8A 3GCPA 4V01A 2ZB1A 4DBNA 3DY7A 3BBWA 4IVAA 3H9FA 4CQEA 5CS6A 3SW4A 1MRVA 3RWPA 3DAKA 4D0WA 5ITAA 3TT0A 4FIHA 2X7OA 4GMYA 4RC2A 5EOBA 4CFXA 5DFPA 4CZUA 4NYEA 5AR7A 2WMBA 1BUHA 4RFZA 4BDCA 3IGGA 2ETKA 2OZAB 3ACKA 4QMMA 4Z7HA 5CYIA 2XBJA 3R04A 5AR4A 5CVGA 3F5XA 5G6VA 5KZIA 4PTEA 1G8SA 1UV5A 4XUFA 4K2RA 5EI8A 1SZMA 4JG6A 4DTKA 2W5AA 3GC7A 4X3JA 4LM5A 1MQ4A 4DCEA 3P23A 2J5FA 3PXYA 3BYUA 1YHVA 2BILB 2QOKA 1XQZA 3RHKA 1VJYA 3FZPA 4I5CA 5C26A 5LVNA 4DEDA 2GPHA 1Q5KA 4IXPA 4MYGA 5IG1A 2XJ1A 4ANOA 2HZ4A 2UZBA 3A62A 3VS0A 1Q99A 1IA8A 3TNIA 4N4SA 4AZEA 4RLKA 2CCHA 1YXSA 1YXUA 4L52A 4PMTA 2CPKE 1CTPE 3GFWA 4H05A 3EL7A 4DG3E 1Y8YA 4GG7A 4HYUA 4DFBA 2JD5A 2WB8A 1ATPE 2CLQA 2YISA 4HYSA 4I22A 2PUPA 2J9MA 3I0QA 4I21A 5IU2A 5BUJA 3MN3A 2YFXA 2EU9A 3R8MA 5C01A 4EOQA 1REJA 2BFYA 3QQGA 4FEWA 1Q62A 4MQ2A 3Q4UA 4NFMA 4EHGA 5L4QA 2WTIA 2C6LA 4N0SA 4E4LA 1PYXA 4FF8A 5JGAA 5H2UA 4TYGA 3MTFA 3R7EA 1PHKA 2FSLX 2FB8A 2OSCA 5HG8A 5HTCA 2WIHA 5FP6A 4ZY5A 3DKCA 4RVKA 4H1JA 1UWJA 4QP3A 4EYJA 3KXHA 4CG8A 4ANQA 4UWBA 5M55A 3OD6X 4E6CA 3KVXA 5HI2A 2WELA 3A4OX 3QWJA 4JS8A 5ANEA 4DEAA 1ZWSA 3KCFA 4IZ7A 1Y91A 2A1AB 2OG8A 3UPXA 4DE4A 3LFSA 2RFEA 2XJ0A 4ZXTA 4HVIA 5M4IA 1IASA 4RJ4A 3IO7A 3PPJA 1S9JA 1PF8A 4GEOA 1ZLTA 2R9SA 3ZM4A 4BDDA 5IA3A 3RNYA 3RNIA 5B7VA 3PJ2A 5AV2A 5GHVA 3BIZA 2Y6MA 3P1AA 1YDRE 3ZRLA 4XH6A 3LFAA 2EB2A 2DQ7X 3Q32A 3OC1A 4MBIA 3VUTA 3U6HA 4F1MA 5B0XA 2VWZA 4PL5A 3QALE 1BL6A 4EH4A 4NTTA 2C5XA 3AC4A 4UMRA 4O0VA 4R78A 4DCAA 5IEYA 5DR2A 3OXZA 3D9VA 4EK8A 5CY3A 1VYZA 3G90X 5CEQA 2X2MA 3RCDA 5DLSA 4KWPA 3FHIA 4BWKA 4A9UA 2IW6A 2QURA 3ZEWA 1XWSA 3DQWA 2UW9A 3ZBFA 2VU3A 3FDNA 3WZEA 3CD3A 1LP4A 3QZIA 5F1ZA 4BYIA 2RFSA 4TWPA 3O8PA 4YO6A 1RW8A 2HWOA 3DKFA 4OLIA 4UZDA 3EQGA 2O3PA 2WQOA 3FI4A 4OT6A 1JNKA 3C4FA 4OTGA 5EYCA 4HVHA 2VNYA 4YURA 4BTJA 2XK8A 2W06A 4C8BA 3F7ZA 5HIDA 4BIBA 3PP1A 2BKKA 3V8TA 5IH4A 3M1SA 4EC8A 3R1SA 3NIEA 5KMNA 1WBPA 2H34A 2JIVA 2ITXA 4IAYA 2UW0A 3F2RA 3PJ8A 5EQYA 4DH7A 4FSYA 5D11A 3E3PA 3LXPA 2PMIA 1XH4A 3P0MA 4J1RA 5AUWA 5M44A 2GNFA 3FZOA 3NNXA 3BWFA 4O96A 4RA4A 1CM8A 1ZARA 4EZ5A 4QYEA 3WF5A 2C3LA 2XNNA 3GVUA 1BLXA 1JQHA 1JBPE 1ZY4A 3IS5A 5E8YA 3RK7A 1OIUA 2F57A 4ZTHA 4D2SA 2CHLA 3BBTB 4DT9A 4E1ZA 3FY0A 3P08A 3ZS5A 2ITZA 5EHOA 3JVSA 3KN5A 2A0CX 3RALA 3OTUA 4EJ7A 3H30A 2J6MA 1DI8A 1YVJA 4XRLA 5KMKA 2HXLA 3U8WA 1ND4A 5A4LA 5J1VA 2Y0AA 2O2UA 1MUOA 3E88A 2ITYA 2PMNX 4MNEB 3DPKA 3HL7A 3OOGA 4DH1A 1PMNA 5DG5A 1R0PA 3TNWA 3BQRA 1FVVA 3BWJA 1YOMA 3T3UA 1PY5A 3O51A 3VC4A 4NTSA 3V5WA 4RQKA 3WI6A 3TKUA 4D0XA 3LKMA 5J95A 3TZ8A 1OUYA 1DI9A 5FWKK 3TZ9A 4G9RA 3RKBA 2X8IA 2BMCA 3HAVA 2XIKA 2JIUA 1IG1A 2OIQA 1YXVA 2UZTA 2VX0A 3HLLA 3JY0A 4IX4A 3ORKA 4RX7A 4ANBA 4PUZA 3LZBA 3L8XA 2E2BA 3KB7A 3IOPA 3TACA 3TNPC 4UMPA 3AC2A 3U55A 3IECA 4DTAA 5HIBA 4BFMA 3L1SA 3CCNA 3LFDA 3QKKA 4G6OA 5J8IA 1ZYDA 2GNLA 4UMQA 3C4CA 4WIHA 5GIOE 5AIRA 4UMTA 5D12A 5IQDA 2BCJA 3LFEA 2QO7A 4OUCA 3OFMA 3TKIA 4DH3A 5AAGA 3QHRA 5C8NA 3MWUA 3NSZA 2R3OA 3PXZA 4L45A 2OZOA 4M0YA 3DB8A 1XBBA 3NWWA 2V55A 4B9DA 4ZOGA 5DNRA 1M17A 3DNDA 3GT8A 3HP5A 4FVQA 2QHNA 2LAVA 2YM8A 3ETAA 4DGMA 3ANRA 3KFAA 2OLCA 3NUPA 1XH9A 1JKTA 2C6DA 2Z7RA 3PE2A 3PRFA 3R9OA 3F2AA 1JAMA 3OCSA 3S1HA 2JAMA 3QX2A 3H0YA 1OBGA 2WGJA 3PA4A 4NFNA 3IW8A 1J1BA 3OF0A 4XG2A 5HGIA 4ZLOA 3SGCA 2QVSE 5IQGA 5ETAA 2OKRA 4EH3A 2CKPA 2YACA 3ALNA 4L3LA 4GSBA 2B9IA 5HNGA 3GCQA 2GU8A 3BPRA 3DJ6A 4WHZA 5J5TA 4MCVA 4FKIA 4D4SA 2JDSA 5CT7A 1PXNA 4TYHA 4M69A 3F5UA 3FUPA 4WT6A 5JN2A 2IW9A 4ASZA 4PQNA 4A06A 5DI1A 4GIIA 2GQGA 4ENXA 5CEPA 3OS3A 3W1FA 3NCZA 3V8SA 2GFSA 4AXAA 3ZOSA 1OIRA 3QTXA 4GUBA 4M84A 4O6EA 2GTNA 1FMKA 3HDNA 3D7ZA 5LMAA 4K11A 4EK5A 3HA8A 4F09A 1UU9A 3R9RA 4ONAA 4J98A 5HCYA 3RI1A 2BAJA 5E8XA 3TIYA 3UNZA 5TF9A 1Q8ZA 4APPA 4FZFB 1L3RE 2YCQA 3LJ2A 3V01A 3QKLA 4BDBA 1IA9A 2C1BA 4Z55A 4ORKA 2OICA 3ET7A 5TE0A 5CVHA 3B2TA 3EIDA 4FKLA 5K0KA 1J3HA 5IQHA 2CGUA 4JQEA 4Y5QA 2Z02A 5FQDC 4R3PA 4F0GA 1KUTA 2RSVA 4KKGA 4FNZA 2HELA 4FK3A 4EHVA 2QCSA 3MPTA 4DLJA 5KX8A 2YLEA 1Y8GA 2C3JA 2VTIA 2YDJA 4GS6A 4RPVA 4M97A 3WILA 2PWLA 2UW8A 4ITJA 4GK4A 5TO8A 2VTSA 3ZONA 4RQVA 1Q4LA 3KN6A 3DZQA 5IPJA 4GFGA 5L2WA 2I6LA 1RDQE 3VNTA 5LARA 3GFEA 2C3KA 4G31A 5C27A 3BRBA 3TUCA 4FEXA 3VQUA 3FI8A 5ANKA 5EW8A 4OAUC 2R3IA 4CFMA 3KREA 2B9JA 2UZWE 1VR2A 2PY3A 3H10A 4G34A 2XBAA 3PTGA 4L7SA 1H08A 4UV0A 3BYMA 4XJ0A 3NYVA 5AR2A 1PXIA 4X3FA 4ZTNA 5E92A 2OFVA 3KRXA 3QCQA 3WYYA 4FSQA 3PY1A 4U44A 3SRVB 1SM2A 3TZMA 2XJ2A 4CFVA 5AUTA 5JFSA 3TNQB 5LMBA 2YAAA 3AQVA 5KMIA 1PXPA 4FIEA 4HJOA 4ERWA 4XRJA 5I3RA 4N6YA 5IQIA 2ETMA 2VTMA 4ZIMA 2QD9A 4K18A 5HLNA 4LMUA 2RGPA 1AGWA 3A61A 3NYNA 5CZHA 4P5ZA 1VZOA 3NRMA 4IWOA 4AS0A 2CN5A 4PPAA 2XB7A 3POZA 3C51A 3AG9A 2YITA 4D2TA 4FEVA 3B2WA 3EQDA 3VN9A 1OIYA 3R71A 2GFCA 3LQ8A 3KXMA 3VQHA 3DK6A 3M11A 1ERKA 5M4UA 3RINA 3BELA 3C7QA 3UGCA 4N6ZA 5JT2A 5IQEA 3OP5A 4M0ZA 5LCKA 1LR4A 5H3QA 3C0IA 4D4RA 3VF8A 3V51A 3OCBA 1GIHA 2YIWA 3NUYA 3TL8A 3GU5A 4FL1A 4QP6A 5LQFA 5HVJA 2XH5A 3NS9A 3CS9A 3R8PA 3D2KA 5CSHA 5DA3A 3CLYA 4AU8A 3BHHA 3OEFX 3PDTA 4D4YA 4U81A 1KV2A 4XV3A 4YR8A 2JAVA 2QC6A 2FYSA 2XVDA 4LRJA 2ITUA 3TNHA 3VBTA 4DAWA 4DYMA 4ZTSA 2G15A 3FLQA 4QP8A 4W8DA 3AD6A 1GAGA 4EOJA 2BIYA 1QMZA 4JAIA 2XYUA 4TYIA 3ZO2A 5EDRA 3AGMA 4ZTRA 1FOTA 4I92A 5DH3A 4CLIA 1WMKA 3VS3A 4D2RA 1OL7A 2OJJA 4FSRA 4EYMA 4O27B 3LMHA 2NPQA 2OW3A 4L6QA 5E91A 2Z60A 3EYHA 3POOA 3COKA 3QBNA 3UOKA 4CFFA 3E8EA 3GI3A 3RPSA 4FVPA 2YWPA 3MESA 3Q9XA 3Q6WA 2UV2A 4NM0A 5HVKA 4F9YA 5EKNA 3MS9A 3QL8A 5ETIA 1YI6A 2J51A 3A7JA 4MXXA 4OR5A 3QD2B 3RMFA 4ZJVA 4XHKB 5CALA 4H3QA 5HNIX 2Y4IB 4FTQA 3VUGA 2C47A 2R0UA 3C5IA 2WTWA 5AP1A 3VUDA 3W8LA 4AUAA 1O9UA 2R4BA 4Y46A 3P7BA 4DH5A 2BZKB 2ONLC 5AUYA 2X2KA 4GT5A 1R3CA 4R8QA 4APCA 2YCFA 3HDMA 4U0IA 4ZY4A 3KC3A 3F3WA 3ZSHA 1QPEA 4EWQA 1H27A 2YIQA 4UY9A 4BZNA 4KIKB 2QU5A 1IRKA 2NP8A 2RG5A 3OWPA 5DBXA 4EHZA 4E4MA 4ZTMA 5IQCA 1ZMWA 4RWKA 1U59A 2JIIA 4RWLA 4V04A 4ZTQA 2X8DA 1P4FA 2QOCA 3E8NA 2ITPA 5AM6A 4YBKA 2HW6A 2XUUA 2Q0BA 3RCJA 4QP1A 5ACKA 3WBLA 4B4LA 4D9UA 4FV3A 4AW1A 5IH5A 2JKKA 2LGCA 4NT4A 5CQWA 1Q8WA 5CI6A 2QOHA 2GS6A 3GU6A 3FQSA 4FUXA 3HMMA 5CZIA 3W8QA 3C5UA 4YNOA 4ZEGA 3RWQA 2F9GA 1YXXA 3L9NA 4MXCA 4YC6A 4CVAA 5B2KA 4QD6A 2VD5A 3QD3A 4MHAA 1RJBA 3IW4A 3EKNA 1JLUE 5HG9A 1CSNA 2GTMA 1A48A 3BX5A 3UVPA 5JMSA 1V1KA 2UZVA 4F63A 3R8ZA 2GMXA 4O2PA 2HOGA 4AF3A 4IHPA 4AA0A 4O1OA 3RM6A 4IAFA 3CR0A 4FTIA 4I5MA 1WVYA 4BCGA 3ZDIA 5GJDA 1FVRA 5IUIA 1GY3A 1TQPA 1VYWA 2QR8A 2PVJA 4XV2A 1KV1A 4NIFA 5DWRA 3FLZA 1NVQA 2WHBA 2J5EA 5CF8A 5HTBA 4MX9A 3KCKA 5M51A 4XV9A 3UODA 3DS6A 2PVFA 3FQEA 4KBKA 3PSBA 3GC8A 2WTKC 3M42A 2XNGA 2QONA 4IZAA 4QYGA 1URCA 3MV5A 3QA8A 3R1YA 2W96B 4QNYA 4R5SA 5CWZA 3NUAA 4F70A 2Y7JA 2B53A 3DV3A 4FC0A 4AGWA 3AMAA 1LEZA 2Z7QA 3UBDA 4C3FA 1NVRA 4RBLA 2BFXA 1OKZA 3MH1A 1FGKA 4LOPA 4F0FA 4FBXA 1WCCA 3JXWA 4FT3A 1W82A 3SW7A 2IZUA 4G5JA 4EQUA 5EH0A 2PUNA 3G15A 3FAAA 3FYKX 4FTJA 2XIRA 4QRCA 5KKRB 5AAFA 3KK8A 4F4PA 3FXZA 4NM7A 5IZFA 4FV2A 3GU8A 4OW8A 4ZY6A 3FMMA 3FMNA 4W9XA 4RIOA 4C3PA 3S2PA 4DFLA 3UYSA 2OIBA 3Q3BA 3MFSA 1IEPA 5JK3A 4A4XA 2WTDA 3LJ0A 4RC3A 4F0IA 2G1TA 3UOHA 3MGYA 3UZRA 2G01A 3N51A 4AZVA 2X7GA 5HG7A 2ZMDA 4IB5A 4BBMA 2VTPA 2W9FB 3RPVA 3RTPA 3CGOA 4F7NA 2VX1A 3HV7A 3BKBA 2PUIA 1QPJA 2I0EA 2EB3A 4OBOA 3O50A 4M7IA 4BDIA 3LCOA 3A4PA 3ZFYA 4ZZMA 4FT7A 4V05A 4IADA 1UKIA 4QP7A 4AE6A 4IX5A 5J7BA 3E3BX 4JDIA 3CJGA 3QUPA 1V0PA 2F7XE 3MFRA 2FSOX 2WU7A 1M2QA 2PZPA 4FODA 1PMUA 4R3CA 4AZFA 3KK9A 2OFUA 4DEEA 4FKQA 3ITZA 3PE1A 2GSFA 2OU7A 2UVXA 3NW6A 5AX9A 1G8AA 4X21A 1FGIA 5BVKA 3FC2A 1WFCA 3RM7A 1OB3A 3OUNB 2VGPA 2VRXA 2YA9A 4YTIA 2OXYA 4AAAA 1H25A 2CGWA 2DUVA 1URWA 4XG8A 5J5SA 1FPUA 3RAWA 3BZ3A 3EN6A 5I9VA 4XBUA 2BRHA 4XG4A 4O0SA 1ZYCA 3A7FA 3ALOA 3HKOA 3QRKA 2GNGA 2R3LA 2F49A 1YWNA 1FBNA 4YPSA 4ASEA 4AT3A 5DEYA 3MY5A 1OZ1A 1WBSA 4YJPA 4TTHB 4C36A 4XMOA 1F3MC 4GL9A 3TUBA 2Q83A 3MIYA 2J0JA 5IDNA 4FYOA 4QQJA 2VX3A 1E1XA 4EBVA 4KS7A 4D2PA 1KOAA 2HZIA 2HENA 3UP2A 3PG3A 1RQQA 3E63A 2IO6A 4FTKA 2ERKA 2GS7A 4QMVA 1UNGA 5FXQA 4H36A 5KNJA 3KMWA 5CQUA 4E20A 4BCHA 2WU6A 3FHRA 4Z16A 4E6QA 3N4UA 2FH9A 2GNIA 1PXMA 2IVVA 1B38A 2J0IA 1O6YA 4MD9E 1ZZ2A 4UYNA 4LRMA 2PYWA 1WZYA 4KRCA 5AP0A 4NK9A 4CYIA 3C9WA 4AX8A 2VN9A 5A54A 3D15A 2I0VA 3GCSA 2QHMA 1S9IA 5CU0A 4RJ6A 3EZVA 2IN6A 4IQ6A 4ZSAA 3D5VA 5JQ5A 1FINA 2ZAZA 4CRSA 3AGLA 5FM3A 2ITVA 2QOQA 4LG4A 4P7EA 2C5OA 4X7QA 1H4LA 3QQFA 4FSNA 4J52A 4BR3A 2J0MB 5HO6A 4C35A 2BPMA
chains in the Genus database with same CATH superfamily
3LM5A 4C4FA 4ZK5A 3EMGA 3P79A 4G3FA 4JLCA 4XG7A 5FTQA 5HLWA 4IE9A 2C0IA 1HOWA 2WQBA 2ZM4A 3NGAA 2W99B 4F9AA 5J9ZA 4C2VA 4IC8A 2QI8A 4ANNA 4E73A 3VHEA 2P0CA 2YDIA 1OITA 1OPJA 3F2NA 4QPMA 3R21A 4UWCA 1WVWA 3TN8A 4PL3A 1EH4A 2HXQA 4X2JA 5AA9A 1GIJA 1XMLA 5JEBA 2A27A 1HCKA 3PA5A 3CTJA 4P5QA 3TTIA 4LOOA 4W4YA 3G51A 3QC9A 4BGHA 4DEGA 5A4CA 4KINA 2R7BA 2B4SB 1Q3WA 4IEBA 4ANMA 5FGKA 3AT4A 3CJFA 3EFJA 4YGAA 3W2RA 3ZLSA 4GKIA 2CN8A 5CU2A 2BZIB 2VWUA 4II5A 5I9WA 2PK9A 1MQBA 2X0QA 3Q9YA 4F1TA 3VF9A 1VLRA 3QF9A 3ODZX 3HGKA 3IW6A 2X9EA 3LCKA 3PIXA 3RVGA 4EOOA 3R2BA 3LOKA 3MY1A 3VJNA 4UX9A 1Q8TA 4FV6A 2BVAA 1ZAOA 4YC8A 4FE2A 3QKMA 5HTIA 4MH7A 5IQAA 4YZBA 3PG1A 2BZJA 2P33A 3KXNA 1Q8UA 2NO3A 1PYEA 2R3PA 3SD0A 4AN9A 4R3RA 4JNWA 3IOKA 4OTDA 2R3GA 4PPCA 2GCDA 3WF8A 4EKLA 5GINE 3LJ1A 4FV9A 4C3RA 2JKMA 3BHVA 4JI9A 3VO3A 3D7TA 4EL9A 3Q4CA 2DWBA 4WG4A 5BYZA 3UO6A 5CASA 5CTPA 4A9TA 5EFQA 1Y6BA 5HX8A 2R3KA 4X6RA 5M07A 3P78A 5CSXA 4FOBA 4RIWA 5K3YA 5A4TA 3I4BA 1CKPA 4WOVA 5AX3A 5IA0A 4HCTA 2XP2A 2YABA 3E64A 4TRLA 5AUUA 3F6XA 4ZLZA 4KSQA 4RJ5A 4PV0A 3UJGA 2WMXA 5HE2A 3Q6UA 4D55A 4ACDA 4K1BA 4W8EA 4FKOA 4C4IA 3AC1A 4OT5A 2F2CB 2IF8A 4Z3VA 4HPUE 3O7LB 2C6TA 3MB6A 4FTOA 2PZRA 3FSFA 4K0YA 4LV5A 4YSJA 5M06A 4O2ZA 4AA5A 4HZRA 4PMPA 4NZWB 4HGSA 3U9NA 3UNJA 3FL4A 4CEGA 3VUKA 5J79A 3LMIA 2XS0A 4DH8A 2WOUA 4NCTC 4EOIA 4S2ZA 4CYJA 5K4JA 3H0ZA 4FYNA 3I81A 4YU2A 4QP9A 3I0OA 4L42A 4NJ3A 4WSYA 2QKRA 4YHFA 2WOTA 3R9DA 4IDTA 4IB1A 3RPYA 3K3JA 3SV0A 5CF6A 4PMMA 5L3AA 3UQGA 2AEGA 4OBQA 4AOTA 4BY9E 4CMUA 3S3IA 1NT2A 1MRYA 4NW6A 5BNJA 2I1MA 3GCUA 5CAVA 3FXXA 5F94A 4JIKA 3NAXA 2YIRA 3S4QA 1SVHA 4AT5A 4ZSJA 3WF6A 1NXKA 3UIMA 4X2NA 3CPCA 5EI6A 5L2TA 2C6OA 4QEBA 4HVSA 3PFQA 5DRBA 5DR6A 2X39A 2PVNA 1YOJA 2WD1A 4UBAA 4BBFA 1SVGA 3NR9A 4BIEA 3PPZA 4C2WA 2WMVA 2O65A 2ITNA 2XCKA 3GXLA 4EK4A 2OO8X 4E5BA 4BCOA 3PJCA 5KMJA 5I5ZA 3QCYA 2R3QA 3QZGA 4GW8A 2W1EA 4L01A 5HEZA 2UZOA 2X1NA 3ODYX 3R9NA 5EK7A 4YLKA 4QMTA 1KE8A 3EFKA 1SNUA 3CD8A 4QMUA 4ZZOA 5HO7A 2EXMA 4TZRA 1JSUA 4MVFA 5M53A 3G9NA 4FSWA 1F0QA 4FV1A 3SC1A 3QTQA 2Q0NA 2CKOA 5EW9A 3E92A 4Y73A 4H58A 3JY9A 4EK3A 3BYOA 4RX8A 2QLQA 4GJ3A 5CEIA 3C0GA 4IWQA 4ACHA 5LVPA 1TQIA 2IPXA 1OM1A 3DKGA 2ONLA 3VS1A 4FTLA 2B52A 2UW4A 2X8EA 4Q9SA 3ZLWA 2Z8CA 5L6PA 4FI1A 2B54A 4BWXA 4ITHA 4IVCA 2GDOA 4ZSGA 4RIYA 4DG2E 2BZHB 4G1WA 2J7TA 5CLPA 4JIAA 3W2OA 5F9EA 1ZOEA 4QMZA 2BRMA 4YUQA 2RKUA 3MVLA 5CX9A 1FVTA 4DFNA 4Y5HA 4BDAA 4DA5A 3DLSA 3EQHA 3K3IA 4J95A 3FMEA 4FL3A 2BUJA 2FSTX 4A9RA 4TNDA 4PP9A 5DPVA 4LDTA 3HYHA 4G16A 3UPZA 3MJ2A 3QTRA 3AMYA 3VIDA 5CSWA 4AW5A 5TOZA 3FV8A 2X2LA 1P5EA 3COHA 2HY81 3DJ5A 4HGTA 3QWKA 3QLFA 3SKCA 4DGLC 5FXRA 4RSSA 2BROA 5EM6A 4FG7A 2OIDA 4O4DA 2G9XA 4TXCA 1PXOA 4FV4A 4NEUA 4CLJA 3FEGA 4FKRA 4TNBA 4XX9A 3ML1A 3R8VA 3BYVA 4ALUA 2SRCA 2OBJA 3TKHA 4O7RA 5HNBA 4GIHA 3T9TA 4JQ8A 5EYMA 3ZO1A 5L2IA 4UXQA 3RPOA 4U80A 2XANA 4IAZA 1BKXA 4AGCA 4C4EA 3TV7A 2BTSA 5DR9A 5B2LA 1J1CA 2YDKA 1YQJA 2C5YA 2I40A 4PNIA 4JG8A 4QYFA 5FBOA 4ALVA 4BGQA 5L8LA 4G5PA 5KMLA 5AUZA 2WTKB 4O0XA 3ROYA 2ZV8A 2HYYA 5AADA 1IR3A 2W5BA 4BL1A 5IDPA 5LVMA 3JS2A 4BI1A 4RGJA 4R7BA 3QLGA 2W4KA 4G3EA 3ZUTA 1TQMA 4B8LA 4Q2AA 4ZS4A 3OWLA 2R3HA 4IC7A 1VEBA 5AEPA 4WRGA 4IWDA 4DN5A 2QO2A 2O64A 4PL4A 3UDSA 3OTVA 2Y9QA 5KCVA 4FNWA 2C30A 4FR4A 4ZZNA 2QG5A 3MFTA 4O7SA 3QD0A 1H26A 1P4OA 1YDTE 3F66A 2KTYA 2ZV9A 3Q53A 3NZ0A 5FEQA 1V0BA 2W4OA 4MNFA 1LUFA 1TKIA 3ID6C 1DS5A 3Q04A 1REKA 2P2IA 3I6UA 2XNPA 3MH0A 1GZNA 1YXTA 4IWPA 4TYHB 4M69B 5D41A 4FSTA 5CXHA 3OT8A 3DK3A 1Q41A 3EL8A 3IPHA 4K9YA 4Y72A 3ZO4A 5AAEA 3QGWA 1Z9XA 4ACGA 2R3NA 4DDIA 4Y95A 3BE9A 3GQIA 5AFVA 3ORTA 4BJJA 4O0WA 1R78A 3UZTA 1YWRA 3RPRA 3KMUA 4FVRA 2PE0A 4G17A 2X9FA 3MFUA 3W10A 3Q9ZA 1KWPA 2VAGA 2QOIA 4O7WA 4QPAA 4E3CA 2XK4A 3W2QA 3FWQA 3LCDA 2UW6A 5T6KA 1XR1A 1PJKA 3FPMA 1DAYA 4KABA 3DBDA 1JVPP 4MEDA 1XH6A 3ELJA 2V62A 4FMQA 4RA5A 3PY0A 3Q4ZA 5F4NA 5I9ZA 3D94A 2W0JA 3VRZA 2ZJWA 4A9SA 5KHXA 3UIXA 5HU3A 4F08A 2FSMX 3OCTA 4UB7A 4D1ZA 2C0OA 3GB2A 3UO4A 4CNHA 4OGRA 4FKWA 4TYJA 4I6QA 3U51A 4JOAA 3ROCA 4A07A 2F7EE 3BL7A 3P86A 4E4NA 4GK2A 3O96A 4AT4A 1QL6A 3ZLYA 2XEYA 4XNEA 3NMUF 4GU9A 3KRRA 1PW2A 4YZMA 4BCMA 5D7VA 3WIKA 1Z57A 2WMUA 4WG5A 5KO1A 1AD5A 4CV8A 4DITA 4RJ7A 5HQ0A 4JBVA 2BAKA 4MXAA 3EQCA 2CCIA 3C50A 5JZNA 3TIZA 4EWHA 1XH7A 1ZOGA 4PDPA 5FP5A 4BYJA 5K0XA 5L2SA 1J7IA 4X3FB 4DC2A 4EUUA 5BVEA 3ORLA 3I1AA 3KXGA 4C57A 4XLVA 2HCKA 2JBOA 1XKKA 1QPCA 1K2PA 1ZY5A 3G6HA 4RMZA 3Q4TA 2IG7A 2RL5A 2YAKA 3ORIA 3ZFXA 4EUTA 1AQ1A 3GU7A 3NNWA 3DAEA 2OGVA 2PL0A 4RT7A 2W1CA 4IW0A 4CFWA 2VWWA 5LCJA 4WNKA 4KIPA 5ETFA 3UMXA 3EQFA 5GZ8A 4FTUA 4OTHA 3OWKA 4BDEA 2WQNA 4YBJA 3UG2A 3DZOA 5K9IA 4YTHA 2NYAA 2PZYA 1YI4A 4H1MA 3RP9A 4O0TA 1ZRZA 4X2FA 3IGOA 4C61A 3JR1A 4GUEA 4CT1A 4GVAA 3CIKA 4YJOA 1OL2A 1YI3A 4O83A 2ZDTA 1UU7A 3ZMMA 3L9LA 3O8TA 3R63A 3UDBA 4O6LA 4BC6A 4WA9A 4BKZA 4IVDA 5IEXA 4YJUA 4FOCA 3KA0A 4YZDA 3Q5ZA 3DT1A 5IQFA 3ZHPC 3NW5A 3PLAE 2WIPA 2X6EA 5BYYA 4NWMA 2W1FA 2X81A 3FMJA 3K5VA 2PZ5A 4GCJA 2UZLA 4D58A 3AC8A 4RRVA 2Y6OA 3BLHA 2ZYBA 4XP2A 1LPUA 5CF5A 3NNUA 5KMOA 3F5GA 3QFVA 4U97A 4G3DA 4D1SA 3C0HA 3ZZWA 1IAHA 4QMPA 4I6BA 5BVWA 4XLIA 3MYGA 5E8TA 4NU1A 1KE7A 5KMMA 5M08A 2ITOA 2PVRA 2CGVA 3LHJA 3RJCA 3NDMA 3BGPA 4AZSA 4QTAA 4FSUA 4YP8A 5T3QA 2JDOA 4QP2A 3ZO3A 4QQTA 4ENYA 2QKWB 3SXFA 4JX7A 3FY2A 4QTBA 3NLBA 5GJFA 3E8DA 3HUCA 3QRUA 5M09A 3TM0A 3F82A 3UDZA 5JRQA 4QMQA 4RLLA 2W17A 3FLNC 4QMSA 5A6NA 5HESA 4IZ5A 2BTRA 2PU8A 4CD0A 3G0FA 4S32A 4U9AA 4QQ5A 3V6SA 4BWPA 4M67A 4BTFA 4AXEA 4KUJA 4IM2A 4L3PA 5CEOA 4EC9A 3LFCA 5HCXA 3CQEA 2W1IA 2WMTA 4S34A 4TWNA 4KB8A 5EOLA 3H9OA 3W32A 3W0SA 1BL7A 2WKMA 3PJ3A 4FA2A 3UQFA 2VWIA 4HYHA 2FGIA 4U3YA 5AV3A 3AOXA 3OEZA 4DINA 3DQXA 4GYGA 5AV4A 4LMNA 4XBRA 3W2SA 1YDSE 1JOWB 3PZEA 5GIPE 3QXPA 1O6KA 1ZYSA 5HVYA 2VNWA 3FI2A 3KRLA 4XG6A 3EHAA 3FKOA 1ZXEA 1M2RA 5FRIA 2XKDA 3ACJA 4IB3A 3RK9A 5JGDA 3IDPA 4O7ZA 3BGQA 3PXKA 3NW7A 3ORPA 4C4HA 4J96A 3OW3A 2DYLA 4F9WA 5JFVA 5HBEA 3HMPA 5BYLA 4K8AA 3E87A 3V5QA 4O22A 3OHTA 4EOKA 5AR5A 3L9PA 3P5JC 3EN7A 4FUYA 4IAAA 1H8FA 4C0TA 5A14A 3A60A 4O0RA 3ZSIA 3AKKA 1Z5MA 1WBWA 2IWIA 3QA0A 4QMNA 3JVRA 4U40A 4ZSLA 4JRVA 1CKJA 3FLSA 3MH3A 2WNTA 2JC6A 2YM5A 3AC5A 3F69A 3QX4A 2B9HA 1BYGA 2VTJA 2W7XA 3GENA 1G3NA 2R7IA 4XG9A 4O84A 5AP7A 4MBLA 2XNMA 1UU8A 5FEDA 3SG9A 5EYDA 4A9YA 4LOQA 3NUUA 4G3CA 4UMUA 4HW7A 1HCLA 1W8CA 3LFQA 4F9BA 4L00A 3HNGA 3CE3A 2PE1A 3R22A 1M7NA 5E1SA 3IK3A 3Q2MA 4FG8A 3ULZA 4UN0C 2J0LA 1B39A 3PYYA 2FA2A 3VS7A 3DXNA 5CVFA 3H3CA 3DBEA 4NIFB 1H0WA 3C4XA 3ENMA 3FSKA 2BAQA 5ANJA 5E8WA 3CY2A 5CAUA 4RFYA 1V0OA 4M66A 3ORZA 3U4UA 4EH6A 4FEQA 4RFMA 2PZIA 3GOPA 1KE5A 4OTWA 3A7HA 4Z9LA 2DS1A 4NCTA 5DIAA 3WF7A 3KIOC 3R7OA 4JR3A 2YJRA 3OBJA 4GU6A 2YM6A 4GFMA 5FBNC 2IW8A 2WEIA 4BN1A 3EFLA 5CEMA 5IA4A 4ZMFA 1K9AA 5DVRA 4FK6A 1W2CA 3R73A 1SMHA 3EZRA 5CI7A 3DNEA 4IACA 2F4JA 1Y57A 4G2FA 4RVTA 4IFCA 2UVYA 5JRSA 4QYHA 4BCNA 2XAOA 1BI8A 2X0GA 4I5PA 2XM9A 2CNQA 4FGRA 4LRKA 1SVEA 4J8MA 3KF4A 3ULIA 2BRNA 5ANDA 5EM7A 3KRWA 5GZAA 4IX6A 4RJ3A 2JBPA 5I9YA 4MF1A 3PVBA 5CU6A 2Z2WA 3LE6A 2IEWA 3R2YA 5DT3A 2XM8A 3K54A 2WQEA 4O86A 1GIIA 1J91A 5C4LA 2YIXA 4BF2A 2WZJA 2XIYA 2IJMA 3F88A 5AV1A 3ZM9A 2VO6A 3GC9A 3G6GA 5LMKA 2GHGA 1GZKA 3EYGA 2C6MA 2BR1A 3DU8A 2QNJA 3IONA 3GUBA 1H1WA 4U79A 3NVMB 3GOKA 5I0BA 4BZDA 4FIFA 1K3AA 5BVFA 3HV4A 4U5JA 4B0GA 1PKGA 3HECA 3BEAA 3I5ZA 3MIAA 2VV9A 3ZH8A 3CKWA 3U54A 4GK3A 2NNWB 3I5NA 3CQUA 2XNBA 3EB0A 4JAJA 2BDFA 2JDVA 3COIA 4PX6A 3NAYA 4O7LA 4DFXE 4H3PA 4OTFA 5CF4A 2XK7A 3LXLA 3QAME 3O5AA 4YC3A 5JFXA 5KUPA 1OI9A 2XK9A 4QT1A 1XH8A 3R00A 3VHKA 3NYXA 3PVWA 5FG8A 5J87A 3R7VA 1U54A 3KRJA 4YJTA 3UVQA 4RZWA 4CKJA 1YOLA 2QR7A 4CFNA 4MWHA 2P3GX 1Q97A 4UALA 3BLRA 4XYFA 3OMVA 5EG3A 3AT2A 4KBAA 2WMWA 3O17A 4FG9A 3SQQA 5TT7A 4ERKA 2ZFYA 5BUIA 4CZTA 5CNNA 1YHSA 2WTVA 4O91A 3V5LA 5JH6A 3UVRA 5ETCA 5JKGA 4P4CA 2C0TA 4J71A 5EYKA 2VO7A 3CEKA 3F7WA 3GCVA 4KRDA 3VUMA 3FZRA 3U6JA 3DLZA 2X7FA 4FV5A 5E8ZA 2WQMA 5CXZA 4GJ2A 5DN3A 3G0EA 3LVPA 4E8AA 4GT3A 4ASDA 3NYOA 2PE2A 1H24A 4RVMA 2YCRA 4C62A 3TCPA 2OJFE 3MA3A 2XNEA 4GYIA 3VUIA 3MSSA 4RWJA 3KULA 3U9CA 2HZNA 3EJ1A 4FTTA 3WE8A 3DFAA 3RBWA 4F65A 4BKJA 2HW7A 4QP4A 4LYNA 5CSPA 4DF3A 5AP3A 3PWDA 4MKCA 4O81A 2YM4A 3DGKA 3UDTA 3UOLA 4CG9A 1H1RA 2UW5A 3BQCA 2X4FA 4IM3A 4L7FA 3IDCA 3UOJA 4JT3A 2RFNA 4A4OA 4L9IA 4CT2A 1U5QA 3BEGA 2HWPA 2CGXA 3BU5A 1OL6A 3DTCA 4CMOA 3V5TA 4AE9A 4M12A 3ZRMA 3R8LA 4BCPA 4Z7GA 4C59A 3KVWA 4TKSA 5EDQA 2OH4A 4R6VA 3GNIB 3VVHA 3AMBA 2VWVA 1OVEA 2ZB0A 3EQRA 4D5KA 1CKIA 3DBFA 4S33A 3OBGA 1KE9A 2GHMA 3MH2A 2WTJA 3DTWA 4O7VA 3I7BA 4DFUA 5HZNA 4JDHA 2E9NA 4AOJA 4FT5A 1H1SA 1STCE 1GJOA 2OJ9A 3CXWA 1P2AA 5FLFA 5HG5A 4CTCA 4D28A 3NVKI 1OPLA 2XK6A 3A7GA 3FPQA 4D9TA 1I44A 5HBJA 5IUHA 4PTCA 3FKNA 2CLXA 4CKIA 3DJ7A 3VS4A 1OECA 3E62A 3GC0A 3HMIA 3TDVA 4ZS0A 2O8YA 2IVSA 3D0EA 1CDKA 5ACBC 3FBVA 3DBCA 4ANSA 4BBEA 4O82A 5AJQA 4M3QA 3PZHA 5IA1A 3IG7A 3H4JA 4K6ZA 4RIXA 1SNXA 4B7TA 3WZJA 5LXMA 3UNKA 4FIGA 4GT4A 3UE4A 3WYXA 3H9RA 3SXRA 3LXNA 4JG7A 3BHYA 3Q52A 5BVOA 5AWMA 5HE0A 3E5AA 4BIDA 5CSVA 3OVVA 4MF0A 3TV4A 3MPMA 5E8SA 2F2UA 5KBQA 3MY0A 4H3BA 4IM0A 3IKAA 2B9FA 3CTQA 5AR3A 1YW2A 4WUNA 3RGFA 4XOZA 4ZAUA 1M2PA 2P2HA 3LPBA 2EUFB 3PRIA 3FJQE 3LFNA 3LLAA 4FJVA 2CNVA 4YJRA 1JKKA 4NM3A 4F64A 2UW3A 1OIQA 4JR7A 2AC3A 3S95A 4AACA 3VBVA 3FLWA 4W9WA 5I9UA 4KS8A 2O5KA 3D7TB 4F6WA 2C3IB 4HGLA 2QU6A 3G5DA 2OH0E 3OROA 3FQHA 4G6LA 4HOKA 4TY1A 4AG8A 4RC4A 5HKMA 3R1NA 4L44A 4OBPA 4RIWB 4YO4A 3R30A 4ARKA 5L6WL 4IBMA 1WAKA 2W9ZB 3OZ6A 3PJ1A 3C4EA 4V0GA 4BTMA 3FMHA 4EZ3A 3PUFC 4TT7A 2OXDA 2VTRA 2WO6A 1E1VA 2HY0A 2XA4A 3DB6A 3E7VA 3KGAA 4YLJA 2HAKA 3F3ZA 4DG0E 2YHVA 1Q61A 4LQMA 3BLAA 4IDVA 2VGOA 2E9OA 2J4ZA 4O1PA 5DRDA 4BKYA 2WFYA 2QG7A 4EK6A 2C5NA 3ZZEA 1E9HA 2JGZA 2WEVA 3BGZA 3CPBA 4KNBA 5BUEA 1UKHA 2VTAA 2ZDUA 3LXKA 4I1ZA 4L3JA 3EQPA 4Q5HA 4U45A 4CFUA 4DFYA 3OY1A 2OZAA 1UVRA 2VTLA 3CC6A 3R01A 4DEBA 2Y4IC 3HV3A 3PSCA 3L8PA 5LVLA 2YM7A 4TW9A 5M57A 3G33A 4YPDA 2XALA 3PVGA 3D14A 3QRIA 4AGUA 2CSNA 4PWNA 2G2FA 4WO5A 4E93A 4JQ7A 2XKCA 2CMWA 3E8CA 1GZOA 1PXKA 3IW5A 5I3OA 5G1XA 4QMLA 4XP0A 1B6CB 2XRWA 3B8QA 3UZPA 2B7AA 3QGYA 4I5HA 4LUEA 3R9HA 1MRUA 3GP0A 2ZM1A 3RHXA 5D10A 4ANLA 4EONA 1T45A 5HE1A 3MDYA 3ATSA 4ITIA 3W0RA 3ZYAA 5EHLA 3I7CA 4KD1A 4FKPA 4B8MA 2VWYA 4FKGA 1I09A 1DM2A 5IQBA 3ZC5A 3LCSA 2QOLA 4RVLA 2FVDA 3HA6A 4AXFA 3F61A 3PIZA 5E4HA 5CAOA 5IH6A 4TWCA 4YZNA 3FMKA 4FV8A 2PTKA 1W83A 4C34A 2FO0A 2XYNA 3BU3A 4F6UA 1APME 3BV2A 4QTDA 4Y85A 4E4XA 4D2VA 5C8KA 1H28A 4IZYA 2J0KA 2VTHA 4AZWA 4EKKA 2R0IA 3S00A 1OKWA 2XEZA 2A4LA 4JBOA 2ETRA 3O23A 4TYEA 4Y8DA 3D83A 3LLTA 3T3VA 3AD4A 3MW1A 4RWIA 2W1ZA 2QOOA 4IFGA 3ZXTA 3MTLA 4IJPA 4USFA 4R1VA 1XHAA 4GH2A 5LMKC 3RK5A 5JQ8A 3LQ5A 3C1XA 3THBA 3V6RA 5HHWA 4DGOA 4O4FA 3ZCLA 4C37A 1P14A 3A8XA 4UXLA 4D2WA 4ACCA 5KZ0A 4FX3A 4BI0A 3I60A 1OGYA 3LCTA 1J7UA 2CNUA 2WAJA 5HU9A 1WBVA 2VTOA 1O6LA 4O0UA 4PMSA 3II5A 4HNFA 3SAYA 5JSMA 3VS6A 2W1HA 4RIYB 2VO0A 1ZYLA 4CXAA 4U42A 3HAMA 3MJ1A 4S31A 5BQ0A 5DYJA 3R7YA 3FXWA 2GHLA 2QO9A 3LM0A 3PP0A 4GV1A 4U43A 2HK5A 3KXXA 5HD7A 4PDYA 4AXDA 4FRFA 4FNXA 4Q9ZA 4RJ8A 3A7IA 3T9IA 2WMRA 2YCSA 4I93A 3TWJA 4WG3A 2GNJA 4XCUA 3VS2A 3ZUVA 3LFBA 1XBCA 3HRFA 3FZ1A 2J50A 4FV0A 3FMDA 2JFMA 3DA6A 3SOAA 2BHEA 1Y6AA 2YM3A 3UG1A 4DTBA 3NUSA 3L8VA 4PPBA 4QTCA 4J8NA 4R7HA 3R83A 5ANOA 4CQGA 5KKRC 2YJSA 5ANGA 5JFWA 2V22A 3R28A 4QOXA 2E9VA 3V8WA 3VBQA 1KOBA 5DMZA 1H01A 4XEYA 3TXOA 4BCJA 5LWMA 3RAHA 4HVGA 1YKRA 3N4VA 1W2FA 4FT9A 4MK0A 4MTAA 2PMOX 2V0DA 3ORNA 4L8MA 3SA0A 2CDZA 4YLLA 5HBHA 4HVDA 4I4EA 4E5AX 4BDFA 4BB4A 2OF4A 3DXQA 5C03A 3F9NA 4FT0A 3SHEA 5DT4A 4ACMA 5AP5A 4FTRA 3ZSGA 3R0TA 4N70A 5A4EA 2IZTA 5FDPA 5AV0A 2HZ0A 2X0PA 2PULA 4O21A 4A7CA 4CCBA 5A4QA 4GKHA 4CSVA 4MXOA 3FKLA 1FQ1B 3QCSA 3UYTA 5E1EA 4YJNA 2ZM3A 3QHWA 4BRXA 2ITTA 4NUSA 4R1YA 5FUTA 3D4QA 4C7TA 4EH8A 4I0TA 5AUXA 2V5QA 4IB0A 4PDSA 2Y8OA 3MPAA 3N9XA 5BX0A 1OGUA 2JFLA 4FZAB 4X2KA 3EFWA 3AXWA 3VRYA 2X6DA 4LV8A 4CKRA 4I24A 2VTQA 3MA6A 3ZDUA 4DLIA 5EW3A 2V7AA 2XMYA 4MNEA 4BHZA 3NUNA 4FICA 3F3UA 5E8UA 3ZTXA 3BI6A 1U46A 5H9BA 4ZLYA 3QZFA 5IKWA 5KBRA 2KULA 3C4WA 2JLDA 1KSWA 4M8TA 4BDJA 2C6EA 4HZSA 4I3ZA 4QMYA 3DOGA 4YHJA 1QPDA 4AQCA 5C1QB 5L2QA 4NL0A 1A9UA 1TVOA 4I0SA 5IF1A 3FZTA 4HNIA 5EHYA 3UQCA 3F3TA 4X0MA 5HD4A 2A19B 3VONA 5E90A 4FKVA 4JDJA 1GOLA 2RG6A 3O2MA 4BJJB 1A06A 5M4CA 3TJCA 2R3FA 3HVCA 2XF0A 4EH7A 2ACXA 3HV5A 3KY2A 3MVMA 4YJSA 2JKQA 3UIBA 2Z7SA 4AOIA 4IIRA 3IDBA 4MQ1A 4O0YA 5C9CA 4D4VA 4YZCA 5EQEA 4WD5A 5CEKA 1SYKA 1R1WA 4C02A 4BGGA 3R6XA 2ZVAA 2ESMA 2OJIA 1M7QA 2GNHA 2CKQA 4NW5A 5K5NA 3JUHA 3F3VA 2PVYA 3L9MA 4U6RA 3HRBA 3CBLA 3CGFA 3SLSA 4CCUA 3UIUA 4BICA 1U4DA 3ORXA 5J7HA 2XKFA 5BMMA 3W2PA 3P7CA 1Q3DA 4DBXA 4J99A 4AW2A 4D1XA 5EI2A 4ZP5A 4KSPA 3B8RA 4XOYA 2RF9A 3FI3A 4YSMA 2C6KA 3D5XA 4YHTA 2B55A 3VW8A 2PPQA 4JDKA 2C6IA 3W0NA 4O7NA 1U5RA 4Y83A 3U87A 1OUKA 3A8WA 3EWHA 1W0XC 3PLSA 4U3ZA 3LQ3A 3EN9A 4FNYA 4BCIA 3D5UA 4WUAA 4LGDA 3NFGB 3P9JA 4HGEA 3ENHA 4YMJA 3NX8A 3RZBA 4I20A 4IAKA 4C4GA 3BHUA 4F1OA 3ERKA 3SXSA 5HICA 4IVBA 3HMNA 4ALWA 3OUKA 5D1JA 5E7RA 1G5SA 5AP4A 1LEWA 3DK7A 2E9PA 5B2MA 3TDWA 1L8TA 2OK1A 4KBCA 1OKYA 5M56A 4PF4A 4ASXA 3A2CA 4FZ7A 4MWIA 3REPA 2JEDA 2QODA 4EOPA 3F5PA 5DT0A 4P2KA 4XP3A 3RAKA 3O8UA 4S30A 2WMAA 4GG5A 3WOWA 5BPYA 4M14A 4UEUA 3EN4A 3PY3A 3WZKA 5AIKA 5LJJA 5KE0A 2AC5A 3D5WA 4FTCA 5LWNA 1OKVA 4KA3A 3U4WA 5JZJA 4N57A 4ID7A 4PDOA 3EQIA 3HEGA 3LW0A 4IJ9A 3V04A 3DCVA 4X6QC 3PIYA 1J7LA 4R5YA 2PVKA 2H9VA 5TKDA 3UP7A 2PVMA 4M68A 3V3VA 5L8JA 3I79A 3GGFA 4E7WA 2BDJA 2B0QA 3LAUA 2OJGA 3DAJA 5HO8A 2R3MA 1T46A 1W7HA 2YN8A 4FIJA<