3DBEA

Crystal structure of an activated (thr->asp) polo-like kinase 1 (plk1) catalytic domain in complex with compound 557
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
287
structure length
284
Chain Sequence
KEIPDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVFAGKVVPKSMLLKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMRQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIEFDGERKKDLPNYIAPEVLCKKGHSFEVDIWSLGCILYTLLVGKPPFETSCLKETYIRIKKNEYSVPRHINPVASALIRRMLHADPTLRPSVAELLTDEFFTSGYAPMRLPTSCLTVPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Polo-like kinase 1
publication title Design and synthesis of 2-amino-pyrazolopyridines as Polo-like kinase 1 inhibitors.
pubmed doi rcsb
source organism Danio rerio
total genus 73
structure length 284
sequence length 287
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2008-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dbeA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dbeA01
2HENA 3ORPA 5HCXA 1Y8YA 2QOBA 3WZUA 4W8DA 4QMXA 3HAVA 2RL5A 5E4HA 3ZFXA 2A2AA 4QMOA 2R0IA 3EZRA 4YTIA 4YC6A 3P23A 3PJ2A 4CFWA 2WMRA 5FGKA 3IW7A 2BTRA 4JRVA 3RALA 3ZU7A 3G5DA 3GXLA 3OEFX 4A9UA 5H9BA 4FEVA 4ANSA 4O21A 1PXOA 4L46A 5LVLA 3REPA 1M52A 4C58A 2UVYA 3FYKX 4EHVA 5DA3A 5A4TA 4M84A 2R7IA 5EYKA 5E8YA 4EBWA 1UNLA 1V1KA 4KD1A 4ZJVA 3L9MA 4QMQA 4GU6A 3PVBA 1XQZA 2PTKA 3DQWA 3C13A 3OEZA 3NUNA 4IDTA 3TKHA 1QCFA 1PKGA 3PSDA 4CFFA 2WELA 3BU6A 4I6HA 3NUXA 2CKEA 3CCNA 3PJ3A 3BHHA 3QTSA 3UO5A 4PY1A 2WTDA 4NKAA 2ZYBA 4OTQA 5C1QB 2PZ5A 5IQDA 3MBLA 4ZJJA 1F5QA 2VTPA 5M4IA 4BZDA 2WTJA 3S2PA 3SKCA 2IW9A 4R6VA 3P4KA 1B39A 2B52A 4JI9A 5AX9A 5AR5A 4KAOA 3QTXA 3IW4A 3G9NA 3P7CA 5IISA 4EK5A 2CMWA 1EH4A 4AW2A 1XH8A 1BI8A 3D4QA 3I6UA 4ZK5A 4BCPA 3ANRA 2XH5A 4Y95A 5HG8A 3VN9A 3HL7A 3FXZA 3CJFA 4YNEA 3UDBA 2F4JA 3CP9A 3FC1X 3ZC5A 4TYEA 4Y73A 3TCPA 3DV3A 4NWMA 5BVKA 2P55A 4C8BA 4M3QA 2I6LA 4UEUA 3VWAA 4M97A 2ZVAA 3FBVA 4CFUA 4DYMA 3VHKA 5J95A 4EH9A 2BAJA 2VGPA 5CEQA 2REIA 4I5HA 3VUMA 5IQFA 3UMWA 4Q9ZA 2W1HA 4ZTSA 4RJ4A 3DB8A 4V01A 5J1VA 1L8TA 3ZCLA 1Q8WA 5G1XA 2XA4A 3MV5A 4AN3A 1ERKA 3O7LB 1CDKA 4UYAA 1XJDA 1GZ8A 2WMXA 5CXZA 4FT7A 3ZYAA 4AE9A 4B6LA 4WKQA 5FEDA 1DAYA 5AR3A 4BDAA 2YM3A 5IQAA 1WVYA 2XIZA 4WO5A 3RHXA 2BKKA 1V0PA 3R02A 5AUXA 4EC9A 2Y6MA 1VYWA 5FP6A 5L4QA 5IH4A 4OR5A 3P5KA 3VBXA 4NIFA 4DHFA 4JBPA 2ZV9A 4NCTA 5IQGA 3HVCA 3LPBA 3UG1A 2RFNA 4KIKB 5FLFA 4L3JA 3PWYA 4OUCA 3DKFA 3QTIA 2UZVA 3VRYA 5BNJA 3E7OA 3QKKA 3DDPA 2J51A 5IF1A 4GSBA 4G5JA 2QR7A 4W9WA 1BL7A 4K18A 4BDHA 1P14A 4MXXA 4BI0A 3FXXA 3GVUA 3HV5A 3R7VA 3GGFA 4GKHA 4L8MA 5ETCA 2VD5A 3II5A 4R8QA 4RFMA 2C47A 2XS0A 4LM5A 4IW0A 4KSQA 2HY0A 5CZIA 2XBJA 2FSMX 5KKRB 4C4JA 3EQBA 5DI1A 4ZTRA 2WQBA 1H1QA 3OBGA 2XK6A 5FTQA 5A4LA 1UKHA 3NUSA 3JY0A 5D7AA 3BRBA 3OT8A 4P5QA 2HW6A 3NYVA 3ODYX 4ACDA 2BHEA 4TYHA 4FEQA 4FIFA 4XUFA 2X7FA 3PE2A 1PKDA 4APPA 2GNIA 3FPQA 1H25A 5L6OA 4RWLA 5I9XA 3EFJA 3Q9YA 2GNLA 1PXNA 3COIA 2RG6A 2XVDA 4IFCA 1FGIA 5HX8A 4ITJA 5HI2A 4S31A 5T3QA 2BILB 2NRYA 2XB7A 3MA3A 3CD8A 4OTDA 2XIRA 4KS7A 1J7IA 2Z7RA 3G51A 1WBVA 4NFNA 3ALNA 3O50A 4Y5HA 5K3YA 4FSMA 3PP0A 4ONAA 3U8WA 2GNJA 1M2PA 3NR9A 3QTRA 3LFQA 2NP8A 3CC6A 4FSUA 2WTVA 3CGOA 3GU8A 3LCOA 3TI1A 1ZYSA 3SG9A 5IA4A 2BZHB 1KE5A 2WMTA 1V0BA 3MS9A 4JDKA 4QMMA 3UVPA 4D1XA 2PVYA 4D4RA 3SW4A 1LP4A 3DAEA 4BICA 1NVRA 3W2CA 3OTUA 1CKIA 3VO3A 3NYNA 2FA2A 4XEYA 5L2SA 2YZLA 3NIEA 4FICA 4H05A 2WTWA 3ZM4A 4U80A 5EK7A 5L8JA 2QOIA 2QOKA 3RK5A 4ANOA 4BZOA 4QMPA 3L8SA 4PMMA 1GY3A 3SHEA 4L7SA 4RC4A 4CMTA 4E6QA 3QXPA 4CLIA 2UUEA 4PTCA 3UPZA 4F7LA 4QMZA 5L2WA 4LMNA 4O82A 5DR2A 2YA9A 4YR8A 5DPVA 5AM6A 3Q2JA 3OW4A 3LJ0A 1OUKA 3F3WA 5AR7A 3W2RA 3R71A 4ZLZA 3UIBA 1DI9A 2X39A 2W5HA 2XK3A 3G2FA 5EYMA 3AD5A 4QMNA 4XOZA 2W1EA 4FV0A 5AR8A 4ANMA 4X3JA 4WRGA 4QNAA 3LQ8A 5AP5A 4U97A 1H1PA 2VUWA 5JRSA 2DWBA 3GEQA 4HGTA 4V04A 4XG2A 4FNXA 3VS1A 2YDIA 3JXWA 3OWPA 5IA2A 3F3TA 2YLFA 2X81A 2C5VA 2ERKA 1BUHA 3BV3A 3MPTA 3ROYA 4TRLA 3ZTXA 3DZOA 4TT7A 4HYSA 2XRWA 4D1SA 4BBFA 3A4OX 3V5QA 4RWIA 2X0GA 3VUHA 5I0BA 2XK4A 4CZTA 5J8IA 5JQ5A 4ZS4A 3IONA 3QTWA 2JITA 5CVFA 5JN2A 1UKIA 3NGAA 1PXMA 5LVNA 3A8WA 4FTTA 5HBJA 4QPSA 4W4VA 4AZWA 5AV0A 2BUJA 4CVAA 2W4KA 3H9FA 3T8OA 4DH1A 3ANQA 4DINA 1Q61A 4I93A 2UW4A 2WTCA 1ZYLA 1JBPE 2FH9A 4G1WA 3VF9A 4GVAA 4EQMA 2XIYA 2YCFA 2CGUA 3G0FA 5IEYA 2VAGA 2VTJA 4EOJA 3LMIA 4GG7A 4XG3A 2BHHA 2CN5A 5ANEA 1UU9A 4C2WA 2FYSA 4ITHA 4ZSEA 3GI3A 2JDTA 3O8TA 4I5CA 5CF6A 3K3JA 4FTRA 4D4SA 1UU7A 2H9VA 4GMYA 2Y8OA 2WOTA 3DKCA 1YHWA 3VS3A 4H39A 1OKWA 4FC0A 3C4FA 3U51A 3SW7A 1Q8YA 3E88A 1UNHA 3PY1A 5HE3A 3T9IA 3KF7A 5J9LA 4K1BA 5A4QA 4XMOA 3C9WA 4NK9A 4E6DA 5JK3A 3LFAA 4C2VA 5BYYA 4OBQA 5GINE 4N6YA 2QC6A 4MK0A 2HWOA 1Q4LA 3ZLSA 3HRCA 4CMOA 3AT2A 3C1XA 2C5NA 2W06A 4IJPA 2ESMA 4HCUA 3TZ8A 5FEQA 4UV0A 3M1SA 3QYWA 4W4YA 3ZBFA 5B0XA 1B6CB 3LQ3A 1WBPA 1GIJA 3RPRA 2NNWB 2PSQA 4CNHA 4GK2A 5HD4A 5HX6A 3WZEA 3KK8A 2XJ1A 4DCAA 4L6QA 4H58A 2VU3A 4YZDA 3FMEA 5CT0A 1YOJA 3A61A 2O0UA 4YZBA 4DG2E 1KV2A 5DFPA 2I0YA 3GCVA 3NDMA 3QGYA 4FV7A 5A46A 1LEZA 3QD2B 5DOSA 3FJQE 3PXRA 4M69A 3NUAA 2XNPA 5E8XA 4GK4A 4FEXA 1RE8A 3PXFA 2JKQA 5GJGA 4AFEA 4CG8A 5DMZA 5AUUA 4WT6A 5A54A 4EHGA 4LL0A 5K4IA 5LXMA 2XUUA 4ZY6A 2QO9A 4RWJA 4G2FA 4ZOGA 3UIXA 4AW0A 3VW6A 3F2NA 5CF8A 3TJCA 2XNOA 5CU6A 4EQUA 2ZV2A 4PP9A 4ANLA 2W7XA 2UW3A 4LL5A 5JGDA 4X21A 4FSRA 3UQGA 3FMDA 3GP0A 2OWBA 3TNQB 2QOCA 2WTKC 1OPKA 3KN5A 4YO4A 4EKKA 4I92A 1NY3A 1OM1A 2YN8A 1REKA 1XWSA 1BMKA 2WFYA 4QD6A 3MH1A 4K2RA 2E9OA 4C4HA 3SXRA 3ZMMA 3EL7A 4BCNA 4CKRA 3EKKA 3VS4A 4UY9A 5DGZA 4Z16A 3LOKA 4BB4A 1QPDA 2C4GA 3DNDA 4FSQA 4JBOA 4RT7A 2ZB1A 4L7FA 3ORTA 4W9XA 3LXLA 4CFNA 3PIZA 3D5VA 3D94A 3LCDA 1R0PA 2ZAZA 4O0TA 3NNXA 4FV5A 3ZH8A 4GK3A 4JIKA 2XNBA 4KBAA 4RIWB 4TZRA 5M55A 3WILA 4RIYA 2UV2A 2ZDTA 4WSQA 5H8BA 5L2TA 2ERZE 3R7GA 3BYOA 5FRIA 2J0MB 4A07A 2AC5A 4QP6A 4YJQA 5FM3A 3CKWA 4J95A 4O6EA 3ZUTA 1R3CA 2YHVA 1S9IA 2Z7SA 2PYWA 3OG7A 4F08A 4FKQA 3R2BA 2YIQA 5JZNA 2VO6A 2P33A 3A62A 3CS9A 3IDCA 5FXSA 4ZEGA 4ANNA 3DK7A 3CBLA 4MWIA 5BVEA 3AQVA 3GT8A 5CQUA 5M53A 4E7WA 3H3CA 1WMKA 2OIBA 3V51A 3PVGA 5HKMA 4EOSA 3A99A 2E2BA 4X3FC 2E9NA 3LJ1A 1ZMUA 1UWJA 2QHNA 2JDRA 4V05A 5C03A 1OBDA 3HRBA 2X6DA 2OLCA 4TNBA 4ACCA 3BEGA 3KMWA 2B0QA 5CXHA 3TNHA 2P3GX 3FZ1A 4QQCA 3QCSA 5H8GA 3PA3A 2X2KA 4BHZA 5DR9A 5E8VA 2R3MA 2JIVA 4KB8A 3PY0A 4QP3A 3EKNA 4D0XA 2VTMA 2IVTA 1REJA 4J71A 3NCGA 4D55A 3N4TA 4X6QC 3Q04A 3WE4A 5L2QA 4P2KA 1TQPA 5IUIA 4XS2A 5BVWA 4BWPA 4C61A 3IKAA 4NUSA 3NEWA 4DC2A 4UMRA 4ID7A 4OTGA 3F3ZA 4AN2A 2PULA 4D2TA 3F61A 3PE1A 4XP0A 3CLYA 4FEUA 4FT9A 4I0TA 3NMUF 3AC8A 4O0VA 3SVVA 4NIFB 3OUNB 3RAIA 4EZ7A 3EN7A 3GFWA 3PPZA 5HU3A 4D5HA 2JC6A 4V0GA 3AG9A 4O83A 3VIDA 4FTMA 4X2FA 4BDDA 5JGAA 2BZJA 4MBIA 3IW8A 4LOOA 4CZUA 5AX3A 4AW1A 5D41A 3HYHA 4PF4A 4UWYA 2PMNX 5EW3A 3HV7A 4FNYA 4GT4A 2YJSA 2JD5A 3SD0A 3E63A 2W9ZB 3OCTA 3ULIA 4DH7A 4MXZA 2XKEA 4JG7A 4J52A 3TUDA 2JBPA 3I7BA 4C36A 4MWHA 4FOBA 2R2PA 1ZAOA 3SV0A 3KMUA 5DH3A 5HLWA 2WB8A 3FLNC 5LWMA 4B8MA 3DAJA 2O64A 1DS5A 4U42A 4EH5A 4FA2A 3ZFMA 5AA8A 3NUUA 1JKSA 2PE0A 4G3CA 3MIAA 4MEDA 4ALVA 1UU8A 3W2SA 3QZHA 4AOTA 4ZY5A 3LLAA 1PY5A 2J0LA 3HV6A 4P90A 3QZIA 5BYZA 4DEIA 3PJ8A 4BDCA 5D7VA 3HA6A 4FKPA 3IK3A 4FSZA 3MFTA 4YZ9A 3ZOSA 3PDTA 3NW6A 1Q41A 5IQCA 2JIUA 2Q83A 2YIXA 5KMOA 4BYJA 3H0ZA 3UE4A 4BKZA 4GEOA 2IW6A 3QQGA 2XP2A 1X8BA 2Z7LA 5CU3A 4HCVA 2YAKA 3UZTA 2BDWA 4RJ5A 3TNIA 4R77A 2XKFA 3I81A 2WMUA 3E3PA 5E8ZA 4FNZA 1WBTA 5CASA 1JSTA 1XO2B 3C4ZA 4G3DA 4PDYA 4HZRA 5JH6A 1M14A 3O7LD 5HIDA 5IA5A 4HVHA 2B9IA 3HNGA 3CJGA 1J91A 3KL8A 3RAHA 5TKDA 3POZA 3ZRLA 4OTWA 4XV9A 3B8QA 4C02A 2C6TA 2GHGA 3SA0A 2GFSA 2JAVA 2VNWA 2WU7A 3KKVA 4UWCA 5IG1A 5IH5A 4JRNA 5HZNA 1WVWA 3QBNA 4AACA 3EFKA 4NW5A 3VS5A 2PZRA 4BKYA 4L42A 3SG8A 5ANDA 3LCTA 4IVBA 4F9CA 2O2UA 5EHYA 5ANJA 5CSPA 4C57A 2F2CB 5E90A 4YC8A 5AP1A 5IZFA 3LFFA 5CI6A 5FP5A 1F3MC 3FY2A 2GU8A 4E6CA 2QG7A 4E4XA 4M0ZA 4FV2A 1J1CA 3Q53A 1YQJA 2CJMA 3EWHA 1U54A 4RLKA 4DGOA 2NO3A 2FGIA 2C30A 4KINA 4EK4A 1OUYA 3NUPA 3Q2MA 1KE6A 2W96B 4Y83A 3VRZA 1RDQE 4MF0A 4DE4A 2PMLX 3ZHPC 3NAXA 4GYIA 4BCGA 3VS6A 3ZXZA 4JS8A 5KMNA 3RPOA 1Y57A 2OF4A 1PF8A 3FZOA 4AZVA 4BF2A 3LFSA 4L3PA 2UW7A 5HHWA 4FBXA 4D58A 4Q5EA 2GQGA 4J53A 3G6GA 3CE3A 5CAVA 3S95A 4Z55A 4YO6A 4YMJA 3ETAA 2JDVA 4AZTA 5EYCA 5EG3A 3R9NA 3RM6A 3ZUUA 3KQ7A 1PXLA 4UMUA 4IMYA 5FBNC 4BDKA 5DT0A 4YJUA 4GFMA 4P4CA 4G3FA 2R3PA 3EH9A 1GZOA 5C9CA 3PG3A 4R1VA 3KA0A 5I9YA 3DJ7A 3MH3A 2BIYA 4E4LA 3T3UA 4RSSA 2EXEA 4F7SA 2OJFE 3MYGA 3R9HA 5B7VA 1SZMA 2YCSA 4FR4A 3F2AA 3WYXA 2XIKA 1KOBA 1PJKA 3LW0A 2CKOA 4HYHA 3VUKA 2ETMA 1VJYA 2XJ0A 2B9FA 3VVHA 3QU0A 3AT4A 4RMZA 4FTQA 1E9HA 1ZWSA 1OGUA 2CGXA 3DDQA 3HMMA 2OZAA 4OTIA 5HO7A 2WQEA 1CMKE 5HBEA 4BWKA 3ZM9A 2XEYA 3PG1A 3V5WA 4F9BA 5CSXA 5L6PA 4IC8A 5F9EA 3KY2A 2VTHA 3D2IA 5KX8A 3G0EA 4OBPA 3WARA 3RAWA 4LQMA 3ATTA 4U41A 4WRSA 3VJNA 5GJDA 4A7CA 5CAOA 5LCKA 4IACA 3FQEA 2OI4X 2QNJA 3ORKA 2AYPA 4MXYA 3A7HA 4FZ6A 2GQRA 5JKGA 2X4ZA 3BLHA 5DT3A 3R1QA 4D5KA 4E8AA 3HMPA 2OBJA 2YISA 4DEAA 4WG3A 5JSMA 5EM8A 2X2MA 2XRUA 1WVXA 2BAKA 4BYIA 2F7XE 1Q5KA 3V04A 4EOLA 3OW3A 4EH3A 5DVRA 4EUTA 5GIOE 4AF3A 5LMKC 3FEGA 5IMXA 3HMOA 2BMCA 4PMPA 4FV4A 3LZBA 4RVMA 2R3IA 4AU8A 5BMSA 2ZDUA 4JG6A 5HNIX 2UZLA 3BU5A 4MF1A 2YCRA 3HLLA 3KRWA 4EOKA 3EQGA 3EMGA 4GRBA 4L67A 3AC5A 3O2MA 3OHTA 5AUVA 3VS2A 5CAUA 4EQCA 3C5IA 3NS9A 4IBMA 4AGDA 2E9VA 3UQCA 1R78A 4CFMA 5D9HA 3FLWA 3S4QA 3EFLA 3UTOA 3AGMA 4ASZA 2ZJWA 1OECA 1U59A 2UW5A 3NZ0A 3P0MA 5KHWA 4FTJA 3TNPC 4G6OA 4H3PA 3ZBXA 4EJ7A 4I1ZA 1OKZA 2Z2WA 4OTPA 5HOAA 3VBTA 4F6UA 3FKLA 2C3KA 4FKGA 2CPKE 2PUNA 3ODZX 4FVQA 5CNOA 4BVUA 4DT9A 3MFUA 4KIQA 2WTKB 3VUTA 4DEHA 5ICPA 4F70A 1SVHA 4FVPA 5LOHA 3PXYA 2C3LA 5FXQA 1M2QA 2XCKA 4HW7A 5ITAA 2DUVA 2ITVA 3VQUA 2JIIA 5EOLA 2OK1A 4DGNA 4JAJA 4IB5A 1TQMA 4FKVA 3HMNA 3MPMA 3V01A 2VWXA 2VX3A 2YEXA 1ZOGA 3Q32A 4NT4A 4QPAA 3SX9A 3LKMA 1VYZA 5CSHA 5FXRA 4KBKA 3KXXA 4ERKA 2YITA 5CT7A 1OKYA 4XG7A 3FZRA 3KN6A 5DE2A 2OGVA 4NZWB 2OU7A 3K5UA 3I5NA 3G15A 3KFAA 1OL7A 3FL5A 4XP3A 2AC3A 3IQ7A 1XBBA 2X7GA 4U43A 1IEPA 2I1MA 4O84A 1KOAA 1SNUA 4F65A 3R1YA 4D9TA 3UYTA 2XKCA 3Q4TA 3PZHA 5HG7A 1Y6AA 3BGQA 5I3RA 4MVFA 3BIZA 1RW8A 4X3FB 4RPVA 1Q62A 4FTCA 1Y6BA 2WMWA 5KZIA 2QO7A 3F9NA 3OWKA 4GCJA 4X7QA 4D0WA 2OSCA 3IGOA 3KXMA 4RIXA 2J5EA 4K33A 4PTGA 3TXOA 3W2OA 4Z7GA 4C35A 4OLIA 4YPDA 2LAVA 2OJJA 2WPAA 2YDKA 4ACHA 4BL1A 2UZUE 2ACXA 3A7FA 2FSLX 4F63A 4NU1A 4NCTC 4JAIA 2VO7A 2E9PA 3BYSA 2GQSA 3F3UA 4MD9E 1NW1A 2UW9A 4M15A 4YSMA 5AR4A 3W8LA 4AUAA 2VWVA 2FSOX 4QTAA 2JAMA 4LGDA 3RPVA 3NYXA 4YNOA 1NVSA 4WUAA 1IAJA 3QD0A 2JDOA 1YWRA 4MNEB 4DH8A 1AQ1A 3FLQA 3FMKA 5DIAA 4DGMA 2YACA 4QYYA 4IAYA 2HCKA 2CDZA 2J0IA 4OTFA 4V0GB 2ZB0A 5GNKA 3TUCA 4DEDA 1XKKA 2B54A 3LLTA 4FTOA 4BCKA 2PUUA 2WD1A 4DFNA 3FLZA 3QQLA 4NM0A 3FI8A 4NYEA 1JKLA 3FMHA 4GS6A 5D12A 3PZEA 2R3NA 2PE1A 4AZSA 5IPJA 3GC0A 1QPCA 3E8NA 1CKPA 3AD6A 3FDNA 4JX3A 4Q9SA 4EUUA 2ETKA 3KRLA 1WBSA 1W84A 2BROA 3OZ6A 3I60A 4XV2A 4BGHA 4EHEA 4JBQA 2PZIA 2Z7QA 4A4LA 1G8SA 3TKUA 3EQFA 3OCGA 1GZKA 1V0OA 4I4EA 3JR1A 4MYGA 2OICA 3QYZA 3FZTA 3DNEA 2C3JA 1APME 1OKVA 2C1AA 4J8MA 4O2ZA 1TVOA 4J96A 1OIRA 4MH7A 4ZZOA 1HCLA 4UBAA 4X0MA 5ETAA 3FC2A 5FDXA 4ZMEA 5EI2A 5GIPE 2SRCA 4M68A 4YC3A 2C3IB 5AEPA 2VO0A 4FKSA 1A48A 4L3LA 4J97A 4YJPA 2WMQA 3ORNA 3ORMA 3RNIA 3MY5A 3UNKA 3WF9A 2KTYA 4YJOA 1UU3A 4IB1A 4C4IA 4CQEA 5CZHA 3F3VA 4Z7HA 4MX9A 5IA1A 4NJDA 5J9YA 2CHLA 1J1BA 2UZNA 2VWIA 5HBHA 1MRYA 3U6JA 5M44A 4OBOA 3UP2A 4A4XA 2GPHA 3A7JA 5IU2A 2PVHA 4AT5A 2HZNA 3IECA 2C6OA 1FVVA 4HNIA 4HYUA 4L53A 1NVQA 5CWZA 4EOMA 3AT3A 4EH4A 3FL4A 4UZHA 1IG1A 3ULZA 3TTIA 4LV8A 2CLXA 4BCQA 3RAKA 2BVAA 3V8TA 3V5PA 4EK3A 4FKRA 4MAOA 5L3AA 1JKKA 4FSWA 3IDBA 5DBXA 3DQXA 3NLBA 3QCQA 4CT2A 3OD6X 2W5AA 5J5SA 3NWWA 4MQ2A 4W4WA 1Q3DA 2ITQA 4G31A 4GH2A 1VEBA 2WEVA 4I6BA 4CFVA 3E93A 4FT3A 4PX6A 1YOLA 3NNVA 4YBJA 5TOZA 2Q0NA 4QP4A 2PVJA 3U54A 4B4LA 2Y4PA 4BBMA 3TV6A 2YERA 3Q96A 3FKOA 2QONA 3GCPA 4YHTA 5LWNA 3E5AA 4G17A 1TKIA 1Y8GA 3FSFA 3L8XA 4G3EA 1JNKA 4JJRA 4R5SA 3PIYA 4QP7A 4RLLA 3Q60A 3QAME 2IZUA 4PV0A 2HAKA 3R28A 3R8MA 3HDNA 3DK6A 3WYYA 2JFMA 2VGOA 1XR1A 4I23A 2C68A 3FXWA 3W10A 3R22A 3GB2A 4UYNA 5EOBA 3PLSA 4FVRA 5HESA 1S9JA 3W8QA 5K5NA 4TY1A 3D15A 2CKPA 4FKJA 3PXKA 5FEEA 4R78A 3QC9A 2OXDA 3DBEA 4XLVA 1P2AA 4RIOA 5EW9A 2RG5A 4QTBA 3NPCA 3EFWA 4U7ZA 3O0GA 3U9CA 3WBLA 3DKOA 3OROA 3OY3A 3HX4A 4FOCA 4S30A 1FPUA 2OW3A 4DFBA 3UO6A 3KXZA 2ITYA 5D1JA 5B2KA 5LARA 2QO2A 1G5SA 2R3LA 4RX8A 3H0YA 4C4FA 3Q5ZA 1I44A 3THBA 3QX2A 3L8PA 2C6EA 4C0TA 1FBNA 3PIXA 4IAIA 3VAPA 4FF8A 4C59A 4BDFA 2ITXA 2OH4A 4AS0A 1CSNA 3ZONA 3QCXA 3ZUVA 4LI5A 5HU9A 5IQEA 4KBCA 3ENHA 2QD9A 2C5OA 5AUZA 4AGUA 4YSJA 5DNRA 3TDWA 3DFAA 4ERWA 3KULA 4RC2A 4AZFA 4IM3A 2EU9A 5EM5A 4DEGA 4F0GA 4RVTA 3UOKA 3ORZA 4RX9A 4II5A 4K8AA 3QHWA 4XV3A 1Q8TA 3MVLA 3NNWA 4O22A 4ZSLA 5IH6A 3FWQA 1ZYCA 5J79A 1OZ1A 5CEKA 1MQ4A 2JKOA 5KMIA 4BIDA 5E8SA 1W83A 3BBTB 5TT7A 3SXFA 4NKSA 3W33A 5B2LA 1QPEA 3QHRA 4Q2AA 4YURA 2HZ0A 3LM5A 4ZTLA 3ZZEA 2OZAB 4B0GA 4RZWA 2BKZA 3TV4A 2PE2A 4QNYA 3Q9WA 2Q0BA 4NM5A 4DF3A 2C6MA 2PZYA 2XMYA 1XH4A 3D7ZA 3O17A 2C6DA 2UVZA 5TF9A 5C8NA 1H27A 4QP9A 5LCJA 3DBFA 4I94A 2X2LA 3P9JA 2R3JA 2WIPA 3ZLWA 4E4NA 4APCA 1OL5A 5HE0A 2CSNA 1HCKA 2YDJA 2PVRA 1H1SA 4GV1A 3NVMB 5IA0A 4U9AA 4FT5A 3F2RA 2KULA 4AFJA 3LE6A 4WNOA 3QALE 2CKQA 1YHVA 3GQIA 2F9GA 2X7OA 3JYAA 1NA7A 3I0QA 1FOTA 2R64A 4AA5A 2FUMA 4IE9A 3UYSA 2IG7A 5DG5A 3FAAA 3QFVA 4FIHA 4HGEA 2IWIA 2O5KA 3SRVA 3W1FA 4QQJA 2ZM3A 3OC1A 3Q9ZA 4RFYA 2W4OA 5JQ8A 4HNFA 2IZSA 3GU5A 4XV1A 4GT3A 1ZOEA 1ZZ2A 1YXUA 3C5UA 3VS7A 4M8TA 4BHNA 5K4JA 3RZFA 2GNGA 3R1NA 4RZVA 4AE6A 5L2IA 1IAHA 1GJOA 2YWPA 4BDEA 5JGBA 4IM0A 2XJ2A 1OIYA 1YDRE 2VWWA 3UBDA 4O7YA 4LGGA 4HYIA 2PMOX 5EDRA 4FG9A 4MHAA 2UZOA 3CTJA 3F5GA 4MQ1A 4LG4A 2W1ZA 5ANKA 3ZEWA 4RQVA 4KS8A 2JKMA 4PL5A 3P1AA 3G9LX 3B2TA 4GVJA 5HVJA 4UXLA 3V6RA 3R9OA 4IB0A 1Z57A 4TYIA 1SVEA 3DBQA 3RPYA 4X2NA 1MP8A 5HEZA 3UIMA 1R39A 3QTQA 4M66A 4QTDA 4F99A 3ZC6A 5HORA 3F5XA 3KVWA 5TR6A 2EB3A 3TL8A 4FIEA 4MCVA 4BTJA 3R7IA 1IA9A 3CQWA 4AA0A 4LRJA 4C62A 5A9UA 1PMEA 4YHJA 3VUGA 1CM8A 1YI4A 1GIHA 3BWJA 3NUYA 4UWBA 2J0JA 4MBJA 4JQ7A 5ACKA 3DXPA 3UP7A 5EKNA 2VTRA 4FZDB 4C4GA 2JLDA 5KO1A 4XCUA 3M11A 4RG0A 4I0RA 3DPKA 3OWLA 4IWPA 4JXFA 5EDPA 4EH7A 2GCDA 4NH1A 4R7HA 4CKJA 5HCYA 2YCQA 4BBEA 1KE7A 4QYEA 4C33A 3IG7A 3UNJA 4ZLOA 4GL9A 3ZLYA 4MBLA 3PA4A 2G2FA 3QXOA 3A7IA 5AIKA 4M14A 3K54A 2WHBA 4D4YA 3UZPA 3Q5IA 4F4PA 5E92A 4C7TA 5AP3A 3OCSA 4A9TA 5BMMA 1MQBA 4F6WA 4IVCA 2I40A 2YJRA 2WKMA 3BU3A 3GC9A 3BE9A 3E62A 3WIGA 4YTFA 3MVMA 3QX4A 4JG8A 1PXKA 4CTCA 4DFZE 4D2WA 3CR0A 3TKIA 4R1YA 1GAGA 3R7UA 5CAQA 4ZZMA 4MXCA 4PP7A 4PDPA 5ACBC 3MIYA 3PVUA 5AFVA 3EQPA 4EH2A 1KUTA 4L45A 1LEWA 4IZ7A 4KIPA 5A6NA 3MTFA 2X4FA 5GJFA 2JGZA 3RTPA 3AC1A 1TQIA 4RIXB 5EYDA 2QCSA 3AC3A 4QMLA 4AZEA 2BRBA 1OIQA 3CEKA 3RK7A 1ND4A 4QP1A 2GNHA 3GU6A 4KIOA 4J7BA 3TDVA 1XBAA 2HXLA 5EM7A 4O7ZA 4FIGA 2PL0A 5AAGA 2WGJA 4U44A 1H00A 3NW5A 3SLSA 2YLEA 4K0YA 1W0XC 2I0EA 2WQOA 5M4FA 1JPAA 4RQKA 2H96A 2DS1A 5D11A 3PXQA 2W17A 3BEAA 2WQMA 4DN5A 4IC7A 3FHRA 4UMPA 4WNPA 4OTHA 3R6XA 3UVRA 3IPHA 3KF4A 4KIKA 4FV8A 2J2IB 4XG9A 3HV3A 1YDTE 4E1ZA 2F49A 5I5ZA 3PRIA 2JEDA 2XNMA 4LUDA 3BPRA 3D2KA 4S33A 1ZARA 3OWJA 2J5FA 5EDQA 2QU6A 1CKJA 3U6IA 2G1TA 4ZY4A 3FMNA 5HLNA 3QQKA 3LIJA 4LUEA 4RX7A 4YPSA 4WG4A 4E73A 5JFXA 4TYHB 4EZ5A 3OP5A 4DAWA 3AMAA 3D5UA 4FZ7A 5H8EA 5KE0A 4BRXA 3EB0A 4ZTHA 3GCSA 3B8RA 1R1WA 2V62A 4XRLA 2WAJA 3CXWA 3MW1A 4EH6A 4BTFA 2WO6A 3ZSIA 3R9DA 1Y91A 2UW6A 3MH2A 1Q24A 1A9UA 4CTBA 3FLYA 4I4FA 3VQHA 2WMVA 4H1MA 1OL1A 2PVLA 4L68A 4P7EA 4HZSA 3RWQA 4EBVA 5KMJA 2PU8A 3ZXTA 4GW8A 3PRFA 2BR1A 2HWPA 2CGVA 5A6OA 3RINA 3U4WA 3E8EA 2XF0A 3FV8A 3AC4A 4QPMA 4LOQA 4ALWA 4FEWA 4BCOA 2C5YA 4FZFB 1SNXA 2IPXA 4XBUA 4AQCA 2FSTX 4WBOA 2ZM4A 3BLRA 3QL8A 3R8PA 3V5JA 4CCBA 4DLJA 5KMMA 5M57A 4O81A 5K0KA 3R83A 4QYFA 3HUBA 3NW7A 4LRMA 3QKMA 4NTSA 4WNKA 4DA5A 3KK9A 3KB7A 3QQHA 4BC6A 5KCVA 5J1WA 4YBKA 4CRSA 5E9EA 1H1RA 2GS6A 1YWNA 3QRUA 4N6ZA 4KNBA 5M4CA 2OIDA 3FI3A 2VRXA 4FKWA 4IXPA 4S32A 5DT4A 4R5YA 5EHLA 2P4IA 4CYJA 4Y72A 4J8NA 3U9NA 3SAYA 2ONLC 5HVKA 4TN6A 2VV9A 4CQGA 2ONLA 4Y85A 2W0JA 3QWJA 4JNWA 4XNEA 2YM8A 3RK9A 3W18A 2I0VA 3HUCA 5IUGA 2UZTA 3R7OA 3PUPA 2BIKB 2XIXA 5HE1A 2XNGA 5BYLA 3UQFA 3KRRA 2O63A 3QGWA 1W8CA 3PVWA 2GS7A 3R21A 4XG8A 1KE9A 2V55A 3R73A 4PPAA 4QO9A 5GHVA 3BKBA 2GHMA 2QOHA 4HGSA 5CALA 4YJNA 2QKRA 4U3YA 1J3HA 3R30A 4WOVA 4UN0C 4ZZNA 4K6ZA 4DITA 2XK9A 3ET7A 3ZO2A 5JFWA 4JOAA 4A06A 2PK9A 4CSVA 5M07A 3PP1A 4ZXTA 3Q4UA 3VBWA 3KXNA 4BDGA 3RCJA 3OFMA 4O96A 2EB2A 1ZZLA 5C27A 3SXSA 3QA8A 1H1WA 1MRVA 3PXZA 5CTPA 1YI3A 3ZSHA 1P5EA 3A60A 3R8UA 2GMXA 2R9SA 3GC8A 5HG9A 1I09A 3LMGA 4GU9A 3DGKA 4O1PA 4U40A 3QZGA 4IZYA 4TWOA 5FQDC 3BHUA 3LCSA 4FK6A 2RKUA 4I22A 3I7CA 4UALA 4DFLA 3N4VA 3D83A 4FGRA 3ZDUA 1URWA 2R3KA 2WIHA 3VUIA 3C0IA 3MB7A 3LFNA 4X2JA 1ZOHA 4BIBA 1QL6A 4YJVA 3HZTA 4DFUA 2CNQA 1Z9XA 1NT2A 3C50A 4O2PA 2W1CA 1PMVA 3CQUA 2OO8X 4F9YA 3AGLA 4IWQA 4RJ3A 2VTAA 5HG5A 3UOJA 1Q3WA 4I5MA 1FGKA 3NCZA 3A2CA 3Q4CA 4FTAA 4L43A 4FSNA 4RWKA 3V5TA 3M42A 2B9HA 5C01A 2PMIA 2DYLA 2ZOQA 3OTVA 4RRVA 3LHJA 2Y7JA 4U81A 1JVPP 5DEYA 3R1SA 4AGWA 3MJ1A 4BIEA 5KBRA 4W8EA 1H26A 3BWFA 4E20A 5CY3A 3GCUA 3W2QA 3OXZA 3PJCA 3N9XA 5JZJA 5LVMA 5CI7A 4LFIA 5DYJA 2BAQA 4JDIA 3L9LA 4X6RA 3UG2A 4ASEA 4UB7A 3QD3A 4RVKA 3TZMA 3G90X 4FTNA 4YTCA 1FVRA 3FKNA 3L8VA 4RFZA 5AV1A 3LXNA 4H3BA 5LMAA 3VNTA 3U6HA 4UMQA 3QLGA 2FB8A 4BGGA 5I9WA 4EONA 3RM7A 2OF2A 4U3ZA 2ITZA 5F4NA 1M7NA 5EQPA 2W05A 4UMTA 3S3IA 3EIDA 5CNNA 3GFEA 4ZJIA 4IWOA 3WZKA 2IVUA 2RFEA 1PYXA 3VS0A 4C3FA 5BUIA 5A3XA 3L9PA 4IX4A 3D14A 4S2ZA 3EN5A 1RJBA 2YM7A 1YXSA 3HP2A 4R3RA 4NM3A 3TIZA 4B9DA 1J7UA 2QLQA 3QQJA 5T6KA 1YXTA 3N4UA 2WU6A 3N51A 5BPYA 2OFUA 4TWPA 2X9EA 1PMUA 3ZEPA 4OAVB 2A1AB 4XX9A 1QPJA 1WFCA 3KGAA 4J1RA 3C0GA 4IZ5A 4J98A 3CGFA 4NM7A 2F7EE 4L01A 4JX7A 5DRDA 4BCFA 4ZMFA 1JQHA 2H6DA 2EVAA 5IKWA 3SDJA 2XM8A 4XOYA 5KNJA 4N4SA 4DH3A 2XEZA 4A4OA 1Q8ZA 2A19B 2B55A 3QCYA 3R8ZA 4DEEA 3G33A 4LOPA 4M69B 3EQRA 2XBAA 2RSVA 2UVXA 3WF7A 5GZAA 3SRVB 4PPBA 4O7RA 4U0IA 5L6WL 4RBLA 3JS2A 5E8UA 2BFXA 3PWDA 3RNYA 2QOQA 3KRJA 3OUKA 4EORA 2VWBA 3F5PA 3ELJA 4LGHA 2UW0A 3DA6A 1Q8UA 4GYGA 3IO7A 2A4LA 2JFLA 5EI8A 1GNGA 3V5LA 2VTQA 1JSUA 3EOCA 4FTKA 2B9JA 3TT0A 4WSYA 2R4BA 3CD3A 3QWKA 5BX0A 5HICA 2EUFB 3E92A 5IQBA 4O38A 2O8YA 4PNIA 2IVVA 3BHVA 4L9IA 4BDJA 4EOIA 4D2PA 3F69A 3AOXA 1U5RA 2QVSE 3DS6A 3IDPA 3MI9A 4EH8A 4HVGA 3PYYA 1J7LA 3EYGA 4CEGA 2PVNA 5JFVA 2J9MA 4BY9E 3DZQA 3EN4A 4N57A 1XHAA 3QA0A 5AP2A 3FPMA 5CEMA 2CCIA 3FZSA 4FKUA 3TNWA 4E93A 5LVOA 4FKIA 4TXCA 2F2UA 3D5WA 4XRJA 4YLLA 2C0TA 3B2WA 4USFA 3LJ2A 4RC3A 2C69A 2AUHA 2WOUA 2QURA 4TWCA 4CCUA 4D4VA 3EHAA 2VWUA 4EOOA 1BX6A 4I6FA 3SOAA 4O1OA 4X2GA 4RIYB 2G2IA 3ENMA 3QZFA 4TPTA 4I20A 4TNDA 5EHOA 3C4CA 4FGBA 5LMBA 2PVMA 2OIQA 4ARKA 3PA5A 4QMSA 4GUEA 3FHIA 2VN9A 2X8DA 3VBYA 1ATPE 4EEVA 2Z02A 1K3AA 2BALA 3BE2A 4RIWA 5AP4A 1A06A 3BX5A 1UNGA 1W98A 2HYYA 3QKLA 4FMQA 4H36A 4YJTA 4B7TA 5AV4A 5A4CA 3FMLA 4FTIA 3MTLA 3LXKA 2G9XA 2IN6A 4QYHA 4KRCA 4NSTA 4B8LA 3D7TA 4E4MA 2EXCX 1NXKA 4NJ3A 4ENYA 3HDMA 2V0DA 3FLSA 1M2RA 5C26A 4C4EA 4GIIA 5M4UA 4PTEA 3K5VA 4HVSA 3O8PA 4NFMA 3Q9XA 4EWHA 4BI1A 2C6LA 4G6LA 4JDHA 3R2YA 4IFGA 1LUFA 3BYUA 5IDNA 5CX9A 5E91A 3MPAA 3UNZA 5EQEA 4GFGA 5KZ0A 3TWJA 2YIYA 4QTCA 4EC8A 2R3GA 3GU7A 3QTUA 5I9ZA 3ACJA 4FODA 3W32A 4N70A 4TYJA 4Y8DA 2ITTA 5I4NA 5J7HA 1LPUA 1SMHA 4FUYA 5J87A 4BTKA 4JT3A 4MD7E 3QRKA 5HQ0A 4FT0A 3HMIA 5CU0A 1YI6A 4PQNA 2A0CX 2VTIA 4PDSA 3PFQA 4DEBA 3Q6WA 3ZRKA 4AT3A 5C4KA 4FE2A 3FY0A 3U87A 3BCEA 4QQ5A 3VJOA 3MVJA 3QRTA 1JLUE 4CYIA 4D2VA 4WHZA 3OY1A 3TTJA 5M08A 1F0QA 3UMXA 4PNKA 4FL1A 3I1AA 2QG5A 4JR7A 4O6LA 2PPQA 4K77A 2FO0A 1IASA 3PY3A 4DT8A 5J7BA 2E9UA 3MESA 2VTLA 4XJ0A 4YUQA 3E8DA 3UO4A 1T46A 1ZRZA 1H01A 3LXPA 2X8IA 3P7BA 3EZVA 3ZO3A 3DXNA 3GC7A 2R3HA 3E87A 5B2MA 3BHYA 4YP8A 3C4WA 4ZSAA 5AA9A 4DGLC 5KMLA 4QMVA 3NNUA 3M2WA 4M67A 4ZLYA 3FQHA 3BQRA 5C8MA 4CD0A 3CSVA 5M51A 4AX8A 2X1NA 4AN9A 3QTZA 4ANQA 5KHXA 4I6QA 2B53A 4M13A 1H8FA 4M0YA 4XP2A 3VBQA 2J7TA 2ETRA 3NRMA 1ZLTA 3DLSA 2EXMA 1IR3A 5FM2A 5CEOA 5F1ZA 3S0OA 4EZ3A 4E26A 2XZSA 3E8CA 3DFCB 3GCQA 2W1FA 4USDA 5CANA 2BPMA 4X2KA 2W9FB 3QRIA 5IUHA 3MJ2A 2WTIA 1WBOA 3V3VA 3QRJA 4FL2A 5HTCA 5FUTA 1KV1A 3DJ5A 5IMEA 2Y0AA 3RVGA 1KWPA 4UZDA 4G9CA 5M56A 3IW5A 4O7NA 3PPKA 2XYUA 3BYVA 4EWQA 5M06A 3HRFA 2GTMA 5IEVA 5CLPA 4DG0E 3EQIA 4G5PA 4WA9A 3PPJA 3ATSA 2OKRA 4KKHA 4OW8A 4R3CA 5ETFA 4CRLA 1MRUA 4GFOA 2P2HA 4IX5A 4YZMA 2VZ6A 4D2SA 3R7YA 4N0SA 3DKGA 2GTNA 4NEUA 2UZBA 5E1EA 5I3OA 1O6YA 4AW5A 2J0KA 4YJRA 4DTBA 2BZIB 1H07A 4AGCA 4AWIA 2CNVA 1YRPA 3F6XA 3FQSA 5C4LA 5CENA 4QT1A 5AP6A 3ZFYA 5IA3A 1YKRA 2B4SB 2IO6A 4BFMA 3S1HA 4IWDA 2WMAA 4O0XA 4S34A 5F20A 2BDJA 2B1PA 3I5ZA 3TZ7A 5AWMA 4O86A 4O7LA 5FTGA 1OI9A 2YZAA 2IZTA 4QMYA 2OZOA 3V6SA 4CZYB 4EL9A 2HW7A 3UOHA 2RIOA 2W1IA 4U45A 2F7ZE 2PUIA 4TWNA 4O7WA 2VX1A 2R3RA 2Y6OA 1PHKA 4BKJA 5J5TA 1GIIA 1DI8A 4E5WA 4EK6A 4TL0A 4F1TA 1BLXA 4EJNA 5HVYA 2YWVA 3LMHA 3HP5A 1OPLA 1O6KA 5CU2A 4QP2A 4IH8A 4RJ6A 3FZPA 3DAKA 2R0UA 4O7SA 4EOPA 4A9SA 2B7AA 2R3QA 3DTCA 3HV4A 3COKA 1ZMVA 2PVKA 4FI1A 3OOMA 4ZSGA 1U54B 4MTAA 2GS2A 4ACMA 4G6NA 3L1SA 1ZY4A 3QQUA 4F9AA 3MH0A 3TACA 5ETIA 3I6WA 3UODA 3VC4A 2XK7A 5BUEA 3OXIA 2HIWA 2JKKA 2WEIA 3BLQA 3DCVA 1IA8A 2C5XA 3O23A 3KCFA 4GKIA 5AP7A 3VBVA 3BZ3A 3KRXA 2YABA 4I41A 3NX8A 3WF8A 2QHMA 3QD4A 4I24A 4F6SA 4FX3A 4DTAA 2ITNA 4BCIA 3R0TA 5AAFA 2BZKB 1PMNA 3OT3A 1VZOA 4QRCA 4PPCA 3LCKA 4PL3A 3UZRA 2YM5A 1H08A 3GBZA 3BV2A 5KBQA 4IDVA 2H34A 4D2RA 1PYEA 5G6VA 4U79A 3QUDA 5AV2A 5HE2A 1FMKA 3DK3A 3DXQA 1W7HA 4PUZA 4XG6A 2HOGA 3CIKA 3I4BA 3MY0A 1BYGA 4NTTA 3JVRA 4PMSA 3S00A 2O3PA 4EHZA 3C0HA 3QUEA 2ZV7A 4GT5A 2J50A 1PRYA 3BI6A 3P78A 4DFXE 5A4EA 4J99A 1FVTA 3BHTA 3DLZA 4CMUA 2W4JA 3HAMA 1UWHA 3KMMA 5BUJA 2VTTA 3JY9A 5AP0A 4ALUA 4YU2A 4FIJA 4YLJA 2ITPA 1JOWB 4U8ZA 2BCJA 5CVGA 1Q97A 3LFBA 2QI8A 3OCBA 5CYIA 5FD2A 3R8LA 4IEBA 3QLFA 4F7JA 4CXAA 3OXTA 4IADA 2VWYA 2P0CA 4FG7A 2YIRA 4DBNA 5C8KA 4ZTMA 3ID6C 5AAEA 2X9FA 1PXPA 3EQCA 4ZIMA 4AG8A 4F7NA 4DFYA 3PJ1A 3EL8A 4AP7A 5K0XA 4FKTA 4IHPA 3SOCA 2EWAA 5H2UA 3UC4A 1OVEA 2I0HA 2BRMA 3ACKA 3PSCA 1B38A 1OL6A 5I9UA 4HOKA 4R3PA 4C38A 4DLIA 1G8AA 4XH6A 4JL9A 5E8TA 5CAPA 5CF4A 3R04A 2Y4IC 1OB3A 2QKWB 5DN3A 1YVJA 1ZYJA 2BTSA 4IANA 3TUBA 4JLCA 3CTQA 3BELA 3MY1A 2YM4A 5DLSA 4IAFA 4BDIA 1K2PA 4EI4A 3D0EA 2PHKA 2ZM1A 4G9RA 4FSYA 5TE0A 3RI1A 4BN1A 1OL2A 5BVFA 4PL4A 3CTHA 3D5XA 2WZJA 2VTSA 1RQQA 2R5TA 3FSKA 4CV9A 3ERKA 4O0WA 4DH5A 3NVKI 4IVAA 3LFDA 4EYJA 4K11A 5JT2A 1WAKA 3RPSA 3ZRMA 1OBGA 5AIRA 4G34A 3WZJA 3OS3A 3EQDA 3TN8A 3E3BX 4QMWA 3C7QA 2UZDA 3L9NA 2PY3A 1K9AA 5K5XA 2BRHA 1Z5MA 3CY3A 1XH5A 5LQFA 4XBRA 4D28A 4CG9A 3VUDA 2HY81 4GUBA 3LVPA 5E8WA 4FV1A 3RMFA 5JMSA 1H0VA 5EI6A 4A9RA 5HGIA 2V7AA 4OT5A 4PDOA 4PRJA 3JUHA 4DTKA 2J6MA 3MFRA 5L8KA 3RCDA 4FTUA 4FG8A 3D9VA 2QODA 1KE8A 3H9OA 3BQCA 3RWPA 4B99A 3CKXA 5HLPA 4FZAB 2VO3A 2ZMDA 4BTMA 4FV6A 4IM2A 4RX5A 2C0IA 3Q52A 4MXAA 4O0SA 3WF6A 4CKIA 5BVNA 1Q99A 4A9YA 1YDSE 1FINA 3KCKA 5CEIA 4YZNA 4IJ9A 3OBJA 2QR8A 4LMUA 5FWKK 4O7TA 4F1OA 3P08A 3DU8A 5GZ9A 3ZLXA 5LVPA 5HNBA 1H28A 3BGZA 3RJCA 2H8HA 2XYNA 4WNMA 3JPVA 3ZZWA 3A7GA 2C0OA 1AGWA 4KA3A 1GZNA 3AMBA 2QOFA 3O51A 3R01A 4E5AX 1W82A 2XNEA 4D9UA 2QLUA 5FG8A 2C6IA 4O27B 3BYMA 1JWHA 2W5BA 3C4XA 3KVXA 4M12A 4XHKB 2F57A 3CQEA 4RJ8A 5HIBA 3WI6A 5HIEA 4WBBB 4RVLA 1QMZA 4GJ2A 3RZBA 5J9ZA 4O7VA 4C34A 4HPTE 4YHFA 2X8EA 4IX6A 2BFYA 4JBVA 3ORXA 1WBNA 1YWVA 4RJ7A 3WIKA 5CU4A 4YJSA 1STCE 4ANBA 1JAMA 4P5ZA 3TV7A 4I21A 3ZO4A 1AD5A 1XH6A 2RGPA 4G16A 4QOXA 1GOLA 2YIWA 1E1XA 1WCCA 5AR2A 4DGGA 4IAZA 2V5QA 1H0WA 4QYGA 3D7TB 4TYGA 3HGKA 3KEXA 4HJOA 2QOLA 2V22A 2R7BA 4MXOA 2VTNA 3KXGA 3EQHA 3ORLA 3UJGA 2CLQA 4NW6A 2GDOA 3UOLA 1VR2A 5I9VA 3NSZA 2UW8A 3POOA 3MGYA 4CGAA 2OXYA 3FI4A 2VNYA 2RF9A 4IB3A 4X3FA 2CNUA 5DRBA 3GQLA 5ANGA 2XKDA 3EN6A 4E3CA 2OG8A 3UIUA 3IS5A 3P86A 2BRGA 5HCZA 3LM0A 4USEA 1IRKA 2J90A 4Y46A 4JIAA 3DJ6A 3I0OA 1HOWA 3MVHA 1BKXA 3CY2A 3SGCA 2V7OA 5E1SA 2OH0E 3MSSA 3F82A 4KKEA 4W4XA 5DEWA 5HNGA 4BCJA 1YOMA 4BGQA 5AUTA 4KUJA 3OVVA 5AM7A 5KMKA 1XH7A 3DY7A 5CSVA 3LQ5A 4BI2A 4CFXA 2VX0A 4JDJA 4CLJA 4HVDA 5AV3A 3LFCA 4BZNA 4EKLA 3PTGA 5IQHA 3DBCA 4G3GA 3H4JA 3CPBA 4RA4A 5BQ0A 3Q4ZA 5D10A 4MNEA 4AOJA 3A4PA 4MNFA 4RA5A 4TW9A 4DBXA 2VTOA 1ZXEA 4BWXA 4EK8A 2HK5A 4QTEA 2XM9A 4Q5HA 3R7EA 2G01A 5EW8A 2OFVA 3DTWA 3ITZA 4RGJA 2HXQA 5KKRC 3MDYA 4IZAA 2OJGA 2PZPA 1G3NA 4AXAA 2R3OA 3FE3A 4BDBA 4U6RA 2R3FA 2PVFA 2ZMCA 2QOOA 3RP9A 4ACGA 1ZYDA 3DBDA 4TKSA 2WMSA 5JEBA 3E7VA 3U55A 1YHSA 1URCA 1SM2A 4LRKA 4WG5A 3V8WA 4XG4A 5CSWA 2VWZA 4FUXA 3LAUA 5GZ8A 1H24A 2BDFA 2QQ7A 3GOKA 3FYJX 5HO6A 3MN3A 1PW2A 4OGRA 4YGAA 4TTHB 5CF5A 3MFSA 5DR6A 4FIIA 1UA2A 1E1VA 3DOGA 4D1ZA 3TJDA 5LJJA 2HZIA 3COMA 3WZDA 4C3RA 3KREA 3GENA 4U5JA 4FKOA 2X6EA 1KSWA 2QU5A 3V8SA 5E7RA 3IOPA 5H3QA 5AJQA 1DM2A 2W99B 4F0FA 4UX9A 4IVDA 5DWRA 4AOIA 4GJ3A 3WF5A 3WE8A 4MD8E 1O6LA 3U4UA 5EQYA 5AUYA 3TM0A 4KKGA 4L44A 3KU2A 2FVDA 2XCHA 3ZO1A 3BBWA 4QMTA 4MKCA 4PWNA 4KRDA 5AMNA 2GNFA 2ITWA 3TG1A 3ZDIA 3RHKA 4ASDA 1UV5A 3AD4A 3IGGA 4ZTNA 3O8UA 3UPXA 2NPQA 3F7WA 5TO8A 1T45A 1OITA 2J4ZA 2OXXA 5EM6A 3EN9A 4Z3VA 5BVOA 4ASXA 3VHEA 1WBWA 4O0UA 1U46A 3AXWA 2JDSA 3Q6UA 3NAYA 2CGWA 4ITIA 1YXVA 4O91A 3A8XA 5L8LA 5AADA 2GHLA 3HKOA 3O71A 3QQFA 5HO8A 2WQNA 3GNIB 4EOQA 4FKLA 4L00A 5IEXA 2GFCA 3DT1A 3HECA 4FNWA 4XYFA 4F0IA 5ANIA 3FMMA 4KSPA 4F9WA 4WUNA 2PWLA 1BI7A 5FTOA 2YAAA 4R7IA 5F94A 1P4FA 3MB6A 5T68A 4C37A 4C3PA 3F88A 2IZRA 4HGLA 3W55A 1PXJA 2YFXA 2HELA 3OF0A 3W2PA 1CTPE 5M09A 2HZ4A 2P2IA 3K2LA 3FI2A 3FMJA 4M7IA 4DG3E 5A14A 5HTIA 1U5QA 2IJMA 2RFDA 3LFEA 4IX3A 3Q3BA 3O96A 3TZ9A 3FUPA 1DAWA 4Z9LA 5F95A 4OAUC 4HCTA 2W1GA 5FDPA 3GUBA 4E6AA 2NRUA 3OMVA 4QQTA 4JR3A 2XNNA 3ZSGA 4H3QA 4IIRA 3ZS5A 2OJ9A 3T3VA 4KABA 3PSBA 3H9RA 3NYOA 5EFQA 5IQIA 4QP8A 4ZSJA 5CEPA 4F64A 4OTRA 5K9IA 4NL0A 5EKOA 3R8VA 1P4OA 1PXIA 4FV9A 1OIUA 3ROCA 3T9TA 3KC3A 3EJ1A 2WNTA 4WIHA 4UXQA 3W16A 4IQ6A 4KWPA 3IOKA 1SVGA 1FQ1B 1R0EA 3RKBA 3G6HA 4I5PA 1M7QA 4FL3A 1O9UA 4XLIA 4AT4A 3F7ZA 1BL6A 5EH0A 3QUPA 3TIYA 2DQ7X 3KXHA 3VW8A 1M17A 5DHJA 3KULB 2Z60A 3UVQA 2G15A 4BR3A 1YXXA 4CT1A 2XK8A 2WXVA 4AAAA 4ZAUA 1ZMWA 3VF8A 3ORIA 4ENXA 4HVIA 2IW8A 3GU4A 4JVGA 5CS6A 4AA4A 3CPCA 2PUPA 4ORKA 2Y9QA 3WOWA 4LYNA 1JSVA 3MA6A 4QMUA 3JVSA 4I3ZA 4O0YA 1XBCA 3SC1A 4CV8A 2CN8A 5HTBA 3EYHA 2Z8CA 4E5BA 1H4LA 2UZWE 4FSTA 3HEGA 3H30A 2ITUA 1LR4A 1XH9A 4ZS0A 3E64A 3R63A 3F5UA 4FK3A 3BGPA 3QC4A 4H1JA 3UC3A 1FMOE 3SQQA 3I79A 4YZCA 5CQWA 5FBOA 4FYNA 4L52A 4WD5A 4F1MA 4EYMA 1ZY5A 4FTLA 2IVSA 4IAAA 4JQEA 3AMYA 1MUOA 2YM6A 5CVHA 2BRNA 3GOPA 4ZP5A 4DCEA 2ITOA 5BVDA 4Y5QA 5ANOA 2C6KA 4K9YA 3K3IA 4BCMA 4FYOA 1OPJA 4JQ8A 3R00A 1SYKA 2RFSA 4GIHA 4PMTA 5JFSA 2UZEA 3MWUA 4OT6A 3UGCA 2A27A 2C1BA 4F09A 2Y4IB 2ZV8A 3P79A 1YW2A 5AUWA 3RBWA 2O65A 5IDPA 1L3RE 4I0SA 4FV3A 3COHA 3R9RA 5KUPA 4HPUE 3NIZA 3H10A 4BCHA 3PLAE 1OMWA 4LV5A 3C51A 2WMBA 4YTHA 3TEIA 3VULA 5JRQA 3ALOA 2W1DA 1WZYA 3F66A 2I7QA 2G2HA 3QF9A 4YLKA 3AC2A 1JKTA 2JBOA 2OJIA 1UVRA 1U4DA 4IAKA 4O0RA 3DB6A 3IW6A 5HD7A 2LGCA 3RGFA 3HA8A 3OOGA 5LMKA 2CCHA 3P7AA 4ZTQA 4GG5A 2GSFA 3C4EA 4R7BA
chains in the Genus database with same CATH superfamily
2HENA 3ORPA 5HCXA 1Y8YA 2QOBA 3WZUA 4W8DA 4QMXA 3HAVA 2RL5A 5E4HA 3ZFXA 2A2AA 4QMOA 2R0IA 3EZRA 4YTIA 4YC6A 3P23A 3PJ2A 4CFWA 2WMRA 5FGKA 3IW7A 2BTRA 4JRVA 3RALA 3ZU7A 3G5DA 3GXLA 3OEFX 4A9UA 5H9BA 4EOMA 4FEVA 4ANSA 4O21A 1PXOA 4L46A 5LVLA 3REPA 1M52A 4C58A 2UVYA 3FYKX 4EHVA 5DA3A 5A4TA 3KIOC 4M84A 2R7IA 5EYKA 5E8YA 4EBWA 1UNLA 1V1KA 4KD1A 4ZJVA 3L9MA 4QMQA 4GU6A 3PVBA 1XQZA 2PTKA 3DQWA 3C13A 3OEZA 3NUNA 4IDTA 3TKHA 1QCFA 1PKGA 3PSDA 4CFFA 2WELA 3BU6A 4I6HA 3NUXA 2CKEA 3CCNA 3PJ3A 3BHHA 3QTSA 3UO5A 4PY1A 2WTDA 4NKAA 2ZYBA 4OTQA 5C1QB 2PZ5A 5IQDA 3MBLA 4ZJJA 1F5QA 2VTPA 5M4IA 4BZDA 2WTJA 3S2PA 3SKCA 2IW9A 4R6VA 3P4KA 1B39A 2B52A 4JI9A 5AX9A 5AR5A 4KAOA 3QTXA 3IW4A 3G9NA 3P7CA 5IISA 4EK5A 2CMWA 1EH4A 4AW2A 1XH8A 1BI8A 3D4QA 3I6UA 4ZK5A 4BCPA 3ANRA 2XH5A 4Y95A 5HG8A 3VN9A 3HL7A 3FXZA 3CJFA 4YNEA 3UDBA 2F4JA 3CP9A 3FC1X 3ZC5A 4TYEA 4Y73A 3TCPA 3DV3A 4NWMA 5BVKA 2P55A 4C8BA 4M3QA 2I6LA 4UEUA 3VWAA 4M97A 2ZVAA 3FBVA 4CFUA 4DYMA 3VHKA 5J95A 4EH9A 2BAJA 2VGPA 5CEQA 2REIA 4I5HA 3VUMA 5IQFA 3UMWA 4Q9ZA 2W1HA 4ZTSA 4RJ4A 3DB8A 4V01A 5J1VA 1L8TA 3ZCLA 1Q8WA 5G1XA 2XA4A 3MV5A 4AN3A 1ERKA 3O7LB 1CDKA 4UYAA 1XJDA 1GZ8A 2WMXA 5CXZA 3W0QA 4FT7A 3ZYAA 4AE9A 4B6LA 4WKQA 5FEDA 1DAYA 5AR3A 4BDAA 2YM3A 5IQAA 1WVYA 2XIZA 4WO5A 3RHXA 2BKKA 1V0PA 3R02A 5AUXA 4EC9A 2Y6MA 1VYWA 5FP6A 5L4QA 5IH4A 4OR5A 3P5KA 3VBXA 4NIFA 4DHFA 3UDZA 4JBPA 2ZV9A 4NCTA 1ST4A 5IQGA 3HVCA 3LPBA 3UG1A 2RFNA 4KIKB 5FLFA 4L3JA 3PWYA 4OUCA 3DKFA 3QTIA 2UZVA 3VRYA 5BNJA 3E7OA 3QKKA 3DDPA 2J51A 5IF1A 4GSBA 4G5JA 2QR7A 4W9WA 1BL7A 4K18A 4BDHA 1P14A 4MXXA 4BI0A 3FXXA 3GVUA 3HV5A 3R7VA 3GGFA 4GKHA 4L8MA 5ETCA 2VD5A 3II5A 4R8QA 4RFMA 2C47A 2XS0A 4LM5A 4IW0A 4KSQA 2HY0A 5CZIA 2XBJA 2FSMX 5KKRB 4C4JA 3EQBA 5DI1A 4ZTRA 2WQBA 1H1QA 3OBGA 2XK6A 5FTQA 5A4LA 1UKHA 3NUSA 3JY0A 5D7AA 3BRBA 2XARA 3OT8A 4P5QA 2HW6A 3NYVA 3ODYX 4ACDA 2BHEA 4TYHA 4FEQA 4FIFA 4XUFA 2X7FA 3PE2A 1PKDA 4APPA 2GNIA 3FPQA 1H25A 5L6OA 4RWLA 5I9XA 3EFJA 3Q9YA 2GNLA 1PXNA 3COIA 2RG6A 2XVDA 4IFCA 1FGIA 5HX8A 4ITJA 5HI2A 4DDGA 4S31A 5T3QA 2BILB 2NRYA 2XB7A 3MA3A 3CD8A 4OTDA 2XIRA 4KS7A 1J7IA 2Z7RA 3G51A 1WBVA 4NFNA 3ALNA 3O50A 4Y5HA 5K3YA 4FSMA 3PP0A 4ONAA 3U8WA 2GNJA 1M2PA 3NR9A 3QTRA 3LFQA 2NP8A 3CC6A 4FSUA 2WTVA 3CGOA 3GU8A 3LCOA 3TI1A 1ZYSA 3SG9A 5IA4A 2BZHB 1KE5A 2WMTA 1V0BA 3MS9A 4JDKA 4QMMA 3UVPA 4D1XA 2PVYA 4D4RA 3SW4A 1LP4A 3DAEA 4BICA 1NVRA 3W2CA 3OTUA 1CKIA 3VO3A 3NYNA 2FA2A 4XEYA 5L2SA 2YZLA 3NIEA 4FICA 4H05A 2WTWA 3ZM4A 4U80A 5EK7A 5L8JA 2QOIA 2QOKA 3RK5A 4ANOA 4BZOA 4QMPA 3L8SA 4PMMA 1GY3A 3SHEA 4L7SA 4RC4A 4CMTA 4E6QA 3QXPA 4CLIA 2UUEA 4PTCA 3UPZA 4F7LA 4QMZA 5L2WA 4LMNA 4O82A 5DR2A 2YA9A 4YR8A 5DPVA 5AM6A 3Q2JA 3OW4A 3LJ0A 1OUKA 3F3WA 5AR7A 3W2RA 3R71A 4ZLZA 3UIBA 5BV3A 1DI9A 2X39A 2W5HA 2XK3A 3G2FA 5EYMA 3AD5A 4QMNA 4XOZA 2W1EA 4FV0A 5AR8A 4ANMA 4X3JA 4WRGA 4QNAA 3LQ8A 5AP5A 3W0RA 4U97A 1H1PA 2A98A 2VUWA 5JRSA 4AXEA 2DWBA 3GEQA 4HGTA 4V04A 4XG2A 4FNXA 3VS1A 2YDIA 3JXWA 3OWPA 5IA2A 3F3TA 2YLFA 2X81A 2C5VA 2ERKA 1BUHA 3BV3A 3MPTA 3ROYA 4TRLA 3ZTXA 3DZOA 4TT7A 4HYSA 2XRWA 4D1SA 4BBFA 3A4OX 3V5QA 4RWIA 2X0GA 3VUHA 5I0BA 2XK4A 4CZTA 5J8IA 5JQ5A 4ZS4A 3IONA 3QTWA 2JITA 5CVFA 5JN2A 1UKIA 3NGAA 1PXMA 5LVNA 3A8WA 4FTTA 5HBJA 4QPSA 4W4VA 4AZWA 5AV0A 2BUJA 4CVAA 2W4KA 3H9FA 3T8OA 4DH1A 3ANQA 4DINA 1Q61A 4I93A 2UW4A 2WTCA 1ZYLA 1JBPE 2FH9A 4G1WA 3VF9A 4GVAA 4EQMA 2XIYA 2YCFA 2CGUA 3G0FA 5IEYA 2VAGA 2VTJA 4EOJA 3LMIA 4GG7A 4XG3A 2BHHA 2CN5A 5ANEA 1UU9A 4C2WA 2FYSA 4ITHA 4ZSEA 3GI3A 2JDTA 3O8TA 4I5CA 5CF6A 3K3JA 4FTRA 4D4SA 1UU7A 2H9VA 4GMYA 2Y8OA 2WOTA 3DKCA 1YHWA 3VS3A 4H39A 1OKWA 4FC0A 3C4FA 3U51A 3SW7A 1Q8YA 3E88A 1UNHA 3PY1A 5HE3A 3T9IA 3KF7A 5J9LA 4K1BA 5A4QA 1W2DA 3C9WA 4NK9A 4XMOA 4E6DA 3LFAA 5JK3A 4C2VA 5BYYA 4OBQA 5GINE 4N6YA 2QC6A 4MK0A 2HWOA 3W0MA 1Q4LA 3ZLSA 3W0NA 3HRCA 4CMOA 3AT2A 3C1XA 2C5NA 2W06A 4IJPA 2ESMA 4HCUA 3TZ8A 5FEQA 4UV0A 3M1SA 3QYWA 4W4YA 3ZBFA 5B0XA 1B6CB 3LQ3A 1WBPA 1GIJA 3RPRA 2NNWB 2PSQA 4CNHA 4GK2A 5HD4A 5HX6A 3WZEA 3KK8A 2XJ1A 4DCAA 4L6QA 4H58A 2VU3A 4YZDA 3FMEA 5CT0A 1YOJA 3A61A 2O0UA 4YZBA 4DG2E 1KV2A 5DFPA 2I0YA 3GCVA 3NDMA 3QGYA 4FV7A 5A46A 1LEZA 3QD2B 5DOSA 3FJQE 3PXRA 4M69A 3NUAA 2XNPA 5E8XA 4GK4A 4FEXA 1RE8A 3PXFA 2JKQA 5GJGA 4AFEA 4CG8A 5DMZA 5AUUA 4WT6A 5A54A 4EHGA 4LL0A 5K4IA 5LXMA 2XUUA 4ZY6A 2QO9A 4RWJA 4G2FA 4ZOGA 3UIXA 4AW0A 3VW6A 3F2NA 5CF8A 3TJCA 4QDEA 2XNOA 5CU6A 4EQUA 2ZV2A 4PP9A 4ANLA 2W7XA 2UW3A 4LL5A 5JGDA 4X21A 4FSRA 3UQGA 3FMDA 3GP0A 2OWBA 3TNQB 2QOCA 2WTKC 1OPKA 3KN5A 4YO4A 4EKKA 4I92A 1NY3A 1OM1A 2YN8A 1REKA 1XWSA 1BMKA 2WFYA 4QD6A 2X0QA 3MH1A 4K2RA 2E9OA 4C4HA 3SXRA 3ZMMA 3EL7A 4BCNA 4CKRA 3EKKA 3VS4A 4UY9A 5DGZA 4Z16A 3LOKA 4BB4A 1QPDA 2C4GA 3DNDA 4FSQA 4JBOA 4RT7A 2ZB1A 4L7FA 3ORTA 4W9XA 3LXLA 4CFNA 3PIZA 3D5VA 3D94A 3LCDA 1R0PA 2ZAZA 4O0TA 3NNXA 4FV5A 3ZH8A 4GK3A 4JIKA 2XNBA 4KBAA 4RIWB 4TZRA 5M55A 3WILA 4RIYA 2UV2A 2ZDTA 4WSQA 5H8BA 5L2TA 2ERZE 3R7GA 3BYOA 5FRIA 2J0MB 4A07A 2AC5A 4QP6A 4YJQA 5FM3A 3CKWA 4J95A 4O6EA 3ZUTA 1R3CA 2YHVA 1S9IA 2Z7SA 2PYWA 3OG7A 4F08A 4FKQA 3R2BA 2YIQA 5JZNA 2VO6A 2P33A 3A62A 3CS9A 3IDCA 5FXSA 4ZEGA 4ANNA 3DK7A 3CBLA 4MWIA 5BVEA 3AQVA 3GT8A 5CQUA 5M53A 4E7WA 3H3CA 1WMKA 2OIBA 3V51A 3PVGA 5HKMA 4EOSA 3A99A 2E2BA 4X3FC 2E9NA 3LJ1A 1ZMUA 1UWJA 2QHNA 2JDRA 4V05A 5C03A 1OBDA 3HRBA 2X6DA 2OLCA 4TNBA 4ACCA 3BEGA 3KMWA 2B0QA 5CXHA 3TNHA 2P3GX 3FZ1A 4QQCA 3QCSA 5H8GA 3PA3A 2X2KA 4BHZA 5DR9A 5E8VA 2R3MA 2JIVA 4KB8A 3PY0A 4QP3A 3EKNA 4D0XA 2VTMA 2IVTA 1REJA 4J71A 3NCGA 4D55A 3N4TA 4X6QC 3Q04A 3WE4A 5L2QA 4P2KA 1TQPA 5IUIA 4XS2A 3BLAA 5BVWA 4BWPA 4C61A 3IKAA 4NUSA 3NEWA 4DC2A 4UMRA 4ID7A 4OTGA 3F3ZA 4AN2A 2PULA 4D2TA 3F61A 3PE1A 4XP0A 2IEWA 3CLYA 4FEUA 4FT9A 4I0TA 3NMUF 3AC8A 4O0VA 3SVVA 4NIFB 3OUNB 3RAIA 4EZ7A 3EN7A 3GFWA 3PPZA 5HU3A 4D5HA 2JC6A 4V0GA 3AG9A 4O83A 3VIDA 4FTMA 4X2FA 4BDDA 5JGAA 4JMQA 2BZJA 4MBIA 4AXCA 3IW8A 4LOOA 4CZUA 5AX3A 4AW1A 5D41A 3HYHA 4PF4A 4UWYA 2PMNX 5EW3A 3HV7A 4FNYA 4GT4A 2YJSA 2JD5A 3SD0A 3E63A 2W9ZB 3OCTA 3ULIA 4DH7A 4MXZA 2XKEA 4JG7A 4J52A 3TUDA 2JBPA 3I7BA 4C36A 4MWHA 4FOBA 2R2PA 1ZAOA 3SV0A 3KMUA 5DH3A 5HLWA 2WB8A 3FLNC 5LWMA 4B8MA 3DAJA 2O64A 1DS5A 4U42A 4EH5A 4FA2A 3ZFMA 5AA8A 3NUUA 1JKSA 2PE0A 4G3CA 3BL7A 3MIAA 4MEDA 4ALVA 1UU8A 3W2SA 3QZHA 4AOTA 4ZY5A 3LLAA 1PY5A 2J0LA 3HV6A 4P90A 3QZIA 5BYZA 4DEIA 3PJ8A 4BDCA 5D7VA 3HA6A 4FKPA 3IK3A 4FSZA 3MFTA 4YZ9A 3ZOSA 4DHJA 3PDTA 3NW6A 1Q41A 5IQCA 2JIUA 2Q83A 2YIXA 4O4CA 5KMOA 4BYJA 3H0ZA 3UE4A 4BKZA 4GEOA 2IW6A 3QQGA 2XP2A 1X8BA 2Z7LA 5CU3A 4HCVA 2YAKA 3UZTA 2BDWA 4RJ5A 3TNIA 4R77A 2XKFA 3I81A 2WMUA 3E3PA 5E8ZA 4FNZA 1WBTA 5CASA 1JSTA 1XO2B 3C4ZA 4G3DA 4PDYA 4HZRA 5JH6A 1M14A 3O7LD 5HIDA 5IA5A 4HVHA 2B9IA 3HNGA 3CJGA 1J91A 3KL8A 3RAHA 5TKDA 3POZA 3ZRLA 4OTWA 4XV9A 3B8QA 4C02A 2C6TA 2GHGA 3SA0A 2GFSA 2JAVA 2VNWA 2WU7A 3KKVA 4UWCA 5IG1A 5IH5A 4JRNA 5HZNA 1WVWA 3QBNA 4AACA 3EFKA 4NW5A 3VS5A 2PZRA 4BKYA 3ML1A 4L42A 3SG8A 5ANDA 3LCTA 4IVBA 4F9CA 2O2UA 5EHYA 5ANJA 5CSPA 4C57A 2F2CB 5E90A 4YC8A 5AP1A 5IZFA 3LFFA 5CI6A 5FP5A 1F3MC 3FY2A 2GU8A 4E6CA 2QG7A 4E4XA 4M0ZA 4FV2A 1J1CA 3Q53A 1YQJA 2CJMA 3EWHA 1U54A 4RLKA 4DGOA 2NO3A 2FGIA 2C30A 4KINA 4EK4A 1OUYA 3NUPA 3Q2MA 1KE6A 2W96B 4Y83A 3VRZA 1RDQE 4MF0A 4DE4A 2PMLX 3ZHPC 3NAXA 4GYIA 4BCGA 3VS6A 3ZXZA 4JS8A 5KMNA 3RPOA 1Y57A 2OF4A 1PF8A 3FZOA 4AZVA 4BF2A 3LFSA 4L3PA 2UW7A 5HHWA 4FBXA 4D58A 4Q5EA 2GQGA 4J53A 3G6GA 3CE3A 5CAVA 3S95A 4Z55A 4YO6A 4YMJA 3ETAA 2JDVA 4AZTA 5EYCA 5EG3A 3R9NA 3RM6A 3ZUUA 3KQ7A 1OGYA 1PXLA 4UMUA 4IMYA 5FBNC 4BDKA 5DT0A 4YJUA 4GFMA 4P4CA 4G3FA 2R3PA 3EH9A 1GZOA 5C9CA 3PG3A 4R1VA 3KA0A 5I9YA 3DJ7A 3MH3A 2BIYA 4E4LA 3T3UA 4RSSA 2EXEA 4F7SA 2OJFE 3MYGA 3R9HA 5B7VA 1SZMA 2YCSA 4FR4A 3F2AA 3WYXA 2XIKA 1KOBA 1PJKA 3LW0A 2CKOA 4HYHA 3VUKA 2ETMA 1VJYA 2XJ0A 2B9FA 3VVHA 3QU0A 3AT4A 4RMZA 4FTQA 1E9HA 1ZWSA 1OGUA 2CGXA 3DDQA 3HMMA 2OZAA 4OTIA 5HO7A 2WQEA 1CMKE 5HBEA 4BWKA 3ZM9A 2XEYA 3PG1A 3V5WA 4F9BA 5CSXA 5L6PA 4IC8A 5F9EA 3KY2A 2VTHA 3D2IA 5KX8A 3G0EA 4OBPA 3WARA 3RAWA 4LQMA 3ATTA 4U41A 4WRSA 3VJNA 5GJDA 4A7CA 5CAOA 5LCKA 4IACA 3FQEA 2OI4X 3P5JC 2QNJA 3ORKA 2AYPA 4MXYA 4O4FA 3A7HA 4FZ6A 2GQRA 5JKGA 2X4ZA 3BLHA 5DT3A 3R1QA 4D5KA 4E8AA 3HMPA 2OBJA 2YISA 4DEAA 4WG3A 5JSMA 5EM8A 2X2MA 2XRUA 1WVXA 2BAKA 4BYIA 2F7XE 1Q5KA 3V04A 4EOLA 3OW3A 4EH3A 5DVRA 4EUTA 5GIOE 4AF3A 5LMKC 3FEGA 5IMXA 3HMOA 2BMCA 4PMPA 4FV4A 3LZBA 4RVMA 2R3IA 4AU8A 5BMSA 2ZDUA 4JG6A 5HNIX 2UZLA 3BU5A 4MF1A 2YCRA 3HLLA 3KRWA 4EOKA 3EQGA 4FJVA 3EMGA 4GRBA 4L67A 3AC5A 3O2MA 3OHTA 5AUVA 3VS2A 5CAUA 4EQCA 3C5IA 3NS9A 4IBMA 4AGDA 2E9VA 3UQCA 1R78A 4CFMA 5D9HA 3FLWA 3S4QA 3EFLA 3UTOA 3AGMA 4ASZA 2ZJWA 1OECA 1U59A 2UW5A 3NZ0A 3P0MA 5KHWA 4FTJA 3TNPC 4G6OA 4H3PA 3ZBXA 4EJ7A 4I1ZA 1OKZA 2Z2WA 4OTPA 5HOAA 3VBTA 4F6UA 3FKLA 2C3KA 4FKGA 2CPKE 2PUNA 3ODZX 4FVQA 5CNOA 4BVUA 4DT9A 3MFUA 4KIQA 2WTKB 3VUTA 4DEHA 5ICPA 4F70A 1SVHA 4FVPA 5LOHA 3PXYA 2C3LA 5FXQA 1M2QA 2XCKA 4HW7A 5ITAA 2DUVA 2ITVA 3VQUA 2JIIA 5EOLA 2OK1A 4DGNA 4JAJA 4IB5A 1TQMA 4FKVA 3HMNA 3MPMA 3V01A 2VWXA 2VX3A 2YEXA 1ZOGA 3Q32A 2X0OA 4NT4A 4QPAA 3SX9A 3LKMA 1VYZA 5CSHA 5FXRA 4KBKA 3KXXA 4ERKA 2YITA 5CT7A 1OKYA 4XG7A 3FZRA 3KN6A 5DE2A 2OGVA 4NZWB 2OU7A 3K5UA 3I5NA 3NFFB 3G15A 3KFAA 1OL7A 3FL5A 4XP3A 2AC3A 3IQ7A 1XBBA 2X7GA 4U43A 1IEPA 2I1MA 4O84A 1KOAA 1SNUA 4O4DA 4F65A 3R1YA 4D9TA 3UYTA 2XKCA 3Q4TA 3PZHA 5HG7A 1Y6AA 3BGQA 5I3RA 4MVFA 3BIZA 1RW8A 4X3FB 4RPVA 1Q62A 4FTCA 1Y6BA 2WMWA 5KZIA 2QO7A 3F9NA 3OWKA 4GCJA 4X7QA 4D0WA 2OSCA 3IGOA 3KXMA 4RIXA 2J5EA 4K33A 4PTGA 3TXOA 3W2OA 3UDSA 4Z7GA 4C35A 4OLIA 4YPDA 2LAVA 2OJJA 2WPAA 2YDKA 4ACHA 4BL1A 2UZUE 2ACXA 3A7FA 2FSLX 4F63A 4NU1A 4NCTC 4JAIA 2VO7A 2E9PA 3BYSA 2GQSA 3F3UA 4MD9E 1NW1A 2UW9A 4BJJA 4M15A 4YSMA 5AR4A 3W8LA 4AUAA 2VWVA 2FSOX 4QTAA 4AXDA 2JAMA 4LGDA 3RPVA 3NYXA 4YNOA 1NVSA 4WUAA 1IAJA 3QD0A 2JDOA 1YWRA 4MNEB 4DH8A 1AQ1A 3FLQA 3FMKA 5DIAA 4DGMA 2YACA 4QYYA 4IAYA 2HCKA 2CDZA 2J0IA 4OTFA 4V0GB 2ZB0A 5GNKA 3TUCA 4DEDA 1XKKA 2B54A 3LLTA 4FTOA 4BCKA 2PUUA 2WD1A 4DFNA 3FLZA 3QQLA 4NM0A 3FI8A 4NYEA 1JKLA 3FMHA 4GS6A 5D12A 3PZEA 2R3NA 2PE1A 4AZSA 5IPJA 3GC0A 1QPCA 3E8NA 1CKPA 3AD6A 3FDNA 4JX3A 4Q9SA 4EUUA 1W2CA 2ETKA 3KRLA 1WBSA 1W84A 2BROA 3OZ6A 3I60A 4XV2A 4BGHA 4EHEA 4JBQA 2PZIA 2Z7QA 4A4LA 1G8SA 3TKUA 3EQFA 3OCGA 1GZKA 1V0OA 4I4EA 4MUQA 3JR1A 4MYGA 2OICA 3QYZA 3FZTA 3DNEA 2C3JA 1APME 1OKVA 2C1AA 4J8MA 4O2ZA 1TVOA 4J96A 1OIRA 4MH7A 4ZZOA 1HCLA 4UBAA 4X0MA 5ETAA 3FC2A 5FDXA 4ZMEA 5EI2A 5GIPE 2SRCA 4M68A 4YC3A 2C3IB 2XAMA 5AEPA 2VO0A 4FKSA 1A48A 4L3LA 4J97A 4YJPA 2WMQA 3ORNA 3ORMA 3RNIA 3MY5A 3UNKA 3WF9A 2KTYA 4YJOA 1UU3A 4IB1A 4C4IA 4CQEA 3TMOA 5CZHA 3F3VA 4Z7HA 4MX9A 5IA1A 4NJDA 5J9YA 2CHLA 1J1BA 2UZNA 2VWIA 5HBHA 1MRYA 3U6JA 5M44A 4OBOA 3UP2A 4A4XA 2GPHA 3A7JA 5IU2A 2PVHA 4AT5A 2HZNA 3IECA 2C6OA 1FVVA 4HNIA 4HYUA 4L53A 1NVQA 4O4EA 5CWZA 3AT3A 4EH4A 3FL4A 4UZHA 1IG1A 3ULZA 3TTIA 4LV8A 2CLXA 4BCQA 3RAKA 2BVAA 3V8TA 3V5PA 4EK3A 4FKRA 4MAOA 5L3AA 1JKKA 4FSWA 3IDBA 5DBXA 3DQXA 3NLBA 3QCQA 4CT2A 3OD6X 2W5AA 5J5SA 3NWWA 4MQ2A 4W4WA 1Q3DA 2ITQA 4G31A 4GH2A 1VEBA 2WEVA 4I6BA 4CFVA 3E93A 4FT3A 4PX6A 1YOLA 3NNVA 4YBJA 5TOZA 2Q0NA 4QP4A 2PVJA 3U54A 4B4LA 2Y4PA 4BBMA 3TV6A 2YERA 3Q96A 3FKOA 2QONA 3GCPA 4YHTA 5LWNA 3E5AA 4G17A 1TKIA 1Y8GA 3FSFA 3L8XA 4G3EA 1JNKA 4JJRA 4R5SA 3PIYA 4QP7A 4RLLA 3Q60A 3QAME 2IZUA 4PV0A 2HAKA 3R28A 3R8MA 3HDNA 3DK6A 3WYYA 2JFMA 2VGOA 1XR1A 4I23A 2C68A 3FXWA 3W10A 3R22A 3GB2A 4UYNA 5EOBA 3PLSA 4FVRA 5HESA 1S9JA 3W8QA 5K5NA 4TY1A 3D15A 2CKPA 4FKJA 3PXKA 5FEEA 4R78A 3QC9A 2OXDA 3DBEA 4XLVA 1P2AA 4RIOA 5EW9A 2RG5A 4QTBA 2AEGA 3NPCA 3EFWA 4U7ZA 3O0GA 3U9CA 3WBLA 3DKOA 3OROA 3OY3A 3HX4A 4FOCA 4S30A 1FPUA 2IF8A 2OW3A 4DFBA 3UO6A 3KXZA 2ITYA 5D1JA 5B2KA 5LARA 2QO2A 1G5SA 2R3LA 4RX8A 3H0YA 4C4FA 3Q5ZA 4I6LA 1I44A 3THBA 3QX2A 3L8PA 2C6EA 4C0TA 1FBNA 3PIXA 4IAIA 3VAPA 4FF8A 4C59A 4BDFA 2ITXA 2OH4A 4AS0A 1CSNA 3ZONA 3QCXA 3ZUVA 4LI5A 5HU9A 5IQEA 4KBCA 3ENHA 2QD9A 2C5OA 5AUZA 4AGUA 4YSJA 1W2FA 5DNRA 3TDWA 3DFAA 4ERWA 3KULA 4RC2A 4AZFA 4IM3A 2EU9A 5EM5A 4DEGA 4F0GA 4RVTA 3UOKA 3ORZA 4RX9A 4II5A 4K8AA 3QHWA 4XV3A 1Q8TA 3MVLA 3NNWA 4O22A 4ZSLA 5IH6A 3FWQA 1ZYCA 5J79A 1OZ1A 5CEKA 1MQ4A 2JKOA 5KMIA 4BIDA 5E8SA 1W83A 3BBTB 5TT7A 3SXFA 4NKSA 3W33A 5B2LA 1QPEA 3QHRA 4Q2AA 4YURA 2HZ0A 3LM5A 4ZTLA 3ZZEA 2OZAB 4B0GA 4RZWA 2BKZA 3TV4A 2PE2A 4QNYA 3Q9WA 2Q0BA 4NM5A 4DF3A 2C6MA 2PZYA 2XMYA 1XH4A 3D7ZA 3O17A 2C6DA 2UVZA 5TF9A 5C8NA 1H27A 4QP9A 5LCJA 3DBFA 4I94A 2X2LA 3P9JA 2R3JA 2WIPA 3ZLWA 4E4NA 4APCA 1OL5A 5HE0A 2CSNA 1HCKA 2YDJA 2PVRA 1H1SA 4GV1A 3NVMB 5IA0A 4U9AA 4FT5A 3F2RA 2KULA 4AFJA 3LE6A 4WNOA 3QALE 2CKQA 1YHVA 3GQIA 2F9GA 2X7OA 3JYAA 1NA7A 3I0QA 1FOTA 2R64A 2NYAA 4AA5A 2FUMA 4IE9A 3UYSA 2IG7A 5DG5A 3FAAA 3QFVA 4FIHA 4HGEA 2IWIA 2O5KA 3SRVA 3W1FA 4QQJA 2ZM3A 3OC1A 3Q9ZA 4RFYA 2W4OA 5JQ8A 4HNFA 2IZSA 3GU5A 4XV1A 4GT3A 1ZOEA 1ZZ2A 1YXUA 3C5UA 3VS7A 4M8TA 4BHNA 5K4JA 3RZFA 2GNGA 3R1NA 4RZVA 4AE6A 5L2IA 1IAHA 1GJOA 2YWPA 4BDEA 5JGBA 4IM0A 2XJ2A 1OIYA 1YDRE 2VWWA 3UBDA 4O7YA 4LGGA 4HYIA 2PMOX 5EDRA 4FG9A 4MHAA 2UZOA 3CTJA 3F5GA 4MQ1A 4LG4A 2W1ZA 5ANKA 3ZEWA 4RQVA 4KS8A 2JKMA 4PL5A 3P1AA 3G9LX 3B2TA 4GVJA 5HVJA 4UXLA 3V6RA 3R9OA 4IB0A 1Z57A 4TYIA 1SVEA 3DBQA 3RPYA 4X2NA 1MP8A 5HEZA 3UIMA 1R39A 3QTQA 4M66A 4QTDA 4F99A 3ZC6A 5HORA 3F5XA 3KVWA 5TR6A 2EB3A 3TL8A 4FIEA 4MCVA 4BTJA 3R7IA 1IA9A 3CQWA 4AA0A 4LRJA 4C62A 5A9UA 1PMEA 4YHJA 3VUGA 1CM8A 1YI4A 1GIHA 3BWJA 3NUYA 4UWBA 2J0JA 4MBJA 4JQ7A 5ACKA 3DXPA 4AQKA 3UP7A 5EKNA 2VTRA 4FZDB 4C4GA 2JLDA 5KO1A 4XCUA 3M11A 4RG0A 4I0RA 3DPKA 3OWLA 4IWPA 4JXFA 5EDPA 4EH7A 2GCDA 4NH1A 4R7HA 4CKJA 5HCYA 2YCQA 4BBEA</