4AE6A

Structure and function of the human sperm-specific isoform of protein kinase a (pka) catalytic subunit calpha 2
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
339
structure length
319
Chain Sequence
SSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA 2
publication title Structure and Function of the Human Sperm-Specific Isoform of Protein Kinase a (Pka) Catalytic Subunit Calpha2
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 319
sequence length 339
chains with identical sequence B
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ae6A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ae6A02
3ZCLA 3A7JA 1YXXA 5CSWA 2ITYA 3U55A 3QCYA 3U87A 2OXXA 5JK3A 1KE8A 5I9YA 1BL6A 2Z7QA 4IJ9A 4XLIA 1GZ8A 3WZJA 3R01A 3FMKA 5CS6A 4MXYA 2HXLA 4ZEGA 1B38A 3SXSA 3PPJA 3PWYA 4RX7A 4DLIA 2Q0NA 4CFWA 5BYZA 5CVFA 4C33A 4XEYA 3LW0A 4USEA 2R4BA 1RQQA 2VTQA 4HCVA 3TTJA 2C30A 4GFOA 2OGVA 3DK3A 3OD6X 3OOMA 4FV0A 2F57A 3FBVA 1Q8ZA 4RWKA 3K3IA 5E8SA 3BYOA 4ZTMA 3QUEA 4AZTA 2R3NA 4NW6A 2AC5A 2HZ4A 2VO6A 2GFSA 3T8OA 3WF6A 4BBFA 5KBQA 5KMKA 3I4BA 2HELA 3W8LA 1IEPA 2Z8CA 4GJ2A 4AGWA 1NXKA 2B1PA 1PYEA 2RIOA 5FLFA 5AUTA 4ENYA 5JFVA 4AXAA 2XNNA 4NZWB 3KMWA 2QLUA 2W9FB 1MRYA 3WBLA 3WF7A 4O82A 5L2IA 4QYHA 3SOCA 2IW6A 2JKQA 3IW7A 2OI4X 4OTRA 3K54A 2G15A 2JDTA 4JDHA 4FVQA 4ITJA 4WSQA 5AX9A 3EOCA 3Q4CA 3IW6A 4IAIA 5D41A 4BIEA 3N51A 1ZZLA 2XBJA 3O2MA 5EOLA 5CI7A 4MF1A 3U6IA 3C1XA 3NVKI 1BUHA 1YOLA 5TT7A 4Z16A 5B2KA 2I40A 4UMRA 4U45A 3L9LA 4EOQA 3WI6A 5CWZA 3RKBA 3V5WA 4QMYA 4WBOA 3OTVA 3A7HA 3QKKA 4PWNA 3FI2A 2VU3A 4JBPA 3VS0A 2ONLA 2C4GA 2J2IB 3OCBA 3AT2A 4GG7A 5J79A 5CSVA 1SNUA 4ZTHA 4AGDA 4EZ3A 4XG8A 4ZP5A 1AQ1A 2WTWA 1ND4A 3FMHA 1ZOHA 4BL1A 4D1XA 2BDWA 3OF0A 4EH5A 4BDDA 1JNKA 5HESA 4CMUA 3MY5A 3QX4A 2FSOX 3NNVA 3O8UA 3FLQA 4ZMFA 3ELJA 4F7LA 2ZB0A 1H1QA 4F08A 3BYMA 3QA0A 4JG7A 3KF7A 1REJA 4ZTQA 3C9WA 3VUDA 4CFXA 5C1QB 5JQ5A 1Q61A 4XP3A 3LQ8A 2LGCA 5AP4A 5HVJA 1BI8A 1YDRE 5I9ZA 4BYIA 3HAMA 4OTWA 4M7IA 2OKRA 3Q04A 5FBNC 4OBOA 1VYZA 2C5XA 4FUXA 4RIYB 4EUTA 1O6YA 1YRPA 5BVFA 2G1TA 3E8CA 3NSZA 4K11A 3LOKA 4R3CA 3A7GA 1T45A 1B6CB 3NUNA 4NJDA 2X7OA 3V8WA 5L4QA 4NIFA 3CY3A 3KKVA 2BZKB 4QP9A 5IU2A 4IAZA 4TWCA 5L2SA 4FZ7A 4R1YA 3LXKA 4A9TA 4OTDA 2F4JA 3R1YA 1XH9A 3EN9A 5HE0A 1J7LA 1PMVA 5HIDA 4ZJJA 3FUPA 4FSUA 3KCKA 2OFVA 4F0FA 2BCJA 4IAAA 2VWIA 3ENHA 4JBOA 1H0VA 4OTHA 4ZY6A 5AAEA 2GHLA 2ZOQA 3E64A 5J9LA 3R22A 5AIKA 5M4FA 3UO5A 3ZH8A 3COHA 3ORXA 4FR4A 4K77A 4E93A 3EIDA 5HNGA 4YPDA 4M13A 5E90A 4FIFA 3MVLA 3E5AA 4RX5A 4XCUA 1NVRA 3AG9A 4Z55A 3NUYA 4G3CA 2PMNX 2B9FA 2VN9A 3QCXA 4QRCA 4XLVA 2YA9A 5DLSA 5EDPA 5JZJA 2ZVAA 3R7UA 3GFWA 3QKLA 4X6QC 5AFVA 3LLAA 2GU8A 2XEYA 4ZY4A 2E9OA 3D7TA 4F4PA 3P7BA 4LL5A 5JQ8A 2WTCA 4FF8A 4PP9A 3RTPA 1FGIA 1RW8A 3R7YA 4F1TA 5F9EA 3VF8A 3AC5A 3D9VA 4QD6A 3M42A 2O3PA 3E3PA 2VX0A 2W7XA 2XIRA 3NYVA 4L43A 3UIXA 4Q2AA 3PA3A 2JBOA 5C4KA 5CQWA 3UC3A 2QHNA 4ALVA 3SX9A 3D2IA 3SRVB 4E20A 3DDQA 2WZJA 3G2FA 4IHPA 2BKKA 2CHLA 2C5VA 2PU8A 2F9GA 3MPAA 4HPUE 3BLRA 3PXRA 4IWQA 4UMQA 4TNBA 3FYKX 4AOTA 2UUEA 4O7LA 3QRTA 1TVOA 4BN1A 3I0OA 3RAIA 2YDJA 1NA7A 2OJFE 3AT3A 3V6SA 1KV1A 5K5NA 3R63A 4GFGA 3DCVA 4PDYA 3Q4TA 5IQFA 3DZOA 2OJ9A 3IGOA 4NUSA 3UG2A 4C35A 4EUUA 4FKGA 2R3HA 3GUBA 3R9DA 2YM7A 2YISA 3V5LA 3HRCA 1WBTA 3DU8A 5H2UA 1OM1A 4ANBA 5CI6A 4BHZA 1JVPP 2C6TA 3W10A 4DFZE 5HTCA 5I9XA 3C4ZA 5HD4A 1H1PA 3RM6A 3NNXA 2CN5A 4DEEA 5CAUA 1F3MC 2O0UA 3FMJA 4O7VA 2ZV2A 5J87A 3RWPA 3W2OA 2PSQA 3FKNA 5FD2A 5AEPA 2XJ1A 4AU8A 2ESMA 4Y95A 1WFCA 4W8EA 1LUFA 4O27B 4GUEA 4R5YA 4NM0A 5DT3A 3KXHA 2PVMA 3BYSA 1X8BA 3G90X 5GJDA 3GU4A 4B7TA 2DWBA 4IAKA 4MVFA 2YM5A 4ZTLA 4RFMA 3H10A 3Q32A 4CZYB 4E5BA 4DEBA 3KK8A 5J7HA 4GKIA 3MWUA 3QQLA 3W16A 2WD1A 4QNYA 3LFSA 4IAFA 3UYTA 4BDEA 4RVMA 1R1WA 5L3AA 4EJ7A 4CFUA 3QYWA 3CJFA 1UVRA 3FHIA 2IG7A 4WRSA 4RLKA 4XNEA 3IECA 4FBXA 4L45A 3UMXA 3KVXA 5FXRA 4DTBA 3EL8A 3MA3A 5L6OA 3HYHA 5BMSA 3Q6UA 3VHEA 4AW5A 4RVTA 3RPOA 3V5TA 3R7GA 4XG9A 1Q8WA 1M14A 2HCKA 3HKOA 3EYHA 4ZTSA 3PSBA 4R77A 3THBA 5EYKA 2Z7SA 1NVSA 4DLJA 1O6LA 4S2ZA 4ZS4A 1QL6A 4B0GA 3PJ2A 3Q5IA 2XNBA 2ONLC 4D0XA 1XWSA 1Q99A 4L3PA 4FYNA 4RJ4A 4CQEA 3FLZA 4QMSA 2W1IA 3BBTB 3P1AA 5HX6A 4AN3A 1A48A 4I5CA 4KBAA 1SZMA 1AGWA 3BHTA 3UC4A 3R00A 5LMBA 4O7NA 3U54A 5AIRA 4DA5A 4YNOA 3JY0A 5DEWA 4LG4A 3G33A 2UZUE 3ZZWA 2GNGA 2GTNA 2VTSA 4L6QA 4ZZNA 4TWPA 1S9IA 4EH8A 4CKJA 1L3RE 4FKVA 4QYFA 3UOLA 1PXOA 4FSYA 4HNFA 4BCHA 4APPA 1O6KA 3MH2A 1Q3DA 3NRMA 4IB0A 3MSSA 3PSDA 4I24A 4ZXTA 2YCQA 3M2WA 5FEQA 3PLSA 5T68A 2J51A 4FTIA 3PTGA 4FT9A 5CEMA 2FSTX 2YJRA 2EXCX 3QQJA 2X6DA 4X6RA 4XG2A 5LCKA 4FT0A 4JX3A 5EI8A 2I1MA 5GIOE 3KRRA 2ZAZA 2ETMA 4FTRA 4K0YA 2R3QA 3HRFA 4FL3A 3TIZA 4EYMA 3FAAA 3TACA 2J50A 4N0SA 4FKUA 3VULA 4N6ZA 1WVXA 4A9YA 3LCKA 4PPAA 2WTDA 3F7ZA 2WTJA 3BV2A 5FG8A 2R64A 4JBVA 2R9SA 3Q2MA 2UW9A 4W9XA 3B8RA 5CT0A 4C4JA 1OUYA 4RFZA 5FDXA 2P33A 4E8AA 5IUHA 1APME 3KXZA 4ALWA 3SLSA 2PTKA 3C13A 3R8UA 3G51A 3OWJA 3UYSA 4EQMA 2GNIA 3VIDA 5CALA 4ANSA 3CBLA 4HGSA 4RVKA 4M0YA 4L3LA 3QUPA 3T3UA 4PPBA 2PWLA 1STCE 3CGOA 2IVVA 2BKZA 3A7IA 5E8UA 4FV5A 3FL4A 3G6HA 3FI4A 5HIBA 4TTHB 3MY0A 2ITQA 3GFEA 3BU6A 3OT3A 5TE0A 5AUWA 4K18A 4DINA 3AC1A 2P3GX 3WARA 4YURA 4ZSAA 4CKRA 2RFNA 3PWDA 4S34A 4FSWA 1PJKA 4RLLA 4IC8A 3FQEA 2RFDA 5HBHA 5KMOA 5FUTA 4EH6A 2UV2A 3N4TA 5BVWA 3RHKA 2VD5A 2Y6OA 4FKSA 4YLLA 4GRBA 2AC3A 2C3KA 3E87A 3I6UA 5JGAA 4GVAA 4I20A 4JXFA 5LCJA 5KMIA 3Q53A 1KV2A 2I0HA 1DM2A 5AR4A 3NX8A 2OZAB 4DBXA 5CLPA 3HZTA 1OL5A 3TN8A 5I4NA 3OZ6A 5IQGA 4YTIA 3AD5A 2O8YA 1FVVA 4UEUA 2XP2A 1WZYA 4WG5A 4JIKA 4BI0A 1PXNA 4GU9A 1V1KA 2QKWB 3NLBA 4D4SA 1JKLA 1H07A 3E8NA 1XO2B 5KCVA 4DC2A 4UWYA 4AOIA 4O86A 5IA5A 3ZM4A 2C6MA 2OJJA 3F2AA 2H8HA 2W99B 4ZJVA 5C8NA 2GPHA 2R3JA 2CKPA 2OXDA 4IWDA 4BIDA 4L8MA 1UNHA 4F09A 2W1GA 3IDCA 3DT1A 1BX6A 1ZARA 4I21A 4CRSA 4UMTA 3QQHA 4OGRA 3SD0A 5L2WA 2UZBA 3DFAA 4JRVA 4YZDA 3AD4A 5J9ZA 2JLDA 3ETAA 5CTPA 5HVKA 5EM5A 3IW8A 4Y46A 5HCXA 2OIDA 3UVRA 4FTJA 2IVUA 2O64A 4AZSA 4BDGA 4UXQA 4O84A 3D2KA 4GJ3A 4Z7HA 4AG8A 2WTVA 2W1DA 2YLEA 3T9TA 4BC6A 3OWLA 5HTBA 2NNWB 5KZIA 1MQBA 3UP2A 5D10A 3BI6A 1OITA 4CFNA 4TYGA 3TWJA 3VC4A 2CCIA 4KIKA 2Y9QA 3FI3A 2GHGA 3QTWA 4BI1A 3SA0A 3IW5A 1W82A 2FUMA 2HK5A 4C2WA 3P78A 5EQYA 2GDOA 4KBCA 3BIZA 3KEXA 3QA8A 1CMKE 4QMQA 3D15A 4UZHA 2V55A 3O7LB 5HLNA 3PIYA 1ERKA 3PUPA 5HO6A 4EOPA 4FV2A 1WCCA 3BE9A 3MTLA 4I3ZA 4MXXA 3TXOA 4AGUA 4RJ5A 4D5KA 1ATPE 4FV1A 3U4UA 3QXOA 4HYHA 3Q2JA 2VWXA 4ITHA 1YXSA 3ZEWA 1Y57A 1LEWA 5BVDA 4QMLA 3KC3A 4RVLA 1REKA 3FJQE 4FVRA 3QTXA 1YVJA 2XVDA 2PMIA 2H96A 2C47A 4EK3A 4OLIA 4U41A 4XOYA 3Q60A 3D0EA 3OXTA 2JITA 4BKJA 4TRLA 4R78A 2YFXA 4RFYA 5M57A 5J1VA 1HOWA 3QTIA 5EQEA 2WTIA 3DBCA 4J53A 5E8VA 5HG5A 1YOJA 3NWWA 4GEOA 4XUFA 5K4JA 4W4XA 4FI1A 3GBZA 3QRJA 3OWKA 4QPMA 5AM7A 3QGWA 4JIAA 2BFXA 3RINA 3RAWA 3RCJA 4IX3A 2UVZA 2F49A 4ZSLA 3FMMA 4FSTA 4ALUA 3EQFA 4F6WA 3EQPA 5A6NA 3MTFA 4F9AA 3T3VA 3A61A 1R3CA 1JAMA 4IDVA 5ANIA 2XM9A 4X2GA 1DAWA 3DAJA 3MIAA 4JR7A 3QF9A 2X9FA 3WZDA 5LWMA 3JYAA 5JKGA 1H0WA 4H1MA 1CKPA 2BRNA 3FLWA 1Q8YA 4J8NA 3R8LA 3P7AA 3LJ1A 3GEQA 1GIIA 2P2HA 3OT8A 4D28A 5IPJA 2QKRA 3AC8A 4USFA 2XRUA 4CNHA 4NW5A 2PULA 2ITZA 3BQCA 2IPXA 3FZOA 4RWLA 3DXPA 3DXNA 3OBGA 1ZYSA 3G5DA 5TOZA 2HIWA 2WU6A 4QMXA 2PK9A 1JSUA 4RG0A 2IZUA 5HE2A 3EL7A 3R7VA 3GB2A 5GJGA 5IEXA 3OW4A 4IX6A 2DYLA 4NTSA 1CM8A 3B2WA 2JKKA 2PZRA 3B8QA 3E62A 1A06A 3HLLA 4OT6A 4TZRA 5CZIA 3W2SA 3TZ9A 3WZEA 4C4IA 4R3PA 5C01A 3TV4A 3OCGA 4ZZOA 5CSPA 3S00A 2YDKA 3JUHA 2W1FA 4IB1A 4ZIMA 4C3RA 2UW8A 3QC4A 2UZLA 3ZLYA 5IA2A 4D0WA 2P55A 4EKLA 4ZS0A 3FMNA 3W32A 3DY7A 3UDBA 1AD5A 5EDQA 4DF3A 1J3HA 2QO9A 3U4WA 4MQ2A 2OJGA 5J5TA 2XYUA 2GS7A 3GNIB 2C1BA 4PNIA 2QOQA 3EZRA 4Y8DA 4KSQA 5FP5A 5IH4A 3RHXA 3U6HA 2ZMDA 1UNGA 5CVGA 3H0YA 3L9MA 5DR2A 3LCTA 3DZQA 5EG3A 5KX8A 4C58A 2GNJA 5HLWA 3MVHA 4K6ZA 5E1EA 1ZMVA 4QOXA 5HTIA 2JIVA 3BX5A 2YWPA 3TKHA 2IN6A 1OECA 3RBWA 5BVNA 2PE0A 5JFSA 5LQFA 3DJ6A 3R30A 3DB6A 2WEVA 2QOIA 4HGTA 2PUIA 3U8WA 3AC3A 2ZDTA 4K8AA 3PRIA 4IM2A 4XHKB 5C03A 2HY0A 4WIHA 3D5UA 3O8PA 5I9UA 3ZHPC 3ORNA 4DGGA 3PLAE 2JDVA 2WOUA 2FO0A 2V7AA 4QTAA 2Y7JA 5BQ0A 3R9RA 2XNGA 2X8EA 4H3PA 2WKMA 1UKIA 2QR7A 3DBQA 3C0IA 4M15A 3F3WA 5LARA 3WILA 4ASDA 2NPQA 3GENA 3HV6A 3LXLA 2XKFA 3HMPA 5JSMA 3FLNC 2XF0A 3R7IA 3NAXA 4MX9A 1XBCA 4TYHB 4O0VA 2IVTA 2QVSE 3NEWA 4WG4A 3V5PA 4YJQA 5D7AA 4PDOA 3DKCA 4BTFA 2OF2A 3EJ1A 4BY9E 1WBNA 2QG5A 4JDIA 4L67A 3A4OX 4EOOA 5F4NA 4FT7A 4RJ6A 3QCSA 3ORZA 4BCNA 4O6LA 5IMEA 4BWXA 4PNKA 4QMNA 3NUUA 5AWMA 4FE2A 2Z7LA 4GG5A 3TNIA 2HAKA 2G01A 1VJYA 4FG8A 3SKCA 4M69B 3WIGA 3DS6A 2PUUA 3NAYA 4KRDA 4FUYA 3MFSA 2XA4A 3R7OA 4YSJA 4ORKA 1S9JA 4MK0A 2QCSA 3Q9ZA 2XJ0A 1Q8UA 3DXQA 3EN6A 4DGOA 5EFQA 4X3FC 3PFQA 2VX1A 3W1FA 4W4YA 3MB6A 2WFYA 2HOGA 4AW2A 5IDNA 2V0DA 4QYGA 2QI8A 4QTEA 3SGCA 2NRUA 3EFKA 3MV5A 3TV6A 5DMZA 5FTOA 3JVRA 4U97A 1Y6BA 4YTHA 3MDYA 2G2IA 2OK1A 2QODA 4OBPA 1HCLA 3SAYA 5AV2A 2QOKA 4FICA 4AN2A 4BBEA 5M4CA 3CD3A 2ZMCA 4PV0A 4D5HA 4O0RA 5A4CA 5M44A 3GU5A 4G3EA 4NIFB 4P7EA 4PMMA 4QQJA 5BUEA 2EVAA 2QC6A 4I5MA 3ZFXA 4AOJA 1XKKA 3KB7A 2XNPA 3N4UA 5HZNA 2YCFA 4U81A 3DGKA 3CJGA 4EOLA 4D4RA 4MAOA 4KUJA 2PYWA 2EXMA 3A8XA 2VRXA 3G6GA 4FIJA 1H24A 5JRSA 2WQEA 3QKMA 3UZTA 4DFNA 2PHKA 2W4OA 2W5BA 3EN5A 3EQIA 3NYOA 4U3ZA 4O7WA 5AM6A 4R7IA 3PPZA 4XG6A 3W2QA 4AAAA 3P86A 4PTCA 3Q96A 3OTUA 4PQNA 4CFVA 4C8BA 2WHBA 5KMNA 3VVHA 2QQ7A 5TR6A 4YO4A 3IS5A 5HORA 4YUQA 5IUGA 5AX3A 3O50A 4IXPA 3PXYA 4MNFA 4QYEA 4F64A 5DR6A 4APCA 3MVMA 2UZOA 2W1CA 1YXTA 4W4VA 3V8TA 4HW7A 3DDPA 4QQ5A 5E8ZA 5J7BA 4PY1A 1Q5KA 3ZSHA 3LM5A 5GZAA 4DEGA 4YP8A 5CX9A 3PXFA 3C4EA 3ANRA 4EORA 5CAPA 1JKKA 3QQKA 4FT5A 4RC2A 2H9VA 2XNEA 4DH1A 5J1WA 3SG9A 2UW7A 5FP6A 3NR9A 4RSSA 4EH4A 5DGZA 3R28A 4II5A 4DFBA 2XIXA 2REIA 4CT1A 4U7ZA 2VWUA 3BYVA 4O0WA 3IDPA 4TL0A 2WTKC 2X1NA 2CJMA 4YHTA 3W2CA 3BELA 1WBVA 4G6NA 2F7EE 3GU7A 3HX4A 4GYIA 1YDTE 4FKTA 4J52A 2W1HA 4YJTA 4FZAB 4DFYA 5KKRB 4F0GA 3EFWA 3AMYA 3EWHA 3MN3A 5J8IA 4BTKA 3RP9A 3FSKA 4EYJA 1UKHA 3L1SA 4XV1A 5CU4A 4E73A 5I0BA 2ZM1A 1MRUA 2VTAA 4O7TA 4P5QA 5FRIA 3ODZX 4Y5HA 2BZHB 3OS3A 2YACA 3FZPA 2JC6A 1SVHA 3NS9A 2XNMA 1Y8YA 3KMUA 4F0IA 3I79A 2EB2A 5KBRA 3MW1A 4MXAA 4JAIA 3W2PA 4KWPA 4YR8A 1H1WA 4I93A 3R8ZA 2YM8A 4FX3A 4D9UA 3VW8A 1ZWSA 2UVXA 2B9JA 4FOBA 5IISA 1OKWA 3PRFA 5EW8A 3ZRKA 4FZFB 4W9WA 5A14A 4DT9A 4YJNA 3C4CA 3ID6C 4AZVA 4FV9A 4EBWA 4UXLA 3H0ZA 2IZSA 5ANDA 3LIJA 5CANA 4FTLA 4L44A 2ITVA 3PVUA 4KABA 3HA8A 4M97A 3TUCA 3QXPA 1V0OA 4ASEA 4NYEA 4IADA 4RQVA 4ACCA 3HP2A 3BCEA 4MKCA 2UW4A 5HO8A 2J0IA 4MWHA 5EKNA 4G2FA 4P4CA 4MXZA 2Y4IB 1G8AA 4JQ7A 4WUAA 3HGKA 2O2UA 3QUDA 4P90A 1XH8A 4PL4A 3ULZA 4BCQA 4EEVA 2Q83A 5GIPE 1KE9A 4FV7A 4LQMA 2FSLX 2Y6MA 1XJDA 2GS2A 3BHVA 3COKA 1M2PA 5KMLA 4J8MA 4OTGA 4BF2A 2P2IA 2YAKA 3LXNA 3AMAA 5CF5A 4CLIA 4HJOA 4QMUA 4O7RA 4BZOA 3BHUA 1H1SA 3DB8A 4KBKA 4HVHA 3PG1A 4U40A 5AV3A 4EHVA 3CS9A 2P4IA 3A7FA 3F5GA 3MVJA 4UWBA 3VJOA 3VNTA 3ZLXA 1EH4A 2QU6A 2PMOX 2XRWA 2CKQA 2YIYA 2OIQA 5GJFA 4DBNA 3VUIA 5CT7A 4IWOA 4L68A 4RZWA 2C3IB 2YITA 2OFUA 3I6WA 4FG7A 4FIIA 4MWIA 4O91A 3UNJA 3VBVA 4F1OA 3BU3A 5E8YA 3S4QA 4F7JA 1UU7A 4LMNA 2JDSA 3F61A 5IQBA 1J1BA 2HWOA 5T6KA 4TN6A 4J96A 2OO8X 3QTSA 3HDMA 4QTCA 4ERKA 4A9SA 3BKBA 4MBIA 4MD9E 1A9UA 1UV5A 4O0XA 1KE6A 4FSNA 5EM6A 4EOSA 4TYEA 4MXCA 4O1PA 5D7VA 1W7HA 4S31A 4AT4A 1GZKA 3ATSA 5HHWA 3F2NA 2KTYA 3ZRLA 2HZ0A 2V62A 3RAHA 1W83A 3RPVA 4DN5A 4E4NA 3DJ5A 1PW2A 3VWAA 4RT7A 5HCYA 3UIUA 4UBAA 5EKOA 5DT4A 1OBGA 3D5XA 3PJ1A 2R3FA 3I7BA 5DR9A 3Q9XA 3ULIA 5EQPA 3CKWA 1FGKA 4MXOA 2CNUA 4GFMA 3DKGA 5DRBA 1IRKA 5ETCA 2UZDA 1Z57A 3EKKA 3HV5A 4R5SA 4AE9A 1Q8TA 5EM8A 4Y5QA 4FSMA 3KXNA 4E7WA 3CPBA 3OVVA 4BWKA 4I1ZA 1Q24A 4FTMA 4XJ0A 2JIUA 4FK6A 5TF9A 3FI8A 2VO3A 3QALE 3LPBA 3ZEPA 2W5AA 2VX3A 3MH1A 4YZBA 2VWBA 5HU9A 4FSQA 4U79A 3QC9A 3RCDA 3W8QA 3BHYA 3L8PA 4TYIA 5M55A 4ANOA 5JRQA 3EQCA 3CPCA 3IQ7A 2NRYA 3NYNA 2XM8A 5HOAA 1K9AA 3EQRA 1BL7A 5IZFA 4ZTNA 3LQ3A 3RWQA 3CTJA 2R3PA 3R71A 5BYYA 3ERKA 5IA3A 4E5AX 4R8QA 3PJ3A 2C3JA 3C0HA 4H3QA 3TG1A 5JFXA 2GTMA 2WOTA 3TL8A 1SVEA 3EQDA 1U5QA 3ACJA 3AGMA 3RAKA 5ITAA 5KMJA 3NUAA 5HG7A 1U54B 2FGIA 4ASXA 1U4DA 4BTMA 4PTEA 5BPYA 5I5ZA 3ORMA 3C0GA 2RKUA 2JDOA 1W0XC 1ZOEA 4M14A 3NZ0A 3QWJA 4XRLA 1ZMWA 3G9NA 3OWPA 4GU6A 1OZ1A 4J7BA 5DOSA 3SXRA 4NU1A 5JMSA 3FEGA 5F1ZA 2XZSA 4WNOA 3R9HA 4NM3A 4EOIA 3LLTA 3VBWA 4JJRA 4CCUA 1Q62A 2PZIA 3QRIA 4QMTA 5A6OA 3HV3A 3TNWA 2ZJWA 3R7EA 5KO1A 1QPEA 4C38A 3GP0A 1OBDA 1LEZA 2JDRA 3FWQA 4BDAA 4FSZA 4FTQA 1Y91A 2WQOA 5BVOA 5HEZA 2UW3A 3TM0A 1YI4A 5FXQA 4AGCA 2XJ2A 4V01A 3KULA 3ZSIA 3A8WA 3AXWA 3VO3A 3UBDA 2OICA 3ZM9A 4U5JA 4O96A 1FPUA 1KE7A 3R1QA 3R2YA 3NPCA 3PP0A 4L9IA 2ZM4A 2WPAA 2O5KA 4TWNA 4IM0A 5ANJA 3FLYA 4YBJA 5ACKA 1ZY5A 3ZFYA 3UZPA 3FKLA 3Q4ZA 3AT4A 3GCSA 4QMOA 3TKUA 1LP4A 2YJSA 4LUDA 3OMVA 2Z2WA 3LFCA 1IAJA 3F3TA 1ZRZA 2W1EA 4YJVA 2ACXA 1PMNA 4HZSA 1CSNA 5LVNA 3F5PA 5G1XA 4DITA 3NW5A 5CASA 4G3FA 3R2BA 4I0RA 1FVTA 3NGAA 4WHZA 4AE6A 5K5XA 4AN9A 3MPTA 5IUIA 2EU9A 5CEOA 3UG1A 4XMOA 2JEDA 3OHTA 4D2WA 3PXQA 4TKSA 2O63A 4G5PA 2FSMX 2Y0AA 4YGAA 5AP2A 2WMVA 4M68A 5D12A 5CF6A 5KHXA 1FMOE 3ZONA 4QP1A 3H9OA 4C59A 4BGHA 1CTPE 4EC9A 2PPQA 3ZFMA 1J91A 2VNWA 4H58A 4A9RA 3I5ZA 3ZO2A 4YJOA 3BBWA 4BBMA 1QPDA 4FTCA 3DJ7A 3DPKA 4FMQA 2B52A 4V05A 2OU7A 5KZ0A 2ZV9A 3DKOA 3I1AA 4JS8A 3LCOA 4DGNA 5HD7A 2JKMA 2X9EA 2ITPA 2GNFA 3A60A 3RPYA 2YCSA 1W84A 3OG7A 4TT7A 4ZY5A 2IO6A 4QT1A 2QOFA 5M53A 1OVEA 1P4FA 3E7VA 3WZKA 5LVLA 3FZSA 3C4FA 5CXHA 3DTWA 2E9NA 2F2UA 3QWKA 5CEQA 4KD1A 1GY3A 1UU8A 4HNIA 2C0TA 3JXWA 4IZ7A 4KIQA 2QOLA 3AC4A 4LOPA 4NWMA 2IZTA 3SRVA 5K0XA 4FV3A 3O17A 2VUWA 3CQEA 3F9NA 1R39A 2Z60A 3P79A 5AR7A 4IVBA 4CMOA 3OOGA 4S32A 1Q41A 2PVNA 1WAKA 4PMSA 1GJOA 3TJDA 3NYXA 5IH5A 3QTRA 4RA5A 4RIOA 3RZFA 3ZO4A 2JBPA 2W0JA 3LFAA 3ZBFA 1SVGA 3NCGA 1PYXA 1H08A 4FC0A 1FOTA 1RE8A 4UV0A 3V5JA 5AJQA 3RI1A 5CZHA 3ZUUA 1NY3A 1SYKA 2JKOA 3IDBA 3O8TA 2HENA 4IH8A 1PY5A 4FV8A 3KREA 3RK7A 4LM5A 3FXZA 4O21A 1T46A 4FZ6A 5F95A 4BDJA 2PVFA 2QD9A 4AZWA 4B8MA 2QOOA 4HYIA 2C5NA 3EYGA 3V6RA 1WVWA 4EL9A 3MY1A 3A99A 3D14A 3O71A 1JKSA 4FKJA 5A4QA 1TQIA 3DBEA 3PPKA 2GCDA 4YZCA 3QZFA 4IM3A 1JLUE 1V0PA 3FC1X 3HECA 4YJUA 3RPRA 2C6KA 5DFPA 4JQ8A 4G31A 3DA6A 1OKVA 5AUVA 3P5KA 3VBXA 4RC3A 2ITUA 3QZGA 2UZEA 3S1HA 5IQDA 3HRBA 4MNEA 1YDSE 2ITWA 2J0JA 1VYWA 3EHAA 4QP2A 4L46A 4IX5A 4XRJA 2A2AA 3DLSA 5HKMA 4C62A 1KE5A 2UZNA 4FIGA 4M67A 5AP1A 5AAFA 4BCJA 5KHWA 4F9CA 3UNZA 4LOQA 1MRVA 3ATTA 2WO6A 2R2PA 4TPTA 4I6BA 5HVYA 4O38A 4QPAA 4BDHA 5AR3A 3QZIA 4OTQA 5A3XA 5HBJA 4FT3A 3TNQB 2JGZA 2GQSA 2EB3A 5E9EA 5IQHA 1SM2A 1GOLA 3DV3A 1YOMA 4AT3A 4E5WA 3PG3A 4GIHA 2XIYA 2BRBA 4EH2A 5IEYA 5B7VA 3DAKA 2CKEA 2WQNA 3EN7A 4EONA 4K9YA 2BRHA 3Q5ZA 2A0CX 4LGGA 4U9AA 3NW7A 4BR3A 1OIUA 4GKHA 3CQWA 3F66A 5E8XA 4DCEA 3KK9A 4WT6A 3SC1A 2W5HA 4L53A 4WKQA 4DH8A 3IG7A 2XB7A 4X3FA 4XG3A 3BGPA 4JI9A 2R3GA 4ANNA 4EQCA 5M07A 3E63A 3ZSGA 1RDQE 2GQGA 2C1AA 3QRKA 3CC6A 1GIHA 3KRLA 4JR3A 3MFTA 3FPMA 2QNJA 3TZ7A 3EH9A 4M8TA 4XBRA 1E1XA 4L52A 4IFCA 5IDPA 4IX4A 3W2RA 2WMTA 2VTOA 3IONA 3LHJA 3T9IA 5AR5A 3F3ZA 2B0QA 3GC7A 3P7CA 3PY1A 4HGEA 5G6VA 3ZYAA 2WMAA 3H9FA 4LFIA 5L6WL 1H00A 2CMWA 3C4WA 5E4HA 2OJIA 4RZVA 4UY9A 4XV9A 2CGUA 2Z02A 3GC8A 2SRCA 2GS6A 3DBFA 3HNGA 3ORPA 3OEZA 2C6IA 5CF4A 1MP8A 5I3RA 4ID7A 2W1ZA 2WMSA 2CNQA 3I5NA 2R3OA 2VGOA 4I0TA 4I41A 2BDJA 4K33A 4I94A 3UVQA 4BYJA 5CAOA 1UWJA 3KF4A 5CQUA 1G5SA 2J7TA 5EYDA 3CR0A 2OXYA 3CGFA 2GNHA 3PE2A 4AFJA 5HGIA 2HW7A 4Z9LA 4GT3A 2FYSA 5ICPA 5LOHA 2BAKA 1YI6A 2C6OA 2R0UA 4MH7A 2XH5A 5EH0A 3L8SA 5ETFA 2BR1A 1BI7A 3TIYA 1XQZA 1XBAA 3KXXA 2BIKB 2OBJA 5F20A 5EYMA 3K5VA 4EBVA 5JFWA 3H30A 3SQQA 3QRUA 2WMRA 3DK7A 3ZXTA 4DT8A 1E9HA 1HCKA 4FKOA 4YC6A 1ZZ2A 1PXPA 5CNNA 2PE2A 3MJ1A 4KNBA 2PL0A 2PZ5A 4AW1A 4CQGA 4UWCA 3TNHA 4ACGA 4YC8A 4D9TA 2QURA 5A9UA 5L6PA 5FM2A 4BKYA 4FEXA 2XKDA 3VS5A 3QYZA 3E92A 4G17A 4TY1A 4G34A 4XG4A 4O2PA 4LGHA 4I6QA 3HL7A 4B9DA 4ERWA 4O0TA 5LMAA 4D2VA 3VBTA 5AA9A 3GCQA 3RK9A 3KA0A 2UZTA 4QP6A 3C5UA 1BYGA 2ZV7A 4IE9A 4BDFA 3Q3BA 4F9WA 4IB3A 5FDPA 4CGAA 2O65A 4CFFA 4NJ3A 5KE0A 4B4LA 5HG8A 4JLCA 3HA6A 5FTQA 2PVHA 2V22A 3NUPA 4EI4A 4JRNA 3UVPA 3IO7A 4I4EA 2BRGA 1OIRA 4BCPA 1ZAOA 4CVAA 5CSHA 2W05A 4B8LA 2NP8A 4AT5A 2BIYA 4H3BA 5A4EA 1R0PA 3LE6A 4IMYA 5EI6A 3REPA 4IW0A 4E4XA 2BTSA 2ITXA 4DEDA 4LRKA 3LCSA 3R02A 3UODA 5FBOA 3BYUA 4QP4A 4LV5A 3EB0A 4YTFA 4OAUC 3POOA 3BWFA 4BFMA 1KSWA 4GSBA 4GIIA 4DG0E 3UO4A 5EI2A 4PTGA 2XK4A 3EFLA 3GI3A 3UO6A 2C5OA 4AZEA 4CYIA 4NKSA 4M0ZA 4GUBA 4ASZA 3NMUF 1PMUA 3ZRMA 4CG9A 3F3UA 4BDIA 4O81A 3F3VA 3FC2A 4ZK5A 3A2CA 4NH1A 3KU2A 5IQCA 4FTTA 4IVDA 2OSCA 3JVSA 5C26A 1J7UA 4Z7GA 4G1WA 4DFUA 2XIKA 5KMMA 4RIWA 3ZC5A 1XH6A 5IA1A 4F7SA 4QMZA 4F70A 1GZOA 3H9RA 4FKWA 1UU9A 4O0YA 4R1VA 5A46A 1PKGA 4IIRA 1DS5A 3IOKA 3COMA 3F7WA 3OFMA 3ZXZA 2G2HA 3LFNA 4PRJA 2Y8OA 3QLFA 3ORIA 4AACA 4BHNA 3C51A 3O96A 1UA2A 2X39A 5M51A 3LXPA 4UYAA 4CTCA 3OCTA 2PUPA 2CGXA 4C37A 5BUIA 4X7QA 5JEBA 3N4VA 2QONA 4FZDB 2XCHA 1E1VA 3OEFX 4L00A 3HMNA 5GZ9A 2RSVA 3RK5A 2J90A 1YWVA 4RJ3A 3ZU7A 5JH6A 1IR3A 2XNOA 2YIWA 2HWPA 2QHMA 2YIQA 3PIZA 4IC7A 2BRMA 2YAAA 3ZZEA 4CZUA 1YHVA 1YXUA 2OLCA 4C2VA 3OP5A 2CPKE 4ACHA 3WF8A 3JR1A 1LR4A 3BV3A 2PE1A 3F69A 4D2RA 5BUJA 4BCMA 4PP7A 3FXWA 3PJCA 3QZHA 2FVDA 2BVAA 2XK6A 4MD7E 4YHFA 5L8JA 4EH9A 3MB7A 4EK4A 3RZBA 5ANOA 3ZDIA 3MJ2A 3V01A 2RL5A 2FA2A 2R3IA 5AP7A 2YDIA 3MFRA 3PIXA 1I09A 4A9UA 4K1BA 3CIKA 4RMZA 4IZAA 3FV8A 3O0GA 2WGJA 5JGBA 1ZY4A 3BE2A 4LOOA 5A54A 5BNJA 2CLXA 2CSNA 2XK8A 1FINA 3SHEA 2GQRA 3TZMA 4X2KA 4FEQA 4HVSA 4UMPA 1ZOGA 3QD0A 5A4TA 4DHFA 5EM7A 5AP5A 3OC1A 1YQJA 1Y6AA 4RWIA 3OY1A 3VS6A 4HPTE 2OW3A 2WIPA 4U44A 4DH7A 5JZNA 4JBQA 2OH0E 3FSFA 4RBLA 4F6SA 3OY3A 4OW8A 4RX8A 5D9HA 5LWNA 1OL2A 5DI1A 4KINA 4NM5A 4E3CA 5LVOA 4AW0A 4CV9A 1NW1A 3NVMB 5FEDA 3WIKA 4FKRA 3JPVA 1I44A 2I0VA 3R1NA 4KKHA 3AD6A 3OCSA 3G0FA 5CSXA 3PA5A 4B99A 2RGPA 4KIPA 2ITOA 4I92A 4MF0A 3R1SA 1SMHA 3DAEA 4AA4A 5A4LA 4DTAA 5LMKA 4D58A 3VUTA 3PJ8A 4JT3A 3R21A 4QO9A 3NNWA 3BRBA 3QHRA 5I9VA 4BCGA 4I4FA 1QCFA 5IH6A 2YM3A 4DGLC 5M09A 5AP0A 3GVUA 4X3JA 5K3YA 4E4MA 5EDRA 3PDTA 4ZLZA 4WG3A 3CD8A 4RJ7A 3D7TB 5GNKA 3S3IA 3VRZA 5C8KA 2ZYBA 5GINE 2JD5A 2X8DA 2J5EA 4W8DA 4FGRA 4FGBA 3UTOA 4NFMA 3CEKA 3VS2A 4C7TA 1J7IA 2YCRA 2YN8A 4QNAA 3PA4A 3OXIA 3PXKA 3G15A 3CCNA 3R9OA 4F9YA 3UMWA 3DFCB 3ZUVA 4M12A 2YLFA 3O23A 1PRYA 4PL3A 5HU3A 4IVAA 2HW6A 5FTGA 4EHZA 3I60A 4PPCA 4YSMA 1JPAA 1OUKA 3S95A 3VS7A 2RG6A 3FMDA 3M1SA 4A07A 1G3NA 2A1AB 3GGFA 4IEBA 3I81A 5ETAA 2CN8A 2RG5A 4NSTA 5HCZA 4CRLA 4IJPA 4EH3A 4OTIA 4QMVA 5H3QA 4G5JA 4G6LA 4O6EA 5IQAA 5TO8A 2WMXA 3HV7A 4EZ5A 3K2LA 2BUJA 4GL9A 2CLQA 4RC4A 4GCJA 2VTLA 5GHVA 5J95A 2ZB1A 2EXEA 1ZLTA 4O0SA 2YABA 4V04A 3BHHA 2VTTA 3RJCA 2B53A 3UGCA 5M56A 1GAGA 3PVWA 4DEHA 2FH9A 4F99A 2W9ZB 4TYHA 4FIHA 4HVDA 3L9PA 3I7CA 4KB8A 2ZM3A 3QAME 5H8BA 5BX0A 2HY81 3L8VA 4N57A 4UYNA 2OH4A 2RFSA 2ZDUA 3V51A 1GIJA 1IG1A 3ZS5A 3OW3A 3TV7A 3QTZA 5C9CA 3MESA 4WA9A 1UWHA 4V0GA 1YKRA 1QPCA 3NUSA 4I5PA 1XBBA 2BTRA 4JVGA 4AX8A 3KCFA 2VTIA 4E6DA 3E7OA 1FBNA 4JDKA 1QPJA 1URWA 4RIXA 4M69A 4ZLOA 4LMUA 5HNIX 4CYJA 4O1OA 4BGQA 4QYYA 2VTMA 3M11A 4L42A 4EHEA 4YO6A 1IA9A 2X4ZA 4WNKA 4H36A 3KULB 3UQGA 3ZUTA 5EHYA 3IOPA 2G9XA 3C4XA 2VWZA 3CLYA 3BEGA 3DK6A 3PYYA 1OPKA 1BLXA 4YZMA 4EK5A 1PXIA 3SG8A 4CEGA 1CDKA 5CYIA 5TKDA 2G2FA 1PXLA 5FWKK 2WU7A 3QFVA 5IA4A 3UZRA 2V7OA 2VTPA 4N4SA 4X0MA 2OWBA 5F94A 3DNEA 5JT2A 4EOJA 5H9BA 1BKXA 4MQ1A 4FOCA 5M4IA 3FZ1A 3V3VA 3QQFA 5B2MA 3MGYA 4ENXA 3UOKA 5EOBA 4BZNA 4ZMEA 4U43A 1O9UA 1PXMA 2W17A 3P23A 4KS8A 3NUXA 5EW3A 3WF9A 4OBQA 3ZTXA 4A4LA 5IQIA 3WF5A 3IKAA 2UVYA 5CXZA 3AC2A 5E7RA 5AUYA 4Q9ZA 3R83A 2YZAA 1WMKA 1M7NA 3GC9A 5HICA 5CF8A 3QGYA 5E92A 4I5HA 2JAVA 4XS2A 5DVRA 4HVGA 4NCTC 5HLPA 4P2KA 2J0MB 3ZC6A 5FEEA 3OBJA 2W96B 4XOZA 3PVBA 4CZTA 3D5VA 5ANKA 5E8WA 5CEKA 4YJRA 5IA0A 4PUZA 5B0XA 5HI2A 3TUBA 1KOAA 3R8PA 5FGKA 4XP0A 4QQCA 3EQGA 2QOCA 1OIYA 3LVPA 5AMNA 5DT0A 5HX8A 1ZYLA 4BDBA 4FKIA 4YLKA 2W4JA 1F5QA 3PZEA 3VS4A 4EOKA 1OKYA 4WO5A 4C4EA 3V04A 4YMJA 3UIBA 2XMYA 3ZO1A 4BCIA 1JOWB 1VEBA 3EFJA 3TJCA 5LJJA 2YWVA 3CTHA 3VS1A 3QLGA 3AMBA 4AA5A 4C4HA 3LMGA 4O0UA 3SXFA 1UU3A 4DYMA 5AR8A 2J9MA 5EW9A 3HV4A 2GNLA 4AP7A 2JIIA 5DWRA 4OR5A 1WBWA 3DTCA 4GMYA 2H34A 3R04A 1H26A 2J0KA 4FNXA 3BZ3A 3FY0A 4M66A 3E88A 3FMEA 4XP2A 5DEYA 4BCFA 2X7GA 2VNYA 3KXGA 4DAWA 1W8CA 2W06A 4BCOA 2C3LA 4D1SA 5LMKC 2WAJA 4FVPA 5CENA 3F5UA 1Z9XA 3U51A 5L8LA 3DOGA 3ANQA 4ARKA 3GOPA 4L7FA 4ZOGA 3I0QA 3ROCA 4D2SA 5HQ0A 2PZYA 3LFDA 4Y83A 2VO7A 1QMZA 2WMBA 3H4JA 4ONAA 5D11A 5EK7A 3VQUA 4D4YA 4UMUA 3RALA 2HXQA 3HAVA 1ZYDA 4RRVA 4TW9A 1UNLA 3BPRA 4D2PA 1M52A 1P2AA 2VAGA 3ITZA 4U8ZA 2I7QA 3FY2A 2DS1A 2Q0BA 2F2CB 3NDMA 4K2RA 4F63A 1GZNA 2ETRA 3SDJA 5C8MA 2PVYA 2YM4A 5ACBC 1H28A 2E9VA 4Y85A 3RPSA 4D1ZA 4Q5HA 3ORKA 4IANA 2PMLX 2BALA 3F2RA 1K2PA 1FMKA 2IW8A 3KL8A 1DI9A 3KVWA 3R73A 3SV0A 1IASA 4ZTRA 3VW6A 1ZMUA 3V5QA 3E93A 2XK9A 4CTBA 4F6UA 1SNXA 4CD0A 4FTOA 4JL9A 2XBAA 4GH2A 3F82A 3JS2A 4R6VA 3FDNA 1H4LA 4RA4A 4JOAA 3D94A 2J5FA 3SOAA 3ZLWA 1CKIA 4BDCA 4EZ7A 4AFEA 5K4IA 2QU5A 3GCUA 1G8SA 2ETKA 2R5TA 4BICA 4PMPA 4O7YA 1M2RA 2QR8A 5AP3A 4MNEB 1YHSA 2PVLA 2CGWA 4FTAA 4QP7A 1JKTA 3HUBA 4YZNA 3VUKA 1TQMA 3IW4A 4WNPA 4RIYA 5AR2A 5DA3A 4LGDA 3E8DA 3ZMMA 2IWIA 4WRGA 4E4LA 2OIBA 3UQFA 2QO7A 4CXAA 3TTIA 3UP7A 5C27A 4WBBB 4YLJA 4BDKA 2E9UA 4DH3A 3VUGA 3HMMA 3EZVA 4BB4A 3LFEA 3KRXA 1XH4A 3ZBXA 3NIEA 3DLZA 3QL8A 4KKEA 4YNEA 5I3OA 3MBLA 1FQ1B 3KXMA 4YPSA 4KIKB 2BFYA 4GK4A 4GYGA 3WZUA 5KNJA 2C5YA 4EOMA 3L9NA 2X81A 5AP6A 5AUXA 3ENMA 5ANGA 3FZTA 5H8EA 3MIYA 4MBLA 3VJNA 2I0YA 5IG1A 4IB5A 5BVEA 4GV1A 4WOVA 4X3FB 1TQPA 1OPJA 5ANEA 1OL1A 2XKCA 2X8IA 3GCVA 1GNGA 3GQLA 3LM0A 3PY3A 3RNYA 2PVJA 3TKIA 4A06A 4AZFA 4BTJA 3P9JA 3Q4UA 4C57A 5HIEA 4PL5A 2R3KA 1OMWA 3VRYA 5CEPA 3MS9A 1WBPA 1U46A 2IW9A 4L3JA 5LVPA 1PKDA 3KN5A 3KY2A 3OUKA 3RVGA 4EJNA 4A4OA 4HCTA 4FA2A 3KN6A 4MEDA 2BMCA 4YTCA 3UNKA 3E8EA 4GT5A 1OPLA 3UPXA 1OB3A 1XH5A 4FSRA 4UZDA 3U9NA 4LL0A 3AQVA 4CSVA 5C4LA 1YW2A 3TCPA 1J1CA 2CCHA 2CGVA 1Y8GA 4X2FA 4X21A 5HBEA 3NIZA 3FQHA 4I0SA 3BGQA 5H8GA 2VGPA 3DNDA 3TNPC 4ZSJA 4EK8A 3CE3A 4IFGA 2R7IA 4A4XA 4BKZA 4H39A 3CTQA 2GMXA 4KRCA 1U59A 4DEAA 2VWVA 4C0TA 4HCUA 3U6JA 4RJ8A 5DNRA 2GFCA 5BVKA 4NEUA 3F5XA 1B39A 4CMTA 2OF4A 5CU0A 1XR1A 4U3YA 4QP8A 4AS0A 1OL7A 4EHGA 4D2TA 3LAUA 4O83A 4UALA 4CLJA 4QTDA 4YBKA 4ZLYA 4EKKA 4UX9A 4U6RA 4JX7A 2X6EA 4H1JA 4W4WA 4MYGA 1YHWA 3ODYX 4JNWA 3F6XA 5FM3A 5DN3A 4I6HA 3UIMA 4PDSA 1U54A 3G0EA 3KRJA 4C34A 1M7QA 2FB8A 3Q52A 4E6AA 4PDPA 1U5RA 5ETIA 4R7HA 2QO2A 4FIEA 3FXXA 4QTBA 3COIA 4ACDA 1F0QA 3VQHA 5EHLA 2B7AA 2C0IA 4FYOA 4NFNA 4X2NA 5KUPA 1KUTA 2YIRA 3OROA 1CKJA 4J98A 4KS7A 3FZRA 3KFAA 3POZA 4FKPA 4ZZMA 5DG5A 4WNMA 3S2PA 4BI2A 5AUUA 3II5A 3VBQA 1WBSA 3K5UA 1IAHA 1KWPA 4NK9A 4DG2E 3LMIA 1P4OA 2VWYA 4GT4A 4ZJIA 3UOHA 4R7BA 4AQCA 1KOBA 4FL1A 4UB7A 3KRWA 2F7ZE 2WTKB 5AV4A 5HNBA 4MHAA 3DBDA 4M3QA 5E8TA 3ALOA 1PXKA 3HP5A 3QCQA 5LXMA 3CXWA 5EHOA 3P4KA 3G9LX 2AUHA 4G9CA 1LPUA 4QP3A 5D1JA 2C0OA 4ANQA 1PHKA 4BRXA 2PY3A 3ET7A 1XH7A 4J1RA 5CEIA 5KKRC 2CKOA 2YZLA 2WQBA 4IBMA 3VS3A 5I9WA 4ZSGA 3H3CA 3TI1A 4IDTA 4IACA 3BEAA 3MFUA 4ITIA 4C61A 5DH3A 1DI8A 3LZBA 4KKGA 3GU6A 2BILB 4PF4A 2BHEA 5HE3A 3FL5A 2VV9A 4OTPA 2WMUA 3Q9WA 5DHJA 2VTJA 4JQEA 4QMMA 2C69A 3CKXA 3LKMA 2DQ7X 1M2QA 2WNTA 3HMOA 4FNZA 4DH5A 4FL2A 4G3DA 4XYFA 5DE2A 5J9YA 3UE4A 3QTUA 4FTKA 3W33A 4P5ZA 4IQ6A 3CSVA 3ZOSA 4R3RA 2R0IA 2X2KA 4I6FA 1PMEA 3BU5A 4UN0C 3QBNA 4YJSA 3SW7A 2UW6A 3EQBA 4FK3A 1H27A 1PF8A 2LAVA 2R3MA 1FVRA 4MTAA 3BQRA 3QD2B 2Y4IC 4RIWB 5L8KA 2EWAA 4J99A 4IVCA 4ANMA 1H25A 2V5QA 4X2JA 5DBXA 2B54A 1Z5MA 2QOBA 4D55A 4ZAUA 4G3GA 3KMMA 4GS6A 3P08A 4Q5EA 4XBUA 4RWJA 1P5EA 4B6LA 2X7FA 3R0TA 3JY9A 3DQXA 2NO3A 2GHMA 2WQMA 3LCDA 4QMPA 4DE4A 3NNUA 2YEXA 3GU8A 5CAQA 4PX6A 2VWWA 4QMWA 4E6CA 4TXCA 3IK3A 4NT4A 3HUCA 5AV0A 3D7ZA 4C36A 4CFMA 3EQHA 1JSVA 2PZPA 4YJPA 4YU2A 2ITNA 3N9XA 4FTNA 2WIHA 3Q6WA 3UJGA 5CNOA 2XIZA 2IVSA 4A7CA 5DPVA 2C6LA 3D5WA 2XUUA 2VZ6A 5K0KA 2VO0A 3Q9YA 4C4GA 5IMXA 2XYNA 3FE3A 3SVVA 1JSTA 2BPMA 2OZOA 4JDJA 4DFXE 3D83A 4LV8A 2BHHA 2XEZA 1YI3A 3CQUA 4GK2A 4G9RA 2HYYA 2YERA 2I6LA 3TZ8A 4O7SA 4F1MA 3FPQA 4FEWA 4C02A 4PMTA 4NKAA 3V8SA 1PXJA 3EN4A 3QD4A 4Q9SA 3ALNA 2A27A 2H6DA 3FKOA 1Q4LA 3WOWA 4CV8A 2R3RA 2A4LA 2VTRA 4O7ZA 5CU6A 1H8FA 2C6EA 4J71A 5L2QA 2AYPA 3HMIA 3VHKA 4E26A 5M08A 3IGGA 3WE4A 1XHAA 3U9CA 3QX2A 2X0GA 1ZYJA 4YZ9A 3B2TA 2UW0A 2XCKA 5IF1A 4AUAA 1YXVA 3C5IA 4RQKA 3WYYA 2Z7RA 2P0CA 2VTNA 1VR2A 3CP9A 5CAVA 2J0LA 3GOKA 4XX9A 4CCBA 3PE1A 1JQHA 2OZAA 2B4SB 4C4FA 3FLSA 4IZYA 1YWRA 4J95A 2E2BA 3DKFA 3FQSA 4U42A 4Z3VA 1OL6A 5AAGA 1BMKA 2GSFA 2Y4PA 3A62A 2VTHA 4G16A 4EC8A 4HOKA 4DTKA 3RMFA 1URCA 3QU0A 4MCVA 1ZXEA 3BWJA 3E3BX 3KQ7A 2QG7A 4EWQA 2ITTA 3LFBA 4NL0A 4L7SA 1JWHA 3MH3A 1NT2A 2E9PA 2C68A 4HVIA 3BLQA 2X2LA 2RFEA 3OUNB 4F7NA 4WSYA 3QTQA 2BDFA 3VAPA 4IAYA 1VZOA 3GC0A 1M17A 2IJMA 3FHRA 2BAJA 4GK3A 4N70A 3LMHA 4H05A 2WELA 4S33A 4BVUA 1DAYA 1OGUA 2BAQA 3GQIA 1IA8A 4DG3E 4TNDA 4F9BA 4KIOA 3C50A 3TEIA 3W18A 2KULA 3UQCA 1OIQA 4RGJA 3SW4A 3NCZA 5CVHA 5AV1A 3VUHA 4OT5A 5K9IA 5BMMA 5E91A 4O2ZA 3W55A 4AF3A 2HZNA 2B55A 3EKNA 4HGLA 4YC3A 4TWOA 4RPVA 1R0EA 4N6YA 2XK7A 2BROA 3AOXA 3TUDA 4E1ZA 4EH7A 4KAOA 4BCKA 1ZYCA 2UZWE 4D4VA 2JFLA 4FV6A 2WXVA 3ZO3A 1NVQA 2F7XE 3ZDUA 2ERZE 2PUNA 2J4ZA 5DIAA 2IZRA 2J6MA 2X2MA 3D4QA 3QQGA 2UW5A 3VF9A 4BWPA 4NM7A 4LUEA 3AGLA 3BLHA 3ORTA 5HG9A 5HO7A 3R9NA 3WYXA 5AADA 2HZIA 3P0MA 4FKQA 4JG8A 4ZSEA 3VUMA 3TDWA 5M06A 1OKZA 4USDA 4OAVB 5IQEA 1Q3WA 1TKIA 3L8XA 1R78A 1WBOA 2QLQA 4MD8E 4LRMA 2I0EA 4YHJA 2CDZA 3WE8A 4LRJA 3BGZA 4AA0A 3S0OA 1V0BA 4FKLA 5T3QA 5JN2A 4GVJA 4E6QA 5LVMA 1MUOA 3QHWA 4XH6A 4XV3A 4DFLA 4EQUA 2B9HA 2JAMA 5DYJA 3GXLA 3IPHA 2A19B 3GT8A 3ZLSA 4BZDA 4ACMA 3MH0A 3PXZA 4KA3A 3O7LD 3TT0A 1Q97A 4DEIA 1RJBA 4QQTA 5HE1A 3FMLA 1W98A 2YHVA 3VN9A 4CKIA 2CNVA 4CG8A 2X4FA 2BZIB 4OUCA 3R8MA 5AA8A 4V0GB 4WD5A 5E1SA 3DQWA 1JBPE 2YM6A 3PZHA 3QQUA 4OTFA 3MI9A 1K3AA 2EUFB 2R7BA 3HVCA 4NCTA 2BZJA 5DRDA 3F88A 5IKWA 3NW6A 3MPMA 2WEIA 3VBYA 1OI9A 4RIXB 1L8TA 4FNWA 3R8VA 3PSCA 4FV4A 4LYNA 5CY3A 3HEGA 5M4UA 1WVYA 3LJ0A 5CU3A 3C7QA 2DUVA 3LQ5A 2XK3A 4JAJA 3LFFA 2WB8A 4IZ5A 4NTTA 5AUZA 4AWIA 4U80A 4BGGA 4BIBA 4MBJA 4HZRA 3ROYA 3UPZA 5L2TA 2W4KA 3ORLA 4IWPA 4I23A 3MYGA 3FYJX 3KGAA 5JGDA 4FNYA 4HYSA 5EYCA 1MQ4A 3QD3A 3R6XA 4LI5A 2PVKA 2PVRA 4DCAA 3MA6A 3RGFA 4M84A 5J5SA 1P14A 1YWNA 4F65A 2XKEA 3CY2A 3PY0A 4WUNA 3ACKA 4XG7A 2OG8A 2ZV8A 2B9IA 2YIXA 4FODA 3TDVA 4QPSA 4S30A 4FTUA 4C3PA 4GW8A 4C3FA 2WMQA 3PP1A 4KSPA 3LFQA 3LJ2A 3PVGA 1H01A 4L01A 5CU2A 3OXZA 5BYLA 3RM7A 4FEUA 4FEVA 4RX9A 4DGMA 5FXSA 4EK6A 3UOJA 3EMGA 5B2LA 3GCPA 4FG9A 4Y72A 2UZVA 5IEVA 4CT2A 2ERKA 4ANLA 3HDNA 2JFMA 5GZ8A 4U0IA 4G6OA 4EWHA 3RNIA 4TYJA 4HYUA 2R3LA 2RF9A 3K3JA 4JG6A 1H1RA 4XV2A 5FQDC 3O51A 2WMWA 4Y73A 2XS0A 2C6DA 4O22A 4I22A 4J97A 3A4PA 2QOHA
chains in the Genus database with same CATH superfamily
3ZCLA 3A7JA 1YXXA 5CSWA 2ITYA 3U55A 3QCYA 3U87A 2OXXA 5JK3A 1KE8A 5I9YA 1BL6A 2Z7QA 4IJ9A 4XLIA 1GZ8A 3WZJA 3R01A 3FMKA 5CS6A 4MXYA 2HXLA 4ZEGA 1B38A 3SXSA 3PPJA 3PWYA 4RX7A 4DLIA 2Q0NA 4CFWA 5BYZA 5CVFA 4C33A 4XEYA 3LW0A 4USEA 2R4BA 1RQQA 2VTQA 4HCVA 3TTJA 2C30A 4GFOA 2OGVA 3DK3A 3OD6X 3OOMA 4FV0A 2F57A 3FBVA 1Q8ZA 4RWKA 3K3IA 5E8SA 3BYOA 4ZTMA 3QUEA 4AZTA 2R3NA 4NW6A 2AC5A 2HZ4A 2VO6A 2GFSA 3T8OA 3WF6A 4BBFA 5KBQA 5KMKA 3I4BA 2HELA 3W8LA 1IEPA 2Z8CA 4GJ2A 4AGWA 1NXKA 2B1PA 1PYEA 2RIOA 5FLFA 5AUTA 4ENYA 5JFVA 4AXAA 2XNNA 4NZWB 3KMWA 2QLUA 2W9FB 1MRYA 3WBLA 3WF7A 4O82A 5L2IA 4QYHA 3SOCA 2IW6A 2JKQA 3IW7A 2OI4X 4OTRA 3K54A 4O4FA 2G15A 2JDTA 4JDHA 4FVQA 4ITJA 4WSQA 5AX9A 3EOCA 3Q4CA 3IW6A 4IAIA 5D41A 4BIEA 3N51A 1ZZLA 2XBJA 3O2MA 5EOLA 2XALA 5CI7A 4MF1A 3U6IA 3C1XA 3NVKI 1BUHA 1YOLA 5TT7A 4Z16A 5B2KA 2I40A 4UMRA 4U45A 3L9LA 4EOQA 3WI6A 5CWZA 3RKBA 3V5WA 4QMYA 4WBOA 3OTVA 3A7HA 3QKKA 4PWNA 3FI2A 2VU3A 4JBPA 3VS0A 2ONLA 2C4GA 2J2IB 3OCBA 3AT2A 4GG7A 5J79A 5CSVA 1SNUA 4ZTHA 4AGDA 4EZ3A 4XG8A 4ZP5A 1AQ1A 2WTWA 1ND4A 3FMHA 1ZOHA 4BL1A 4D1XA 2BDWA 3OF0A 4EH5A 4BDDA 1JNKA 5HESA 4CMUA 3MY5A 3QX4A 2FSOX 3NNVA 3O8UA 3FLQA 4ZMFA 3ELJA 4F7LA 2ZB0A 1H1QA 4F08A 3BYMA 3QA0A 4JG7A 3KF7A 1REJA 4ZTQA 3C9WA 3VUDA 4CFXA 5C1QB 5JQ5A 1Q61A 4XP3A 3LQ8A 2LGCA 5AP4A 5HVJA 1BI8A 1YDRE 5I9ZA 4BYIA 3HAMA 4OTWA 4M7IA 2OKRA 3Q04A 5FBNC 4OBOA 1VYZA 2C5XA 4FUXA 4RIYB 4EUTA 1O6YA 1YRPA 5BVFA 2G1TA 3E8CA 3NSZA 4K11A 3LOKA 4R3CA 3A7GA 1T45A 1B6CB 3NUNA 4NJDA 2X7OA 3V8WA 5L4QA 4NIFA 3CY3A 3KKVA 2BZKB 4QP9A 2XARA 5IU2A 4IAZA 4TWCA 5L2SA 4FZ7A 4R1YA 3LXKA 4A9TA 4OTDA 3TYKA 2F4JA 3R1YA 1XH9A 3EN9A 5HE0A 1J7LA 1PMVA 5HIDA 4ZJJA 3FUPA 4FSUA 3KCKA 2OFVA 4F0FA 2BCJA 4IAAA 2VWIA 3ENHA 4JBOA 1H0VA 4OTHA 4ZY6A 5AAEA 2GHLA 2ZOQA 3E64A 5J9LA 3R22A 5AIKA 5M4FA 3UO5A 3ZH8A 3COHA 3ORXA 4FR4A 4K77A 4E93A 3EIDA 5HNGA 4YPDA 4M13A 5E90A 4FIFA 3MVLA 3E5AA 4RX5A 4XCUA 1NVRA 3AG9A 4Z55A 3NUYA 4G3CA 2PMNX 2B9FA 2VN9A 3QCXA 4QRCA 4XLVA 2YA9A 5DLSA 5EDPA 5JZJA 2ZVAA 3R7UA 3GFWA 3QKLA 4X6QC 5AFVA 3LLAA 2GU8A 2XEYA 4ZY4A 2E9OA 3D7TA 4F4PA 3P7BA 4LL5A 5JQ8A 2WTCA 4FF8A 4PP9A 3RTPA 1FGIA 1RW8A 3R7YA 4F1TA 5F9EA 3VF8A 3AC5A 3D9VA 4QD6A 3M42A 2O3PA 3E3PA 2VX0A 2W7XA 2XIRA 3NYVA 4L43A 3UIXA 4Q2AA 3PA3A 2JBOA 5C4KA 5CQWA 3UC3A 2QHNA 4ALVA 3SX9A 3D2IA 3SRVB 4E20A 3DDQA 2WZJA 3G2FA 4IHPA 2BKKA 2CHLA 2C5VA 2PU8A 2F9GA 3MPAA 4HPUE 3BLRA 3PXRA 4IWQA 4UMQA 4TNBA 3FYKX 4AOTA 4LDTA 2UUEA 4O7LA 3QRTA 1TVOA 4BN1A 3I0OA 3RAIA 2YDJA 1NA7A 2OJFE 3AT3A 3V6SA 1KV1A 5K5NA 3R63A 4GFGA 3DCVA 4PDYA 3Q4TA 5IQFA 3DZOA 2OJ9A 3IGOA 4NUSA 3UG2A 4C35A 4EUUA 4FKGA 2R3HA 3GUBA 3R9DA 2YM7A 2YISA 3V5LA 3HRCA 1WBTA 3DU8A 5H2UA 1OM1A 4ANBA 5CI6A 4BHZA 1JVPP 2C6TA 3W10A 4DFZE 5HTCA 5I9XA 3C4ZA 5HD4A 1H1PA 3RM6A 3NNXA 2CN5A 4DEEA 5CAUA 1F3MC 2O0UA 3FMJA 4O7VA 2ZV2A 5J87A 3RWPA 3W2OA 2PSQA 3FKNA 5FD2A 5AEPA 2XJ1A 4AU8A 2ESMA 4Y95A 1WFCA 4W8EA 1LUFA 4O27B 4GUEA 4R5YA 4NM0A 5DT3A 3KXHA 2PVMA 3BYSA 1ST0A 1X8BA 3G90X 5GJDA 3GU4A 4B7TA 2DWBA 4IAKA 4MVFA 2YM5A 4ZTLA 4RFMA 3H10A 3Q32A 4CZYB 4E5BA 4DEBA 3KK8A 5J7HA 4GKIA 3MWUA 3QQLA 3W16A 2WD1A 4QNYA 3LFSA 4IAFA 3UYTA 4BDEA 4RVMA 1R1WA 5L3AA 4EJ7A 4CFUA 3QYWA 3CJFA 1UVRA 3FHIA 4FRFA 2IG7A 4WRSA 4RLKA 4XNEA 3IECA 4FBXA 4L45A 4BJJB 3UMXA 3KVXA 5FXRA 4DTBA 3EL8A 3MA3A 5L6OA 3HYHA 5BMSA 3Q6UA 3VHEA 3ML1A 4AW5A 4RVTA 3RPOA 3V5TA 3R7GA 3VONA 4XG9A 1Q8WA 1M14A 2HCKA 3HKOA 3EYHA 4ZTSA 3PSBA 4R77A 3THBA 5EYKA 2Z7SA 1NVSA 4DLJA 1O6LA 4S2ZA 4ZS4A 1QL6A 4B0GA 3PJ2A 3Q5IA 2XNBA 2ONLC 4D0XA 1XWSA 1Q99A 4L3PA 4FYNA 4RJ4A 4CQEA 3FLZA 4QMSA 2W1IA 3BBTB 3P1AA 5HX6A 4AN3A 1A48A 4I5CA 4KBAA 1SZMA 1AGWA 3BHTA 3UC4A 3R00A 5LMBA 4O7NA 3U54A 5AIRA 4DA5A 4YNOA 3JY0A 5DEWA 4LG4A 3G33A 2UZUE 3ZZWA 2GNGA 2GTNA 2VTSA 4L6QA 4ZZNA 4TWPA 1S9IA 4EH8A 4CKJA 1L3RE 4FKVA 4QYFA 3UOLA 1PXOA 4FSYA 4HNFA 4BCHA 4APPA 1O6KA 3MH2A 1Q3DA 3NRMA 3W0NA 4IB0A 3MSSA 3PSDA 4I24A 4ZXTA 2YCQA 3M2WA 5FEQA 3PLSA 5T68A 2J51A 4FTIA 3PTGA 4FT9A 5CEMA 2FSTX 2YJRA 2EXCX 3QQJA 2X6DA 4X6RA 4XG2A 5LCKA 4FT0A 4JX3A 5EI8A 2I1MA 5GIOE 3KRRA 2ZAZA 2ETMA 4FTRA 4K0YA 2R3QA 3HRFA 4FL3A 3TIZA 4EYMA 3FAAA 3TACA 2J50A 4N0SA 4FKUA 3VULA 4N6ZA 1WVXA 4A9YA 3LCKA 4PPAA 2WTDA 3F7ZA 2WTJA 3BV2A 5FG8A 2R64A 4JBVA 2R9SA 3Q2MA 2UW9A 4W9XA 3B8RA 5CT0A 4C4JA 1OUYA 4RFZA 5FDXA 2P33A 4E8AA 5IUHA 2XANA 1APME 3KXZA 4ALWA 3SLSA 2PTKA 3C13A 3R8UA 3G51A 3OWJA 3UYSA 4EQMA 2GNIA 3VIDA 5CALA 4ANSA 3CBLA 4HGSA 4RVKA 4M0YA 4L3LA 3QUPA 3T3UA 4PPBA 2PWLA 1STCE 3CGOA 2IVVA 2BKZA 3A7IA 5E8UA 4FV5A 3FL4A 3G6HA 3FI4A 5HIBA 4TTHB 3MY0A 2ITQA 3GFEA 3BU6A 3OT3A 5TE0A 5AUWA 4K18A 4DINA 3AC1A 2P3GX 3WARA 4YURA 4ZSAA 4CKRA 2RFNA 3PWDA 4S34A 4FSWA 1PJKA 4RLLA 4IC8A 3FQEA 2RFDA 5HBHA 5KMOA 5FUTA 4EH6A 2UV2A 3N4TA 5BVWA 3RHKA 2VD5A 2Y6OA 4FKSA 4YLLA 4GRBA 2AC3A 2C3KA 3E87A 3I6UA 5JGAA 4GVAA 4I20A 4JXFA 5LCJA 5KMIA 3Q53A 1KV2A 2I0HA 1DM2A 5AR4A 3NX8A 2OZAB 4DBXA 5CLPA 3HZTA 1OL5A 3TN8A 5I4NA 3OZ6A 5IQGA 4YTIA 3AD5A 2O8YA 1FVVA 4UEUA 2XP2A 1WZYA 4WG5A 4JIKA 4BI0A 1PXNA 4GU9A 1V1KA 2QKWB 3NLBA 4D4SA 1JKLA 1H07A 3E8NA 1XO2B 5KCVA 4DC2A 4UWYA 4AOIA 4O86A 5IA5A 3ZM4A 2C6MA 2OJJA 3F2AA 2H8HA 2W99B 4ZJVA 5C8NA 2GPHA 2R3JA 2CKPA 2OXDA 4IWDA 4BIDA 4L8MA 1UNHA 4F09A 2W1GA 3IDCA 3DT1A 1W2FA 1BX6A 1ZARA 4I21A 4CRSA 4UMTA 3QQHA 4OGRA 3SD0A 5L2WA 2UZBA 3DFAA 4JRVA 4YZDA 3AD4A 5J9ZA 2JLDA 3ETAA 5CTPA 5HVKA 5EM5A 3IW8A 4Y46A 5HCXA 2OIDA 3UVRA 4FTJA 2IVUA 2O64A 4AZSA 4DHIB 4BDGA 4UXQA 4O84A 3D2KA 4DHZA 4GJ3A 4Z7HA 4AG8A 2WTVA 2W1DA 2YLEA 3T9TA 4BC6A 3OWLA 5HTBA 2NNWB 5KZIA 1MQBA 3UP2A 5D10A 3BI6A 1OITA 4CFNA 4TYGA 3TWJA 3VC4A 2CCIA 4KIKA 2Y9QA 3FI3A 2GHGA 3QTWA 3AKLA 4BI1A 3SA0A 3IW5A 1W82A 2FUMA 2HK5A 4C2WA 3W0MA 3P78A 5EQYA 2GDOA 4KBCA 3BIZA 3KEXA 3QA8A 1CMKE 4QMQA 3D15A 4UZHA 2V55A 3O7LB 5HLNA 3PIYA 1ERKA 3PUPA 5HO6A 4EOPA 4FV2A 1WCCA 3BE9A 3MTLA 4I3ZA 4MXXA 3TXOA 4AGUA 4RJ5A 4D5KA 1TFFA 1ATPE 4FV1A 3U4UA 3QXOA 4HYHA 3Q2JA 1W2DA 2VWXA 4ITHA 1YXSA 3ZEWA 1Y57A 1LEWA 5BVDA 4QMLA 3KC3A 4RVLA 1REKA 3FJQE 4FVRA 3QTXA 1YVJA 2XVDA 2PMIA 2H96A 2C47A 4EK3A 4OLIA 4U41A 4XOYA 3Q60A 3D0EA 3OXTA 2JITA 4BKJA 4TRLA 4R78A 2YFXA 4RFYA 5M57A 5J1VA 1HOWA 2A98A 3QTIA 5EQEA 3W0QA 2WTIA 3DBCA 4J53A 5E8VA 5HG5A 1YOJA 3NWWA 4GEOA 4XUFA 5K4JA 4W4XA 4FI1A 3GBZA 3QRJA 3OWKA 4QPMA 5AM7A 3QGWA 4JIAA 2BFXA 3RINA 3RAWA 3RCJA 4IX3A 2UVZA 2F49A 4ZSLA 3FMMA 4FSTA 4ALUA 3EQFA 4F6WA 3EQPA 5A6NA 3MTFA 4F9AA 3T3VA 3A61A 1R3CA 1JAMA 4IDVA 5ANIA 2XM9A 4X2GA 1DAWA 3DAJA 3MIAA 1XMLA 4JR7A 3QF9A 2X9FA 3WZDA 2AEGA 5LWMA 3JYAA 5JKGA 1H0WA 4H1MA 1CKPA 2BRNA 3FLWA 1Q8YA 4J8NA 3R8LA 3P7AA 3LJ1A 3GEQA 1GIIA 2P2HA 3OT8A 4D28A 5IPJA 2QKRA 3AC8A 4USFA 2XRUA 4CNHA 4NW5A 2PULA 2ITZA 3BQCA 2IPXA 3FZOA 4RWLA 3DXPA 3DXNA 3OBGA 1ZYSA 3G5DA 5TOZA 2HIWA 2WU6A 4QMXA 2PK9A 1JSUA 4RG0A 2IZUA 5HE2A 3EL7A 3R7VA 3GB2A 5GJGA 5IEXA 3OW4A 4IX6A 2DYLA 4NTSA 1CM8A 3B2WA 2JKKA 2PZRA 3B8QA 3E62A 1A06A 3HLLA 4OT6A 4TZRA 5CZIA 3W2SA 3TZ9A 3WZEA 4C4IA 4R3PA 5C01A 3TV4A 3OCGA 4ZZOA 5CSPA 3S00A 2YDKA 3JUHA 2W1FA 4IB1A 4ZIMA 4C3RA 2UW8A 3QC4A 2UZLA 3ZLYA 5IA2A 4D0WA 2P55A 4EKLA 4ZS0A 3FMNA 3W32A 3DY7A 3UDBA 1AD5A 5EDQA 4DF3A 1J3HA 2QO9A 3U4WA 4MQ2A 2OJGA 5J5TA 2XYUA 2GS7A 3GNIB 2C1BA 4PNIA 2QOQA 3EZRA 4Y8DA 4KSQA 5FP5A 5IH4A 3RHXA 3U6HA 2ZMDA 1UNGA 5CVGA 3H0YA 3L9MA 5DR2A 3LCTA 3DZQA 5EG3A 5KX8A 4C58A 2GNJA 5HLWA 3MVHA 4K6ZA 5E1EA 1ZMVA 4QOXA 5HTIA 2JIVA 3BX5A 2YWPA 3TKHA 2IN6A 1OECA 3RBWA 5BVNA 2PE0A 5JFSA 5LQFA 3DJ6A 3R30A 3DB6A 2WEVA 2QOIA 4HGTA 2PUIA 3U8WA 3AC3A 2ZDTA 4K8AA 3PRIA 4IM2A 4XHKB 5C03A 2HY0A 4WIHA 3D5UA 3O8PA 5I9UA 3ZHPC 3ORNA 4DGGA 3PLAE 2JDVA 2WOUA 2FO0A 2V7AA 4QTAA 2Y7JA 5BQ0A 3R9RA 2XNGA 2X8EA 4H3PA 2WKMA 1UKIA 2QR7A 3DBQA 3C0IA 4M15A 3F3WA 5LARA 3WILA 4ASDA 2NPQA 3GENA 3HV6A 3LXLA 2XKFA 3HMPA 5JSMA 3FLNC 2XF0A 3R7IA 3NAXA 4MX9A 1XBCA 4TYHB 4O0VA 2IVTA 2QVSE 3NEWA 4WG4A 3V5PA 4YJQA 5D7AA 4PDOA 3DKCA 4BTFA 2OF2A 3EJ1A 4BY9E 1WBNA 2QG5A 4JDIA 4L67A 3A4OX 4EOOA 5F4NA 4FT7A 4RJ6A 3QCSA 3ORZA 4BCNA 4O6LA 5IMEA 4BWXA 4PNKA 4QMNA 3NUUA 5AWMA 4FE2A 2Z7LA 4GG5A 3TNIA 2HAKA 2G01A 1VJYA 4FG8A 3SKCA 4M69B 3WIGA 3DS6A 2PUUA 3NAYA 4KRDA 4FUYA 3MFSA 2XA4A 3R7OA 4YSJA 4ORKA 1S9JA 4MK0A 2QCSA 3Q9ZA 2XJ0A 1Q8UA 3DXQA 3EN6A 4DGOA 4QDVA 5EFQA 4X3FC 3PFQA 2VX1A 3W1FA 4W4YA 3MB6A 2WFYA 2HOGA 4AW2A 5IDNA 2V0DA 4O4EA 4QYGA 2QI8A 4QTEA 3SGCA 2NRUA 3EFKA 3MV5A 3TV6A 5DMZA 5FTOA 3JVRA 4U97A 1Y6BA 4YTHA 3MDYA 2G2IA 2OK1A 2QODA 4OBPA 1HCLA 3SAYA 5AV2A 2QOKA 4FICA 4AN2A 4BBEA 5M4CA 3CD3A 2ZMCA 4PV0A 4D5HA 4O0RA 5A4CA 5M44A 3GU5A 4G3EA 4NIFB 4P7EA 4PMMA 4QQJA 5BUEA 2EVAA 2QC6A 4I5MA 3ZFXA 4AOJA 1XKKA 3KB7A 2XNPA 3N4UA 5HZNA 2YCFA 4U81A 3DGKA 3CJGA 4EOLA 4D4RA 4MAOA 4KUJA 2PYWA 2EXMA 3A8XA 2VRXA 3G6GA 4DDGA 4FIJA 1H24A 5JRSA 2WQEA 3QKMA 3UZTA 4DFNA 2PHKA 2W4OA 2W5BA 3EN5A 3EQIA 3NYOA 4U3ZA 4O7WA 5AM6A 4R7IA 3PPZA 4XG6A 3W2QA 4AAAA 3P86A 4PTCA 3Q96A 3OTUA 4PQNA 4CFVA 4C8BA 2WHBA 5KMNA 3VVHA 2QQ7A 2X0OA 5TR6A 4YO4A 3IS5A 5HORA 3NFFB 4YUQA 5IUGA 5AX3A 3O50A 4IXPA 3PXYA 4MNFA 4QYEA 4F64A 5DR6A 4APCA 3MVMA 2UZOA 2W1CA 1YXTA 4W4VA 3V8TA 4HW7A 3DDPA 4QQ5A 5E8ZA 5J7BA 4PY1A 1Q5KA 3ZSHA 3LM5A 5GZAA 4F78A 4DEGA 4YP8A 5CX9A 3PXFA 3C4EA 3ANRA 4EORA 5CAPA 1JKKA 3QQKA 4FT5A 4RC2A 2H9VA 2XNEA 4DH1A 5J1WA 3SG9A 2UW7A 5FP6A 3NR9A 4RSSA 4EH4A 5DGZA 3R28A 4II5A 4DFBA 2XIXA 2REIA 4CT1A 4U7ZA 2VWUA 3BYVA 4O0WA 3IDPA 4TL0A 2WTKC 2X1NA 2CJMA 4YHTA 3W2CA 3BELA 1WBVA 4G6NA 2F7EE 3AKJA 3GU7A 3HX4A 4GYIA 1YDTE 4FKTA 4J52A 2W1HA 4YJTA 4FZAB 4DFYA 5KKRB 4F0GA 2NYAA 3EFWA 3AMYA 3EWHA 3MN3A 5J8IA 4BTKA 3RP9A 3FSKA 4EYJA 1UKHA 3L1SA 4XV1A 5CU4A 4E73A 5I0BA 2ZM1A 1MRUA 2VTAA 4O7TA 4P5QA 5FRIA 3ODZX 4Y5HA 2BZHB 3OS3A 2YACA 3FZPA 2JC6A 1SVHA 3NS9A 2XNMA 1Y8YA 3KMUA 4F0IA 3I79A 2EB2A 5KBRA 3MW1A 4MXAA 4JAIA 3W2PA 4KWPA 4YR8A 1H1WA 4I93A 3R8ZA 2YM8A 4FX3A 4D9UA 3VW8A 1ZWSA 2UVXA 2B9JA 4FOBA 5IISA 1OKWA 3PRFA 5EW8A 3ZRKA 4FZFB 4W9WA 5A14A 4DT9A 4YJNA 3C4CA 3ID6C 4AZVA 4FV9A 4EBWA 4UXLA 3H0ZA 2IZSA 5ANDA 3LIJA 5CANA 4FTLA 4L44A 2ITVA 3PVUA 4KABA 3HA8A 4M97A 3TUCA 3QXPA 1V0OA 4ASEA 4NYEA 4IADA 4RQVA 4ACCA 3HP2A 3BCEA 4MKCA 2UW4A 5HO8A 2J0IA 4MWHA 5EKNA 4G2FA 4P4CA 4MXZA 2Y4IB 1G8AA 4JQ7A 4WUAA 3HGKA 2O2UA 3QUDA 4P90A 1XH8A 4PL4A 3ULZA 4BCQA 4EEVA 2Q83A 5GIPE 1KE9A 4FV7A 4LQMA 2FSLX 2Y6MA 3UDTA 1XJDA 2GS2A 3BHVA 3COKA 1M2PA 5KMLA 4J8MA 4OTGA 4BF2A 2P2IA 2YAKA 3LXNA 3AMAA 5CF5A 4CLIA 4HJOA 4QMUA 4O7RA 4BZOA 3BHUA 1H1SA 3DB8A 4KBKA 4HVHA 3PG1A 4U40A 5AV3A 4EHVA 3CS9A 2P4IA 3A7FA 3F5GA 3MVJA 4UWBA 3VJOA 3VNTA 3ZLXA 1EH4A 2QU6A 2PMOX 2XRWA 2CKQA 2YIYA 2OIQA 5GJFA 4DBNA 1VLRA 3VUIA 5CT7A 4IWOA 4L68A 4RZWA 2C3IB 2YITA 2OFUA 3I6WA 4FG7A 4FIIA 4MWIA 4O91A 3UNJA 3VBVA 4F1OA 3BU3A 5E8YA 3S4QA 4F7JA 1UU7A 4LMNA 2JDSA 3F61A 5IQBA 1J1BA 2HWOA 5T6KA 4TN6A 4J96A 2OO8X 3QTSA 3HDMA 4QTCA 4ERKA 4A9SA 3BKBA 4MBIA 4MD9E 1A9UA 1UV5A 4O0XA 1KE6A 4FSNA 5EM6A 4EOSA 4TYEA 4MXCA 4O1PA 5D7VA 1W7HA 4S31A 4AT4A 1GZKA 3ATSA 5HHWA 3F2NA 2KTYA 3ZRLA 2HZ0A 2V62A 3RAHA 1W83A 3RPVA 4DN5A 4E4NA 3DJ5A 1PW2A 3VWAA 4RT7A 5HCYA 3UIUA 4UBAA 5EKOA 5DT4A 1OBGA 3D5XA 3PJ1A 2R3FA 3I7BA 5DR9A 3Q9XA 3ULIA 5EQPA 3CKWA 1FGKA 4MXOA 2CNUA 4GFMA 3DKGA 5DRBA 1IRKA 5ETCA 2UZDA 1Z57A 3EKKA 3HV5A 4R5SA 4AE9A 1Q8TA 5EM8A 4Y5QA 4FSMA 4AXDA 3KXNA 4E7WA 3CPBA 3OVVA 4BWKA 4I1ZA 1Q24A 4FTMA 4XJ0A 2JIUA 4FK6A 5TF9A 3FI8A 2VO3A 3QALE 3LPBA 3ZEPA 3NFGB 2W5AA 2VX3A 3MH1A 4YZBA 2VWBA 5HU9A 4FSQA 4U79A 3QC9A 3RCDA 3W8QA 3BHYA 3L8PA 4TYIA 5M55A 4ANOA 5JRQA 3EQCA 3CPCA 3IQ7A 2NRYA 3NYNA 2XM8A 5HOAA 1K9AA 3EQRA 1BL7A 5IZFA 4ZTNA 3LQ3A 3RWQA 3CTJA 2R3PA 3R71A 5BYYA 3ERKA 5IA3A 4E5AX 4R8QA 3PJ3A 2C3JA 3C0HA 4H3QA 3TG1A 5JFXA 2GTMA 2WOTA 3TL8A 1SVEA 3EQDA 1U5QA 3ACJA 3AGMA 3RAKA 5ITAA 5KMJA 3NUAA 5HG7A 1U54B 2FGIA 4ASXA 1U4DA 4BTMA 4PTEA 5BPYA 5I5ZA 3ORMA 3C0GA 2RKUA 2JDOA 1W0XC 1ZOEA 4M14A 3NZ0A 3QWJA 4XRLA 1ZMWA 3G9NA 3OWPA 4GU6A 1OZ1A 4J7BA 5DOSA 3SXRA 4NU1A 5JMSA 3FEGA 5F1ZA 2XZSA 4WNOA 3R9HA 4NM3A 4EOIA 3LLTA 3VBWA 4JJRA 4CCUA 1Q62A 2PZIA 3QRIA 4QMTA 5A6OA 3HV3A 3TNWA 2ZJWA 3R7EA 5KO1A 1QPEA 4C38A 3GP0A 1OBDA 1LEZA 2JDRA 3FWQA 4BDAA 4FSZA 4FTQA 1Y91A 2WQOA 5BVOA 5HEZA 2UW3A 3TM0A 3W0OA 1YI4A 5FXQA 4AGCA 2XJ2A 4V01A 3KULA 3ZSIA 3A8WA 3AXWA 3VO3A 3UBDA 3TMOA 2OICA 3ZM9A 4U5JA 4O96A 1FPUA 1KE7A 3R1QA 3R2YA 3NPCA 3PP0A 4L9IA 2ZM4A 2WPAA 2O5KA 4TWNA 4IM0A 5ANJA 3BLAA 3FLYA 4YBJA 5ACKA 1ZY5A 3ZFYA 4MUQA 3UZPA 3FKLA 3Q4ZA 3AT4A 3GCSA 4QMOA 3TKUA 1LP4A 2YJSA 4LUDA 3OMVA 2Z2WA 3LFCA 1IAJA 3F3TA 1ZRZA 2W1EA 4YJVA 2ACXA 1PMNA 4HZSA 1CSNA 5LVNA 3F5PA 5G1XA 4DITA 2X0QA 3NW5A 4QDEA 5CASA 4G3FA 3R2BA 4I0RA 1FVTA 3NGAA 4WHZA 4AE6A 5K5XA 4AN9A 3MPTA 5IUIA 2EU9A 5CEOA 3UG1A 4XMOA 2JEDA 3OHTA 4D2WA 3PXQA 4TKSA 2O63A 4G5PA 2FSMX 2Y0AA 4YGAA 5AP2A 2WMVA 4M68A 5D12A 5CF6A 5KHXA 1FMOE 3ZONA 4QP1A 3H9OA 4C59A 4BGHA 1CTPE 4EC9A 2PPQA 3ZFMA 1J91A 2VNWA 4H58A 4A9RA 3I5ZA 3ZO2A 4YJOA 3BBWA 4BBMA 1QPDA 4FTCA 3DJ7A 3DPKA 4FMQA 2B52A 4V05A 2OU7A 5KZ0A 4LV7A 2ZV9A 3DKOA 3I1AA 4JS8A 3LCOA 4DGNA 5HD7A 2JKMA 2X9EA 2ITPA 2GNFA 3A60A 3RPYA 2YCSA 1W84A 3OG7A 4TT7A 4ZY5A 2IO6A 4QT1A 2QOFA 5M53A 3BL7A 1OVEA 1P4FA 3E7VA 3WZKA 5LVLA 3FZSA 3C4FA 5CXHA 3DTWA 2E9NA 2F2UA 3QWKA 5CEQA 4KD1A 1GY3A 1UU8A 4HNIA 2C0TA 3JXWA 4IZ7A 4KIQA 2QOLA 3AC4A 4LOPA 4NWMA 2IZTA 3SRVA 5K0XA 4FV3A 3O17A 2VUWA 3CQEA 3F9NA 1R39A 2Z60A 3P79A 5AR7A 4IVBA 4CMOA 3OOGA 4S32A 1Q41A 2PVNA 1WAKA 4PMSA 1GJOA 3TJDA 3NYXA 5IH5A 3QTRA 4RA5A 4RIOA 3RZFA 3ZO4A 2JBPA 2W0JA 3LFAA 3ZBFA 1SVGA 3NCGA 1PYXA 1H08A 4FC0A 1FOTA 1RE8A 4UV0A 3V5JA 5AJQA 3RI1A 5CZHA 3ZUUA 1NY3A 1SYKA 2JKOA 3IDBA 3O8TA 2HENA 4IH8A 1PY5A 4FV8A 3KREA 3RK7A 4LM5A 3FXZA 4O21A 1T46A