4AE6A

Structure and function of the human sperm-specific isoform of protein kinase a (pka) catalytic subunit calpha 2
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
339
structure length
319
Chain Sequence
SSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA 2
publication title Structure and Function of the Human Sperm-Specific Isoform of Protein Kinase a (Pka) Catalytic Subunit Calpha2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 100
structure length 319
sequence length 339
chains with identical sequence B
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ae6A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ae6A02
1Q8ZA 4USFA 3HV6A 3ITZA 5HICA 5LCKA 4IACA 4IC8A 3N9XA 4R3PA 2RKUA 3BBWA 4Z55A 2OZAA 3CC6A 3QYWA 2ITNA 4AN2A 1S9IA 4GMYA 3Q4ZA 1KSWA 5HVJA 5DNRA 2WB8A 4NCTC 4O7SA 3QGYA 4JDHA 4IC7A 2YIRA 4I6QA 2QHNA 5IQDA 3KCKA 4OTRA 3D94A 2QLQA 3OC1A 3G0FA 2Q0BA 4QQCA 2R3GA 2IVVA 3C5IA 3H9OA 2GQSA 1H1SA 3FPMA 5DR2A 3A60A 3H9RA 3VVHA 3F7ZA 5M55A 2QKWB 4FKJA 1XQZA 4S33A 3F82A 1GJOA 2J9MA 3V8WA 4FIJA 4D0XA 3ROCA 5AEPA 1TKIA 2VWUA 2BRBA 5I3OA 4DC2A 3G5DA 2A27A 2EVAA 3N4VA 4MEDA 2C30A 4U9AA 2WMAA 4FSQA 2BAJA 2OG8A 3EH9A 2XVDA 5CF8A 5IDPA 2Y9QA 3QZGA 5BVNA 2W1IA 2J2IB 3LCOA 4KIKB 5KZ0A 2B4SB 5E8WA 3ZRKA 3C51A 4BL1A 4UV0A 2YM5A 2PZPA 1XH5A 2OXXA 4JQ8A 4BDIA 1VZOA 4C4GA 2WMRA 4ZLOA 2UZOA 4F0IA 5B2MA 2JKQA 3FXWA 4KA3A 2E9UA 4FSTA 4RJ5A 5LVLA 2OH4A 2ZDUA 1OKWA 5HBHA 1W84A 4RZVA 3O96A 4I0TA 3QQFA 4G3GA 3VS1A 1YHVA 2RSVA 3BBTB 4FT5A 4ZLZA 1CDKA 5M4FA 4U40A 2W1ZA 2C3IB 3FMJA 3R6XA 4PRJA 2SRCA 2W1FA 1PKDA 1WVXA 4FT3A 4FTAA 4IX4A 3HDNA 2BPMA 5AWMA 4B9DA 5IDNA 3ET7A 3FLNC 3NLBA 4GFGA 4J97A 2CCHA 1OM1A 3LXLA 5CS6A 1PJKA 2VGPA 3DTCA 1OI9A 4FVRA 4Z9LA 2A1AB 3BV2A 3W32A 3WYXA 5BNJA 4WG3A 3KREA 3E64A 3EQIA 4RVLA 3OWLA 2R3JA 2Z02A 2RF9A 3LJ2A 3TCPA 2HY81 3LCKA 2ZMDA 3GVUA 3H9FA 5HIBA 1J1BA 5EM6A 2GFSA 2WIPA 2OXYA 4UMTA 2CKOA 4FNWA 3LIJA 3R1QA 2AUHA 5E1EA 5L2TA 3KXGA 3A7IA 4GCJA 3R04A 3IONA 4I6FA 5CSVA 4K2RA 4DTAA 3A8XA 5L3AA 5TE0A 3KK8A 4BYJA 3BEGA 1T45A 2HK5A 4IWDA 4F99A 3ORXA 4R3RA 4PY1A 1WBSA 2WU7A 4MK0A 4BCPA 3VS6A 4R3CA 2HWOA 4I0SA 4PNIA 4APPA 1OL1A 1WZYA 5A6OA 3U6JA 4O1OA 4QT1A 2HENA 3PWDA 2W1EA 4IE9A 3S2PA 1VEBA 2WQEA 4O0XA 1JPAA 4HVDA 2OIBA 3QGWA 3BWJA 3GU6A 5DE2A 3GBZA 5FEDA 3TEIA 1HCKA 2YITA 4BCKA 3H4JA 4TWOA 5IQAA 1JWHA 4EK3A 3NUSA 4FTMA 3D15A 4D2RA 2V7OA 3ELJA 4YHFA 3TUBA 3N51A 4AUAA 4AW1A 1B39A 1Q5KA 4I6HA 3V3VA 2O3PA 3KL8A 4U43A 2YIWA 3A62A 4BKZA 4CLJA 5AA8A 4QMSA 2OLCA 2GS2A 2JKMA 3DKCA 3FSFA 2WTWA 2UVZA 3T3UA 4F9YA 2UUEA 3MTLA 4EC9A 2W4JA 3QC4A 4KBAA 4DH3A 3R7OA 4EK5A 1WBNA 3TT0A 2R5TA 3PA4A 3BYVA 4RJ4A 2IW8A 1JVPP 1O9UA 3C4FA 3OW3A 2A4LA 2V5QA 3H30A 2QNJA 3VQUA 3C7QA 4BTKA 4XCUA 5EOLA 3OROA 5ANDA 4DBNA 5BMMA 5L4QA 2BIKB 2ITYA 2IN6A 5IU2A 2GMXA 3PXZA 3DLZA 3QTXA 4WHZA 2VRXA 3FMLA 5LVMA 4BGQA 5FDXA 4XLIA 1FVTA 5EHYA 1UV5A 3CXWA 4PWNA 4ARKA 3COMA 2O65A 2WTJA 4M14A 4EH4A 3V04A 3BIZA 5CAPA 4AZEA 4NTTA 4L8MA 4XBUA 4O91A 5KMKA 3R0TA 4L42A 1Y8YA 2PUNA 4DBXA 4F9BA 5B0XA 4Y95A 4TYJA 4JJRA 3GOKA 5CQUA 3V5QA 2I0EA 4RIXA 4RIWA 4L52A 1GY3A 4KS7A 3MS9A 4QMLA 2BTRA 1MRUA 3ZSGA 4ANBA 5L2SA 4I0RA 4J1RA 4G1WA 2PZ5A 4QMPA 5EW9A 4UYNA 3R00A 5CU6A 2R64A 5DIAA 4U41A 4AN9A 3EZVA 2YEXA 3E92A 3IW8A 4D2PA 2BZKB 2GHGA 4DG0E 1PMUA 3LE6A 4JLCA 1DM2A 5LVNA 1NVQA 2WTDA 2YM4A 4AACA 3F9NA 4L68A 3ATTA 4M15A 4IX5A 3EN4A 1QPEA 3NX8A 4FK3A 3C13A 3HRCA 4JAIA 2PZYA 4BZDA 3WIGA 4M69A 5CASA 5CSXA 4YJOA 4N70A 2I1MA 4YO4A 3EYHA 3Q60A 2XCHA 1VJYA 2XF0A 4M13A 5EK7A 1OVEA 1ZMWA 2OU7A 2C6KA 4D4YA 2E9NA 2C5XA 4FV8A 4FKTA 4ZTRA 1IRKA 4C3PA 4O0SA 4M67A 2XIRA 4IM3A 5EDRA 2PY3A 2UZTA 4FZAB 5AP7A 4ASDA 4QTEA 3QRIA 2ITVA 3Q9WA 3CJGA 3HEGA 4IQ6A 4X2GA 3FI8A 4L3JA 4X6QC 4RVMA 4CEGA 4UBAA 2E2BA 3LCTA 5TO8A 5HX8A 3GP0A 4CFUA 2R3MA 3SXRA 1Z57A 5KX8A 4GV1A 4IBMA 3JS2A 2YM8A 3ZLXA 4DGGA 4D9TA 4JBOA 4FX3A 4GIIA 3P23A 3I7BA 4HPUE 1Q61A 1UNGA 3IDPA 4RFMA 4U45A 3R73A 3RAWA 4DEEA 5IQFA 5DPVA 3SDJA 4TXCA 1OMWA 4QPAA 4EEVA 2QR8A 4J99A 4KRDA 5IEVA 4MNEB 5F4NA 2WPAA 4UMRA 4V0GA 4NK9A 3OFMA 3PIYA 3GCPA 3E93A 3HNGA 3RBWA 3R8VA 3VQHA 4AA4A 4DEBA 1Q24A 2JIIA 2HY0A 3KCFA 3N4UA 4DT9A 3LLTA 3GFWA 1OUKA 3KXMA 1KOBA 2OIDA 3RZFA 4FL2A 4GYIA 5JK3A 5E4HA 3AC2A 4M68A 5CYIA 1RDQE 4FV2A 2HIWA 3CQWA 3MFTA 5GZ9A 3DZQA 4F6WA 3SGCA 3U54A 4AW2A 3DDQA 4FMQA 3MIAA 3MY5A 3UJGA 1G8SA 1UVRA 4BCIA 5F1ZA 2GNIA 5M4CA 2XJ0A 1SMHA 4FEQA 4OT6A 4CKJA 1WBPA 1PXMA 4ASXA 4DF3A 2OO8X 2BDWA 3D2IA 4XLVA 3U6IA 4WUAA 3SLSA 4TWPA 2WQNA 4DE4A 4JNWA 4QP7A 1M14A 2ITPA 5D9HA 4MTAA 4RC2A 4W8EA 3QQGA 2BAQA 4F7JA 5AX9A 3P7AA 3R2YA 2ZDTA 2J51A 3CJFA 1IA9A 2OJGA 3QTWA 3F6XA 4GT5A 5D10A 5EYCA 4D2TA 2ZV2A 5JEBA 2XK3A 4EHGA 2WXVA 4JVGA 4GG5A 3W2CA 4HVIA 4O7YA 2P4IA 4YBJA 2PMOX 4KKEA 4EOJA 4GIHA 1WVWA 2WIHA 2V62A 4DH8A 4DFXE 4ITIA 3AGLA 3CY2A 3FZOA 5EFQA 2VO7A 3NZ0A 4TNDA 5D7AA 2WTIA 3VS2A 2XKEA 1NVRA 3EQDA 1M2QA 3VULA 1Q99A 5E91A 4ZSAA 3NIEA 5F9EA 5JQ8A 3R63A 2X6EA 4K11A 2PPQA 4HVHA 5CF4A 3UVRA 1JKSA 1CKJA 2YN8A 3PXRA 5FXRA 3HKOA 2PSQA 4R77A 2HW6A 1HCLA 1WBWA 2EB3A 2P2IA 4PMSA 4EKLA 2G1TA 5A6NA 3KXNA 4QMZA 1H00A 3I6UA 3FMEA 4G3CA 2F57A 4CZYB 2CKPA 4M3QA 5F95A 2DQ7X 1SVHA 5CSHA 2CLXA 3BE2A 4JR3A 2H6DA 2G01A 3BHYA 5HI2A 3TZ9A 4BDBA 2G2IA 2XBAA 4RC3A 4JIKA 2XB7A 5A4LA 4LI5A 2ERZE 2UZUE 4RIOA 2PTKA 3LLAA 4APCA 5J9LA 1UU9A 3DS6A 2C3LA 2OK1A 3I4BA 3IW7A 4FNXA 3QD3A 4USDA 1V0BA 5BVWA 3NCZA 4JDJA 1B38A 2NRUA 4JL9A 5AR7A 4ZTQA 5BYZA 3M2WA 4TYHA 2QD9A 4YZDA 3UBDA 5I0BA 4KABA 3CQEA 4A4OA 3A8WA 4G9RA 2YAAA 1A06A 3MPAA 4TYEA 5GJGA 1P4FA 5CF6A 3DJ5A 4O38A 4QO9A 1PYXA 3VWAA 4MXXA 2BRMA 4LGHA 3G33A 4E6QA 3ODYX 2OXDA 3LCSA 5HE3A 4FSNA 4NIFB 5AR2A 4ALWA 3EJ1A 1YWRA 4GS6A 3LJ0A 2JDSA 3CD8A 2R0IA 2V55A 4IWQA 4FG8A 4A4XA 4OTWA 4PP7A 4JT3A 4RX7A 4S32A 4YJUA 1UKIA 5FBNC 3ZO1A 4DGOA 5DVRA 5BYLA 5E8ZA 2C3KA 4OBOA 2CJMA 3VNTA 3UOLA 4AT5A 2X6DA 3TZMA 4EH7A 4F6SA 4ZSJA 3DY7A 2ONLA 3FZTA 3QCSA 4FIIA 4YBKA 3QLFA 3VBYA 2CMWA 3ZEWA 4EH5A 3DXQA 1KE8A 1JSTA 3ZO2A 3FZRA 2UZBA 1Q41A 3SHEA 1NXKA 3AD5A 2OICA 1SNXA 4KSPA 4OT5A 2IG7A 3GCVA 4OLIA 4EH3A 3TWJA 5A9UA 3U55A 5L2WA 3QRJA 3MFRA 4ID7A 4W8DA 3F61A 2ITWA 4ZY4A 5HD4A 4TY1A 3QUEA 3KA0A 2VAGA 3E3BX 4J53A 3QKLA 5T6KA 4AOJA 1SYKA 5KCVA 5T3QA 4QNYA 1W98A 2BAKA 2GNFA 3E8NA 4PPCA 3SA0A 3QTQA 3D5XA 3ANRA 2QOFA 5DWRA 4AN3A 4DGNA 4ORKA 3R1YA 1K9AA 1CKPA 5CXHA 4D58A 3HGKA 4UWCA 5J8IA 2H8HA 4JX3A 3TN8A 3LFEA 1Q4LA 3VS7A 3HMIA 3JVSA 2H96A 4PNKA 2C5NA 1Y6AA 3KN6A 5DA3A 3DCVA 4RX9A 3UNJA 4EORA 3KEXA 3KQ7A 4YPSA 2X2LA 4RT7A 4XS2A 5KMJA 2J5FA 4KKHA 4JXFA 1BLXA 2OFUA 3OBJA 4BDGA 1KV2A 5AM7A 4BIBA 5JGAA 4BN1A 4UMUA 2GS7A 2BCJA 5EDQA 4F64A 1PY5A 4CT1A 3W33A 1FMKA 3K2LA 4Q9SA 1WAKA 4FSWA 1O6YA 3TJCA 2DWBA 3WE4A 2AC5A 2XNGA 3PXYA 4EOKA 2ZV9A 3NMUF 3HZTA 2VWYA 3PY3A 3RAHA 3ENMA 2PVLA 3PRFA 3O8UA 3QYZA 5FD2A 4UX9A 4QQ5A 2XK9A 2PWLA 4J8MA 3AMBA 3RP9A 5IA3A 3MVLA 2EWAA 2WMBA 4C4JA 4Y5HA 3FLWA 4LGDA 4L7FA 3UNZA 4ACCA 5M53A 2UZNA 4FTKA 4O0YA 3I79A 4W9XA 3CTQA 3VBVA 5AMNA 5J7BA 3MPTA 2VWXA 3QRUA 1FOTA 4AZVA 4J7BA 3BZ3A 5CI7A 2XUUA 3UO5A 1K2PA 3MESA 1PXJA 2E9PA 1NA7A 4BCHA 3REPA 1GZOA 4B6LA 3OZ6A 1YHSA 2X8EA 3F5UA 4M0YA 4ZMEA 3W2PA 4Z16A 4RVTA 5AIKA 3MWUA 3DV3A 5JFWA 2R3HA 2R4BA 4CNHA 4ZZMA 2EXEA 1YDSE 3EL8A 3NNWA 3OWKA 1ZRZA 5E92A 2DUVA 4V04A 3GXLA 3R9OA 4P2KA 2BRGA 3SXFA 4CKIA 4HW7A 1UA2A 4AW0A 4IDVA 3UO4A 4O7NA 2X9EA 3O2MA 4MBIA 3NW6A 1KE7A 3PLAE 4A9RA 3D5UA 5K3YA 5EM7A 5EYDA 4OAUC 5KE0A 3DKOA 3F3VA 3RGFA 4J98A 4I24A 5ACKA 1J7IA 2PHKA 4D9UA 3FQEA 3QLGA 3VUTA 4B8MA 4CLIA 3RPOA 3PSCA 1Y8GA 3W2SA 4IFGA 2CGXA 3KULB 2I6LA 2XJ1A 4IZYA 4JS8A 4M84A 5CY3A 4ACMA 4E4NA 4QQTA 4XUFA 4BIEA 3NCGA 2B9IA 1YKRA 4O2ZA 2XEZA 3L9MA 5KMMA 5GINE 3F3UA 3SG9A 3OT8A 1CSNA 1L8TA 4D4RA 1JKLA 2Y6OA 4L3LA 4RGJA 4QNAA 4DFYA 4WRGA 2GNJA 4EQUA 5A54A 2JGZA 5FTQA 5JGDA 4H3QA 5I9WA 1SVEA 3NVMB 2EXMA 3ZC6A 3W2RA 3O17A 2XM8A 4WG4A 4TKSA 4GG7A 4FTTA 2WMQA 4YHJA 3UIUA 2X2MA 2QODA 3GGFA 5E9EA 1YI4A 4IIRA 3PWYA 2A0CX 5CTPA 4YO6A 3AC4A 3R1SA 2JKKA 1SNUA 4BICA 1NY3A 4KBCA 4DH1A 3FKOA 1R3CA 1OB3A 3C0HA 4RJ3A 4WD5A 4EONA 3UVQA 5AP6A 4GFOA 3T3VA 1JLUE 2QU5A 5AP1A 1U54A 3GUBA 5CX9A 5IH4A 4DAWA 1YI3A 3UTOA 3KXZA 3SKCA 4LYNA 4BWKA 2BZIB 5L6PA 3OTUA 3WBLA 4YJVA 3CY3A 3SRVB 1FBNA 3CCNA 3NAYA 4Q2AA 2O2UA 2YJSA 3C4EA 3G0EA 4JAJA 2XKCA 3I5NA 2CGVA 4C36A 4BWPA 1R78A 5JZJA 5HO8A 2QKRA 3KMUA 4C59A 5CEOA 5JFSA 2BALA 4ZZOA 3QX2A 5GZAA 5FTGA 4D2SA 4UXQA 2X9FA 3TZ8A 2J4ZA 3F3WA 3L1SA 4HYHA 4PL4A 5K0KA 4HGSA 2QONA 3NDMA 2C4GA 2CN5A 4BDCA 4O7WA 5EHLA 4BI0A 4ZS4A 3CTJA 3B8QA 4QRCA 2OJ9A 3F88A 3HYHA 3PRIA 4MQ1A 5EDPA 4USEA 4DLIA 2G9XA 1OIQA 1IG1A 4U3ZA 4U7ZA 4I4EA 3TV6A 4NM7A 3ZH8A 3D4QA 3NUUA 2UW8A 5JRQA 4FKLA 4XV1A 3TM0A 4ZLYA 2BFXA 4C38A 5K4JA 2RL5A 4BKJA 3HUCA 4NKSA 5JFXA 2VTQA 5I3RA 3R8ZA 3CSVA 1XHAA 4FR4A 3UOHA 2NP8A 1VYWA 3RALA 5F94A 4QMMA 3UVPA 2F7EE 2J5EA 2YIXA 4GJ2A 2CGUA 3OHTA 4CCUA 3TL8A 5C01A 4L53A 3BV3A 4F0GA 3AT2A 4U42A 5J95A 4KUJA 5KO1A 2HZIA 2E9OA 2UZEA 4CT2A 4EH6A 4DH5A 4MWHA 3FSKA 3LM5A 5HBJA 4FIGA 3UIMA 3SX9A 4RBLA 2IVUA 4Z7HA 2GSFA 5HE2A 3RZBA 3VUIA 4RSSA 3HMPA 2V7AA 2Z2WA 5EW8A 3VJOA 4G3DA 4HVGA 3EYGA 4MX9A 4EK6A 5M09A 4II5A 2PVNA 3V5LA 3CBLA 2Y0AA 3GU8A 5BVFA 4TTHB 2WMUA 4AA5A 3E8EA 3FLYA 4R7IA 2XK4A 4OW8A 2YM7A 3FYKX 3MBLA 1OL2A 1R39A 4O0RA 3R7UA 4C62A 4J96A 3NYXA 4HYSA 5FLFA 5DLSA 3F7WA 2W1DA 2X8DA 3G51A 3UOJA 3CPBA 3QC9A 2HZ4A 3PPJA 3OF0A 5K0XA 3PSBA 4OR5A 4BDDA 1WVYA 5JFVA 5I5ZA 2QOHA 4ITHA 4BCOA 4DG3E 3DAJA 2JIVA 2BVAA 4FV3A 5L6WL 3BRBA 4CRSA 2PUUA 3ORIA 4DN5A 5HO6A 2WHBA 4DCEA 4EOQA 5HCYA 2VTNA 1REKA 3OP5A 4FTOA 3RKBA 4AF3A 4EK8A 3IQ7A 3DK7A 3NS9A 5CENA 3HMMA 1UNHA 1ERKA 3FY0A 1OPJA 4BCGA 5JZNA 1GAGA 4UEUA 4C61A 4O7RA 4Q9ZA 2B55A 4HCTA 3F2RA 2OJJA 5LJJA 4JG6A 3P7BA 1YOMA 3QAME 3IPHA 4L45A 3BELA 4M97A 1PXOA 4RWKA 2XIZA 3DB6A 4CTBA 1Q3WA 4LMUA 1MP8A 1YQJA 5GJDA 4IADA 3CKWA 2GFCA 2WZJA 3TJDA 3FXXA 3E8DA 4EZ5A 4H1JA 4MYGA 4AS0A 2R3KA 3FKNA 5TT7A 2ITQA 2R7IA 3UZRA 2CGWA 3DK3A 3QTUA 4XG2A 4LM5A 4YLKA 4IVCA 4B0GA 4Z3VA 1PXLA 4H3BA 5I9XA 2PULA 5C8NA 5ANJA 4C2WA 4C3RA 4MCVA 4O22A 2WELA 3DNEA 3HL7A 4H58A 3SD0A 5HG8A 2X0GA 2IO6A 4G16A 1YXUA 4A9SA 3QTZA 3TUCA 4O82A 1WMKA 3EMGA 3LXPA 4P4CA 4FT0A 2GU8A 4PDPA 1W82A 3OTVA 4F4PA 5GIOE 4E6CA 4F7SA 5DHJA 4ZEGA 3OY1A 3OY3A 3HLLA 3KRLA 3NSZA 1JOWB 4X3FB 3ULZA 4CV8A 1NW1A 1J91A 3A7GA 3DJ7A 2VWZA 4QMVA 1SZMA 3Q6UA 4FTNA 3QWJA 4AZTA 5CF5A 2Y6MA 4MBJA 2GNHA 4YZMA 5AUYA 2REIA 5HNBA 5K4IA 4F9CA 4LRJA 1OECA 4FKSA 3KVWA 5K5NA 2R3QA 5CVGA 2W9FB 3HRFA 4QOXA 5GZ8A 2ACXA 3W55A 4BI1A 4K9YA 5ANOA 4CFVA 5BVOA 3AG9A 2J7TA 4PMTA 2B52A 4MXZA 4ZTLA 5KNJA 3PPZA 2P2HA 2RG6A 5HIEA 2C6MA 4TYGA 2C6OA 4HYUA 3R9HA 4AWIA 2C0OA 3FI3A 4YPDA 3BWFA 4NJ3A 3VF8A 4F09A 3BU6A 4WRSA 3RWQA 5HLNA 2C5OA 4CMTA 2BKKA 4F65A 2YDKA 3FEGA 3ZHPC 3EKNA 3M42A 4L01A 4FV4A 4OTHA 3PY1A 5C9CA 1H08A 3LQ5A 3WF9A 4O81A 2Z60A 3GQIA 2GPHA 4LG4A 4G5JA 4AA0A 5LMKA 4O0VA 5T68A 4TN6A 4DEGA 2C5YA 2HZ0A 3MYGA 4CV9A 4DEAA 3R01A 4YLJA 5AM6A 4BWXA 3RM6A 2F7XE 4YUQA 1CMKE 4FL1A 3RINA 4EQCA 5KBRA 4PQNA 2W4OA 1J7UA 4U44A 3CE3A 2HCKA 2JAVA 4IDTA 2WMSA 4E6DA 2ITUA 2VWWA 2H9VA 2X39A 1LEZA 3I60A 4W4XA 2V22A 1NT2A 3DGKA 3VRYA 4YTCA 4FSZA 1QPCA 1WFCA 3Q3BA 2XRUA 4LV5A 5D12A 4HJOA 1CKIA 5AP3A 4R78A 3R21A 3UMWA 3RM7A 3WYYA 4TYIA 2CLQA 2OIQA 4WNPA 2VNWA 4WT6A 5DN3A 2UZDA 4G3EA 1PYEA 3FPQA 3HAMA 1J1CA 2VWVA 3EHAA 2WD1A 3P4KA 3GC9A 3TZ7A 3A4PA 3ZUUA 5IQHA 3UP7A 4F0FA 2PVJA 4NEUA 1JKKA 4GRBA 1ZYDA 5CWZA 4O7LA 3OEZA 3PPKA 2GNGA 3S95A 3MH1A 4HGLA 2QHMA 4E20A 2XH5A 3QKKA 3ORKA 2I0VA 4FV6A 2OKRA 2PE0A 5CSWA 2WGJA 3U9NA 2IPXA 4G6LA 3L8SA 1QL6A 1H28A 2XRWA 2FSTX 2VO3A 5AP5A 3ALOA 3CGOA 5DFPA 1KE6A 1ZZ2A 4BVUA 4AXAA 2YCQA 3HECA 4MBLA 3OUKA 1XO2B 4HCVA 1I44A 5H3QA 5H8GA 1R0EA 3OBGA 4OBPA 3U6HA 3MB6A 3MH2A 3QXPA 4KKGA 4QQJA 4DTKA 5IMEA 4I4FA 4U3YA 5I4NA 4O86A 4JRVA 1E9HA 2DYLA 2O0UA 4U8ZA 5KZIA 4ZIMA 4C58A 2HXQA 3FMMA 5AAEA 5J5SA 3RTPA 5EI6A 5FEEA 4AOTA 2WQMA 5EM5A 3AT4A 3MFSA 3BYMA 3E3PA 4GK2A 4CD0A 4OAVB 3NAXA 5CVHA 2ONLC 3DPKA 3EQCA 5TOZA 5HOAA 1KV1A 2PVRA 4WNMA 2B9JA 3Q4UA 1ZY4A 5CANA 3OG7A 3P7CA 3E7VA 4I41A 1V1KA 3Q4CA 4DFZE 3QQUA 1GIHA 2HXLA 2R3LA 4RG0A 3NNXA 4WO5A 4JDIA 5DRDA 3Q9ZA 5CAUA 4UMPA 4PF4A 5M51A 3R9RA 3QBNA 3BYSA 2ZB0A 2O64A 3WIKA 3Q5IA 5JQ5A 2JKOA 4FYNA 1APME 3ZRMA 4KBKA 1XH7A 5LQFA 4Q5HA 3W2QA 4BCJA 4YLLA 3C5UA 5IQEA 4YR8A 3WZUA 2O63A 2NNWB 1XH6A 4RJ6A 4JG7A 4E73A 2VTRA 1U5RA 2OGVA 4OTDA 5C8KA 5CVFA 3NUAA 2YHVA 3ZLYA 4IAYA 5FM3A 3QWKA 3SOCA 5ANKA 4O6LA 5HG9A 3F2AA 3KF7A 4NCTA 1M52A 2H34A 1YXTA 2VTTA 4NL0A 4WUNA 5LVPA 4GEOA 3DBDA 3IK3A 3OXZA 4BHZA 4E5BA 3UQFA 1OIUA 4X3FC 3R7YA 2CCIA 4X3JA 4NZWB 4QYGA 4FKVA 2UV2A 4D55A 3S1HA 2JDTA 2JFMA 3FKLA 1OBDA 3MTFA 1M2RA 3PVBA 4FV0A 1P2AA 3DAEA 3QTRA 4O83A 3EZRA 4FEUA 4M66A 2FSLX 4GW8A 3Q2MA 4QMQA 4MHAA 2NPQA 3Q04A 3G9NA 4GT3A 1W83A 4BKYA 5IH5A 3PZHA 4FTLA 4U0IA 2RFDA 4MAOA 4F6UA 2YLEA 1V0PA 3FLSA 4ZXTA 4CGAA 2VTHA 2WMVA 3IKAA 1KE9A 3D5WA 2W7XA 5A4QA 5CAOA 4JRNA 2PZRA 4RC4A 3EFLA 4OGRA 4IX3A 4IH8A 4MD9E 4XMOA 1YXXA 2ZYBA 4XP0A 5C27A 3U4WA 3KXHA 1H8FA 3KMWA 3EL7A 5D11A 5HO7A 3C4WA 1JSVA 4FNZA 5E8UA 3ZSIA 5J87A 1G5SA 5KMOA 3DKFA 4JQ7A 4PDYA 4W4YA 1XBAA 2LGCA 1OITA 5CNOA 2UW3A 3BHHA 2VGOA 3E8CA 3ZM4A 2XP2A 1V0OA 3ZO4A 2KTYA 2J6MA 2BMCA 3R7IA 2X8IA 5IG1A 5HTBA 5CNNA 4EZ3A 5HU9A 3ID6C 5A3XA 1HOWA 4QP8A 2UW7A 2KULA 4GT4A 4QP1A 4RMZA 2X2KA 4PPBA 1ZLTA 3ZZWA 3SRVA 3L8PA 1F3MC 4RIYA 4ANSA 4BI2A 4XRJA 1PHKA 4I23A 4D0WA 4ZSGA 3MH0A 3MN3A 3ALNA 3UC3A 4DA5A 1JKTA 4JBVA 2BILB 5ETFA 1K3AA 1LEWA 3F2NA 4ACDA 5LWNA 4X7QA 5EQEA 1QPDA 2WTKC 5HE1A 1Y6BA 4EUTA 4YJPA 4AT4A 5BVKA 4DEIA 3V6SA 3BPRA 3KY2A 3DFCB 4YSMA 5EYKA 3NYOA 1YHWA 2B9FA 1XWSA 3D2KA 3M11A 3M1SA 2RFSA 3PZEA 4FIHA 5EG3A 3UPZA 2JEDA 5E1SA 4FOCA 2C69A 4NW5A 1XR1A 1PKGA 5B2LA 5HLPA 1PRYA 4R5SA 2X7GA 4R5YA 4FGRA 4R7BA 4EBVA 2CNUA 3QQKA 4IXPA 4CG8A 3EOCA 1Q3DA 1IR3A 2IW6A 1KE5A 1YOLA 2X1NA 3LMGA 2YZLA 2P3GX 2R3PA 4E1ZA 3VW8A 3OCSA 3ZDUA 1G3NA 3ZOSA 4FEVA 4ZOGA 4EOMA 3KB7A 3WF8A 5IQBA 4ANLA 4IFCA 3S3IA 3UZPA 2W1GA 4FKOA 3WF7A 4QP6A 3WF5A 3QZHA 2QO9A 5IUIA 5FM2A 1WCCA 1OKZA 3LHJA 2HW7A 3F69A 2W17A 3MW1A 3NW5A 3RAIA 3WZEA 4FEWA 4MVFA 4QMTA 3CPCA 1SM2A 3A7HA 1R0PA 4RPVA 1ZYJA 3UOKA 4E4MA 5L2QA 2BRNA 4G17A 1ZOEA 3LQ3A 4QMYA 2XMYA 5D41A 1Q8WA 5HD7A 2GQRA 3TXOA 1GZNA 5E8XA 4O84A 4EHZA 3I7CA 5C03A 4RRVA 3PA3A 5DI1A 5HBEA 4X6RA 3V5PA 4Y46A 5IUHA 4BY9E 3SV0A 4EZ7A 4JI9A 3LZBA 4PTEA 4BTJA 3FQHA 1Z5MA 3OEFX 3TNHA 3HV3A 4QP2A 4XP3A 5M07A 1UU7A 2IZUA 4HYIA 4HZSA 3QKMA 4CYIA 3SVVA 1ZYLA 1QPJA 3OCGA 4FNYA 3B2WA 3ROYA 3SW4A 2QG7A 3AC1A 4FKIA 1OIRA 4XBRA 1H01A 2HWPA 5L2IA 4GYGA 4I5CA 4U79A 5HVYA 4AQCA 2O5KA 4FKRA 3DBEA 4IB1A 4L43A 2YABA 1H07A 3SAYA 3TV4A 2J0LA 4LRMA 4RA4A 1ZMVA 4XX9A 3RHKA 3VRZA 4UZDA 3O8TA 4ZTHA 1NVSA 3L8XA 5ETIA 5BVDA 4EBWA 1VR2A 1KUTA 2R3NA 2B1PA 3KRJA 3ZONA 2JDOA 1Y57A 1TQPA 1Q8UA 1FQ1B 4FKQA 4IB5A 3P86A 1XKKA 1FPUA 3FAAA 4XV3A 1P4OA 4QMXA 4DH7A 3EQGA 2AC3A 2OJFE 3R7GA 4FSUA 3TTJA 1OPKA 1IASA 2FSOX 2W05A 3GC8A 3GFEA 4CVAA 5FEQA 3CQUA 1E1XA 3QQHA 4PMMA 2IJMA 2J0MB 2Z7QA 5FG8A 3VW6A 1PMNA 5IF1A 4ASEA 5J1WA 5DRBA 5JMSA 4J95A 1JAMA 2YFXA 4XNEA 3O8PA 5H9BA 4X2NA 5HQ0A 4ZK5A 3OCTA 2VTPA 4BFMA 1U59A 4FTQA 3QXOA 3RPVA 5GIPE 4KIKA 1BYGA 1W7HA 4H05A 5HESA 4DGLC 4PL5A 5EI8A 3HUBA 4MXAA 3ZM9A 4ALVA 2XNPA 1TQIA 3ORNA 4TZRA 2R7BA 5AV2A 3VIDA 4WIHA 3UMXA 4NYEA 4K0YA 5BUJA 3D5VA 5CZIA 4AGCA 2VZ6A 5IQGA 2QCSA 4EOSA 3A7FA 5GJFA 3MY1A 4C4EA 4FSRA 4EL9A 3DB8A 3VUMA 5IA0A 2WOUA 2UZWE 4FVPA 5A46A 2ITXA 2UVYA 4DFLA 4IWPA 2JIUA 5I9UA 4ANQA 4I5PA 3G90X 4FIFA 4MD7E 1H1PA 4LMNA 2VX0A 4P5ZA 4YNEA 4EOLA 3HVCA 4YJQA 4RIXB 4JDKA 5M4IA 3MVJA 4RIWB 3EFKA 4EHVA 5BUEA 4KWPA 3DZOA 3OXTA 4G5PA 5HIDA 2W5BA 2JLDA 4KNBA 2FA2A 3BX5A 3LM0A 2XJ2A 3KVXA 2RFEA 4QYHA 3FLQA 1XH8A 4PTGA 5TR6A 3UQGA 4WSQA 3A61A 3RHXA 3BLRA 2IZSA 3KU2A 3R7VA 3O7LB 2GDOA 3LXKA 5AV1A 5EOBA 4HVSA 2G15A 4FA2A 4NW6A 2VTLA 2WMXA 3DA6A 4BF2A 3MPMA 3QTSA 3FHRA 3R71A 3C9WA 4S30A 4CSVA 5CEPA 2XKDA 3E62A 1YXSA 4M69B 3MB7A 3UODA 4P90A 3QCQA 4WBBB 4I22A 2X7FA 5AR5A 3FY2A 3L9NA 4IW0A 2VWIA 3DQWA 2OF2A 4RQKA 2A2AA 4X2KA 2PMLX 3D7ZA 4FE2A 5DOSA 4YURA 4QPMA 2C47A 4CMOA 4DT8A 1M7QA 2F49A 3GC7A 4ZSEA 4FV5A 1JNKA 2RG5A 3W10A 4CZUA 3MH3A 3BGZA 3OMVA 2QOIA 4A4LA 5M44A 2XM9A 5DBXA 4D1ZA 5HG5A 4JOAA 2YA9A 4BZNA 4F9WA 5CAVA 2J0JA 4E4XA 5FQDC 3EQRA 1JBPE 5L6OA 3UQCA 3DBFA 1ZAOA 2PUIA 4ZMFA 4EKKA 4ENYA 4Z7GA 4B4LA 4EWQA 2XIKA 3PVWA 1STCE 4LOPA 4TT7A 5CALA 3EWHA 3FL5A 1FVVA 3GQLA 3Q96A 3BU5A 3W8QA 3DQXA 3DXNA 3P9JA 1LUFA 4TRLA 4V0GB 3ZFYA 1OGUA 4RVKA 4XRLA 3SW7A 4FODA 1FINA 3KXXA 4K77A 3PFQA 4FIEA 3KGAA 3FUPA 3QUDA 5CLPA 5HEZA 4XV9A 1GZKA 4YTHA 3BLHA 3EFJA 4GKIA 3OD6X 3NUNA 4DFBA 4F1OA 4FV7A 4W9WA 4AFJA 2YERA 5HZNA 4C33A 4K1BA 3Q9XA 2YM3A 2C0TA 1SVGA 3QD2B 4I92A 5FXSA 4J71A 5DG5A 4YMJA 5LMKC 2X4FA 5L8JA 3TUDA 4L9IA 1GOLA 3QTIA 3I5ZA 2OSCA 1MRYA 4OTGA 4QP3A 4A07A 4AT3A 5CT7A 1IAHA 2ZB1A 3MV5A 3FI2A 3Q52A 2ITTA 5IMXA 1BL6A 2PK9A 4LGGA 1AGWA 2F7ZE 3ZTXA 3CD3A 1F5QA 2WFYA 3EQBA 5IUGA 3WZKA 3HMNA 3CP9A 4JX7A 4IJ9A 1BL7A 3K5VA 4UWBA 4W4VA 4WA9A 1UU3A 5LXMA 2HYYA 4L00A 3VHEA 3PTGA 2VTMA 5EYMA 3UO6A 3AD6A 3NPCA 4G2FA 1PMVA 4F08A 5CAQA 5L8KA 2I0HA 4YJNA 4QYFA 3W1FA 4ANMA 4FGBA 3R1NA 4AZFA 3RPYA 5LARA 4RLLA 2QO7A 3IDBA 3DU8A 2VNYA 4QMWA 1Q8YA 5AUVA 3HA6A 5AR8A 3C0IA 3S00A 3SG8A 3T9TA 3LAUA 3I81A 3FZPA 5D1JA 5LVOA 2OJIA 4MXCA 3EIDA 3HP2A 4C34A 4S31A 2F2UA 1JQHA 2VO0A 5D7VA 4AFEA 2Y4IB 2B7AA 1ZY5A 3IDCA 5FRIA 2J0KA 3OVVA 2W5HA 3I1AA 3PSDA 3ZMMA 3QHWA 4NT4A 4F7NA 2I7QA 2FH9A 5FP5A 2HZNA 1DS5A 3VAPA 4RWJA 3ZYAA 1H0WA 2QOLA 4KIOA 1P5EA 3TNQB 4NU1A 4FZFB 4J52A 1Y91A 3TKHA 3II5A 4FICA 4WNKA 3LFDA 3IECA 4GUEA 3KRWA 3ZEPA 4ZY5A 2HOGA 2UW9A 3JUHA 3I0QA 4MF0A 5FTOA 4IZ7A 3MY0A 2WKMA 4C4IA 4PDOA 2PL0A 4UN0C 5FP6A 4IAIA 4ZSLA 1OL5A 3O0GA 1OL6A 2VTOA 3PYYA 4CTCA 2Y4PA 2QOKA 1ZZLA 5H2UA 4AG8A 3AMAA 4IAFA 2QVSE 4FEXA 4F7LA 3LQ8A 3HMOA 4AX8A 2WAJA 5IA2A 3EQHA 3MJ1A 4MNEA 2GHLA 3ZZEA 5JGBA 3AMYA 4AGUA 3RI1A 4PTCA 3WZDA 4C0TA 3PUPA 3JYAA 4Y83A 4XG6A 3LFBA 5GHVA 4EI4A 5JRSA 2IWIA 4TWCA 2UZLA 3VUDA 4EC8A 5IA4A 1A48A 3VS5A 5IA1A 4BGGA 4XG9A 1F0QA 1BI7A 4IB3A 3CKXA 4U80A 4BB4A 5EW3A 5E8SA 4UY9A 5A14A 4NM3A 4PX6A 4L67A 4Y72A 3FXZA 1M7NA 2UW5A 2VWBA 5BUIA 2JITA 2VTJA 3AC8A 4BDJA 2VN9A 5IKWA 5HHWA 5M06A 3OWJA 3MA3A 3PXQA 3R8LA 3TG1A 3ZBXA 5J7HA 1YW2A 5AADA 4E93A 3U51A 5JN2A 2Z7SA 1FMOE 2GNLA 2OFVA 3QHRA 3BI6A 4MF1A 4FL3A 3ZFMA 2BZJA 4QMNA 3NUXA 1XH9A 1BKXA 3BHUA 3BHVA 4HPTE 4CFXA 4ERWA 3ZXTA 3HAVA 2UW6A 2RGPA 5J79A 3KC3A 4A7CA 1OL7A 3O23A 1XBCA 4FYOA 4DITA 4EQMA 5C4KA 5HE0A 2FYSA 4NFMA 3KN5A 3UIXA 3VHKA 2CNVA 1RJBA 4FKPA 3KK9A 4GK3A 4KB8A 4GVJA 2JBOA 5AAGA 3JY9A 4IVDA 3MA6A 3MSSA 4PP9A 4K33A 2XKFA 4F1MA 3OW4A 4WNOA 5EHOA 3RVGA 4Y5QA 5KKRC 5EQYA 2IZRA 2HELA 3LMIA 1O6KA 3WI6A 4E4LA 3N4TA 1ZARA 2YCRA 3E63A 4NSTA 4NKAA 4DYMA 1XBBA 4R1VA 1L3RE 4YC6A 3DBCA 3PY0A 1E1VA 1OPLA 4FTIA 3UNKA 4ITJA 4UYAA 4YTFA 3BYUA 2AYPA 2CDZA 4G9CA 4CFFA 4U5JA 5HGIA 5IZFA 5AR3A 2I0YA 3DXPA 2NRYA 3IOPA 4I5MA 4R7HA 4OBQA 4GFMA 4EK4A 4BTFA 2R2PA 5KMLA 4CYJA 3HRBA 4CFMA 4CG9A 3PG3A 4ZJVA 1MRVA 2QC6A 3C0GA 3VF9A 2YAKA 3C4CA 3IS5A 4P7EA 3TNWA 1G8AA 2XNNA 4FG9A 3VBXA 2RIOA 2X4ZA 3A4OX 2QG5A 4U6RA 3IOKA 4EOPA 3FLZA 3VS0A 4CQEA 4A9UA 3QCXA 3S4QA 2C68A 5CEQA 1ND4A 4B7TA 4AGWA 3R83A 2Y7JA 2QI8A 4N6ZA 3WOWA 1UKHA 2IVSA 4D1SA 2VX3A 1UU8A 3S0OA 4LOQA 4BBEA 5DMZA 3LFSA 4NIFA 2PUPA 3BHTA 3P79A 4YZBA 3TKUA 4KAOA 3QF9A 3K5UA 3HA8A 3ENHA 4N6YA 3GU7A 3RAKA 4O7ZA 4D4VA 2ITOA 1U5QA 5CU3A 2W0JA 2ETRA 1AQ1A 3PP1A 3D7TB 4ZJJA 2EUFB 5CU4A 4RX5A 5AUUA 3VO3A 3V5JA 3QD0A 2WNTA 3ZLSA 4PV0A 4DEDA 2PVFA 1T46A 4NFNA 4BCNA 2Y4IC 4IVAA 4RLKA 5AUTA 4X2FA 3VUGA 2ZM3A 4KSQA 4X2JA 5BQ0A 2WTKB 4TWNA 5E7RA 3RJCA 2XIYA 2XYUA 4GUBA 3A2CA 2Z7RA 4L6QA 3RCJA 5C26A 3RWPA 3RPSA 5A4EA 2C6TA 2WOTA 4D2VA 4XYFA 3OUNB 4ANOA 3AC3A 4BDFA 3RK9A 3OOGA 2YWPA 1U46A 5M56A 3ULIA 4K8AA 1PF8A 2JDRA 4RFZA 4FZ7A 4O2PA 2JAMA 5IQCA 3ACKA 4FKUA 2LAVA 3KFAA 5HNIX 3TIZA 2JBPA 2O8YA 3GT8A 4CKRA 3H0ZA 4QMUA 4H36A 1H1RA 2ZJWA 4U97A 2OWBA 4R1YA 3THBA 2P0CA 2R3OA 2F4JA 2W5AA 3R9DA 1PW2A 3ZUTA 4UALA 4Q5EA 4QTDA 3GNIB 4L44A 5JH6A 2VD5A 2F2CB 4O6EA 3NNUA 3AC5A 1I09A 3F5XA 2NO3A 3D83A 3IO7A 4X21A 4OTPA 3VUKA 2ETKA 2B0QA 3NRMA 3V5TA 1ZWSA 3IW4A 4RFYA 2W06A 2E9VA 1GIIA 3QQJA 2F9GA 2ITZA 4JBQA 4QTBA 3W16A 5DR9A 3MIYA 1U54B 3ODZX 4O1PA 3TDVA 4FK6A 2QQ7A 4BDAA 4N57A 2X81A 3GCQA 4KIQA 1H1WA 4FZDB 2YCSA 1QMZA 2DS1A 1FGIA 1YDRE 3OCBA 3OXIA 4XOYA 3V01A 2G2HA 3QU0A 4XEYA 4F70A 2FB8A 1WBVA 3TIYA 5FBOA 2QOOA 5DEWA 3UIBA 4EOOA 4EYJA 5FDPA 3JY0A 4FC0A 3MVMA 3F3ZA 4IAZA 1M2PA 5I9YA 4I93A 4XG4A 3GEQA 4M7IA 5G6VA 2C1BA 4IMYA 2YACA 3A7JA 3ORTA 4YZCA 3BYOA 3QRTA 5DH3A 3U8WA 5HTIA 3U9CA 5K9IA 4E26A 4ZAUA 3Q32A 4XG8A 3ETAA 3V8TA 3PA5A 1ZXEA 3FHIA 3IW6A 4I94A 3VJNA 4LQMA 4I5HA 3FWQA 3LFFA 2IW9A 1IEPA 4EJNA 4FTCA 5HU3A 3G6GA 4XV2A 2XK7A 1ZMUA 1B6CB 2W1CA 3FC1X 2BHHA 3LFAA 3NGAA 1CTPE 5EKNA 3PDTA 4TL0A 4E7WA 4BDEA 2XA4A 4BHNA 1FVRA 1OZ1A 4XJ0A 5LMBA 4H39A 4AP7A 4RX8A 5JSMA 3BU3A 5AUWA 2CKEA 4YC8A 4IZ5A 2OZOA 3BEAA 4NM0A 4O0TA 3DAKA 1FGKA 2PZIA 2R3RA 4UWYA 5GNKA 3EQFA 3LVPA 4UB7A 4RQVA 1BI8A 5ICPA 4NWMA 4FTUA 3LXNA 2GTNA 5IISA 5C1QB 3GCSA 1ATPE 4AE6A 4D5KA 4E8AA 2P55A 4MQ2A 1LPUA 1J3HA 3KULA 2C5VA 4BBMA 3ORZA 3BLQA 3RK5A 4CCBA 4DEHA 5A4TA 2R0UA 4FKWA 1YRPA 3DKGA 4PPAA 2ZM4A 3QQLA 5KHXA 4YZNA 4CXAA 3H10A 4MNFA 4ONAA 3NWWA 4AZWA 3LFCA 1OIYA 3NVKI 3GCUA 1XH4A 3AOXA 4HGEA 4C4FA 2UW4A 4XHKB 5C4LA 3C50A 2P33A 3QZFA 3DNDA 3MJ2A 2OW3A 3R30A 3E88A 2HAKA 4IWOA 4U81A 5AP4A 4C8BA 3UPXA 1H26A 1UWJA 5HKMA 5LMAA 3EN5A 4XOZA 1PXIA 3LPBA 5F20A 1M17A 4IM0A 4YC3A 3DJ6A 2XYNA 4RWIA 5B7VA 3QX4A 5AJQA 4A9TA 3FC2A 5CT0A 3ZLWA 3PXFA 2YDJA 4EUUA 4RWLA 5AV0A 3SXSA 1QCFA 2V0DA 3AQVA 3PP0A 2OZAB 3PE2A 3Q53A 3I6WA 2J90A 2B9HA 4IAAA 5CU0A 5I9ZA 2QOBA 3DFAA 1TQMA 3L9LA 1PXKA 2EB2A 5AUXA 4M0ZA 2Q83A 2WEVA 3NYNA 2C6LA 3DTWA 4YJRA 4QP9A 2PE1A 3H3CA 4E5WA 3PE1A 3C1XA 4F1TA 2BZHB 3VS3A 4LUEA 4IHPA 3QL8A 2EXCX 1O6LA 5TF9A 4NH1A 4EWHA 5FUTA 3DT1A 2W96B 3MVHA 2J0IA 4IZAA 4BBFA 5IEYA 3RNYA 3POZA 2VTAA 5L8LA 3GC0A 1H24A 1RW8A 2UW0A 3RK7A 3GU4A 3O50A 3EB0A 5CZHA 2C1AA 4PUZA 2W9ZB 4QP4A 3V5WA 4PL3A 4IEBA 4F63A 1Q62A 1MUOA 2ZMCA 4QPSA 5E8TA 3TV7A 2VX1A 4RJ7A 2PVYA 4C3FA 3OOMA 2VTIA 3D0EA 2ZOQA 5ANEA 2R9SA 5H8EA 5DT3A 5AAFA 5KBQA 1REJA 4FT7A 3F3TA 4WKQA 1U4DA 4V05A 4HOKA 4AAAA 3AXWA 3NUPA 3H0YA 4QD6A 4YU2A 3PJ3A 5IEXA 4EYMA 1BUHA 5CEMA 4G6NA 2FSMX 4JBPA 2ERKA 5BX0A 3HV7A 3UGCA 5AFVA 4DTBA 3LFQA 4BR3A 3BQCA 3POOA 3CS9A 3NR9A 5AUZA 2WMTA 5AV4A 5ANGA 3SQQA 4GH2A 2CNQA 4CFWA 4I3ZA 5ACBC 5J5TA 2PMNX 3AGMA 1TVOA 3CTHA 4H1MA 5BYYA 4AZSA 1BX6A 2BKZA 2GHMA 4JR7A 1XJDA 3FYJX 4WOVA 3TI1A 4FVQA 5LCJA 4EH9A 3QZIA 4C02A 2CPKE 5HX6A 2QURA 3FMDA 3PJ8A 5B2KA 5AX3A 2GTMA 3EFWA 3ERKA 1MQ4A 1Z9XA 2FO0A 2R3FA 2XNEA 2YDIA 3IGGA 2CSNA 3PJ1A 4FUXA 5CQWA 5HCZA 4AU8A 3DLSA 4RJ8A 1GNGA 5DEYA 4BDKA 3IGOA 3AD4A 4MXOA 1ZOGA 4UMQA 3TNIA 3VC4A 4N0SA 2YJRA 2Z7LA 4BDHA 1OBGA 5M08A 5HCXA 3KMMA 1DI8A 3GB2A 2J50A 4AE9A 2VUWA 4RZWA 4XH6A 4ZP5A 2JFLA 3QFVA 2WQOA 3E5AA 1GZ8A 3FL4A 4IAKA 4R6VA 2WTCA 3LKMA 3ZXZA 3RNIA 2BFYA 3ZRLA 3UP2A 3V51A 1W0XC 2JC6A 2UVXA 3WF6A 2C3JA 4E6AA 4P5QA 1R1WA 5BVEA 1J7LA 2Y8OA 3QA8A 2WO6A 4K6ZA 3LFNA 3Q4TA 2X7OA 2WEIA 3ZBFA 4D2WA 3BGPA 5I9VA 4FUYA 4C4HA 4ZZNA 4ZS0A 4ZTSA 3W8LA 3GI3A 2WU6A 4TNBA 4LUDA 3R8MA 4EHEA 3TNPC 2CN8A 1PXPA 4J8NA 4QTCA 4X0MA 4D28A 3L8VA 4WG5A 2PVMA 4N4SA 4IB0A 2OBJA 5BMSA 4L3PA 2XS0A 2BTSA 3U87A 3A99A 4BRXA 4D1XA 3IG7A 1YXVA 4E3CA 4DCAA 4O96A 4HGTA 1PMEA 4FZ6A 4O7TA 4CMUA 4ERKA 3BQRA 4L46A 4BCFA 3EKKA 3QCYA 3R22A 3OWPA 3SC1A 3R2BA 2GCDA 3P78A 2CHLA 2YISA 2FVDA 1VYZA 5ITAA 4QYEA 2XBJA 3TACA 2BUJA 3PIZA 4DLJA 2PYWA 5LWMA 3W18A 2PU8A 4GJ3A 4R8QA 4MKCA 1LR4A 4IANA 4XP2A 4CFNA 4BGHA 3CIKA 2CKQA 5BPYA 4AGDA 3PLSA 3NUYA 2XZSA 4LL5A 2B54A 5ETCA 5CSPA 5J9ZA 1H4LA 5K5XA 3O71A 2BIYA 3ORPA 4HCUA 3B8RA 5CU2A 1MQBA 4FSYA 5FWKK 3KRXA 2WQBA 4FTRA 3JVRA 4LRKA 2PVHA 2W4KA 4RA5A 3D14A 3ZU7A 1EH4A 1IAJA 4GKHA 2UZVA 4A9YA 3V6RA 4MH7A 5ETAA 2C0IA 4FT9A 4G3FA 3MI9A 4O21A 3R28A 3TTIA 5DT0A 3R7EA 3BKBA 3K3JA 3NIZA 3OT3A 4G6OA 3T9IA 4GSBA 4DG2E 2OH0E 4I20A 3ZO3A 1YWVA 3AT3A 4PMPA 5KMIA 3DDPA 4X3FA 5JKGA 3FJQE 3D9VA 3EN6A 4BIDA 3NW7A 3UDBA 3BGQA 1S9JA 2VU3A 1YI6A 4WBOA 4ZJIA 4DHFA 3V8SA 2IZTA 3CR0A 2ZV7A 5DT4A 2Z8CA 3U4UA 3WARA 1DI9A 4HNFA 1H0VA 1GIJA 1WBOA 4YHTA 3UG1A 2Q0NA 1H27A 4O27B 3FMNA 5ANIA 3TDWA 1ZYSA 3P08A 4I21A 3F66A 4YNOA 5HNGA 3WILA 4ANNA 3FI4A 3GENA 4DGMA 4FG7A 5J1VA 2YWVA 4D5HA 4XG3A 4S2ZA 3LOKA 1Q97A 2G2FA 4ALUA 1AD5A 3PVGA 5G1XA 1WBTA 3GOPA 4DINA 3OS3A 5CXZA 4M12A 2QLUA 3PIXA 4C7TA 2YCFA 4FTJA 4KD1A 4K18A 1KWPA 3JXWA 4FSMA 4KINA 3K54A 3PXKA 3E7OA 3MDYA 4MWIA 2ZAZA 4JG8A 4A06A 4IJPA 1IA8A 3TKIA 3KKVA 3PVUA 2IVTA 4YJSA 4EJ7A 5TKDA 5HG7A 3FZ1A 5E8VA 4BCMA 3IW5A 4CRLA 2XK8A 5IH6A 3F5GA 3B2TA 3COIA 2WMWA 4GU9A 4B99A 3R02A 5J9YA 2EU9A 1ZYCA 3CLYA 4ZY6A 3EQPA 3UYSA 2FUMA 3ZS5A 3FMKA 2BRHA 2ZV8A 4ENXA 1YDTE 3D7TA 2JD5A 3JR1A 4IM2A 4O0WA 2YZAA 3K3IA 3R8PA 2YM6A 5E8YA 5CEIA 4S34A 3FQSA 3BE9A 3R9NA 5HORA 3PG1A 1H1QA 4F9AA 4FBXA 4LL0A 5M57A 3G9LX 1KOAA 3KRRA 3Q5ZA 4D4SA 4AW5A 5AA9A 4BZOA 2XCKA 4BCQA 2VO6A 1JSUA 1RE8A 4KIPA 4DFNA 2C6EA 4GL9A 3LW0A 3HDMA 4G31A 3F5PA 1OKYA 5KKRB 4GU6A 5CEKA 3VBWA 3QA0A 3Q9YA 1ZOHA 4TPTA 3VN9A 1DAYA 4GVAA 4BTMA 3ATSA 3C4XA 4FKGA 5EM8A 4YTIA 4EOIA 3O7LD 5CI6A 5DR6A 4QYYA 3Q2JA 3HV5A 3HV4A 4G34A 3FMHA 5M4UA 2QO2A 2A19B 3HP5A 4FOBA 4OTFA 3ZCLA 5IQIA 4YGAA 4GK4A 3PJCA 5EKOA 4MD8E 4V01A 1UNLA 1X8BA 2ZM1A 3UYTA 4IX6A 5AR4A 4CZTA 3EN7A 2QOCA 4I6BA 4JQEA 3RPRA 2XK6A 3VUHA 5FGKA 2QR7A 3COKA 4DFUA 3P5KA 3GU5A 3HX4A 2XNOA 3VBQA 4HNIA 3DOGA 1PXNA 2C6DA 2OF4A 4QMOA 3P0MA 1YOJA 3P1AA 5HTCA 4BC6A 1OKVA 4H3PA 5HLWA 5EI2A 4RIYB 3UC4A 3SOAA 4E5AX 4UZHA 3JPVA 4PDSA 5AP2A 3LMHA 3UZTA 4L7SA 4FV9A 2XEYA 2BDJA 3ZSHA 3MFUA 1URCA 3NNVA 1OUYA 2RFNA 3UE4A 4BYIA 5E90A 4OUCA 5FXQA 3W2OA 4LV8A 4AOIA 3DK6A 4C2VA 3RCDA 2ETMA 3I0OA 2BHEA 3FE3A 2B53A 2GQGA 3KF4A 3ORMA 4KS8A 4LFIA 4W4WA 2ESMA 5DGZA 4Y85A 4IVBA 1A9UA 2XNBA 4JIAA 1YWNA 3MGYA 1DAWA 3G2FA 2PMIA 4YJTA 3L9PA 2QU6A 3R8UA 4YZ9A 2BDFA 3G15A 5HVKA 1CM8A 3NYVA 1P14A 4YP8A 4HZRA 2XIXA 3QUPA 3C4ZA 3BCEA 2R3IA 3T8OA 3G6HA 1RQQA 5IPJA 5AIRA 4MXYA 5AP0A 3ORLA 3ZDIA 2BROA 2YIYA 3CEKA 4M8TA 3FDNA 4NJDA 3UG2A 4KRCA 4QTAA 4O7VA 3E87A 4I1ZA 2VV9A 1BMKA 4C37A 3FZSA 3COHA 1UWHA 2I40A 3CGFA 4XG7A 2XNMA 3NEWA 3LJ1A 5LOHA 2C6IA 3FV8A 3WZJA 4CQGA 4C35A 5EQPA 4FV1A 4NM5A 2OI4X 4TYHB 3DBQA 4Y8DA 4ASZA 3ZUVA 3EN9A 4LOOA 2YIQA 1YVJA 5KMNA 1W8CA 4EH8A 1URWA 2PE2A 3ZFXA 2GS6A 2PVKA 2QOQA 3QALE 4B8LA 3ANQA 3LCDA 4Y73A 4C57A 2W99B 3QRKA 4O0UA 4ZTNA 4ACGA 4ACHA 4YSJA 5A4CA 4WSYA 5C8MA 3Q6WA 5H8BA 2VTSA 3O51A 5JT2A 4UXLA 3WE8A 3VS4A 1H25A 1Q8TA 2WTVA 4TW9A 2W1HA 2FGIA 2ZVAA 3QD4A 4FF8A 3RMFA 4OTQA 3VBTA 4ZTMA 5KUPA 5DYJA 1LP4A 3PJ2A 4EH2A 5IA5A 5AV3A 4FI1A 5EH0A 2BR1A 2YLFA 4NUSA 2JDVA 4NTSA 4OTIA 5KHWA 3ACJA 3FBVA 3ZC5A
chains in the Genus database with same CATH superfamily
1Q8ZA 4USFA 3HV6A 3ITZA 5HICA 5LCKA 4IACA 4IC8A 3N9XA 4R3PA 2RKUA 3BBWA 4Z55A 2OZAA 3CC6A 3QYWA 2ITNA 4AN2A 1S9IA 4GMYA 3Q4ZA 1KSWA 5HVJA 5DNRA 2WB8A 4NCTC 4O7SA 3QGYA 4JDHA 4IC7A 2YIRA 4I6QA 2QHNA 5IQDA 3KCKA 4OTRA 3D94A 2QLQA 3OC1A 3G0FA 2Q0BA 4QQCA 2R3GA 2IVVA 3C5IA 3H9OA 2GQSA 1H1SA 3FPMA 5DR2A 3A60A 3H9RA 3VVHA 3F7ZA 5M55A 2QKWB 4FKJA 1XQZA 4S33A 3F82A 1GJOA 2J9MA 3V8WA 4FIJA 4D0XA 3ROCA 5AEPA 1TKIA 2VWUA 2BRBA 5I3OA 4DC2A 3G5DA 2A27A 2EVAA 3N4VA 4MEDA 2C30A 4U9AA 2WMAA 4FSQA 2BAJA 2OG8A 3EH9A 2XVDA 5CF8A 3BLAA 5IDPA 2Y9QA 3QZGA 5BVNA 2W1IA 2J2IB 3LCOA 4KIKB 5KZ0A 2B4SB 5E8WA 3ZRKA 3C51A 4BL1A 4UV0A 2YM5A 2PZPA 1XH5A 2OXXA 4JQ8A 4BDIA 1VZOA 4C4GA 2WMRA 4ZLOA 2UZOA 4F0IA 5B2MA 2JKQA 3FXWA 4KA3A 2E9UA 4FRFA 4FSTA 4RJ5A 2OH4A 5LVLA 2ZDUA 1OKWA 5HBHA 1W84A 4RZVA 3O96A 4I0TA 3QQFA 4G3GA 3VS1A 1YHVA 2RSVA 3BBTB 4FT5A 4ZLZA 1CDKA 5M4FA 4U40A 2W1ZA 2C3IB 3FMJA 3R6XA 4PRJA 2SRCA 3UDTA 2W1FA 1PKDA 1WVXA 4FT3A 4FTAA 4IX4A 3HDNA 2BPMA 5AWMA 4B9DA 5IDNA 3ET7A 3FLNC 3NLBA 4GFGA 4J97A 2CCHA 1OM1A 3LXLA 5CS6A 1PJKA 2VGPA 3DTCA 1OI9A 4FVRA 4Z9LA 2A1AB 3BV2A 3W32A 3WYXA 5BNJA 4WG3A 3KREA 3E64A 3EQIA 4RVLA 3OWLA 2R3JA 2AQXA 2RF9A 3LJ2A 3TCPA 2Z02A 2HY81 3LCKA 2ZMDA 3GVUA 3H9FA 5HIBA 1J1BA 5EM6A 2GFSA 2WIPA 2OXYA 4UMTA 2CKOA 4FNWA 3LIJA 3R1QA 2AUHA 5E1EA 5L2TA 3KXGA 3A7IA 4GCJA 3R04A 3IONA 4I6FA 5CSVA 4K2RA 4DTAA 3A8XA 5L3AA 5TE0A 3KK8A 4BYJA 3BEGA 1T45A 2HK5A 4IWDA 4F99A 3ORXA 4R3RA 4PY1A 3UDSA 1WBSA 2WU7A 4MK0A 4BCPA 3VS6A 4F78A 4R3CA 2HWOA 4I0SA 4PNIA 4APPA 1OL1A 1WZYA 5A6OA 3U6JA 4O1OA 4QT1A 2HENA 3PWDA 2W1EA 4IE9A 3S2PA 1VEBA 2WQEA 4O0XA 1JPAA 4HVDA 2OIBA 3QGWA 3BWJA 3GU6A 5DE2A 3GBZA 5FEDA 3TEIA 1HCKA 2YITA 4BCKA 3H4JA 4TWOA 5IQAA 1JWHA 4EK3A 3NUSA 4FTMA 3D15A 4D2RA 2V7OA 3ELJA 4YHFA 3TUBA 3N51A 4AUAA 4AW1A 1B39A 1Q5KA 4I6HA 3V3VA 2O3PA 3KL8A 4U43A 2YIWA 3A62A 4BKZA 4CLJA 5AA8A 4QMSA 2OLCA 2GS2A 2JKMA 2X0QA 3DKCA 2WTWA 2UVZA 3FSFA 3T3UA 2UUEA 4F9YA 3MTLA 4EC9A 2W4JA 3QC4A 4KBAA 4DH3A 3R7OA 4EK5A 1WBNA 3TT0A 2R5TA 3PA4A 3BYVA 4RJ4A 2IW8A 1JVPP 1O9UA 3C4FA 3OW3A 2A4LA 2V5QA 3H30A 2QNJA 3VQUA 3C7QA 4BTKA 4XCUA 5EOLA 3OROA 5ANDA 4DBNA 5BMMA 5L4QA 2BIKB 2ITYA 2IN6A 5IU2A 2GMXA 3PXZA 3DLZA 3QTXA 4WHZA 2VRXA 3FMLA 5LVMA 4BGQA 5FDXA 4XLIA 1FVTA 5EHYA 1UV5A 3CXWA 4PWNA 4ARKA 3COMA 2O65A 2WTJA 4M14A 4EH4A 3V04A 3BIZA 5CAPA 4AZEA 4NTTA 4L8MA 4XBUA 4O91A 5KMKA 3R0TA 4L42A 1Y8YA 2PUNA 4DBXA 4F9BA 5B0XA 4Y95A 4TYJA 4JJRA 3GOKA 5CQUA 3V5QA 2I0EA 4RIXA 4RIWA 4L52A 1GY3A 4KS7A 3MS9A 4QMLA 2BTRA 1MRUA 3ZSGA 4ANBA 5L2SA 4I0RA 4J1RA 4G1WA 2PZ5A 4QMPA 5EW9A 4UYNA 3R00A 5CU6A 2R64A 5DIAA 4U41A 4AN9A 3EZVA 2YEXA 3E92A 3IW8A 4D2PA 2BZKB 2GHGA 4DG0E 1PMUA 3LE6A 4JLCA 1DM2A 5LVNA 1NVQA 2WTDA 2YM4A 4AACA 3F9NA 4L68A 3ATTA 4M15A 4IX5A 3EN4A 1QPEA 3NX8A 4FK3A 3C13A 3HRCA 4JAIA 2PZYA 4BZDA 4I6LA 3WIGA 4M69A 5CASA 1ST0A 5CSXA 4YJOA 4N70A 2I1MA 4YO4A 3EYHA 3Q60A 2XCHA 1VJYA 2XF0A 4M13A 5EK7A 1OVEA 1ZMWA 2OU7A 2C6KA 2X0PA 4D4YA 2E9NA 2C5XA 4FV8A 4FKTA 4ZTRA 1IRKA 4C3PA 4O0SA 4M67A 4QEBA 2XIRA 4IM3A 5EDRA 2PY3A 2UZTA 4FZAB 5AP7A 4ASDA 4QTEA 3QRIA 2ITVA 3Q9WA 3CJGA 3HEGA 4IQ6A 4X2GA 3FI8A 4L3JA 4X6QC 4RVMA 4CEGA 4UBAA 2E2BA 3LCTA 5TO8A 5HX8A 3GP0A 4CFUA 2R3MA 3SXRA 1Z57A 5KX8A 4GV1A 4IBMA 3JS2A 2YM8A 3ZLXA 4DGGA 4D9TA 4JBOA 4FX3A 4GIIA 3P23A 3I7BA 4HPUE 1Q61A 1UNGA 3IDPA 4RFMA 4U45A 3R73A 3RAWA 4DEEA 5IQFA 5DPVA 3SDJA 4TXCA 1OMWA 4QPAA 4EEVA 2QR8A 4J99A 4KRDA 5IEVA 4MNEB 5F4NA 2WPAA 4UMRA 4V0GA 4NK9A 3OFMA 3PIYA 3GCPA 3E93A 3HNGA 3RBWA 3R8VA 3VQHA 4AA4A 4DEBA 1Q24A 2JIIA 2HY0A 3KCFA 3N4UA 4DT9A 3LLTA 3GFWA 1OUKA 3KXMA 1KOBA 2OIDA 3RZFA 4FL2A 4GYIA 5JK3A 5E4HA 3AC2A 4M68A 5CYIA 1RDQE 4FV2A 2HIWA 3CQWA 3MFTA 5GZ9A 3DZQA 4F6WA 3SGCA 3U54A 4AW2A 3DDQA 4FMQA 3MIAA 3MY5A 3UJGA 1G8SA 1UVRA 4BCIA 5F1ZA 1W2FA 2GNIA 5M4CA 2XJ0A 1SMHA 4FEQA 4OT6A 4CKJA 1WBPA 1PXMA 4ASXA 4DF3A 2OO8X 2BDWA 3D2IA 4XLVA 3U6IA 4WUAA 3SLSA 4TWPA 2WQNA 4DE4A 4JNWA 4QP7A 1M14A 2ITPA 5D9HA 4MTAA 4RC2A 4W8EA 3QQGA 2BAQA 4F7JA 5AX9A 3P7AA 3R2YA 2ZDTA 2J51A 3CJFA 1IA9A 2OJGA 3QTWA 3F6XA 4GT5A 5D10A 5EYCA 4D2TA 2ZV2A 5JEBA 2XK3A 4EHGA 2WXVA 4JVGA 4GG5A 3W2CA 4HVIA 4O7YA 2P4IA 4YBJA 2PMOX 4KKEA 4EOJA 4GIHA 1WVWA 2WIHA 2V62A 4DH8A 4DFXE 4ITIA 3AGLA 3CY2A 3FZOA 5EFQA 2VO7A 3NZ0A 4TNDA 5D7AA 2WTIA 3VS2A 2XKEA 1NVRA 3EQDA 1M2QA 3VULA 1Q99A 5E91A 4ZSAA 3NIEA 5F9EA 5JQ8A 3R63A 2X6EA 4K11A 2PPQA 4HVHA 5CF4A 3UVRA 1JKSA 1CKJA 2YN8A 3PXRA 5FXRA 3W0NA 3HKOA 2PSQA 4R77A 2HW6A 1HCLA 1WBWA 2EB3A 2P2IA 4PMSA 4EKLA 2G1TA 5A6NA 3KXNA 4QMZA 1H00A 3I6UA 3FMEA 4G3CA 2F57A 4CZYB 2CKPA 4M3QA 5F95A 2DQ7X 1SVHA 5CSHA 2CLXA 3BE2A 4JR3A 2H6DA 2G01A 3BHYA 5HI2A 3TZ9A 4BDBA 2G2IA 2XBAA 4RC3A 4JIKA 2XB7A 5A4LA 4LI5A 2ERZE 2UZUE 4RIOA 2PTKA 3LLAA 4APCA 5J9LA 1UU9A 3DS6A 2C3LA 2OK1A 3I4BA 3IW7A 4FNXA 3QD3A 4USDA 1V0BA 5BVWA 3NCZA 4JDJA 1B38A 2NRUA 4JL9A 5AR7A 4ZTQA 5BYZA 3M2WA 4TYHA 2QD9A 4YZDA 3UBDA 5I0BA 4KABA 3CQEA 4A4OA 3A8WA 4G9RA 2YAAA 1A06A 3MPAA 4TYEA 5GJGA 1P4FA 5CF6A 3DJ5A 4O38A 4QO9A 1PYXA 3VWAA 4MXXA 2BRMA 4LGHA 3G33A 4E6QA 3ODYX 2OXDA 3LCSA 5HE3A 4FSNA 4NIFB 5AR2A 4ALWA 2AEGA 2XARA 3EJ1A 1YWRA 4GS6A 3LJ0A 2JDSA 3CD8A 2R0IA 2V55A 4IWQA 4FG8A 4A4XA 4OTWA 4PP7A 4JT3A 4RX7A 4S32A 4YJUA 1UKIA 5FBNC 3ZO1A 4DGOA 5DVRA 5BYLA 5E8ZA 2C3KA 4OBOA 2CJMA 3VNTA 3UOLA 2IEWA 4AT5A 2X6DA 3TZMA 3TMOA 4EH7A 4F6SA 4ZSJA 3W0RA 3DY7A 2ONLA 3FZTA 3QCSA 4FIIA 4YBKA 3QLFA 3VBYA 2CMWA 3ZEWA 4EH5A 3DXQA 1KE8A 1JSTA 3ZO2A 3FZRA 2UZBA 1Q41A 3SHEA 1NXKA 3AD5A 2OICA 1SNXA 4KSPA 4OT5A 2IG7A 3GCVA 4OLIA 4EH3A 3TWJA 5A9UA 3U55A 5L2WA 3QRJA 3MFRA 4ID7A 4W8DA 3F61A 2ITWA 4ZY4A 5HD4A 4TY1A 3QUEA 3KA0A 2VAGA 3E3BX 4J53A 3QKLA 5T6KA 4AOJA 1SYKA 5KCVA 4AXEA 5T3QA 4QNYA 1W98A 2BAKA 2GNFA 3E8NA 4PPCA 3SA0A 3QTQA 3D5XA 3ANRA 2QOFA 5DWRA 4AN3A 4DGNA 4ORKA 3R1YA 1K9AA 1CKPA 5CXHA 4D58A 3HGKA 4UWCA 5J8IA 2H8HA 4JX3A 3TN8A 3LFEA 1Q4LA 3VS7A 3HMIA 3JVSA 2H96A 4PNKA 2C5NA 1Y6AA 3KN6A 5DA3A 3DCVA 4RX9A 3UNJA 4EORA 3KEXA 3KQ7A 4YPSA 2X2LA 4RT7A 4XS2A 5KMJA 2J5FA 4KKHA 4JXFA 1BLXA 2OFUA 3OBJA 4BDGA 1KV2A 5AM7A 4BIBA 5JGAA 4BN1A 4UMUA 2GS7A 2BCJA 5EDQA 4F64A 1PY5A 4CT1A 3W33A 1FMKA 3K2LA 4Q9SA 1WAKA 4FSWA 1O6YA 3TJCA 1OGYA 2DWBA 3WE4A 2AC5A 2XNGA 3PXYA 4EOKA 2ZV9A 3NMUF 3HZTA 2VWYA 3PY3A 3RAHA 3ENMA 2PVLA 3PRFA 3O8UA 3QYZA 5FD2A 4UX9A 4QQ5A 2XK9A 2PWLA 4J8MA 3AMBA 3RP9A 5IA3A 3MVLA 2EWAA 4DHZA 2WMBA 4C4JA 4Y5HA 3FLWA 4LGDA 4L7FA 3UNZA 4ACCA 5M53A 2UZNA 4FTKA 4O0YA 3I79A 4W9XA 3CTQA 3VBVA 5AMNA 5J7BA 3MPTA 2VWXA 3QRUA 1FOTA 4AZVA 4J7BA 3BZ3A 5CI7A 2XUUA 3UO5A 1K2PA 3MESA 1PXJA 3W0OA 2E9PA 1NA7A 4BCHA 3REPA 1GZOA 4B6LA 3OZ6A 1YHSA 2X8EA 3F5UA 4M0YA 4ZMEA 3W2PA 4Z16A 4RVTA 5AIKA 3MWUA 3DV3A 5JFWA 2R3HA 2R4BA 4CNHA 4ZZMA 2EXEA 1YDSE 3EL8A 2A98A 3NNWA 3OWKA 1ZRZA 5E92A 2DUVA 4V04A 3GXLA 3R9OA 4P2KA 2BRGA 3SXFA 4CKIA 4HW7A 1UA2A 4AW0A 4IDVA 3UO4A 4O7NA 2X9EA 3O2MA 4MBIA 3NW6A 1KE7A 3PLAE 4A9RA 3D5UA 5K3YA 5EM7A 5EYDA 4OAUC 5KE0A 3DKOA 3F3VA 3RGFA 4J98A 4I24A 5ACKA 1J7IA 2PHKA 4D9UA 3FQEA 3QLGA 3VUTA 4B8MA 4CLIA 3RPOA 3PSCA 1Y8GA 3W2SA 4IFGA 2CGXA 3KULB 2I6LA 2XJ1A 4IZYA 4JS8A 4M84A 5CY3A 4ACMA 4E4NA 4QQTA 4XUFA 4BIEA 3NCGA 2B9IA 1YKRA 4O2ZA 2XEZA 3L9MA 5KMMA 5GINE 3F3UA 3SG9A 3OT8A 1CSNA 1L8TA 4D4RA 1JKLA 2Y6OA 4L3LA 4RGJA 4QNAA 4DFYA 4WRGA 2GNJA 4EQUA 5A54A 2JGZA 5FTQA 5JGDA 4H3QA 5I9WA 1SVEA 3NVMB 2EXMA 3ZC6A 3W2RA 3O17A 2XM8A 4WG4A 4TKSA 4GG7A 4FTTA 2WMQA 4YHJA 3UIUA 2X2MA 2QODA 3GGFA 5E9EA 1YI4A 4IIRA 3PWYA 2A0CX 5CTPA 2XAMA 4YO6A 3AC4A 3R1SA 2JKKA 1SNUA 4BICA 4MUQA 1NY3A 4KBCA 4DH1A 3FKOA 1R3CA 1OB3A 3C0HA 4RJ3A 4WD5A 4EONA 3UVQA 5AP6A 4GFOA 3T3VA 1JLUE 2QU5A 5AP1A 1W2DA 1U54A 3GUBA 5CX9A 5IH4A 4DAWA 1YI3A 3UTOA 3KXZA 3SKCA 4LYNA 4BWKA 2BZIB 5L6PA 4DHIB 3OTUA 3WBLA 4YJVA 3CY3A 3SRVB 1FBNA 3CCNA 3NAYA 4Q2AA 2O2UA 2YJSA 3C4EA 3G0EA 4JAJA 2XKCA 3I5NA 2CGVA 4C36A 4BWPA 1R78A 5JZJA 5HO8A 2QKRA 3KMUA 4C59A 5CEOA 5JFSA 2BALA 4ZZOA 3QX2A 5GZAA 5FTGA 4D2SA 4UXQA 2X9FA 3TZ8A 2J4ZA 3F3WA 3L1SA 4HYHA 4PL4A 5K0KA 4HGSA 1G8KA 2QONA 3NDMA 2C4GA 2CN5A 4BDCA 4O7WA 5EHLA 4BI0A 4ZS4A 3CTJA 3B8QA 4QRCA 2OJ9A 3F88A 3HYHA 3PRIA 4MQ1A 5EDPA 4USEA 4DLIA 2G9XA 1OIQA 1IG1A 4U3ZA 4U7ZA 4I4EA 3TV6A 4NM7A 3ZH8A 1XMLA 3D4QA 3NUUA 2UW8A 5JRQA 4FKLA 4XV1A 3TM0A 4ZLYA 2BFXA 4C38A 5K4JA 2RL5A 4BKJA 3HUCA 4NKSA 5JFXA 2VTQA 5I3RA 3R8ZA 3CSVA 1XHAA 4FR4A 3UOHA 2NP8A 1VYWA 3RALA 5F94A 4QMMA 3UVPA 2F7EE 2J5EA 2YIXA 4GJ2A 2CGUA 3OHTA 4CCUA 3TL8A 5C01A 4L53A 3BV3A 4F0GA 3AT2A 4U42A 5J95A 4KUJA 5KO1A 2HZIA 2E9OA 2UZEA 4CT2A 4EH6A 4DH5A 4MWHA 3FSKA 3LM5A 5HBJA 4FIGA 3UIMA 3SX9A 4RBLA 2IVUA 4Z7HA 2GSFA 5HE2A 3RZBA 3VUIA 4RSSA 3HMPA 2V7AA 2Z2WA 5EW8A 3VJOA 4G3DA 4HVGA 3EYGA 4MX9A 4EK6A 3AKLA 5M09A 4II5A 2PVNA 3V5LA 3CBLA 2Y0AA 3GU8A 5BVFA 4TTHB 2WMUA 4AA5A 3E8EA 3FLYA 4R7IA 2XK4A 4OW8A 2YM7A 3FYKX 3MBLA 1OL2A 1R39A 4O0RA 3R7UA 4C62A 4J96A 3NYXA 4HYSA 5FLFA 5DLSA 3F7WA 2W1DA 2X8DA 3G51A 3UOJA 3CPBA 3QC9A 2HZ4A 3PPJA 3OF0A 5K0XA 3PSBA 4OR5A 4BDDA 1WVYA 5JFVA 5I5ZA 2QOHA 4ITHA 4BCOA 4DG3E 3DAJA 2JIVA 2BVAA 4FV3A 5L6WL 3BRBA 4CRSA 2PUUA 3ORIA 4DN5A 5HO6A 2WHBA 4DCEA 4EOQA 5HCYA 2VTNA 1REKA 3OP5A 4FTOA 3RKBA 4AF3A 4EK8A 3IQ7A 3DK7A 3NS9A 5CENA 3HMMA 1UNHA 1ERKA 3FY0A 1OPJA 4BCGA 5JZNA 1GAGA 4UEUA 4C61A 4O7RA 4Q9ZA 2B55A 4HCTA 3F2RA 2OJJA 5LJJA 4JG6A 3P7BA 1YOMA 3QAME 4AXDA 3IPHA 4BJJA 4L45A 3BELA 4M97A 1PXOA 4RWKA 2XIZA 3DB6A 4CTBA 1Q3WA 4LMUA 1MP8A 1YQJA 5GJDA 4IADA 3CKWA 2GFCA 2WZJA 3TJDA 3FXXA 3E8DA 4EZ5A 4H1JA 4MYGA 4AS0A 2R3KA 3FKNA 5TT7A 3ML1A 2ITQA 2R7IA 3UZRA 2CGWA 3DK3A 3QTUA 4XG2A 4LM5A 4YLKA 4IVCA 4B0GA 4Z3VA 1PXLA 4H3BA 5I9XA 2PULA 5C8NA 5ANJA 4C2WA 4C3RA 4MCVA 4O22A 2WELA 3DNEA 3HL7A 4H58A 3SD0A 5HG8A 2X0GA 2IO6A 4G16A 1YXUA 1TZDA 4A9SA 3QTZA 3TUCA 4O82A 1WMKA 3EMGA 3LXPA 4P4CA 4FT0A 2GU8A 4PDPA 1W82A 3OTVA 4F4PA 5GIOE 4E6CA 4F7SA 5DHJA 4ZEGA 3OY1A 3OY3A 3HLLA 3KRLA 3NSZA 1JOWB 4X3FB 3ULZA 4CV8A 1NW1A 1J91A 3A7GA 3DJ7A 2VWZA 4QMVA 1SZMA 3Q6UA 4FTNA 3QWJA 4AZTA 5CF5A 2Y6MA 4MBJA 2GNHA 4YZMA 5AUYA 2REIA 5HNBA 5K4IA 4F9CA 4LRJA 1OECA 4FKSA 3KVWA 5K5NA 2R3QA 5CVGA 2W9FB 3HRFA 4QOXA 5GZ8A 2ACXA 3W55A 4BI1A 4K9YA 5ANOA 4CFVA 5BVOA 3AG9A 2J7TA 4PMTA 2B52A 4MXZA 4ZTLA 5KNJA 3PPZA 2P2HA 2RG6A 5HIEA 2C6MA 4TYGA 2C6OA 4HYUA 3R9HA 4AWIA 2C0OA 3FI3A 4YPDA 3BWFA 4NJ3A 3VF8A 4F09A 3BU6A 4WRSA 3RWQA 5HLNA 2C5OA 4CMTA 2BKKA 4F65A 2YDKA 3FEGA 3ZHPC 3EKNA 3M42A 4L01A 4FV4A 4OTHA 3PY1A 5C9CA 1H08A 3LQ5A 3WF9A 4O81A 2Z60A 3GQIA 2GPHA 4LG4A 4G5JA 4AA0A 5LMKA 4O0VA 5T68A 4TN6A 4DEGA 2C5YA 2HZ0A 3MYGA 4CV9A 4DEAA 3R01A 4YLJA 5AM6A 4BWXA 3RM6A 2F7XE 4YUQA 1CMKE 4FL1A 3RINA 4EQCA 5KBRA 4PQNA 2W4OA 1J7UA 4U44A 3CE3A 2HCKA 2JAVA 4IDTA 2WMSA 4E6DA 2ITUA 2VWWA 2H9VA 2X39A 1LEZA 3I60A 4W4XA 2V22A 1NT2A 3DGKA 3VRYA 4YTCA 4FSZA 1QPCA 1WFCA 3Q3BA 2XRUA 4LV5A 5D12A 4HJOA 1CKIA 5AP3A 4R78A 3R21A 3UMWA 3RM7A 3WYYA 4TYIA 2CLQA 2OIQA 4WNPA 2VNWA 4WT6A 5DN3A 2UZDA 4G3EA 1PYEA 3FPQA 3HAMA 1J1CA 2VWVA 3EHAA 2WD1A 3P4KA 3GC9A 3TZ7A 3A4PA 3ZUUA 5IQHA 3UP7A 4F0FA 2PVJA 4NEUA 1JKKA 4GRBA 1ZYDA 5CWZA 4O7LA 3OEZA 3PPKA 2GNGA 3S95A 2ZFYA 3MH1A 4HGLA 2QHMA 4E20A 2XH5A 3QKKA 3ORKA 2I0VA 4FV6A 2OKRA 2PE0A 5CSWA 2WGJA 3U9NA 2IPXA 4G6LA 3L8SA 1QL6A 1H28A 2XRWA 2FSTX 2VO3A 5AP5A 3ALOA 3CGOA 5DFPA 1KE6A 1ZZ2A 4BVUA 4AXAA 2YCQA 3HECA 4MBLA 3OUKA 1XO2B 4HCVA 1I44A 5H3QA 5H8GA 1R0EA 3OBGA 4OBPA 3U6HA 3MB6A 3MH2A 3QXPA 4KKGA 4QQJA 4DTKA 5IMEA 4I4FA 4U3YA 5I4NA 4O86A 4JRVA 1E9HA 2DYLA 2O0UA 4U8ZA 5KZIA 4DDGA 4ZIMA 4C58A 2HXQA 3FMMA 5AAEA 5J5SA 3RTPA 5EI6A 5FEEA 4AOTA 2WQMA 5EM5A 3AT4A 3MFSA 3BYMA 3E3PA 4GK2A 4CD0A 4OAVB 3NAXA 5CVHA 2ONLC 3DPKA 3EQCA 5TOZA 5HOAA 1KV1A 2PVRA 4WNMA 2B9JA 3Q4UA 1ZY4A 5CANA 3OG7A 3P7CA 3E7VA 4I41A 1V1KA 3Q4CA 4DFZE 3QQUA 1GIHA 2HXLA 2R3LA 4RG0A 3NNXA 4WO5A 4JDIA 5DRDA 3Q9ZA 5CAUA 4UMPA 4PF4A 5M51A 3R9RA 3QBNA 3BYSA 2ZB0A 2O64A 3WIKA 3Q5IA 5JQ5A 2JKOA 4FYNA 1APME 3ZRMA 4KBKA 1XH7A 5LQFA 4Q5HA 3W2QA 4BCJA 4YLLA 3C5UA 5IQEA 4YR8A 3WZUA 2O63A 2NNWB 1XH6A 4RJ6A 4JG7A 4E73A 2VTRA 1U5RA 2OGVA 4OTDA 5C8KA 5CVFA 3NUAA 2YHVA 3ZLYA 4IAYA 5FM3A 3QWKA 3SOCA 5ANKA 4O6LA 5HG9A 3F2AA 3KF7A 4NCTA 4DDIA 1M52A 2H34A 1YXTA 2VTTA 4NL0A 4WUNA 5LVPA 4GEOA 3DBDA 3IK3A 3OXZA 4BHZA 4E5BA 3UQFA 1OIUA 4X3FC 3R7YA 2CCIA 4X3JA 4NZWB 4QYGA 4FKVA 2UV2A 4D55A 3S1HA 3W0MA 2JDTA 2JFMA 3FKLA 1OBDA 3MTFA 1M2RA 3PVBA 4FV0A 1P2AA 3DAEA 3QTRA 4O83A 3EZRA 4FEUA 4M66A 2FSLX 4GW8A 3Q2MA 4QMQA 4MHAA 2NPQA 3Q04A 3G9NA 4GT3A 1W83A 4BKYA 5IH5A 3PZHA 4FTLA 4U0IA 2RFDA 4MAOA 4F6UA 2YLEA 1V0PA 1VLRA 3FLSA 4ZXTA 4CGAA 4LDTA 2VTHA 2WMVA 3IKAA 1KE9A 3D5WA 2W7XA 5A4QA 5CAOA 4JRNA 2PZRA 4RC4A 3EFLA 4OGRA 4IX3A 4IH8A 4MD9E 4XMOA 1YXXA 2ZYBA 4XP0A 5C27A 3U4WA 3KXHA 1H8FA 3KMWA 3EL7A 5D11A 5HO7A 3W0SA 3C4WA 1JSVA 4FNZA 5E8UA 3ZSIA 5J87A 1G5SA 5KMOA 3DKFA 4JQ7A 4PDYA 4W4YA 1XBAA 2LGCA 1OITA 5CNOA 2UW3A 3BHHA 2VGOA 3E8CA 3ZM4A 2XP2A 1V0OA 3ZO4A 2KTYA 2J6MA 2BMCA 3R7IA 2X8IA 5IG1A 5HTBA 5CNNA 4EZ3A 5HU9A 3ID6C 5A3XA 1HOWA 4QP8A 2UW7A 2KULA 4GT4A 4QP1A 4RMZA 2X2KA 4PPBA 1ZLTA 3ZZWA 3SRVA 3L8PA 1F3MC 4RIYA 4ANSA 4BI2A 4XRJA 1PHKA 4I23A 4D0WA 4ZSGA 3MH0A 3MN3A 3ALNA 3UC3A 4DA5A 1JKTA 4JBVA 2BILB 5ETFA 1K3AA 1LEWA 3F2NA 4ACDA 5LWNA 4X7QA 5EQEA 1QPDA 2WTKC 5HE1A 1Y6BA 4EUTA 4YJPA 4AT4A 5BVKA 4DEIA 3V6SA 3BPRA 3KY2A 3DFCB 4YSMA 5EYKA 3NYOA 1YHWA 2B9FA 1XWSA 3D2KA 3M11A 3M1SA 2RFSA 3PZEA 4FIHA 5EG3A 3UPZA 2JEDA 5E1SA 4FOCA 2C69A 4NW5A 1XR1A 1PKGA 5B2LA 5HLPA 1PRYA 4R5SA 2X7GA 4R5YA 4FGRA 4R7BA 4EBVA 2CNUA 3O5AA 4DHJA 3QQKA 4IXPA 4CG8A 3EOCA 1Q3DA 1IR3A 2IW6A 1KE5A 1YOLA 2X1NA 3LMGA 2YZLA 2P3GX 2R3PA 4E1ZA 3VW8A 3OCSA 3ZDUA 1G3NA 3ZOSA 4FEVA 4ZOGA 4EOMA 3KB7A 3WF8A 5IQBA 4ANLA