4CCUA

Structure of the human anaplastic lymphoma kinase in complex with 2-(5-(6-amino-5-((r)-1-(5-fluoro-2-(2h-1,2,3-triazol-2-yl)phenyl)ethoxy) pyridin-3-yl)-4-methylthiazol-2-yl)propan-2-ol
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
309
structure length
292
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGEVYEGQVPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title The Design of Potent and Selective Inhibitors to Overcome Clinical Alk Mutations Resistant to Crizotinib.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 292
sequence length 309
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ccuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ccuA01
2UV2A 3B2WA 2WHBA 2W1GA 2BRHA 1YXVA 3QKKA 5LVLA 4P90A 4V0GA 3SW4A 2IZSA 3QHRA 3G33A 4IZ5A 3WZKA 3A62A 4YJRA 5AP5A 2J0IA 4W4XA 4CCBA 1F3MC 3Q9WA 3R8MA 2WQMA 4QTAA 3A7HA 4G5JA 3ZFYA 3W8LA 4FNYA 2CDZA 1Q8ZA 3E7VA 3UGCA 4DG0E 5ANKA 4L3JA 3R7UA 2OSCA 3RINA 2JAVA 5IMEA 5DN3A 3TCPA 3U54A 5HNGA 3VQHA 2PE2A 2PMIA 3VHKA 1YI4A 3NVMB 5K3YA 4L53A 2OJJA 5KHXA 3F2AA 3T9TA 3Q6WA 4JBVA 4U6RA 2E9OA 2VRXA 2EXEA 3CD8A 3ORXA 3FKLA 4FSNA 4C4EA 2X8DA 3BE9A 2IZTA 4NWMA 2WMWA 2VD5A 4DHFA 2PVLA 3FV8A 4FTAA 3IDPA 4NTTA 4A07A 3BHVA 5JFXA 4FVRA 4UWYA 2Q83A 2YA9A 2ACXA 2HZIA 3TJDA 2ZMCA 3WYXA 1U54A 3TZ7A 3OWKA 4D58A 3ZO1A 5ITAA 3PXQA 4JS8A 3JVRA 5I5ZA 3EQIA 3OMVA 4YTCA 4CQEA 1K9AA 1MP8A 4NUSA 4R5YA 1U4DA 2QOOA 4Z7HA 2WQOA 4XP2A 4O38A 3TACA 2HY81 4G9RA 4U44A 4U3ZA 3MH0A 4CD0A 3MFUA 3OW3A 4Y5HA 2QLQA 3I5NA 4D1ZA 4FV5A 4DEIA 4CFVA 4U45A 2GNHA 2UW0A 5E8ZA 5CT0A 4PMPA 3KXNA 4N4SA 3ORLA 2I0YA 5HTCA 2PE0A 2X7GA 3KRXA 4BDGA 3DY7A 4LV5A 1KUTA 3AC1A 2AC5A 2VV9A 3PA5A 3DBEA 3OCSA 1O6LA 3ZZWA 1KWPA 3DU8A 4QP8A 4TTHB 3SGCA 3ZM4A 3F7WA 4OT6A 2BZIB 5AIRA 5HX6A 3P7AA 4QPMA 3O23A 4RLKA 3LZBA 3F82A 3F6XA 3PZEA 4IX6A 4JNWA 2GS7A 2GQGA 4ZSEA 5E4HA 3CQWA 3V04A 1H27A 3HP2A 1W83A 3KXXA 1OVEA 2GQRA 3W2OA 4CKIA 1IEPA 3FAAA 4KKEA 4XOYA 1OBGA 2QKWB 3MB6A 3CD3A 4H3PA 2O3PA 3K3IA 4L01A 4WNMA 3OW4A 4S30A 1TQMA 1DAYA 4FICA 5L2TA 4MH7A 1YDSE 5FDPA 3DB8A 5KHWA 2JAMA 4WHZA 3FMKA 3DB6A 4PDYA 3FL4A 4ALWA 2EXMA 1QPCA 4Q9ZA 4YJSA 4PDPA 3SOCA 2WQEA 3ANQA 1WVYA 3DTCA 3MVJA 4QP6A 2WQBA 2Z7SA 2QOHA 5JK3A 2OGVA 3R0TA 2ZV9A 4YGAA 2CHLA 5J8IA 5AR3A 5HIEA 3CS9A 5CLPA 2P55A 4EZ5A 2EUFB 5LVNA 2GS6A 2OFVA 3FMDA 4M84A 4PMSA 2GDOA 3KN6A 4XCUA 3ZC5A 3QUDA 1UU8A 5L6OA 5AR7A 2OBJA 4E7WA 1GIIA 2RFSA 3UIBA 4CG8A 4HZRA 3RPYA 5FRIA 2WEVA 4K77A 3FLYA 3WE8A 5E8VA 5H9BA 2PVNA 4EH4A 4Q5HA 4WOVA 1AD5A 3UE4A 4EZ3A 3ZMMA 4B7TA 2C0OA 3SRVA 2BMCA 2FO0A 2QC6A 3D15A 4BDJA 5DRBA 3QU0A 4EOKA 3VJOA 4BGGA 2V62A 3EKNA 1FVRA 5K0KA 5E92A 4BCPA 2DUVA 3KKVA 1GIJA 4BBFA 5ANGA 5JGAA 1OL6A 4O0YA 1NVQA 4RVKA 4NFMA 3PXKA 4DFNA 3EFLA 2JLDA 4GKIA 2JBPA 5HICA 2YISA 3NCZA 4D0WA 3NUXA 5AMNA 4QQCA 5CI6A 3EQGA 5HHWA 4C61A 4XHKB 5EKNA 5F9EA 5LOHA 3LVPA 1WFCA 2OJFE 3FYKX 1IAJA 3QQKA 3A8WA 2OZAA 3PSBA 3DKCA 4QP9A 4FGRA 4QD6A 2RSVA 2BKZA 5BVNA 4R78A 3F61A 3R21A 2R7IA 4FV2A 3DLZA 3AG9A 5KNJA 1YDRE 4BCMA 4JAIA 5JFVA 3IDCA 3R8PA 5LVMA 4MWIA 2IZRA 3PXZA 3POOA 4WT6A 4ZZNA 2VWXA 5ACKA 5EHLA 3KXGA 3AC4A 4O7TA 3CKWA 3SHEA 4EORA 4FTKA 4F70A 4F7JA 2BROA 4C4FA 1H8FA 3GC9A 4C4JA 3RAIA 1W0XC 4QMTA 3IW8A 2ZDUA 2EXCX 1H1RA 4NU1A 4YZDA 5FTOA 1ZYCA 5I3OA 4C02A 4EK6A 4G6OA 4FV6A 5HE0A 5DE2A 3CBLA 3SAYA 4I94A 3Q9YA 4LL5A 4QMWA 2E2BA 4FSQA 4RC3A 5J95A 2CPKE 5AFVA 3JVSA 2P3GX 4BCIA 4RGJA 5KKRB 5IQHA 2V5QA 1YRPA 1KE9A 3DV3A 3OHTA 5GIOE 5ANJA 3EFWA 3G2FA 5CAPA 5IA2A 4PTGA 3DGKA 2NRYA 2YM7A 4DYMA 1M52A 2YIWA 3TV6A 3VO3A 4DGMA 4RVTA 4RWLA 4XG9A 4DG3E 2C5VA 2YWPA 2JKOA 2VNYA 4FT3A 3IG7A 4AW0A 4EH6A 3QTWA 3K3JA 3V5QA 3E62A 2VAGA 2YM3A 4TYEA 3DBDA 3WZDA 3KU2A 3NNXA 5C4LA 2BDWA 1OL5A 1Q8WA 5BYYA 3O8TA 4L52A 3VRYA 2XNOA 1XO2B 5CU6A 1OPKA 4PPCA 4V05A 3SRVB 3R7GA 5LQFA 1PXLA 3UO5A 3F3VA 5CU0A 2YABA 2B1PA 3LFDA 3IECA 5KMKA 2QOCA 3P1AA 1T45A 2QOBA 2ERKA 4G1WA 3LAUA 3RPOA 5TR6A 3AC3A 1PYXA 5HOAA 3F88A 4YUQA 2J5FA 4AGCA 2W4KA 5HG7A 4U43A 2YAAA 3QALE 4N6YA 4YC3A 5HCZA 4LRMA 1Z5MA 4NW5A 3IS5A 4ZSGA 3U6JA 2XK4A 2X8IA 4D9UA 4LYNA 5L2IA 4XG7A 4L8MA 3RPSA 4YHJA 4UN0C 4C35A 2O65A 3GC8A 4FTUA 2WGJA 5A14A 1LEWA 4KSPA 4QMUA 3KVXA 4IHPA 1XHAA 2ZMDA 3PIXA 5F4NA 1J1BA 4FGBA 5HVYA 1U46A 5EW3A 2ITOA 4NT4A 4QMPA 4OBOA 1YOMA 4D2RA 2WKMA 4OTFA 4I3ZA 3VN9A 2XRWA 3IK3A 2HW7A 4E6AA 5CF8A 2OFUA 4RX8A 3BBWA 5IEVA 1K3AA 3ZLYA 3ELJA 2VNWA 1ZMUA 3UNKA 3UIXA 4ORKA 5AP4A 3V5TA 4J8NA 2GNFA 3ZEPA 4R1YA 3CTQA 4IC8A 4G31A 5IMXA 4YJOA 2UZWE 4BHZA 3FKNA 5AV0A 4EJNA 1FBNA 1GNGA 2R3JA 3BI6A 3N4UA 2WD1A 2ZB1A 3T9IA 3P7BA 3AOXA 3RPRA 4DAWA 2UVYA 4JDHA 3SKCA 1J7UA 1Q24A 5IA5A 3IW4A 4FYNA 5CEPA 3VBWA 2WMTA 4TRLA 3COKA 3KC3A 3RALA 3N4VA 3BU5A 4BDEA 4BN1A 5A46A 1BI7A 1F0QA 4D4VA 4U81A 3PJ1A 2BAJA 2YEXA 3FLSA 3OFMA 5FEEA 3IQ7A 4OUCA 3R7VA 3C0IA 4ASEA 2B54A 3QKLA 3U9CA 3HGKA 4FL1A 3NEWA 5EM5A 2XMYA 4P7EA 3R9OA 3QWJA 3RMFA 4HPUE 2XJ0A 1OIYA 1P5EA 3MN3A 5KCVA 3AC5A 1NXKA 2W7XA 2F7ZE 5I9VA 2XKEA 4F9YA 4ZJVA 5HVKA 2PU8A 3FMMA 5E8TA 1PYEA 3ANRA 5IKWA 4GU6A 4DFBA 2PUIA 5JRSA 2WMVA 4FKWA 4LGDA 2C0IA 3G0EA 3BU6A 5M4CA 2PZ5A 5DR9A 3R9HA 2YDKA 3KN5A 5FBNC 4WNOA 3O8UA 2C4GA 1B39A 4GJ3A 4ZOGA 5EM8A 3ATTA 4IB3A 2GHMA 3LCKA 3VIDA 4O86A 1OIRA 3P78A 5JH6A 4TWNA 2OKRA 4PMTA 1BMKA 3NLBA 3DNEA 1BL6A 5BVKA 3P08A 5HLWA 4OR5A 5HLPA 2UW9A 4RC2A 3HRBA 3NZ0A 2XIXA 4MXCA 3NYNA 2JIVA 3C5UA 4BBMA 5AAEA 3FY0A 1VZOA 4GKHA 3NCGA 1XBCA 2WXVA 3M2WA 2XVDA 3PPJA 4IX5A 4E6DA 5M07A 3LXPA 3PDTA 2C3KA 3BRBA 4TNDA 5E91A 2XNBA 2EB2A 4NZWB 4XLVA 3H0ZA 1WBTA 2W1EA 2ZAZA 2W9FB 3G5DA 2DS1A 3NW7A 5JGDA 4I4EA 2UZDA 3BEAA 3B8QA 4BKYA 4EOLA 5KZIA 2QOIA 5KMOA 2IG7A 1Y91A 4HVGA 4KSQA 4BTJA 5DLSA 1UV5A 2VTIA 4G3GA 5HVJA 4AOIA 1TQPA 4D2TA 4O2ZA 4KA3A 4ID7A 3ZSGA 3U6IA 4RLLA 3LFFA 4AOTA 2BRBA 4YHFA 2Z8CA 3RVGA 3MIAA 4X21A 4C4HA 4QMYA 3UNZA 3BIZA 3S00A 3QRTA 3OY3A 4M3QA 3WYYA 2C0TA 3PE2A 4O7LA 4FKVA 4XMOA 3UZRA 1AQ1A 4YJVA 4ALUA 3QTUA 4NM5A 3GB2A 3ZYAA 1H00A 3EQDA 1OL7A 3A99A 2V7OA 2BZHB 2O63A 3PRFA 3BBTB 4PP7A 3ZLXA 3NUAA 1FINA 2XK6A 4DFYA 1OZ1A 4BYIA 5FQDC 5ETCA 1ZWSA 3ZDUA 3PIZA 1V1KA 5AUUA 1KE8A 3N4TA 1PXMA 3CJGA 5KBQA 3ODZX 2VTMA 2XCHA 4USEA 1WAKA 5D12A 4BYJA 2Z7RA 3FKOA 4IVCA 3SC1A 5AX3A 1Q62A 3I5ZA 4ITJA 3KK9A 5A6NA 2IVSA 5FWKK 3UMXA 4CZTA 4EHVA 4PF4A 4TXCA 5HU3A 2PE1A 1KOBA 4NCTC 4GIHA 4M68A 3ZS5A 4D2VA 3FSFA 5CTPA 4EI4A 1OBDA 3FI2A 3O8PA 3QCQA 3LMIA 2GNLA 3PVGA 2ZM3A 3Q4ZA 4FTLA 4DA5A 3WIGA 2YM8A 3DKGA 4F6UA 2BPMA 3M42A 1NY3A 4TYIA 1R0EA 4BDBA 3HLLA 4O6EA 3CC6A 3OEFX 3QD0A 4YLJA 1GZOA 4KRCA 4QP4A 3HA8A 5B7VA 1ZYSA 3OS3A 4GUBA 4EK8A 2ETRA 4ANLA 2CSNA 3Q6UA 4MXAA 4NM0A 4Y73A 3UPZA 4DTAA 2R3OA 1STCE 1TQIA 4W9WA 3ZC6A 1JPAA 3BQRA 2YIQA 4FOBA 4HVIA 3GXLA 2OICA 5E8UA 4UY9A 3UQCA 1DI8A 2ITWA 4BZNA 4CV8A 5K5NA 5IA4A 4IZ7A 3D83A 2VTTA 2Y8OA 3PVUA 4RIXA 3VF9A 4AT3A 4BDHA 3UZTA 3F2RA 4AT5A 1JSVA 5CEMA 1A48A 1PMEA 2HCKA 3LM5A 1ND4A 3LQ8A 3R71A 3S3IA 3ORIA 1Q5KA 3QCYA 4FKQA 4I6FA 4QTCA 2J7TA 4LFIA 5CU2A 3WF8A 4CKJA 2XNMA 2O8YA 4R7IA 3Q96A 4FV0A 3H10A 4G6LA 3FXZA 3D5UA 3FBVA 2PK9A 4USFA 2Y4PA 3GP0A 4G3CA 1QPDA 1IG1A 2KULA 4HYUA 2QLUA 3R9NA 2CNVA 2VO0A 2YWVA 3ZBXA 1CTPE 5JT2A 2O64A 5CI7A 5CZHA 4MTAA 2VGPA 3DK3A 5HX8A 1OM1A 5H3QA 4D4YA 4RT7A 4MXOA 4D2WA 3DQXA 2R7BA 3LFEA 3RBWA 3F5UA 2F57A 2OF4A 4QP7A 4FKLA 4D4SA 3DXQA 4O7SA 3UG1A 3EYGA 4G17A 2BRNA 3K54A 2FB8A 5TKDA 3II5A 4JI9A 4GS6A 1H07A 3TKHA 4MD7E 4DFUA 4AZEA 3C4CA 1BL7A 4GSBA 4EQCA 3SD0A 3GGFA 5HD4A 5F1ZA 4RA4A 5AP3A 5HESA 5HCYA 3VUKA 1G8SA 5E9EA 4BCHA 4E20A 3MFRA 2UVXA 4JBPA 3V8TA 4XP3A 3E7OA 3LFQA 4KIQA 4TZRA 4NSTA 4LRJA 4EH2A 2JEDA 3C51A 3QLFA 4FSZA 3RHKA 5L2SA 3NUNA 1SVEA 1L8TA 2HY0A 3VS0A 3FZPA 3ACJA 1VJYA 4ZS0A 3ZZEA 4FIJA 3CJFA 2YZAA 2OI4X 2QODA 2IZUA 4LV8A 4DE4A 2C6KA 3AMYA 3VS4A 2H96A 4A9UA 4FV8A 5KMIA 5AP0A 3ZUUA 4E4MA 1REKA 1MRVA 2XJ2A 1YHSA 4MF0A 4FC0A 5ANIA 5BMMA 1M2PA 2OJ9A 3EN4A 4USDA 4XV3A 3VUTA 4BWXA 2UZOA 2ZVAA 5IEXA 4KIKA 1R39A 4FUXA 3PSDA 2JD5A 4FKRA 2ERZE 4HVDA 4G3EA 5DIAA 4C57A 3G51A 3FMHA 5K5XA 2RFNA 1WZYA 2Z02A 3FEGA 3O7LB 2VTPA 4IFCA 4FOCA 3BU3A 5JRQA 3V51A 4J53A 5I9UA 1MQBA 4YJTA 2WELA 3WF5A 4ZLZA 1NT2A 4HCUA 3DJ5A 2C5YA 5EFQA 4J97A 3PP1A 5EM7A 2B53A 1PW2A 4R7BA 4RX7A 4BIEA 3HNGA 4BCGA 3FQEA 3B2TA 4RIXB 3SDJA 1BKXA 2I6LA 4F09A 3VUIA 5IZFA 3QQUA 2YACA 4X2JA 4EL9A 3NDMA 3K5VA 4WG5A 3Q60A 2QO2A 3NYXA 3UP7A 4A9SA 4FKJA 2B0QA 5CSWA 5D9HA 3FPQA 5EQPA 1FGKA 1W8CA 1RQQA 1OKYA 5CZIA 4O96A 4FKOA 5AP6A 3F5PA 5K4JA 3SLSA 2UZVA 4CNHA 5DR6A 2V7AA 2PMOX 4FK3A 3H30A 3UOHA 3I0OA 4H05A 3PWYA 2DQ7X 3OROA 4GEOA 1V0OA 2Y0AA 4ASDA 4CMOA 1ZOHA 2NP8A 5HG9A 1FOTA 4J7BA 4PP9A 4H1MA 4HVSA 3LPBA 4GK3A 4I23A 3ZO2A 3OEZA 5HKMA 3ZBFA 1R78A 3DTWA 2OH4A 3PWDA 4ZSLA 3M1SA 4EYJA 5AUYA 5IQDA 3TUBA 3LJ2A 5GHVA 4IH8A 2XH5A 4G16A 3PIYA 2VO6A 4L42A 3LM0A 1XJDA 4ZIMA 4CLJA 3EN6A 1EH4A 2RIOA 3FQSA 2QU5A 2X6EA 2YCFA 3DPKA 5DVRA 3NVKI 3QBNA 2A0CX 4ZZMA 4HGEA 3OBJA 5KMMA 3WIKA 3TT0A 3ORNA 4JG6A 2E9PA 4GG7A 5ANDA 2GS2A 4O0UA 2REIA 3CEKA 5CXHA 5D11A 4CSVA 1SMHA 2RF9A 2UVZA 4DH5A 4JRNA 4AOJA 5IUGA 1QPJA 3PY1A 5DT3A 4RJ8A 4KIKB 3QX4A 4PWNA 4D5HA 1YHVA 5CASA 4E1ZA 4MHAA 1ZAOA 2WU7A 3VVHA 3C9WA 3DZQA 3LCTA 4I4FA 3ZCLA 3QYZA 4I20A 4IDTA 5HZNA 1UNGA 1UNHA 1XH4A 3ENMA 2CN8A 2H6DA 4O0SA 4I92A 3C5IA 4YO6A 2WNTA 5AM7A 2GPHA 3UNJA 3ORKA 4DCEA 3PYYA 2WEIA 2OLCA 3C4WA 3ALNA 3CP9A 3OWLA 4O0TA 3TJCA 2ETMA 2WIHA 3V01A 4CYIA 4ZXTA 2EB3A 4PMMA 4PRJA 5E1EA 3ZFMA 4O82A 2GTNA 2VTAA 5CQUA 3E3PA 3OCTA 2C6EA 4IAIA 2A2AA 3IOPA 5DOSA 2IW8A 3IGGA 2OF2A 3P7CA 2VWUA 3MY5A 3TV7A 2UZLA 4PL4A 5K9IA 2FGIA 5EDPA 2EU9A 3LQ3A 1OIQA 4CRSA 1Y57A 4NEUA 5T6KA 4EC9A 1UKHA 4RMZA 3R1QA 1JAMA 3RHXA 3QCXA 4C3PA 4QYHA 2OJIA 1WBNA 1YXTA 4IJ9A 4WNKA 1Q97A 1WBPA 2W05A 4EOPA 5LXMA 2PL0A 1XBBA 3AMBA 4TNBA 5AV2A 2C30A 4X2KA 1UWJA 3L8VA 3E92A 4AGWA 1YWNA 3D7ZA 2HAKA 4X2GA 4PL5A 3IW6A 3T8OA 3D7TA 3IGOA 4QT1A 3ZEWA 2C6OA 4OBPA 2CJMA 5DH3A 3G0FA 3RNIA 3HAVA 1FMKA 3DDPA 3CPBA 3GQLA 3NAXA 2YDIA 3Q4UA 2QU6A 4KIOA 2VO7A 3PJ8A 4QMLA 5IA0A 4FK6A 3P79A 4DH1A 4LMNA 4M97A 2UZUE 1WVWA 4F64A 1BUHA 1FMOE 3AGMA 4XBUA 4Y95A 5FTGA 2QD9A 5G6VA 3VAPA 3FE3A 4FL3A 4BGHA 4CYJA 4DBXA 2B9FA 5AAFA 5FDXA 3FDNA 5FXRA 4KIPA 4LOPA 3HUCA 3OBGA 3L9PA 4WUAA 4DLIA 4IB0A 2GMXA 2G1TA 4KBCA 4M69A 2I0HA 3IKAA 1H0VA 4S34A 4WSQA 3TUDA 3SG9A 5M06A 3R30A 2XM8A 3HRFA 4IANA 5JFSA 3WZEA 5K4IA 3FC2A 3FWQA 4J95A 4HGSA 5AV1A 3UOLA 4OTRA 3Q9ZA 4L3LA 2XCKA 3RK9A 3CE3A 4F6SA 2FSMX 3PTGA 4MEDA 3ATSA 2WTKC 2J5EA 4GL9A 4GFGA 1Q8YA 3C13A 3L9MA 2R9SA 4JDKA 3D2IA 4U42A 3CY2A 4IX3A 4XP0A 5DNRA 5ICPA 5KKRC 3I1AA 4ZZOA 4XUFA 4ZMEA 3BKBA 4J71A 1OITA 4CFXA 4YPDA 4FNXA 2NNWB 5CU3A 2UUEA 4FT9A 2J50A 3HV6A 2BHHA 1FVTA 3HMIA 4FIFA 5CVGA 5FTQA 4IVDA 2NO3A 2J51A 4PDOA 3OWPA 5FP5A 2GNGA 2B55A 3KQ7A 3Q32A 2B7AA 3GU5A 3OG7A 2XRUA 4QTDA 3FHRA 4LL0A 1T46A 3NW6A 4X3FB 4Q5EA 1IR3A 2P33A 3NSZA 3EQRA 2IWIA 4ALVA 4EH3A 4CFNA 3G6GA 5CSXA 5BVDA 2PPQA 2ONLC 4ACGA 1RE8A 4GIIA 3VW8A 1ZOGA 2ONLA 3R73A 3D2KA 5E8XA 2BDJA 5AADA 3EOCA 3MPMA 2WPAA 4UMTA 4IWDA 4AW5A 4IZYA 4I5HA 5IUIA 1PKGA 3A7FA 3R9RA 4L3PA 2Y7JA 2XK3A 3UVQA 4MD8E 1TVOA 5HO6A 5A4CA 3QTQA 4BR3A 3D7TB 1JKSA 3GFEA 2OZOA 1H01A 4J98A 2IVVA 3FLWA 4EEVA 3DXPA 5AP1A 5C9CA 5LARA 5A4TA 1YXSA 3DBCA 2VGOA 4H1JA 2BIKB 4I5CA 2XIKA 2UW7A 2CN5A 1JOWB 3NR9A 4F7NA 2CCHA 5K0XA 3PVWA 3D5XA 3EN9A 4RJ6A 5E8YA 3QTIA 2XB7A 3QRKA 1IRKA 1WBOA 3OVVA 4TT7A 3H0YA 5EHOA 4RX5A 3JS2A 3CSVA 3QTZA 4M69B 3VBYA 3R7OA 5E7RA 4ACMA 3NX8A 4MXXA 3BX5A 1Y6BA 5AX9A 3SG8A 4EHGA 4MK0A 3W33A 3LXKA 4Y85A 4FV9A 4YBJA 4Z7GA 4FZ7A 1J3HA 1OKVA 2YERA 4OGRA 3VBTA 2FSTX 2KTYA 2YFXA 3V6RA 2W5HA 2WMSA 4I6BA 4AT4A 3UIMA 3Q2MA 1CDKA 3A4OX 3KCFA 4CCUA 4BFMA 1YOLA 3GCPA 2JGZA 1M7NA 3R00A 2VTRA 4GK2A 3TZMA 5I9XA 3C1XA 5FM3A 4ZY6A 3DQWA 3RCJA 2JKKA 5CQWA 3EL7A 3BHUA 3W1FA 3PVBA 4AZTA 5CAQA 4WRGA 4EH8A 5IF1A 5KO1A 1UKIA 1P4OA 3AQVA 4IX4A 5DI1A 3MWUA 5AR2A 5ETIA 3ZH8A 4DEDA 3L8SA 5CF4A 3F69A 4YR8A 2QKRA 2HWPA 4IFGA 3TG1A 2ETKA 3EFJA 2OH0E 4EC8A 4YTFA 4J52A 4BI0A 4O91A 3BYOA 2V55A 5LMBA 2HK5A 2VUWA 2XS0A 5D41A 5AUVA 3UJGA 1ZRZA 5AIKA 4LUEA 5JKGA 4L6QA 1KSWA 4ZTNA 4JDJA 2E9NA 3WF9A 4QPSA 4YLLA 5FEDA 2O0UA 4L00A 2PYWA 3K5UA 3LKMA 4DGOA 4A9RA 4IACA 5BVEA 3R01A 5EM6A 3B8RA 4C38A 3R7EA 4D55A 3UMWA 5BUIA 4O7VA 3EN7A 3OWJA 5EG3A 3UTOA 3MSSA 1V0PA 2CNUA 3IOKA 5HU9A 1H24A 3F3UA 4DT8A 5JMSA 1YWVA 3QZHA 1DAWA 4FMQA 4BDDA 4ZLOA 4F1OA 4HGTA 5M08A 5HEZA 3I79A 2Y6OA 3Q5IA 4CG9A 4WG3A 3CR0A 4TYHA 3M11A 4NM3A 4OTHA 1KV1A 3QD2B 2OJGA 5L6PA 2BKKA 3RAKA 5I3RA 4UYAA 3UO4A 2QO7A 4C3FA 3MTLA 4D9TA 5T3QA 4EH5A 3TM0A 4DTBA 1R1WA 1ZMVA 2X4ZA 1Q8UA 3O71A 1RW8A 5L2WA 3ERKA 5BMSA 4D5KA 2CKQA 3GU7A 3DDQA 4BDAA 3S95A 2WOTA 5KMNA 4EOQA 4HNFA 3LFBA 5D1JA 5HNIX 1LPUA 2X2KA 4AFEA 2PVJA 3A7GA 3LFAA 2C1AA 4O0XA 4BI2A 3OZ6A 4TWPA 2PTKA 4S31A 4YZMA 3ZO3A 1Q8TA 1OI9A 4R77A 2WMQA 1Q3WA 4GYIA 3WZJA 2WTCA 3NYOA 4PNIA 4XOZA 1JKTA 3PZHA 4H3QA 5LMKA 3KCKA 3O51A 4JG7A 5AM6A 4ZJJA 4A9TA 3VBQA 4BRXA 2UZTA 4DEAA 4ZTMA 5CAOA 3MGYA 1H08A 3UZPA 4ZY4A 3R2BA 2YM6A 3OT3A 3PPZA 4Z3VA 4ACHA 4FI1A 3SVVA 1O9UA 1PY5A 4II5A 2P4IA 4P5QA 4AU8A 1E1VA 3MA6A 3WILA 2BR1A 3EIDA 3WZUA 4I1ZA 5CS6A 3W18A 5EYKA 4KWPA 4GVAA 5HNBA 3FMEA 1H1PA 4C4IA 2WIPA 1YXXA 3OOGA 4BDKA 2A19B 5DG5A 1PXPA 4C36A 4E26A 3DAEA 2HZ0A 4FKGA 3VS3A 5M57A 1GY3A 1MRYA 2XEZA 4XLIA 4U9AA 4PX6A 2BTSA 4K9YA 3R8ZA 3S2PA 4XRJA 3TL8A 4CKRA 3NAYA 5L8LA 2O2UA 3NNUA 3DJ7A 2VO3A 2UW8A 2GSFA 3A8XA 4L45A 5I0BA 4JDIA 3QA8A 3PSCA 2YIXA 4XG6A 4WIHA 1QMZA 4YTHA 1SZMA 5J9ZA 4EHEA 3PXRA 2ITNA 4OBQA 4KUJA 4RPVA 1G3NA 2OWBA 2HWOA 5IU2A 3TUCA 2XKFA 3HL7A 4FTQA 3DAJA 2J0JA 3OY1A 4FZAB 3QLGA 1WMKA 5M09A 1M2QA 1BI8A 2C5XA 4TYHB 4HCTA 2H9VA 2WTDA 4IM2A 2JKMA 2WB8A 4FVPA 3EKKA 4WRSA 5HBEA 3VUHA 3NS9A 4MXZA 4FEWA 1M2RA 3MFSA 3R28A 4DG2E 2FH9A 3VS6A 5FUTA 5DPVA 2Z60A 4MBLA 4A4XA 2W4JA 3QRUA 5AP7A 3HKOA 3VBXA 4R3PA 4RIWA 2BUJA 5CWZA 4FEVA 4FBXA 5DT4A 2UZBA 4YO4A 2ZV7A 4O0RA 3LFNA 1U5RA 3ETAA 3I7CA 4FF8A 4IAYA 3MH1A 4GU9A 4DGLC 5LMAA 5FXQA 2VWZA 5AWMA 3GBZA 3RGFA 5IEYA 3E8CA 4M7IA 4XG3A 4IB1A 1WCCA 1H1SA 4DTKA 4RC4A 2WTIA 3VHEA 2VX0A 2BFXA 2R0UA 5CU4A 2FVDA 1UU7A 4FSYA 3R1NA 1Z9XA 3FZSA 3Q52A 5AUWA 4MYGA 4HW7A 3FC1X 4EZ7A 4C62A 3HP5A 4NTSA 1Y6AA 2W4OA 4PDSA 4IXPA 4DITA 4EOSA 3WARA 2PWLA 4ZS4A 2UZNA 4W4VA 5EI2A 3O2MA 5HG8A 3FI4A 2C6IA 3PP0A 4Z9LA 4TYJA 2PVMA 3UC4A 3TV4A 4ZEGA 1YI3A 5J5SA 4G6NA 1SYKA 1XQZA 4M0ZA 3NW5A 3WBLA 5A54A 5EYDA 4YNEA 4K11A 2XZSA 4CLIA 3VNTA 2ZB0A 5DMZA 1NA7A 4RG0A 3R7IA 4DINA 1Z57A 4BZDA 1XH6A 4EK5A 4IAAA 5BVOA 2BCJA 4CRLA 4GYGA 2X0GA 4M0YA 2C6DA 3LCOA 1JNKA 4QYGA 4F9BA 2B9IA 1G5SA 2W1HA 5E90A 4KNBA 3E3BX 3EN5A 1S9JA 4E93A 5C27A 4XRLA 3UYSA 5CVFA 2ZV8A 2ZJWA 2GCDA 4FTMA 3G90X 4ENXA 2E9VA 3EFKA 3QL8A 3ZOSA 3TDVA 4K1BA 3RNYA 1GIHA 2VWVA 4R6VA 3SXFA 4EK4A 2CKOA 2HOGA 3EMGA 3O17A 1X8BA 4FSUA 2JFLA 4E4NA 3A2CA 4MF1A 5FBOA 4ZTQA 2BRMA 4GW8A 4JOAA 4X2FA 3GCVA 3UYTA 4EKKA 4QMQA 4CGAA 4TN6A 4U80A 4BTMA 4AE6A 4FX3A 3BPRA 4P4CA 1Q4LA 2CGWA 4LRKA 5EW9A 3KVWA 4AZFA 1W7HA 2UW4A 3BCEA 4JQ8A 4L44A 2WZJA 4MQ2A 4EOIA 3QXPA 3BV2A 4UYNA 3RK5A 3VS7A 4WKQA 3RZBA 2PVHA 4O7ZA 2QVSE 4C3RA 1U59A 2PHKA 3POZA 3QQGA 4YZ9A 3DBQA 1M17A 3FMNA 1CKPA 2ZM1A 3L9LA 5M55A 3TTIA 4BY9E 2C5OA 2QR7A 4F65A 5F94A 3UVPA 4UXLA 2R2PA 1UU9A 2RGPA 4ACDA 3GQIA 4UX9A 1XR1A 4UWBA 2EWAA 5TOZA 2XEYA 3TZ9A 4HOKA 4FTRA 3FLQA 1JSUA 2W06A 1CM8A 1ZY5A 5F95A 3RAHA 4MNEB 1Q41A 2OXXA 2X2MA 4RIWB 4WUNA 3C0HA 2ITXA 4FKPA 1P2AA 2ZOQA 3HMOA 2XIYA 5GZ9A 5C1QB 2G15A 5DRDA 3AXWA 5JSMA 5TE0A 4ARKA 4FYOA 2Y9QA 5EK7A 5HBHA 4F08A 4U41A 3S4QA 5ETAA 5LVOA 1IASA 4RVLA 3COMA 2OK1A 2OU7A 2JKQA 3KULB 3TI1A 4BF2A 3BE2A 2XBJA 3JY0A 3QF9A 4RQKA 1B38A 3V5LA 1M14A 3LJ0A 3ZLWA 4MWHA 2J2IB 4N70A 4KBKA 2AC3A 2XNEA 4ZK5A 5CEIA 3H9RA 4IAZA 4MBJA 4NYEA 3MVLA 3RZFA 5J7BA 5D7VA 3UBDA 1J91A 4C4GA 4KAOA 4NJDA 4P2KA 2VX1A 2A27A 5HIDA 4TYGA 3LXNA 3FZRA 3VWAA 4L7SA 5EYMA 3I6UA 3ZFXA 3CLYA 4BTKA 3RM6A 5IH6A 2OIQA 2G2HA 3LE6A 4FT0A 1OPJA 4RA5A 4CXAA 3DAKA 4LMUA 2I0EA 3ZRMA 5LJJA 3TEIA 2R5TA 5CT7A 4FA2A 4ZLYA 5M53A 2BHEA 3P0MA 4IW0A 4O0WA 4L43A 5IA3A 3BLHA 3HV3A 3KEXA 3W2PA 2VX3A 3PY0A 4IIRA 5CF5A 4C2WA 1OL1A 3F5GA 3OOMA 3TKUA 4AN9A 4DFLA 1SVHA 4RWIA 3MY1A 3D5VA 5F20A 2W5BA 5AV3A 4JX3A 3GOPA 4JQEA 3CGFA 3OD6X 3SXRA 4UMUA 4O6LA 4C59A 4BC6A 4MVFA 3QKMA 4E8AA 4AX8A 3SW7A 4GV1A 3BWJA 3TTJA 4F7SA 4E3CA 4RFMA 1H4LA 5LCKA 1E9HA 3I7BA 5IQCA 4ERKA 4NKAA 3OC1A 3QQJA 2PVYA 4U40A 2C69A 4MD9E 5C01A 4F0IA 4CMUA 3V8WA 3ZRLA 2RKUA 2DYLA 2PY3A 5KMLA 4V04A 3G6HA 2AUHA 3DK7A 3KMMA 4FTCA 5D10A 4QO9A 3R8VA 4ANBA 5FEQA 4BDCA 1PJKA 3R1SA 4RZVA 3GCQA 5DR2A 5C8KA 1DS5A 4AG8A 4EH9A 3QZGA 4DF3A 2J90A 3GCSA 4LOOA 4O1PA 1M7QA 4DFZE 1OKWA 4GCJA 4M14A 2ITZA 4YJUA 4AA5A 4ZY5A 3OXTA 5GNKA 4NIFA 4HCVA 3LFCA 4DBNA 3QUEA 4O22A 3KY2A 4FT7A 2JITA 3DOGA 3PJ3A 2ITTA 3DT1A 4QMZA 2R3IA 2YM5A 1W82A 4MQ1A 3VF8A 2HZNA 3PFQA 3E8EA 4JX7A 5HD7A 2B9HA 4G3FA 4TPTA 4ERWA 3BYMA 4CFWA 3CCNA 2GQSA 3RAWA 2XA4A 4OTIA 3JPVA 4IDVA 5BQ0A 5GIPE 4AE9A 4D2SA 4E4XA 4MAOA 2Y4IB 4C7TA 4S2ZA 4YZBA 5M4UA 3EZRA 4XS2A 4BCKA 4OAVB 2YHVA 3DJ6A 4FG9A 5IDNA 4QNAA 4X0MA 4KKHA 3D14A 4BCNA 4UB7A 2BAQA 5TF9A 2ESMA 5BUJA 1K2PA 1RDQE 5JZNA 3LHJA 5TO8A 4AGDA 3FUPA 4QQJA 2C6LA 2QQ7A 2XK8A 3A60A 1BLXA 4U79A 5GJDA 1S9IA 2G9XA 2XNGA 2CKPA 4EJ7A 4FV3A 2HXLA 2YCRA 3OF0A 4GVJA 5CSPA 3I4BA 5HE1A 2QNJA 3LLTA 4O7WA 3HVCA 2QONA 2XK7A 5L8KA 4A7CA 3VULA 2I40A 4F1TA 3ZU7A 4E6CA 4D1XA 3CKXA 5ANOA 5H8GA 3RJCA 5J1VA 5M44A 3CQEA 1V0BA 2VTQA 3FHIA 3HV7A 4AZSA 3R83A 2R3LA 3JXWA 3PUPA 3VS1A 5AUTA 5I9YA 1APME 4Y8DA 2CGVA 3CGOA 3DK6A 3MI9A 2JDRA 3DBFA 3V3VA 4D28A 2XKCA 3QQHA 3FYJX 3DKOA 3U4UA 5EI8A 4EBVA 4PV0A 4BBEA 5HQ0A 3QFVA 2NRUA 4FZDB 2Q0NA 3BGPA 1PXNA 2BIYA 3BQCA 3Q5ZA 4DH7A 2BRGA 4FIEA 4UBAA 3U6HA 3BZ3A 2PUNA 3ZO4A 2P2HA 4OW8A 4APPA 3LOKA 4IM0A 2YN8A 3FXXA 2IW6A 3LW0A 1IA8A 5FG8A 3ZXTA 2HW6A 3TXOA 3AC2A 2R64A 4GUEA 2PVFA 4DEBA 2X39A 2YCQA 5AAGA 2F49A 2HELA 4RJ4A 3LXLA 3U8WA 3GI3A 3LQ5A 3CXWA 3FSKA 4TL0A 3KK8A 4FTJA 4X3FC 5CAUA 2WQNA 5IISA 4R3RA 3IDBA 4X3FA 1GZKA 5IQIA 3SQQA 3SV0A 4FIHA 3EQHA 3F9NA 4EONA 3KRWA 2EVAA 2HYYA 2CGUA 4UMRA 3V6SA 5A4QA 3RWPA 3GU4A 4BHNA 4G5PA 1JSTA 2YIYA 3FL5A 4M67A 5AA9A 5J79A 2F2CB 3VW6A 3DKFA 4IAKA 3UO6A 2G2FA 3TN8A 3GC7A 4P5ZA 2IVTA 3MS9A 1XKKA 4NIFB 5I9ZA 2H34A 2HIWA 4AACA 3VC4A 4WBOA 1PHKA 1PXOA 5GZAA 2CLQA 2A4LA 5BYZA 2R3PA 4HYSA 1ZY4A 5ETFA 4J99A 2QCSA 4ANQA 5M4IA 3MJ1A 5A4EA 2XBAA 3GC0A 4PUZA 3UOKA 2XF0A 3BELA 3P23A 4QMVA 4TWCA 1I44A 5BVFA 4O1OA 4ENYA 5EW8A 5KMJA 3DS6A 4YMJA 2PZYA 3TWJA 4PTCA 3E8NA 5AEPA 3BLQA 3MDYA 4K6ZA 4A4OA 3FLNC 4I24A 4YPSA 4DT9A 4GT4A 3Q3BA 1YI6A 5DGZA 5H2UA 5EQYA 3R04A 5CVHA 3L9NA 1JBPE 2V0DA 3JYAA 4JVGA 3UG2A 4QMNA 5B2LA 4IVBA 3NRMA 5KE0A 2X81A 4O21A 5CEKA 2WMUA 1MUOA 3Q53A 4CFUA 5HTIA 5GJFA 4ASZA 5AR4A 4BDFA 3ET7A 4RWJA 3TIYA 1J1CA 5HG5A 5DBXA 3DNDA 3AD4A 4Z16A 5JQ8A 3UDBA 3V8SA 2ITVA 1FGIA 4BCFA 2F2UA 2J0KA 2F4JA 3F3TA 5HO8A 5KX8A 4IEBA 3F3WA 3R02A 2VTJA 3D4QA 5EDRA 3NNWA 1JKLA 3L8XA 4E5BA 4GK4A 4BIBA 4O7NA 4TY1A 3R7YA 2R3HA 2VZ6A 1SVGA 4L67A 4JR3A 4CTBA 3BYSA 4BWPA 5CALA 4NK9A 4B8LA 3EL8A 4C0TA 4EUUA 4LQMA 3VRZA 4YTIA 5IPJA 3I0QA 4QYEA 5HORA 4AA4A 2PZRA 3PA3A 4GMYA 2BZJA 2OIBA 3PJCA 3S0OA 4ANNA 5CEOA 1JLUE 5J1WA 3Q4TA 3MPTA 3A7JA 4IZAA 4FTTA 3CTHA 2SRCA 3FXWA 3COHA 3TDWA 1PMVA 5AR8A 4IBMA 3FZTA 4DH3A 2QOKA 4J1RA 5A9UA 4BTFA 2ITPA 2QOQA 2JDVA 2BZKB 4W4WA 4O27B 3ULIA 4U97A 4RQVA 2I7QA 4YURA 5M56A 3KRLA 3KFAA 4O84A 1H0WA 1R0PA 2BTRA 3N51A 4O2PA 4V0GB 4XV2A 3W2SA 4GH2A 4AN2A 4BICA 4XYFA 5EYCA 3ID6C 3TNIA 2X7FA 3WE4A 3ZSHA 5IQGA 2JIIA 4IAFA 5JGBA 2YIRA 3OXZA 2HXQA 5HCXA 1LP4A 1MQ4A 2OG8A 1DM2A 3PJ2A 4RJ5A 4CMTA 4Z55A 3LCDA 4R5SA 3HMNA 4N6ZA 2Z7LA 3T3VA 3FQHA 3RM7A 1PMNA 2X1NA 2C3IB 5AUXA 4L9IA 5HE2A 4BIDA 4FT5A 2W99B 2R3NA 5G1XA 3BLRA 3N9XA 2NPQA 4BCJA 3EQBA 4X2NA 5L3AA 4A9YA 5BX0A 4JR7A 3MH2A 4HGLA 4QOXA 4XNEA 5E8SA 2ZV2A 2VWBA 4FSWA 5E8WA 3SOAA 5JQ5A 4CZYB 4CT2A 4ZTSA 4YNOA 3C50A 5JN2A 4AXAA 3LLAA 3OTVA 3LMHA 3V5JA 4X6QC 4C33A 2X6DA 5BPYA 4QRCA 3KMWA 3W32A 5H8EA 4FIIA 3TZ8A 1U54B 2XM9A 3MPAA 4FTOA 3OCGA 3NIEA 2GNJA 2PZIA 4AA0A 4F1MA 4QQTA 2B9JA 3KA0A 4O7YA 3ORPA 4YP8A 4LUDA 4I0TA 3COIA 4OTWA 4TKSA 4QP1A 3E8DA 1OKZA 5A3XA 3ZLSA 4BB4A 3JUHA 3BHHA 3C0GA 3GUBA 4NJ3A 4YHTA 1GOLA 1P4FA 2YJSA 2B4SB 3QYWA 3QC9A 1BYGA 4OTPA 3BV3A 3EQFA 3QGYA 2YITA 3PA4A 4GJ2A 1SM2A 5DWRA 4PY1A 4F6WA 2W17A 2RFDA 4PPBA 3R8UA 1KE7A 3HAMA 3AT3A 3PXFA 1CSNA 2R3GA 3FI3A 4NFNA 4RZWA 4FODA 3AD6A 4FTNA 5GZ8A 2X8EA 3CQUA 1NW1A 3V5PA 4DGGA 3F7ZA 2VN9A 2XJ1A 3F3ZA 1KE5A 1XH5A 2X4FA 4IM3A 1WBVA 4WG4A 5LWNA 3G15A 1HCLA 2UW6A 3NNVA 5KZ0A 3UPXA 3MA3A 4XV1A 4WA9A 2W1DA 2WU6A 3RTPA 1URWA 2JIUA 5IQFA 3EB0A 4AUAA 1YQJA 1SNXA 3DFCB 3BHYA 3R22A 4RWKA 5DYJA 5D7AA 4YSJA 4LOQA 1WBSA 2PUPA 4Y46A 3VBVA 2JC6A 3I81A 2WTKB 3TKIA 4RVMA 2ZDTA 3C4FA 3NIZA 4Y83A 4ZJIA 1OL2A 4YZCA 3C4ZA 1PF8A 1HCKA 1LR4A 1VR2A 3AGLA 4NH1A 2ITUA 2HZ4A 4IVAA 4KS8A 4YJPA 5FD2A 3R6XA 1OUYA 2W5AA 3MYGA 3AD5A 2OXYA 2WOUA 1CMKE 3VQUA 4TW9A 3QHWA 5EOLA 2FA2A 2WTWA 4U3YA 3OUKA 4RRVA 4I41A 4EYMA 3TNPC 3ODYX 4B99A 2BILB 1YDTE 3WF7A 4XX9A 4DEEA 3QA0A 4FE2A 3PLAE 2OIDA 2UZEA 1URCA 4DFXE 2FSOX 3CIKA 4ANSA 2Y6MA 3OT8A 3FI8A 1KE6A 2W1IA 4RJ3A 3P5KA 2WTJA 4PPAA 4EOJA 4QP3A 4B0GA 1YWRA 4WBBB 5L2QA 1PRYA 2GFSA 3D5WA 3F2NA 4JAJA 5JFWA 3SX9A 2WFYA 4AAAA 4EQMA 3UP2A 4RX9A 4JIKA 1OIUA 2IW9A 4AQCA 2PULA 4DEGA 4O83A 1WBWA 2PVRA 3Q4CA 5B2KA 4QYFA 2R3QA 4FTIA 3MY0A 4BCQA 3UOJA 3DA6A 3UODA 4E4LA 3LJ1A 3KMUA 2YAKA 3FZ1A 3DXNA 4WSYA 4LGGA 4YZNA 3KXZA 4E5WA 5GJGA 2C6TA 4TWOA 2FSLX 4XG8A 2W1CA 3CY3A 4ITHA 3ULZA 4AWIA 3EYHA 4FEUA 4DCAA 2YLFA 3GT8A 5HIBA 2VWWA 4N57A 3U51A 4D1SA 3HMPA 1H28A 5DFPA 5C8MA 2IPXA 4YBKA 5L8JA 1A9UA 2R3FA 4I21A 4JBOA 4X3JA 4S33A 4BZOA 3EQCA 5C03A 2OZAB 2BFYA 2QG7A 1UU3A 4RJ7A 4UV0A 4GFOA 4CFMA 4GT5A 3W2QA 4GG5A 2QR8A 4V01A 3KRRA 4YSMA 4CZUA 1OUKA 4F7LA 4A4LA 3H9FA 3P9JA 5LMKC 3PRIA 2X7OA 3MVMA 4QTEA 2W0JA 2VTNA 4BKZA 4O81A 1FVVA 4FNZA 5J5TA 1RJBA 4BWKA 3MW1A 4AZVA 2GFCA 4U8ZA 2WTVA 3L1SA 4CFFA 4CEGA 3LFSA 5A4LA 2PZPA 3F5XA 4BDIA 4LI5A 2J4ZA 3GVUA 4NL0A 3VUGA 3ZONA 3A4PA 3OUNB 4MCVA 5DT0A 1ZYLA 5BVWA 4K0YA 5HTBA 2XKDA 3G9LX 3O96A 2V22A 1YHWA 3ACKA 3HZTA 4YJNA 3AMAA 1Y8YA 2WMBA 2ZM4A 3TNQB 4QNYA 4YJQA 4YU2A 4RIOA 3U9NA 2R3RA 5CENA 3BYVA 2F7XE 4WNPA 3QTSA 2CGXA 2VWIA 2G2IA 5EDQA 2P0CA 4I22A 4W8EA 3HV4A 3D0EA 4CTCA 5CANA 1AGWA 4CT1A 2FUMA 2J0MB 5FXSA 3VJNA 1H1QA 4F99A 3WF6A 3NUPA 4XV9A 5CX9A 3E63A 4ANOA 5CAVA 1QL6A 3MVHA 4KBAA 4MX9A 2J9MA 3NYVA 3ZUVA 3RWQA 5JEBA 4LG4A 4UWCA 3IPHA 4FV4A 5EKOA 3RKBA 4BCOA 1PMUA 2GHLA 4IWPA 1I09A 4AZWA 1BX6A 4KINA 4UZDA 3K2LA 4WD5A 5CEQA 3RPVA 5HO7A 3BGQA 3E64A 2XIZA 3ZSIA 4EQUA 4KB8A 4H3BA 4NM7A 2QO9A 2CLXA 1GZ8A 3QQFA 4AN3A 4DGNA 4U7ZA 4OLIA 4DN5A 2E9UA 2ITQA 1OECA 3MTFA 2BVAA 5DHJA 2IJMA 5C8NA 1UVRA 1CKIA 3QC4A 4OTGA 3A61A 5FGKA 1LUFA 5T68A 4Q2AA 4I0RA 5AP2A 2HENA 3GU6A 5FLFA 3D94A 4FZFB 1CKJA 4L7FA 2YZLA 5AV4A 3SA0A 4I6QA 2A1AB 4E5AX 4F0GA 1QCFA 2R4BA 2X9FA 4BGQA 4MNEA 4UMPA 4FV7A 4ZTRA 4B9DA 4D4RA 4Y5QA 2GTMA 3ORZA 2DWBA 4H58A 4EKLA 2XIRA 1H25A 2CNQA 4I93A 2WMRA 3TNWA 5CYIA 4KD1A 2RG6A 4H36A 1UNLA 1LEZA 3LIJA 4LGHA 5ACBC 4FV1A 3QRIA 4UMQA 1XH8A 5L6WL 3ORMA 4A06A 2GU8A 4B6LA 2G01A 5BNJA 2BALA 3GOKA 3BYUA 1A06A 4ZTLA 1ZYDA 1REJA 3ORTA 4K18A 5AUZA 3KULA 3PPKA 4JLCA 4DLJA 3QZFA 4HYIA 2QG5A 1KOAA 4UALA 4EUTA 2LGCA 4R1VA 1JQHA 3OCBA 1H26A 2QURA 5DEYA 4AF3A 3THBA 2BDFA 4IB5A 4BKJA 3R1YA 3QZIA 4HZSA 4ZAUA 2IVUA 4FIGA 2QOFA 4JRVA 5C4KA 2JDOA 3PY3A 1OMWA 4IWOA 3KF4A 4FSRA 3ZDIA 3QX2A 1J7LA 4QMMA 2VTHA 4JXFA 3MB7A 3E87A 4RIYA 5GINE 4X6RA 4BVUA 5J9YA 4XEYA 4M13A 3QUPA 1PKDA 2PUUA 4MKCA 4FSTA 3Q04A 5LCJA 3EWHA 3GEQA 2AYPA 3WI6A 1TKIA 2C3JA 5IUHA 3HECA 4JQ7A 4DC2A 3ITZA 1ERKA 4R7HA 4YC8A 4ZP5A 4FL2A 4GT3A 4RSSA 3P4KA 4MXYA 5CNOA 4FKTA 4AW1A 4F4PA 4G3DA 3ZHPC 1JWHA 3IONA 2QOLA 5CSVA 2W1ZA 3HDMA 4FG8A 5B0XA 3QGWA 4LM5A 3W10A 4F9CA 2QI8A 1O6YA 2VWYA 1UA2A 2CCIA 2I1MA 5TT7A 5FP6A 3ROYA 5HI2A 4DH8A 4F0FA 5I4NA 3O7LD 4K33A 3QAME 1ZOEA 3HMMA 4KKGA 4NKSA 4QMXA 3VUDA 5I9WA 4I0SA 2CMWA 2ITYA 1IA9A 1GZNA 2QHNA 4ITIA 1OPLA 4QQ5A 3KXMA 3KF7A 3NGAA 3GFWA 3W2CA 4F9AA 4EK3A 3EHAA 4KS7A 3AC8A 1H1WA 3CTJA 3PXYA 3L8PA 4FZ6A 2VTOA 4GRBA 4QYYA 3NUYA 4U5JA 2C1BA 4HNIA 4NCTA 3RK7A 1XBAA 3HUBA 4ZMFA 4UXQA 2JDSA 4I5PA 3FZOA 1FQ1B 2P2IA 5L4QA 1W84A 4H39A 1NVSA 4S32A 5CF6A 3QRJA 2XNPA 4HVHA 4AW2A 2VU3A 5H8BA 2W96B 5J87A 3QD3A 5IH4A 3QCSA 5KUPA 3ZM9A 1IAHA 3FPMA 3UIUA 5IH5A 2JDTA 4IC7A 3I60A 4DEHA 3FY2A 3VS5A 3BGZA 2X2LA 1W98A 3PLSA 1ZXEA 4O7RA 3OXIA 4D0XA 4X7QA 4BL1A 3W2RA 2YDJA 1YVJA 4FKSA 4OT5A 3W16A 4G2FA 3DLSA 1Q3DA 4ZSJA 1SNUA 4IWQA 4JT3A 4FKIA 2IN6A 4O0VA 4Y72A 2Y4IC 4Q9SA 3IO7A 5IQEA 3KRJA 5IDPA 2BAKA 2QHMA 3DZOA 1R3CA 4HPTE 3P86A 4W9XA 4FNWA 1QPEA 2VTSA 1XH7A 3LMGA 5AA8A 2W1FA 3D9VA 2XP2A 4I6HA 1GJOA 3TIZA 4PTEA 1VYZA 4EBWA 3JY9A 4GFMA 5KBRA 5C26A 4ZTHA 4RIYB 2PMLX 4IE9A 3C7QA 2CKEA 2ZYBA 3LCSA 4FSMA 3GENA 5CNNA 3W55A 4K8AA 5LVPA 3U87A 3IW5A 4JBQA 2YJRA 1PXJA 3G9NA 3C4EA 4PL3A 4ACCA 4BI1A 4RFYA 1YKRA 2J6MA 3BHTA 1Q99A 3DCVA 3ENHA 3F66A 5LWMA 4N0SA 5BYLA 1GAGA 5EH0A 2XYNA 2JFMA 2XNNA 2JBOA 3KB7A 2W9ZB 4G9CA 2XYUA 4I5MA 4WO5A 3KGAA 5CXZA 3QQLA 5EHYA 2YLEA 3WOWA 4XBRA 2RG5A 3E93A 4FUYA 2LAVA 4EWHA 3R9DA 4EWQA 3AT2A 4EHZA 3NWWA 4JJRA 4F9WA 3E88A 1O6KA 2UW3A 4C8BA 4MNFA 4ZSAA 3CPCA 3UQFA 5DEWA 4QTBA 4FG7A 2WO6A 3PE1A 4ANMA 4RFZA 4RBLA 5BUEA 2RL5A 4E73A 1WVXA 2GNIA 2FYSA 1XWSA 3FMLA 4KRDA 3HYHA 3PG3A 3VUMA 4D2PA 4J96A 3JR1A 5EI6A 4OTDA 3SXSA 1ZMWA 4AP7A 3Q2JA 2H8HA 2VTLA 3HRCA 3MV5A 3ZTXA 1DI9A 3QD4A 4QPAA 1E1XA 3R63A 5E1SA 4M15A 3HA6A 2WMXA 1FPUA 3MJ2A 2YM4A 4EOOA 3RP9A 4IJPA 1MRUA 4JL9A 4W4YA 3ZRKA 4R3CA 3NUSA 4UZHA 5AJQA 1B6CB 3GU8A 3EJ1A 4AS0A 2Z2WA 3T3UA 3PG1A 2I0VA 3R8LA 2GHGA 4C2VA 3TNHA 3KREA 3VS2A 4FEQA 5ANEA 3KXHA 2C68A 2R0IA 5IQBA 1ZYJA 4C34A 1YW2A 3Q9XA 4K2RA 4JG8A 3ZUTA 1KV2A 1YXUA 3U4WA 4XG4A 3MFTA 4OTQA 3A7IA 3R2YA 2F7EE 1VEBA 4M66A 4FKUA 2PMNX 1VYWA 4CQGA 3GCUA 3QXOA 4HYHA 4XJ0A 2C3LA 5J9LA 3H3CA 1JKKA 5AR5A 4QMOA 5IG1A 4HJOA 1PXKA 3MIYA 3UQGA 2PVKA 4B4LA 3HDNA 3MESA 4FR4A 4XG2A 2C5NA 3UVRA 2IO6A 3QTRA 4W8DA 4ASXA 4XH6A 1JVPP 4E6QA 4YC6A 3BEGA 3C4XA 2X9EA 4PQNA 1U5QA 3HV5A 3KL8A 3NPCA 3S1HA 3BWFA 2XK9A 3NMUF 1ATPE 3ALOA 3RI1A 4YLKA 4APCA 3DFAA 4J8MA 3H9OA 3O50A 4MBIA 4C58A 5M51A 4OAUC 5J7HA 3RCDA 5M4FA 3ZXZA 2F9GA 3FLZA 3QTXA 1P14A 1Y8GA 4M12A 5HE3A 1ZARA 3ROCA 4F63A 1G8AA 1OB3A 4AFJA 3HEGA 5A6OA 2C47A 3QWKA 3V5WA 5HLNA 2R3MA 5CY3A 3HX4A 3EH9A 2O5KA 1HOWA 1PXIA 5IQAA 1YOJA 5HBJA 2YCSA 5DA3A 1F5QA 3EZVA 3O0GA 5EOBA 2OO8X 3U55A 1J7IA 2WAJA 5EQEA 4L46A 4EH7A 2XUUA 3OTUA 3MBLA 4NW6A 5JZJA 1L3RE 1Q61A 3UC3A 4CV9A 4KABA 4L68A 3FJQE 2R3KA 4U0IA 1ZLTA 2J0LA 4QP2A 4FEXA 4AGUA 3NUUA 4JIAA 4R8QA 5B2MA 2Z7QA 2OXDA 1UWHA 2Q0BA 2B52A 3IW7A 4IADA 1ZZLA 3OP5A 4M8TA 4PNKA 4IQ6A 3I6WA 2OW3A 2PSQA 1NVRA 4ONAA 4B8MA 3E5AA 3AT4A 3W8QA 3MH3A 4C37A 4CVAA 4FVQA 2WMAA 1XH9A 3H4JA 4UEUA 3FMJA 4G34A 2C6MA 5HGIA 5FM2A 4EOMA 3GNIB 4QMSA 3REPA 1OGUA 2UW5A 5CSHA 5IA1A 4IMYA 3EQPA 2RFEA 1ZZ2A
chains in the Genus database with same CATH superfamily
2UV2A 3B2WA 2WHBA 2W1GA 2BRHA 1YXVA 3QKKA 5LVLA 4P90A 4V0GA 3SW4A 2IZSA 3QHRA 3G33A 4IZ5A 3WZKA 3A62A 4YJRA 5AP5A 2J0IA 4W4XA 4CCBA 1F3MC 3Q9WA 3R8MA 2WQMA 4QTAA 3A7HA 4G5JA 3ZFYA 3W8LA 4FNYA 2CDZA 1Q8ZA 3E7VA 3UGCA 4DG0E 5ANKA 4L3JA 3R7UA 2OSCA 3RINA 2JAVA 5IMEA 5DN3A 3TCPA 3U54A 5HNGA 3VQHA 2PE2A 2PMIA 3VHKA 1YI4A 3NVMB 5K3YA 4L53A 2OJJA 5KHXA 3F2AA 3T9TA 3Q6WA 4JBVA 4U6RA 2E9OA 2VRXA 2EXEA 3CD8A 3ORXA 3FKLA 4FSNA 4C4EA 2X8DA 3BE9A 1XMMA 2IZTA 4NWMA 2WMWA 2VD5A 4DHFA 2PVLA 3FV8A 4FTAA 3IDPA 4NTTA 4A07A 3BHVA 5JFXA 4FVRA 4UWYA 2Q83A 2YA9A 2ACXA 2HZIA 3TJDA 2ZMCA 3WYXA 1U54A 3TZ7A 3OWKA 4D58A 3ZO1A 5ITAA 3PXQA 4JS8A 3JVRA 5I5ZA 3EQIA 3OMVA 4YTCA 4CQEA 1K9AA 1MP8A 4NUSA 4R5YA 1U4DA 2QOOA 4Z7HA 2WQOA 4XP2A 4O38A 3TACA 2HY81 4G9RA 4U44A 4U3ZA 3MH0A 4CD0A 3MFUA 3OW3A 4Y5HA 2QLQA 3I5NA 4D1ZA 4FV5A 4DEIA 4CFVA 4U45A 2GNHA 2UW0A 5E8ZA 5CT0A 4PMPA 3W0MA 3KXNA 4N4SA 3ORLA 2I0YA 5HTCA 2PE0A 2X7GA 3KRXA 4BDGA 3DY7A 4LV5A 1KUTA 3AC1A 2AC5A 2VV9A 3PA5A 3DBEA 3OCSA 1O6LA 3ZZWA 1KWPA 3DU8A 4QP8A 4TTHB 3SGCA 3ZM4A 3F7WA 4OT6A 2BZIB 5AIRA 5HX6A 3P7AA 4QPMA 3O23A 4RLKA 3LZBA 3F82A 2ZFYA 3F6XA 3PZEA 4IX6A 4JNWA 2GS7A 2GQGA 4ZSEA 5E4HA 3CQWA 3V04A 1H27A 3HP2A 1W83A 3KXXA 1OVEA 2GQRA 3AKLA 3W2OA 4CKIA 1IEPA 3FAAA 4KKEA 4XOYA 1OBGA 2QKWB 3MB6A 3CD3A 4H3PA 2O3PA 3K3IA 4L01A 4WNMA 3OW4A 4S30A 1TQMA 1DAYA 4FICA 5L2TA 4MH7A 1YDSE 5FDPA 3DB8A 5KHWA 2JAMA 4WHZA 3FMKA 3DB6A 4PDYA 3FL4A 4ALWA 2EXMA 1QPCA 4Q9ZA 4YJSA 4PDPA 3SOCA 2WQEA 3ANQA 1WVYA 3DTCA 3MVJA 4QP6A 2WQBA 2Z7SA 2QOHA 5JK3A 2OGVA 3R0TA 2ZV9A 4YGAA 2CHLA 5J8IA 5AR3A 5HIEA 3CS9A 5CLPA 2P55A 4EZ5A 2EUFB 5LVNA 2GS6A 2OFVA 3FMDA 4M84A 4PMSA 2GDOA 3KN6A 4XCUA 3ZC5A 3QUDA 1UU8A 5L6OA 5AR7A 2OBJA 4E7WA 1GIIA 2RFSA 3UIBA 4CG8A 4HZRA 3RPYA 5FRIA 2WEVA 3AKJA 4K77A 3FLYA 3WE8A 4DDGA 5E8VA 5H9BA 3PFYA 2PVNA 4EH4A 4Q5HA 4WOVA 1AD5A 3UE4A 4EZ3A 4O4EA 3ZMMA 2C0OA 3SRVA 4B7TA 2BMCA 2FO0A 2QC6A 3D15A 4BDJA 5DRBA 3QU0A 4EOKA 3VJOA 4BGGA 2V62A 3EKNA 1FVRA 4O4DA 5K0KA 5E92A 4BCPA 2DUVA 3KKVA 1GIJA 4BBFA 5ANGA 5JGAA 1OL6A 4O0YA 1NVQA 4RVKA 4NFMA 3PXKA 4DFNA 3EFLA 2JLDA 4GKIA 2JBPA 5HICA 2YISA 3NCZA 4D0WA 3NUXA 5AMNA 4QQCA 5CI6A 3EQGA 5HHWA 4C61A 4XHKB 5EKNA 5F9EA 5LOHA 3LVPA 1WFCA 2OJFE 3FYKX 1IAJA 3QQKA 3A8WA 2OZAA 3PSBA 3DKCA 4QP9A 4FGRA 4QD6A 2RSVA 2BKZA 5BVNA 4R78A 3F61A 3R21A 2R7IA 4FV2A 3DLZA 3AG9A 5KNJA 1YDRE 4BCMA 4JAIA 5JFVA 3IDCA 3R8PA 5LVMA 4MWIA 2IZRA 3PXZA 3POOA 4WT6A 4ZZNA 2VWXA 5ACKA 5EHLA 3KXGA 3AC4A 4O7TA 3CKWA 3SHEA 3TMOA 4EORA 4FTKA 4F70A 4F7JA 2BROA 4C4FA 1H8FA 3GC9A 4C4JA 3RAIA 1W0XC 4QMTA 3IW8A 2ZDUA 2EXCX 1H1RA 4NU1A 4YZDA 5FTOA 1ZYCA 5I3OA 4C02A 4EK6A 4G6OA 4FV6A 5HE0A 5DE2A 3CBLA 3SAYA 4I94A 3Q9YA 4LL5A 4QMWA 2E2BA 4FSQA 4RC3A 5J95A 2CPKE 5AFVA 3JVSA 2P3GX 4BCIA 4RGJA 5KKRB 5IQHA 2V5QA 1YRPA 1KE9A 3DV3A 3OHTA 5GIOE 5ANJA 3EFWA 3G2FA 5CAPA 5IA2A 4PTGA 3DGKA 2NRYA 2YM7A 4DYMA 1M52A 2YIWA 3TV6A 3VO3A 4DGMA 4RVTA 4RWLA 4XG9A 4DG3E 2C5VA 2YWPA 2JKOA 2VNYA 4FT3A 3IG7A 4AW0A 4EH6A 3QTWA 3K3JA 3V5QA 3E62A 2VAGA 2YM3A 4TYEA 3DBDA 3WZDA 3KU2A 3NNXA 5C4LA 2BDWA 4LDTA 1OL5A 1Q8WA 5BYYA 3O8TA 4L52A 3VRYA 2XNOA 1XO2B 5CU6A 1OPKA 4PPCA 4V05A 3SRVB 3R7GA 5LQFA 1PXLA 3UO5A 3F3VA 5CU0A 2YABA 2B1PA 3LFDA 3IECA 5KMKA 2QOCA 3P1AA 1T45A 2QOBA 2ERKA 4G1WA 3LAUA 3RPOA 5TR6A 3AC3A 1PYXA 5HOAA 3F88A 4YUQA 2J5FA 4AGCA 2W4KA 5HG7A 4U43A 2YAAA 3QALE 4N6YA 4YC3A 5HCZA 4LRMA 1Z5MA 4NW5A 3IS5A 4ZSGA 3U6JA 2XK4A 2X8IA 4D9UA 4LYNA 5L2IA 4XG7A 4L8MA 3RPSA 4YHJA 4UN0C 4C35A 2O65A 3GC8A 4FTUA 2WGJA 5A14A 1LEWA 4KSPA 4QMUA 3KVXA 4IHPA 1XHAA 2ZMDA 3PIXA 5F4NA 1J1BA 4FGBA 5HVYA 1U46A 5EW3A 2ITOA 4NT4A 4QMPA 4OBOA 1YOMA 4D2RA 2WKMA 4OTFA 4I3ZA 3VN9A 2XRWA 3IK3A 2HW7A 4E6AA 5CF8A 2OFUA 4RX8A 3BBWA 5IEVA 1K3AA 3ZLYA 3ELJA 2VNWA 1ZMUA 3UNKA 3UIXA 4ORKA 5AP4A 3V5TA 4J8NA 2GNFA 3ZEPA 4R1YA 3CTQA 4IC8A 4G31A 5IMXA 4YJOA 2UZWE 3PUFC 4BHZA 3FKNA 5AV0A 4EJNA 1FBNA 1GNGA 2R3JA 3BI6A 3N4UA 2WD1A 2ZB1A 3T9IA 3P7BA 3AOXA 3RPRA 4DAWA 2UVYA 4JDHA 3SKCA 1J7UA 1Q24A 5IA5A 3IW4A 4FYNA 5CEPA 3VBWA 2WMTA 4TRLA 3COKA 3KC3A 3RALA 3N4VA 3BU5A 4BDEA 4BN1A 5A46A 1BI7A 1F0QA 4D4VA 4U81A 3PJ1A 2BAJA 2YEXA 3FLSA 3OFMA 5FEEA 3IQ7A 4OUCA 3R7VA 3C0IA 4ASEA 2B54A 3QKLA 3U9CA 3HGKA 4FL1A 3NEWA 5EM5A 2XMYA 4P7EA 3R9OA 3QWJA 3RMFA 4HPUE 2XJ0A 1OIYA 1P5EA 3MN3A 5KCVA 3AC5A 1NXKA 2W7XA 2F7ZE 5I9VA 2XKEA 4F9YA 4ZJVA 5HVKA 2PU8A 3FMMA 5E8TA 1PYEA 3ANRA 5IKWA 4GU6A 4DFBA 2PUIA 5JRSA 2WMVA 4FKWA 4LGDA 2C0IA 3G0EA 3BU6A 5M4CA 2PZ5A 5DR9A 3R9HA 2YDKA 3KN5A 5FBNC 4WNOA 3O8UA 2C4GA 1B39A 4GJ3A 4ZOGA 5EM8A 3ATTA 4IB3A 2GHMA 3LCKA 3VIDA 4O86A 1OIRA 3P78A 5JH6A 4TWNA 2OKRA 4PMTA 1BMKA 3NLBA 3DNEA 1BL6A 5BVKA 3P08A 5HLWA 3W0PA 4OR5A 5HLPA 2UW9A 4RC2A 3HRBA 3NZ0A 2XIXA 4MXCA 2IF8A 3NYNA 3C5UA 2JIVA 4BBMA 5AAEA 3FY0A 1VZOA 4GKHA 3NCGA 1XBCA 2WXVA 3M2WA 2XVDA 3PPJA 4IX5A 4E6DA 5M07A 3LXPA 3PDTA 2C3KA 3BRBA 4TNDA 5E91A 2XNBA 2EB2A 4NZWB 4XLVA 3H0ZA 1WBTA 2W1EA 2ZAZA 2W9FB 3G5DA 2DS1A 3NW7A 5JGDA 4I4EA 2UZDA 3BEAA 3B8QA 4BKYA 4EOLA 5KZIA 2QOIA 5KMOA 2IG7A 1Y91A 2X0QA 4HVGA 4KSQA 4BTJA 5DLSA 1UV5A 2VTIA 4G3GA 5HVJA 4AOIA 1TQPA 4D2TA 4O2ZA 4KA3A 4ID7A 3ZSGA 3U6IA 3NFGB 4RLLA 3LFFA 4AOTA 2BRBA 4YHFA 2Z8CA 3RVGA 3MIAA 4X21A 4C4HA 4QMYA 3UNZA 3BIZA 3S00A 3QRTA 3OY3A 4M3QA 3WYYA 2C0TA 3PE2A 4O7LA 4FKVA 4XMOA 3UZRA 1AQ1A 4YJVA 4ALUA 3QTUA 4NM5A 3GB2A 3ZYAA 1H00A 3EQDA 1OL7A 3A99A 2V7OA 2BZHB 2O63A 3ML1A 3PRFA 3BBTB 4PP7A 3ZLXA 3NUAA 1FINA 2XK6A 4DFYA 1OZ1A 4BYIA 5FQDC 5ETCA 1ZWSA 3ZDUA 3PIZA 1V1KA 5AUUA 1KE8A 3N4TA 1PXMA 3CJGA 5KBQA 3ODZX 2VTMA 2XCHA 4USEA 1WAKA 5D12A 4BYJA 2Z7RA 3FKOA 4IVCA 3SC1A 5AX3A 1Q62A 3I5ZA 4ITJA 3KK9A 5A6NA 2IVSA 5FWKK 3UMXA 4CZTA 4EHVA 4PF4A 4TXCA 5HU3A 2PE1A 1KOBA 4NCTC 4GIHA 4M68A 3ZS5A 4D2VA 3FSFA 5CTPA 4EI4A 1OBDA 3AKKA 3FI2A 3O8PA 3QCQA 3LMIA 2GNLA 3PVGA 2ZM3A 3Q4ZA 4FTLA 4DA5A 3WIGA 2YM8A 3DKGA 4F6UA 2BPMA 3M42A 1NY3A 4TYIA 1R0EA 4BDBA 3HLLA 4O6EA 3CC6A 3OEFX 3QD0A 4YLJA 1GZOA 4KRCA 4QP4A 3HA8A 5B7VA 1ZYSA 3OS3A 4GUBA 4EK8A 2ETRA 4ANLA 2CSNA 3Q6UA 4MXAA 4NM0A 4Y73A 3UPZA 4DTAA 2R3OA 1STCE 1TQIA 4W9WA 3ZC6A 1JPAA 3BQRA 2YIQA 4FOBA 4HVIA 3GXLA 2OICA 5E8UA 4UY9A 3UQCA 1DI8A 2ITWA 4BZNA 4CV8A 5K5NA 5IA4A 4IZ7A 3D83A 2VTTA 2Y8OA 3PVUA 4RIXA 3VF9A 4AT3A 4BDHA 3UZTA 3F2RA 4AT5A 1JSVA 5CEMA 1A48A 1PMEA 2HCKA 3LM5A 1ND4A 3LQ8A 3R71A 3S3IA 3ORIA 1Q5KA 3QCYA 4FKQA 4I6FA 4QTCA 2J7TA 4LFIA 5CU2A 3WF8A 4CKJA 2XNMA 2O8YA 4R7IA 3Q96A 4FV0A 3H10A 4G6LA 3FXZA 3D5UA 3FBVA 2PK9A 4USFA 2Y4PA 3GP0A 4G3CA 1QPDA 1IG1A 2KULA 4HYUA 2QLUA 3R9NA 2CNVA 2VO0A 2YWVA 3ZBXA 1CTPE 5JT2A 2O64A 5CI7A 5CZHA 4MTAA 2VGPA 3DK3A 5HX8A 1OM1A 5H3QA 4D4YA 4RT7A 4MXOA 4D2WA 3DQXA 2R7BA 3LFEA 3RBWA 3F5UA 2F57A 2OF4A 4QP7A 4FKLA 4D4SA 3DXQA 4O7SA 3UG1A 3EYGA 4G17A 2BRNA 3K54A 2FB8A 5TKDA 3II5A 4JI9A 4GS6A 3VONA 1H07A 3TKHA 4MD7E 4DFUA 4AZEA 3C4CA 1BL7A 4GSBA 4EQCA 3SD0A 3GGFA 5HD4A 5F1ZA 4RA4A 5AP3A 5HESA 5HCYA 3VUKA 1G8SA 5E9EA 4BCHA 4E20A 3MFRA 2UVXA 4JBPA 3V8TA 4XP3A 3E7OA 3LFQA 4KIQA 4TZRA 4NSTA 4LRJA 4EH2A 2JEDA 3C51A 3QLFA 4FSZA 3RHKA 5L2SA 3NUNA 1SVEA 1L8TA 2HY0A 3VS0A 3FZPA 3ACJA 1VJYA 4ZS0A 3ZZEA 4FIJA 3CJFA 2YZAA 2OI4X 2QODA 2IZUA 4LV8A 4DE4A 2C6KA 3AMYA 3VS4A 2H96A 4A9UA 4FV8A 5KMIA 5AP0A 3ZUUA 4E4MA 1REKA 1MRVA 2XJ2A 1YHSA 4MF0A 4FC0A 5ANIA 5BMMA 1M2PA 2OJ9A 3EN4A 4USDA 4XV3A 3VUTA 4BWXA 2UZOA 2ZVAA 5IEXA 4KIKA 1R39A 4FUXA 3PSDA 2JD5A 4FKRA 2ERZE 4HVDA 4G3EA 5DIAA 4C57A 3G51A 1G8KA 3FMHA 5K5XA 2RFNA 1WZYA 2Z02A 3FEGA 3O7LB 2VTPA 4IFCA 4FOCA 3BU3A 5JRQA 3V51A 4J53A 5I9UA 1MQBA 4YJTA 2WELA 3WF5A 4ZLZA 1NT2A 4HCUA 3DJ5A 2C5YA 5EFQA 4J97A 3PP1A 5EM7A 1G8JA 2B53A 1PW2A 4R7BA 4RX7A 4BIEA 3HNGA 4BCGA 3FQEA 3B2TA 4RIXB 3SDJA 1BKXA 2I6LA 4F09A 3VUIA 5IZFA 3QQUA 2YACA 4X2JA 4EL9A 3NDMA 3K5VA 4WG5A 3Q60A 2QO2A 3NYXA 3UP7A 4A9SA 4FKJA 2B0QA 5CSWA 5D9HA 3FPQA 5EQPA 1FGKA 1W8CA 1RQQA 1OKYA 5CZIA 4O96A 4FKOA 4FJVA 5AP6A 3F5PA 5K4JA 3SLSA 2UZVA 4CNHA 5DR6A 2V7AA 2PMOX 4FK3A 3H30A 3UOHA 3I0OA 4H05A 3PWYA 2DQ7X 3OROA 4GEOA 1V0OA 2Y0AA 4ASDA 4CMOA 1ZOHA 2NP8A 5HG9A 1FOTA 4J7BA 4PP9A 4H1MA 4HVSA 3LPBA 4GK3A 4I23A 3ZO2A 3OEZA 5HKMA 3ZBFA 1R78A 3DTWA 2OH4A 3PWDA 4ZSLA 3M1SA 4EYJA 5AUYA 5IQDA 3TUBA 3LJ2A 5GHVA 4IH8A 2XH5A 4G16A 3PIYA 2VO6A 4L42A 3LM0A 1XJDA 4ZIMA 4CLJA 3EN6A 1EH4A 2RIOA 3FQSA 2QU5A 2X6EA 2YCFA 3DPKA 5DVRA 3NVKI 3QBNA 2A0CX 4ZZMA 4HGEA 3OBJA 5KMMA 3WIKA 3TT0A 4AAYA 3ORNA 4JG6A 2E9PA 4GG7A 5ANDA 2GS2A 4O0UA 2REIA 3CEKA 5CXHA 5D11A 4CSVA 1SMHA 2RF9A 2UVZA 4DH5A 4JRNA 4AOJA 5IUGA 1QPJA 3PY1A 5DT3A 4RJ8A 4KIKB 3QX4A 4PWNA 4D5HA 1YHVA 5CASA 4E1ZA 4MHAA 1ZAOA 2WU7A 3VVHA 3C9WA 3DZQA 3LCTA 4I4FA 3ZCLA 3QYZA 4I20A 4IDTA 5HZNA 1UNGA 1UNHA 1XH4A 3ENMA 2CN8A 2H6DA 4O0SA 4I92A 3C5IA 4YO6A 2WNTA 5AM7A 2GPHA 3UNJA 3ORKA 4DCEA 3PYYA 2WEIA 2OLCA 3C4WA 3ALNA 3CP9A 3OWLA 4O0TA 3TJCA 2ETMA 2WIHA 3V01A 4CYIA 4ZXTA 2EB3A 4PMMA 4FRFA 4PRJA 5E1EA 3ZFMA 4O82A 2GTNA 2VTAA 5CQUA 3E3PA 3OCTA 2C6EA 4IAIA 2A2AA 3IOPA 4O4CA 5DOSA 3IGGA 2IW8A 2OF2A 3P7CA 2VWUA 3MY5A 3TV7A 2UZLA 4PL4A 5K9IA 2FGIA 5EDPA 2EU9A 3LQ3A 1OIQA 4CRSA 1Y57A 4NEUA 5T6KA 4EC9A 1UKHA 4RMZA 3R1QA 1JAMA 3RHXA 3QCXA 4QEBA 4C3PA 4QYHA 2OJIA 1WBNA 1YXTA 4IJ9A 4WNKA 1Q97A 1WBPA 2W05A 4EOPA 5LXMA 4AXDA 2PL0A 1XBBA 3AMBA 4TNBA 5AV2A 2C30A 4X2KA 1UWJA 3L8VA 3E92A 4AGWA 1YWNA 3D7ZA 2XALA 2HAKA 4X2GA 4PL5A 3IW6A 3T8OA 3D7TA 3IGOA 4QT1A 3ZEWA 2C6OA 4OBPA 2CJMA 5DH3A 3G0FA 3RNIA 3HAVA 1FMKA 3DDPA 3CPBA 3GQLA 3NAXA 2YDIA 3Q4UA 2QU6A 4KIOA 2VO7A 3PJ8A 4QMLA 5IA0A 4FK6A 3P79A 4DH1A 4LMNA 4M97A 2UZUE 1WVWA 4F64A 1BUHA 1FMOE 3AGMA 4XBUA 4Y95A 5FTGA 2QD9A 5G6VA 3VAPA 3FE3A 4FL3A 4BGHA 4CYJA 4DBXA 2B9FA 5AAFA 5FDXA 3FDNA 5FXRA 4KIPA 4LOPA 3HUCA 3OBGA 3L9PA 4WUAA 4DLIA 4IB0A 2GMXA 2G1TA 4KBCA 4M69A 2I0HA 3IKAA 1H0VA 4S34A 4WSQA 3TUDA 3SG9A 5M06A 3R30A 2XM8A 3HRFA 4IANA 5JFSA 3WZEA 5K4IA 3FC2A 3FWQA 4J95A 4HGSA 5AV1A 3UOLA 4OTRA 3Q9ZA 4L3LA 2XCKA 3RK9A 3CE3A 4F6SA 2FSMX 3PTGA 4MEDA 3ATSA 2WTKC 4AQKA 2J5EA 4GL9A 4GFGA 1Q8YA 3C13A 3L9MA 2R9SA 4JDKA 3D2IA 4U42A 3CY2A 4IX3A 4XP0A 5DNRA 5ICPA 5KKRC 3I1AA 4ZZOA 4XUFA 4ZMEA 3BKBA 4J71A 1OITA 4CFXA 4YPDA 4FNXA 2NNWB 5CU3A 2UUEA 4FT9A 2J50A 3HV6A 2BHHA 1FVTA 3HMIA 4FIFA 5CVGA 5FTQA 4IVDA 2NO3A 2J51A 4PDOA 3OWPA 5FP5A 2GNGA 2B55A 3KQ7A 3Q32A 2B7AA 3GU5A 3OG7A 2XRUA 4QTDA 3FHRA 4LL0A 1T46A 3NW6A 4X3FB 4Q5EA 1IR3A 2P33A 3NSZA 3EQRA 2IWIA 4ALVA 4EH3A 4CFNA 3G6GA 5CSXA 5BVDA 2PPQA 2ONLC 4ACGA 1RE8A 4GIIA 3VW8A 1XMLA 1ZOGA 2ONLA 3R73A 3D2KA 5E8XA 2BDJA 5AADA 4AXFA 3EOCA 3MPMA 2WPAA 4UMTA 4IWDA 4AW5A 4IZYA 4I5HA 5IUIA 1PKGA 3A7FA 3R9RA 4L3PA 2Y7JA 2XK3A 3UVQA 4MD8E 1TVOA 5HO6A 5A4CA 3QTQA 4BR3A 3D7TB 1JKSA 3GFEA 2OZOA 1H01A 4J98A 2IVVA 3FLWA 4EEVA 3DXPA 5AP1A 5C9CA 5LARA 5A4TA 1YXSA 3DBCA 2VGOA 4H1JA 2BIKB 4I5CA 2XIKA 2UW7A 2CN5A 1JOWB 3NR9A 4F7NA 2CCHA 5K0XA 3PVWA 3D5XA 3EN9A 4AXEA 4RJ6A 5E8YA 3QTIA 2XB7A 3QRKA 1IRKA 1WBOA 3OVVA 4TT7A 3H0YA 5EHOA 4RX5A 3JS2A 3CSVA 3QTZA 4M69B 3VBYA 3R7OA 5E7RA 4ACMA 4QDVA 4F78A 3NX8A 4MXXA 3BX5A 1Y6BA 5AX9A 3SG8A 4EHGA 4MK0A 1W2CA 3LXKA 4Y85A 3W33A 4FV9A 4YBJA 3UDSA 4Z7GA 4FZ7A 1J3HA 1OKVA 2YERA 4OGRA 3VBTA 2FSTX 2KTYA 2YFXA 3V6RA 2W5HA 2WMSA 4I6BA 4AT4A 3UIMA 3Q2MA 1CDKA 3A4OX 3KCFA 4CCUA 4BFMA 1YOLA 3GCPA 2JGZA 1M7NA 3R00A 2VTRA 4GK2A 3TZMA 5I9XA 3C1XA 5FM3A 4ZY6A 3DQWA 3RCJA 2JKKA 5CQWA 3EL7A 3BHUA 3W1FA 3PVBA 4AZTA 5CAQA 4WRGA 4EH8A 5IF1A 4BJJA 5KO1A 1UKIA 1P4OA 3AQVA 4IX4A 5DI1A 3MWUA 5AR2A 5ETIA 3ZH8A 4DEDA 3L8SA 5CF4A 3F69A 4YR8A 2QKRA 2HWPA 4IFGA 3TG1A 2ETKA 3EFJA 2OH0E 4EC8A 4YTFA 4J52A 4BI0A 4O91A 3BYOA 2V55A 5LMBA 2HK5A 2VUWA 2XS0A 5D41A 5AUVA 3UJGA 1ZRZA 5AIKA 4LUEA 5JKGA 4L6QA 1KSWA 4ZTNA 4JDJA 2E9NA 3WF9A 4QPSA 4YLLA 5FEDA 2O0UA 4L00A 2PYWA 3K5UA 3LKMA 4DGOA 4A9RA 4IACA 5BVEA 3R01A 5EM6A 3B8RA 4C38A 3R7EA 4D55A 3UMWA 5BUIA 4O7VA 3EN7A 3OWJA 5EG3A 3UTOA 3MSSA 1V0PA 2CNUA 3IOKA 5HU9A 1H24A 3F3UA 4DT8A 5JMSA 1YWVA 3QZHA 1DAWA 4FMQA 4BDDA 4ZLOA 4F1OA 4HGTA 5M08A 5HEZA 3I79A 2Y6OA 3Q5IA 4CG9A 4WG3A 3CR0A 4TYHA 3M11A 2NYAA 4NM3A 4OTHA 1KV1A 3QD2B 2OJGA 5L6PA 2BKKA 3RAKA 5I3RA 4UYAA 3UO4A 2QO7A 4C3FA 3MTLA 4D9TA 5T3QA 4EH5A 3TM0A 4DTBA 1R1WA 1ZMVA 2X4ZA 1Q8UA 3O71A 4MUQA 1RW8A 5L2WA 3ERKA 5BMSA 3W0OA 4D5KA 2CKQA 3GU7A 3DDQA 4BDAA 3S95A 2WOTA 5KMNA 4EOQA 4HNFA 3LFBA 5D1JA 5HNIX 4LV7A 1LPUA 2X2KA 4AFEA 2PVJA 3A7GA 3LFAA 2C1AA 4O0XA 4BI2A 3OZ6A 4TWPA 2PTKA 4S31A 4YZMA 3ZO3A 1Q8TA 1OI9A 4R77A 2WMQA 1Q3WA 4GYIA 3WZJA 2WTCA 3NYOA 4PNIA 4XOZA 1JKTA 3PZHA 4H3QA 5LMKA 3KCKA 3O51A 4JG7A 5AM6A 4ZJJA 4A9TA 3VBQA 4BRXA 2UZTA 4DEAA 4ZTMA 5CAOA 3MGYA 1H08A 3UZPA 4ZY4A 3R2BA 2YM6A 4BJJB 3OT3A 3PPZA 4Z3VA 4ACHA 4FI1A 3SVVA 1O9UA 1PY5A 4II5A 2P4IA 4P5QA 4AU8A 1E1VA 3MA6A 3WILA 2BR1A 3EIDA 3WZUA 4I1ZA 5CS6A 3W18A 5EYKA 4KWPA 4GVAA 5HNBA 3FMEA 1H1PA 4C4IA 2WIPA 1YXXA 3OOGA 4BDKA 2A19B 5DG5A 1PXPA 4C36A 4E26A 3DAEA 2HZ0A 4FKGA 3VS3A 5M57A 1GY3A 1MRYA 2XEZA 4XLIA 4U9AA 4PX6A 2BTSA 4K9YA 3R8ZA 3S2PA 4XRJA 3TL8A 4CKRA 3NAYA 5L8LA 2O2UA 3NNUA 3DJ7A 2VO3A 2UW8A 2GSFA 3A8XA 4L45A 5I0BA 4JDIA 3QA8A 3PSCA 2YIXA 4XG6A 4WIHA 1QMZA 4YTHA 1SZMA 5J9ZA 4EHEA 3PXRA 2ITNA 4OBQA 4KUJA 4RPVA 1G3NA 2OWBA 2HWOA 5IU2A 3TUCA 2XKFA 3HL7A 2A98A 4FTQA 3DAJA 2J0JA 3OY1A 4FZAB 3QLGA 1WMKA 5M09A 1M2QA 1BI8A 2C5XA 4TYHB 4HCTA 2H9VA 2WTDA 4IM2A 4DDIA 2JKMA 2WB8A 4FVPA 3EKKA 4WRSA 5HBEA 3VUHA 3NS9A 4MXZA 4FEWA 1M2RA 3MFSA 3R28A 4DG2E 2FH9A 3VS6A 5FUTA 5DPVA 2Z60A 4MBLA 4A4XA 2W4JA 3QRUA 5AP7A 3HKOA 3VBXA 4R3PA 4RIWA 2BUJA 5CWZA 4FEVA 4FBXA 5DT4A 2UZBA 4YO4A 2ZV7A 4O0RA 3LFNA 1U5RA 2IEWA 3ETAA 3I7CA 4FF8A 4IAYA 3MH1A 4GU9A 4DGLC 5LMAA 5FXQA 2VWZA 5AWMA 3GBZA 3RGFA 5IEYA 3E8CA 4M7IA 3UDTA 4XG3A 4IB1A 1WCCA 1H1SA 4DTKA 4RC4A 2WTIA 3VHEA 2VX0A 2BFXA 2R0UA 5CU4A 2FVDA 1UU7A 4FSYA 3R1NA 1Z9XA 3FZSA 3Q52A 5AUWA 4MYGA