1BKXA

A binary complex of the catalytic subunit of camp-dependent protein kinase and adenosine further defines conformational flexibility
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
339
structure length
337
Chain Sequence
QESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A binary complex of the catalytic subunit of cAMP-dependent protein kinase and adenosine further defines conformational flexibility.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (phosphotransferase/adenosine)
molecule keywords CAMP-DEPENDENT PROTEIN KINASE
total genus 88
structure length 337
sequence length 339
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 1997-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1bkxA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1bkxA02
3OY3A 3QYWA 4RX7A 3UNJA 2HZ4A 3QD3A 1REKA 3O8PA 3ODZX 4JXFA 5L2WA 2WEIA 2QO9A 2UV2A 1FVVA 3G9NA 4MXXA 4YBKA 4FKGA 2OF4A 2VV9A 2J90A 5C8KA 5J79A 4XNEA 2QR7A 5EH0A 2FSOX 2RF9A 3CQWA 3O71A 4FNXA 3OY1A 1OL2A 2C3IB 2WIPA 3ALNA 3HMPA 4F1OA 5IEVA 5IQAA 5M44A 3HMOA 4WD5A 4RA5A 3MVHA 4IWDA 3W2RA 2ZB0A 4EZ5A 3SAYA 2R7BA 2BCJA 2Y8OA 1YHSA 4BFMA 4X6RA 3F5XA 4O0XA 3TEIA 5L3AA 1WZYA 3R7EA 4FV2A 2EVAA 1KE7A 5M51A 3R2YA 1WBNA 2W9FB 4OT5A 4QO9A 4EH8A 4WSQA 5J1WA 5HNBA 4MQ1A 4KKGA 4N0SA 4ZTRA 2X8IA 3U55A 4OBOA 4ZS0A 2LAVA 2V7AA 4D0XA 3KMUA 2XK8A 4QMTA 2ITVA 3G0FA 5JQ5A 4NFNA 2CCIA 2UZWE 4KSQA 4Q9SA 1BLXA 3JVSA 3BQCA 3OTUA 4IVDA 4JI9A 1PXMA 4UWCA 5IMXA 5AR7A 3FZSA 4EH2A 1ZAOA 4V04A 4LI5A 4CFUA 5C4LA 3AC4A 3RGFA 4O0WA 2QKRA 3BU5A 3RWPA 1KE5A 5HD7A 2HENA 4F0FA 2PUPA 1UNLA 1T45A 3D9VA 2IZRA 4M7IA 5FM3A 4ANOA 3F3ZA 1M14A 5EHLA 5AUUA 2C69A 3TIZA 3UPXA 2CKOA 2X6EA 2W1IA 3PPJA 3HAVA 4R78A 5IQFA 3KULA 5M09A 5A4EA 1YHWA 3ZH8A 4TT7A 4I93A 5BX0A 3E7OA 4FKVA 3TN8A 4J1RA 5J9YA 1JKTA 3R9HA 3Q2MA 2IVSA 5KBQA 4I1ZA 2XNBA 4HCVA 3LCTA 3A8WA 1XH6A 2WU6A 3FAAA 4TWPA 3BWFA 5AAGA 3L9PA 4XP3A 4M0ZA 1NW1A 4E6QA 4MXOA 4IBMA 4EHVA 4LRKA 4AWIA 3BPRA 4YTCA 2OW3A 3FMJA 4IAZA 5E7RA 5EKOA 5IA3A 1JKLA 2YABA 4K77A 4YNEA 5CAVA 4PL5A 3K3IA 5KHWA 2Q0BA 3LIJA 3BGZA 4AFJA 4L7SA 4E7WA 3G6GA 1KE8A 3F9NA 3BKBA 4MKCA 3D4QA 3I81A 3NUYA 4JG6A 1H27A 3NNVA 1CMKE 3FQSA 5AP7A 1V0OA 5IQEA 3ZRMA 2UZOA 3VVHA 4FNZA 5IA2A 4NIFB 5GZ9A 2ITPA 5JN2A 2XK4A 3PY3A 4FF8A 2NNWB 3VS3A 2BZHB 1SNUA 5KHXA 5AUYA 2HWPA 4M8TA 5I3OA 1OBDA 3ZBFA 4ACCA 4J99A 1ZMVA 4FT7A 4O2ZA 2IW6A 4YLJA 3NUNA 1GZOA 4UMPA 2JKKA 2WTJA 2PVMA 2NRYA 3I7CA 2WTKB 3OMVA 4BDHA 1GY3A 1VR2A 2C47A 3DJ7A 1ZOEA 2GNGA 2VX1A 2ZV8A 1KUTA 2XIRA 4IHPA 2P2IA 3T9IA 3F2RA 1XBCA 3ANQA 2A1AB 2ETRA 2YAKA 5CLPA 2ESMA 3I0OA 1Q8WA 3MB6A 3SRVA 3TZ8A 5F9EA 3HAMA 4YO6A 4FTJA 3IS5A 2JAVA 1G3NA 1KV1A 1MRYA 4S2ZA 3K5UA 2IVUA 3ZEWA 4D1SA 3GOKA 4A06A 3R04A 1ZMUA 2W5BA 5AR4A 4FT3A 1M2QA 2ZDTA 4D2RA 1JWHA 4BZOA 1SYKA 5FUTA 4AA0A 2YISA 3COKA 3QHWA 4WNPA 1FBNA 5KNJA 5E8SA 3OEFX 5DE2A 1M17A 4G9CA 5DEYA 4BCQA 3ZSHA 2WXVA 2R5TA 2PUUA 2ITZA 3PLSA 3O23A 3G15A 5H3QA 3NW7A 2BRHA 3TJDA 4FG7A 5J1VA 5J7BA 4IQ6A 5IG1A 5AX9A 3DKCA 5AWMA 3ERKA 3ID6C 5CI6A 5DEWA 5K0KA 2OXYA 3QRKA 3VS0A 3ZONA 4N6YA 4L3JA 3JR1A 3FMMA 3RAKA 2XYUA 3AG9A 4ANLA 4KIQA 3EQCA 2C6DA 3T9TA 1Q8TA 3P79A 2VX3A 4NCTA 4AOIA 4EYMA 2XS0A 2YM7A 4FSYA 4G34A 4AUAA 1CKJA 2C6IA 3CD3A 4AF3A 4G16A 5AV2A 3I4BA 2OJJA 4TYEA 3TIYA 3VWAA 3ATTA 5J5TA 3P0MA 4IVCA 4YGAA 3HA8A 4BCMA 3QRUA 1W98A 2WMRA 3V5PA 2PMNX 2B53A 3E3BX 4X2GA 2BR1A 4O7SA 3NZ0A 4QMPA 1X8BA 3DK7A 3GUBA 2W05A 5CQUA 3C0HA 4X3FC 5FTQA 4HPUE 4BDBA 2X0GA 3V5LA 3CJFA 3IG7A 4EOQA 2ONLC 3A60A 4OT6A 4BL1A 2RIOA 2X8DA 2GS2A 2PZIA 3Q2JA 4W4WA 4R3RA 1LP4A 3NX8A 3CBLA 3QTQA 4JBPA 4BRXA 2C5NA 3R9OA 2W4JA 2EXMA 2YIRA 4G9RA 2UZDA 1SVGA 3KVXA 1JOWB 1OECA 3E92A 1XBBA 2PU8A 3HVCA 4CG8A 3KK8A 3BRBA 3PVGA 3R8VA 3D5XA 4KSPA 3ROYA 4BKJA 3I5NA 3CPCA 4YC8A 3WF8A 1UV5A 2HYYA 3PSBA 1UWHA 1BL7A 3NYVA 4GSBA 4E93A 4ALVA 3O7LB 5BUEA 3PA3A 4BB4A 4O81A 3OW4A 4DF3A 2G9XA 4IVBA 3II5A 4XOYA 4BTFA 3W2OA 1ZY4A 3HP2A 1LR4A 1QPEA 5CS6A 4RFMA 4CVAA 3DJ5A 5JT2A 1BI7A 2XK6A 4TWOA 4USEA 2GFCA 4F1MA 5AEPA 5F4NA 4J95A 2R7IA 4L9IA 4II5A 4NIFA 4WRGA 4GT3A 2YLFA 3UVRA 4RA4A 4I23A 2X6DA 5HE1A 5A4LA 4M14A 3CQUA 1KE6A 3GVUA 4BF2A 3OC1A 3AOXA 4PDPA 5HO6A 4CKJA 2YCQA 4ZTLA 2BIYA 3EOCA 4BCJA 2W1EA 2B9IA 4FT5A 5HESA 4U0IA 5HIBA 4C2WA 2BTRA 2X2KA 4YJPA 3V6SA 4DGLC 4TL0A 4TYIA 3SC1A 2CGWA 2WKMA 3KXNA 3EN9A 5J95A 5CF6A 3AC8A 1UU9A 3MA3A 4RWKA 2OLCA 2ITNA 2WQNA 4O21A 3U87A 4EK8A 4Q9ZA 5HVKA 3R9DA 2XNMA 1JSVA 3BGQA 5BVFA 1BUHA 2F7XE 4O96A 2HW7A 3C51A 5FEDA 4QT1A 4ZS4A 2VN9A 3HUBA 1XQZA 1BX6A 3IOKA 3QX2A 1NVSA 2JD5A 2VWVA 4GYGA 3R30A 4TN6A 2FUMA 2C0TA 1JSTA 3R8MA 2J0IA 1MRUA 4XBRA 4D2PA 1JPAA 2VTJA 3MIAA 2Z8CA 2UZVA 2G2HA 4QP7A 5LQFA 4M97A 5IA4A 3QTSA 3KFAA 5EYDA 3DZQA 3GQIA 4ZZOA 4RC2A 5JGDA 3RAIA 1YOJA 5D10A 2WHBA 4HGTA 3I79A 2VO7A 3NNUA 5DA3A 1J1CA 2UZEA 4WG5A 3B2TA 5HCZA 2R3IA 4M66A 4NM5A 4RX9A 4EK3A 4LOOA 3UO5A 2W1ZA 5DT3A 5HORA 3QXPA 4U6RA 3FC1X 2QOKA 4MBLA 4WG4A 2BROA 4EYJA 2I6LA 2UW3A 4P5ZA 4FV9A 5AV3A 1YI3A 3B8RA 1OL5A 4F63A 5CNOA 4V0GA 5L4QA 3OTVA 3E7VA 5E1EA 1JKSA 1FMOE 3U51A 4FTCA 5EM5A 2BRMA 4CYIA 2QD9A 4FNYA 2I40A 4DEIA 2EWAA 1XH4A 3L9NA 4UMUA 1K2PA 3L8VA 4OUCA 5IEYA 3U6HA 5CF4A 1F5QA 1GIHA 4FTMA 4PY1A 4BIDA 1ZOGA 3AT4A 3BYOA 3Q5ZA 4O86A 2OWBA 3MH3A 2QG7A 3LAUA 2PK9A 4NYEA 2H34A 4DFLA 2OIDA 4MTAA 4JQ7A 4PMTA 1P4OA 4Q5HA 4M84A 5HNGA 1HOWA 4P7EA 3VRYA 4FBXA 4O7NA 1OL1A 3Q6UA 3EN7A 3NLBA 1CKPA 3ORXA 3R2BA 3HL7A 3MFSA 4IAKA 4EBVA 3DXPA 3TDVA 3R7GA 1Q99A 4BGQA 2P33A 2X2LA 3FLQA 5TR6A 3OWPA 3QCXA 4HJOA 1R39A 3QWJA 3SD0A 4FEXA 1QPJA 3ORLA 3QUDA 3EQDA 4OTHA 4R1YA 4BCOA 3GU6A 1W7HA 3KK9A 3FSKA 2W7XA 1MUOA 1OUKA 3Q60A 4KIPA 2IO6A 2R3MA 4RX8A 3BHTA 1WMKA 3CS9A 1Q97A 3PE2A 4C33A 3BV2A 4PL4A 3EQPA 3ZSGA 4EK4A 4WKQA 2GTNA 4QPSA 4FR4A 3OCSA 2VGPA 3LPBA 4XX9A 5LMKC 3MA6A 2PUIA 4R7HA 3UG1A 4Y5HA 1JBPE 2BVAA 1PKGA 4A7CA 5I9VA 4G5PA 4EKKA 1NT2A 4FTUA 4ZP5A 2CJMA 2C0OA 2FSTX 3F2NA 3MPTA 3QTWA 3LQ3A 5KKRC 1PW2A 3R71A 2PZYA 1YVJA 3EMGA 3SKCA 3ZLWA 5HICA 3RCJA 3BE2A 4AGCA 5JFSA 3LFAA 4ASZA 5DHJA 1U54B 5HG8A 3D5UA 4I6FA 4Y95A 4IZ7A 1PJKA 3F2AA 1J91A 2WQEA 4IB3A 2CN5A 4QP1A 5FG8A 4KINA 5AIKA 5HE0A 4BCPA 3P7AA 3OCGA 3RPYA 4IAAA 3ZLYA 4IE9A 4GFGA 3HZTA 4QMSA 5CANA 2JDVA 3D15A 4RRVA 2G01A 5H8EA 3V8WA 4BYJA 2C6KA 4O82A 3KGAA 3QXOA 3IKAA 4GVAA 4O2PA 4CCUA 1MP8A 3DBCA 3TKIA 3D2IA 4FKWA 4G31A 3TV4A 2YDKA 1PKDA 2ITUA 2ZDUA 3DCVA 3UC3A 2C5XA 2QODA 5A4TA 1F0QA 1WBSA 4EKLA 2QOCA 4RJ4A 3PDTA 3QTUA 5HE3A 3DDPA 2BHEA 3F61A 3A2CA 4AU8A 3W2QA 3A8XA 3UQFA 5M55A 3E63A 4R7IA 5DH3A 4DG2E 1DI9A 3UIMA 1UU7A 4NZWB 4DA5A 2YA9A 2ZVAA 4YTHA 3ZO3A 2RL5A 2PWLA 2WMUA 4DG3E 2Y4PA 2Z2WA 4J96A 3V5TA 4JX7A 4I22A 1B6CB 4RIYA 3UE4A 4X0MA 1OB3A 2CHLA 3O17A 5IEXA 2QNJA 3AC2A 3VS7A 4C0TA 5A3XA 3O8TA 1A06A 3TUBA 3DAEA 1GZ8A 5AX3A 3EQIA 5B0XA 3ULIA 4G6NA 1IEPA 4RLKA 4G3FA 3UNZA 3SGCA 4O0SA 2GS7A 2RFEA 2WMAA 3PWDA 3NVMB 2YZAA 2XJ2A 4LRMA 4AGWA 4FG9A 3Q4TA 2JKOA 1M52A 4DFNA 1GNGA 4L53A 3UODA 3TV7A 2X8EA 3P08A 2WMSA 4O7LA 4YJUA 3GC8A 4S31A 5IUGA 5EHYA 2R3FA 2W4OA 3E3PA 3EQGA 3HMMA 4PMMA 5M4FA 3Q4ZA 1H1PA 2WMTA 2VTMA 4OLIA 1XH9A 2O0UA 3JS2A 3M11A 4PWNA 5HVYA 4GT4A 3C0GA 3VBQA 1R0EA 3KY2A 2WD1A 3W10A 3PIXA 3LOKA 5HIDA 4BICA 1NXKA 4AG8A 5CF8A 2X81A 2Y7JA 3BU3A 3F69A 4V0GB 4YR8A 2QI8A 2VTNA 3HKOA 2YCFA 4U8ZA 3QWKA 5I9ZA 3NRMA 2CCHA 2OJGA 1PMVA 2Z7RA 2F57A 3LJ0A 3S4QA 2XKDA 3V8SA 1Q3DA 1Y8GA 4H3BA 5IPJA 3ZYAA 4UXQA 3QF9A 5DPVA 2XP2A 3QRJA 4YZ9A 5CSWA 3BEAA 4PPAA 4DH3A 4TY1A 5FWKK 4HYSA 2WPAA 3RNIA 4FKQA 3AGMA 4NCTC 4O7RA 4O7VA 5FDXA 2GNFA 3NW6A 4HGLA 4BCGA 1FGKA 5EK7A 3CLYA 3N4VA 4L3PA 4L52A 1Q8YA 3CY3A 4E4MA 2RFNA 5JMSA 4MNEB 1R0PA 4GU6A 3MPMA 4LM5A 1Q5KA 5HO8A 5KZIA 5TE0A 4YURA 2XB7A 2OH0E 3OG7A 4Z16A 3FMKA 3GBZA 4EH5A 2B7AA 4YZBA 3FLNC 4X6QC 4L3LA 4FV8A 5A4QA 5E1SA 4C35A 1WBPA 1OUYA 2OJ9A 2XRWA 4GCJA 2WB8A 4JX3A 5DFPA 4BDAA 3AMYA 3MN3A 2KULA 4YC6A 4U43A 5IQCA 4A9YA 4R6VA 4XMOA 4USDA 5M53A 3U9NA 1Y91A 5C27A 2OH4A 4ERKA 2P3GX 3H0ZA 5BUJA 2XBAA 3R00A 3BELA 1Q41A 3KF4A 2OU7A 3LXKA 3QRIA 4AGUA 4QQ5A 4FIHA 4L42A 5D7VA 4C57A 1SVEA 2XIKA 2ITWA 5DIAA 4QNYA 3JPVA 4FOCA 3ZS5A 4B7TA 2AC5A 3QGWA 4CRSA 4OW8A 4M0YA 5B2MA 3LXPA 3MH1A 4ZSGA 4IEBA 4EC9A 3COIA 1XKKA 2J50A 4WA9A 2ITYA 4XUFA 4ZSJA 3PIYA 4DG0E 5E8YA 3QD2B 3NR9A 3KREA 2R3KA 3GCVA 1OITA 4EBWA 4HVIA 2JFMA 5EW3A 2WNTA 2XKEA 5CAOA 5DRBA 4WNOA 4IX4A 5AR5A 4JVGA 2W1GA 4FMQA 1Z9XA 3BCEA 1W82A 2EXEA 2OICA 3AD4A 4GK3A 5BVKA 4RQKA 4EHGA 4XV1A 2XIYA 2BILB 3UQCA 2WZJA 2R4BA 4OTFA 3PG3A 2ETMA 3CQEA 4IH8A 4RIYB 3RHXA 3DBDA 1REJA 4CV9A 1RW8A 4DFXE 4MXCA 4PP9A 4D2TA 3MJ2A 1PY5A 4RWLA 3TACA 2P0CA 4E5WA 1OMWA 4FC0A 5LMBA 2JIVA 3FDNA 1FVTA 2W0JA 4FT0A 4JR3A 5JRQA 2O63A 3S0OA 2P4IA 3Q5IA 3FKNA 5L6PA 4KABA 1FGIA 5ANDA 3HV7A 4MF0A 4MWHA 3UTOA 5IF1A 2R3NA 2ACXA 1YKRA 3VIDA 4F6WA 4PPBA 5FXQA 3UZTA 4FVQA 3THBA 3OZ6A 3ZHPC 3MESA 3V8TA 5EW8A 3RK5A 5KX8A 4FTQA 3BLRA 3VS1A 5HLWA 4DTKA 5HBEA 3VUMA 4DT9A 4BCNA 4ZTMA 4UMQA 1FQ1B 4PNKA 2HWOA 3NUPA 3JYAA 4YO4A 2R3RA 4HOKA 3HUCA 4W4XA 2J0MB 3PJ1A 3ZTXA 2X1NA 4UBAA 1M2PA 3NUXA 1WBWA 2F4JA 2VU3A 3PWYA 5F20A 3LFSA 2I0VA 2OGVA 5DG5A 4E4XA 2YDJA 5IDPA 2XJ1A 2PVFA 1P5EA 4OAUC 3KXMA 4H39A 3R8PA 1ZWSA 4WNKA 1OIUA 3C5UA 4Y72A 3TNIA 2HAKA 2J6MA 3D7TB 5AR2A 2CNQA 4GRBA 3ZFXA 3HV4A 4DH7A 3W2PA 4JAJA 4MEDA 4W9WA 4AQCA 4X2NA 3QD0A 2VWBA 3FXXA 5HG7A 3NUSA 4A9TA 2GHMA 1FVRA 3FSFA 3LCSA 3R63A 5FDPA 2P55A 4F70A 2CMWA 2OZOA 3CKWA 3OWLA 3VHKA 4KS7A 3RALA 4AZVA 3PZHA 3AMBA 4D2WA 4JRNA 3UYSA 1YWRA 3RWQA 5I0BA 3D94A 3F3UA 3HX4A 4FKTA 4LUDA 2G15A 3PRIA 4JDJA 4RJ3A 1OIQA 1H0VA 4HCTA 3R1SA 3QL8A 4RFYA 3PIZA 1WBTA 4QQTA 3QYZA 4YJVA 4O0VA 1Y6BA 2H8HA 5LVNA 1WVXA 3IDPA 2YITA 3UOLA 4FTKA 5HLNA 2BRBA 1YDSE 2WTKC 4LGDA 2EB3A 3A7FA 4D1XA 3S2PA 1URWA 4FSWA 3ZUUA 4DEBA 2HW6A 2W4KA 4EUUA 5AUTA 5CAUA 5M4IA 4WT6A 3QCSA 2BDFA 4FUYA 4IWQA 2V62A 3MBLA 3D5WA 5H9BA 5I9YA 4RG0A 1VYWA 2CKEA 3H9RA 2W96B 1B38A 3DXNA 2UVZA 4KA3A 5L6WL 4CFMA 4D5KA 3PJ2A 4AOTA 4G3CA 1VJYA 5HCYA 2PUNA 4FGBA 4ITJA 4PUZA 3I0QA 4CNHA 4F7SA 1H25A 3F5UA 5C4KA 1Q3WA 1PXPA 4JL9A 3D7ZA 3FY2A 4YBJA 3D5VA 3QQHA 4XRJA 2UZTA 4XV3A 3C4ZA 4F4PA 2OO8X 4PNIA 2XA4A 5CXHA 3ZRKA 2XMYA 3OW3A 5BMSA 4R3PA 3EN4A 3EKNA 4A4LA 5JEBA 5CU0A 3EJ1A 3HRBA 3V6RA 4F9YA 5DR6A 4UWYA 3VQUA 4EQCA 4XEYA 2WMBA 2WMVA 5IISA 5I9XA 3RNYA 4D58A 2J5EA 3KA0A 3PXZA 1OL6A 3LLTA 3WE4A 1XBAA 4Q2AA 3EWHA 3P23A 3NAXA 5FP5A 1H24A 2DWBA 2YIQA 4BIEA 1S9IA 2FGIA 4O1PA 4CCBA 2GNJA 3UZPA 2C6EA 3Q9WA 3NYXA 5CSXA 3WF6A 4B4LA 3GC0A 3F7ZA 5DGZA 3K2LA 2O2UA 4E5BA 4E73A 4BDCA 2YFXA 3FEGA 1ZARA 2EXCX 1GOLA 3FL5A 2UW8A 3ZXZA 3KRJA 5ETFA 2HK5A 2X39A 3IO7A 4EOLA 5L2IA 4DEAA 1G8AA 4ZMEA 4KRCA 5FP6A 4K6ZA 3OT8A 4ZLZA 2QHNA 4UZHA 2FSMX 3EN6A 3IK3A 3NS9A 3PUPA 5CT0A 2VTAA 4NTTA 4OR5A 4ASEA 4Z7GA 4UX9A 2PMOX 4EOMA 3RZBA 3ZC5A 4C3RA 3DKGA 2QOBA 4RSSA 3TZMA 4AZSA 5FLFA 4TW9A 3W18A 5BYLA 4FTRA 5KMIA 2JFLA 1B39A 2R3JA 3G5DA 3GT8A 2R0UA 4JIKA 3QD4A 5JRSA 5HEZA 1UNHA 4F7NA 5C01A 1ATPE 3E8EA 4DFYA 3MGYA 4Q5EA 5CWZA 3E8CA 3G33A 4TZRA 2CN8A 4EI4A 4XRLA 3VJNA 5CEKA 3SXRA 4C61A 4EZ3A 1IAHA 2YIXA 3HRFA 3MV5A 3ZCLA 4HW7A 4DHFA 4O0TA 5LWMA 2I7QA 4C8BA 3A7GA 1WAKA 3LQ5A 5AUVA 4L46A 4ANNA 3QRTA 4UYNA 4ALWA 4CFWA 2R3OA 3LCDA 5KZ0A 2UVYA 2WTIA 3CJGA 3D7TA 4FYOA 5LVMA 4R1VA 4DTBA 2A4LA 3KMMA 3ORTA 4FKLA 4NL0A 3NVKI 4X7QA 3KF7A 3UYTA 2CGVA 3BQRA 4ZOGA 3DGKA 4ARKA 3OS3A 3FUPA 2VTRA 4HVHA 2YEXA 4JBOA 4GH2A 4GG7A 4HYUA 4Y8DA 3TTIA 2XK7A 3ZEPA 2XEYA 4RC4A 2VTSA 5E8XA 1PXIA 4J8NA 3F82A 5EQPA 3R8ZA 4RVKA 3E8NA 1JQHA 2RSVA 5EM6A 4U5JA 4O0YA 3RPRA 4S33A 4ANQA 3GFEA 2OFUA 4BWKA 3UGCA 4QP4A 1UU8A 2ZM3A 4LV8A 4YNOA 4QMYA 3PA4A 4YPSA 3ZFYA 4ACHA 5HVJA 1O6YA 1R3CA 3SVVA 3PG1A 5D41A 1IA8A 2GQGA 4K18A 3V5JA 4BI0A 5E9EA 1TQPA 4PRJA 3QCYA 5GNKA 5ANGA 3M1SA 2ZV2A 4AXAA 4ID7A 1J1BA 5T3QA 4ANMA 4AA5A 4RVLA 2PHKA 3RZFA 2ERZE 4C62A 3DB6A 2PVKA 1MQBA 1YI6A 3FYJX 3CIKA 2V0DA 3GCQA 3RAHA 1CDKA 2ZM1A 1O9UA 2O3PA 3HYHA 5FXRA 3D2KA 4NJ3A 3ZZEA 4APPA 2W99B 3MH2A 4AE9A 2VNYA 2Y0AA 2W9ZB 2WGJA 3FZ1A 4HGSA 4JQEA 4XG2A 3QKMA 3E62A 3WIGA 3OCBA 3E93A 4FE2A 3BHUA 3KULB 4BDIA 3TUDA 4B0GA 3UO6A 3PJ8A 4FTTA 4QD6A 2BKKA 2J0LA 1E9HA 4BKYA 5CSVA 1FINA 2CNUA 2QOOA 1CM8A 2QONA 2WMQA 5JH6A 2VD5A 1AD5A 1H8FA 2G1TA 3MB7A 3BYSA 2C5VA 5BYZA 4F9BA 1WBOA 3NSZA 3JY9A 4Y46A 4XG8A 4XG3A 4HGEA 3G2FA 4ZMFA 4A4OA 4RJ5A 1I09A 1HCLA 2BAKA 3ETAA 3QC4A 2PL0A 3HMIA 3LJ2A 3VUHA 2EUFB 4FIFA 4G1WA 3PSDA 3UDBA 3E64A 3MPAA 4PTGA 5EDRA 1ZMWA 4PMSA 4AT3A 4IB5A 4WHZA 4RJ6A 3FQEA 3SG9A 3VS2A 2VTQA 4KD1A 4RIWB 4ZTHA 4RQVA 3ZFMA 4GYIA 3SDJA 4I5CA 1L8TA 4O0UA 1BMKA 4OTIA 4DITA 3QCQA 3R7UA 2GQRA 2E9UA 3VO3A 3ZLSA 2OJIA 4XV9A 2PTKA 3KRLA 4A4XA 4XG9A 2XNEA 4PMPA 3P7CA 4OTWA 3FI8A 3HRCA 3IW5A 1OM1A 3R02A 5ICPA 2R3HA 1Q24A 5CX9A 4ASDA 4MD9E 2BKZA 4IJ9A 5E90A 2IZSA 4LGHA 4NM3A 4NKAA 5EYCA 5IQBA 4E20A 2HZ0A 3EIDA 1ZZLA 2QOQA 2WTDA 2J7TA 3O8UA 4NT4A 4F9WA 1F3MC 4KBAA 4OTGA 4IX5A 4I92A 4BTJA 4BTMA 2YZLA 3DXQA 4FZFB 5CVGA 3FLYA 3I7BA 3KXZA 3Q9ZA 4QTDA 1KWPA 3F3TA 2H6DA 5EI2A 1LPUA 1IR3A 4MNFA 4X2FA 2B9FA 4MK0A 3WARA 1XH7A 2OF2A 3F3WA 5IKWA 3FXZA 3C5IA 4OBPA 4I4EA 4F0IA 3QUPA 5IH4A 4U3YA 4KRDA 4BDKA 5AP0A 2XVDA 5I4NA 4NTSA 3MTFA 3DT1A 5M06A 4L68A 4J98A 2WFYA 4UV0A 4ANBA 2VAGA 4FZAB 2J4ZA 3JUHA 4YLLA 1YDTE 3L8XA 4EH6A 2PPQA 5EQYA 1GJOA 3OXIA 4FIJA 4DT8A 2YIYA 4LGGA 2OXDA 3R73A 5JK3A 2YLEA 3FE3A 4L7FA 4F0GA 4CQEA 5AA8A 2QOHA 4BWXA 2GS6A 2QOIA 4RGJA 4EH4A 3P5KA 4WRSA 4ALUA 3ZOSA 4KBKA 4R5SA 4ZTSA 5B2KA 4F7JA 4MAOA 4UMRA 3KXGA 5F94A 3WE8A 2KTYA 4ERWA 3LKMA 4FSTA 5HTCA 4MWIA 3NCGA 2GDOA 3PXQA 4JAIA 3VUKA 4O6EA 2HIWA 2JGZA 3QFVA 2XNPA 3QLGA 3FI3A 4IX3A 1PXLA 3VUTA 5AV1A 4E1ZA 4FIGA 4JDKA 5CENA 2BAQA 4YJQA 1H01A 2JDOA 4XYFA 4CLJA 3ULZA 2QOFA 5LARA 4DLJA 5CSPA 2PYWA 1DI8A 1UA2A 3KU2A 2ZOQA 3BHVA 2QVSE 5CVFA 5HBHA 2JKQA 5GHVA 1YQJA 2H9VA 1STCE 3TI1A 3A7IA 3KN5A 4KIOA 3GB2A 1NY3A 3QBNA 3R1NA 5BVOA 2J0JA 5HU9A 3ZO4A 2YM6A 4X2JA 4HYHA 3RI1A 3FWQA 4FIIA 4UXLA 5FEEA 3R8UA 2BDWA 5L2QA 4ZJJA 5CXZA 4MNEA 4HVSA 4U81A 4UY9A 2JBOA 4BIBA 1ZYDA 3DLZA 4F08A 3MFUA 3QLFA 3JVRA 4FKJA 4L6QA 2JEDA 4BI2A 5M57A 3ATSA 5K0XA 5J87A 1TQMA 3LMIA 3CTHA 3SXSA 4PP7A 1XJDA 3EH9A 1R78A 4FSNA 4M15A 4M12A 5FTOA 5H8GA 2QHMA 3O51A 3DTWA 4G3GA 3CD8A 2QCSA 4I4FA 5EFQA 5HI2A 4ZY6A 4ZTQA 4EL9A 3SQQA 3SHEA 4UZDA 4CMOA 5HHWA 4GKIA 3IW8A 3ORPA 5C1QB 5JGAA 5BPYA 4PTCA 3IQ7A 3KN6A 3OP5A 4JT3A 3K54A 5K3YA 3JY0A 3KVWA 5K4IA 4FVRA 4YZNA 4BDGA 3E87A 2XIXA 3R22A 4IM3A 5AUXA 4NW6A 1UNGA 4QMUA 4IMYA 2C0IA 2CDZA 1H1WA 3NNWA 4XV2A 2P2HA 3QZHA 3ZDUA 4QPAA 4YLKA 5K5NA 2GQSA 5EYKA 2UW5A 3H30A 3RP9A 4AA4A 3QQFA 4KBCA 4AGDA 3GU5A 4XG6A 4AP7A 3EYHA 3KEXA 4U80A 4XLVA 4D4YA 3TXOA 4F64A 3FLWA 2FA2A 3DOGA 5L8JA 3H0YA 2WIHA 1OPJA 2JDRA 2YWPA 3FZOA 4QP9A 4U45A 4EOIA 1ZXEA 4FTNA 1P14A 1YOLA 3LXNA 3UG2A 2J51A 3BX5A 5IMEA 2R3QA 3W2CA 1Y8YA 3KCFA 2VTHA 4FSUA 4J53A 3AXWA 4QMZA 4YJTA 1K3AA 4IW0A 4DEGA 3VS4A 2JC6A 4GJ2A 1OZ1A 4WOVA 5TF9A 4EHEA 5CEPA 2VTTA 4X2KA 4CT1A 4AW1A 1PXNA 4JOAA 5AP6A 3FBVA 5DNRA 5LXMA 4ZJVA 2ZM4A 3FI2A 4O0RA 3RPVA 2GTMA 4W9XA 2WMWA 3QZIA 4GL9A 3VUDA 2B4SB 1OI9A 3BYUA 3GC7A 3LM5A 5D9HA 5GJGA 2B9HA 3MIYA 3COMA 1SMHA 1MRVA 3C4XA 4ZAUA 2XNOA 2X9FA 1Q4LA 4CT2A 2W1CA 3DS6A 3ACJA 4JG8A 5KMJA 5LOHA 4NK9A 3W1FA 1YWNA 2XKCA 4DTAA 3LXLA 2JLDA 2QLQA 5FBNC 4N57A 4C36A 5GJDA 4ZLOA 4G17A 4BWPA 1DM2A 3EHAA 4O7ZA 5IU2A 2W5HA 4W8DA 3BYMA 3H4JA 1RDQE 4LG4A 3PVWA 2WU7A 4IB0A 3FY0A 1Q8ZA 1S9JA 5DR2A 1XO2B 4HZSA 5ETAA 3OCTA 3T3VA 5CEOA 1VYZA 3R28A 3TTJA 1JVPP 1GIJA 2VTOA 4FZ7A 4IJPA 3MS9A 3PP1A 4FSZA 5DYJA 3TM0A 3R8LA 4DH8A 2XEZA 5AR8A 5AR3A 1OIRA 3FV8A 4BGGA 2XCKA 3OHTA 5IQHA 4TPTA 2PZ5A 3FMEA 3P1AA 4BGHA 4C02A 3JXWA 2F7EE 2BALA 4CD0A 3NDMA 5DMZA 4ACGA 3R9RA 3KRWA 4YHJA 5AV0A 3DU8A 5BMMA 4HNFA 3SOAA 4DLIA 3WZJA 3ZM4A 4CZUA 5AP3A 4JBQA 3NIZA 4IXPA 3C0IA 5EDQA 1W8CA 2BHHA 4XJ0A 4L44A 1H1RA 2NO3A 1V1KA 5E8VA 4E5AX 5IQGA 3OVVA 3DDQA 3LFBA 1I44A 1W84A 3CCNA 4FUXA 4GU9A 2NP8A 5E91A 1VEBA 1H4LA 4JJRA 5M56A 1APME 2IZTA 2YAAA 5D1JA 4MYGA 2OZAB 4C7TA 5C8NA 5GIOE 4QYGA 2I0EA 2WMXA 4QMXA 3DY7A 4FV5A 1IASA 3UIUA 1PF8A 1VZOA 1CKIA 3AT2A 4FL3A 4P5QA 4TYGA 4C4GA 4C3PA 1O6LA 4ENXA 5FTGA 2C3KA 3POOA 4EJNA 3WF7A 3V01A 5HX8A 3NAYA 4RZWA 4ZZMA 4RX5A 2HZIA 4DGNA 3NYOA 3IW4A 2ZJWA 4CMTA 2F2CB 3R6XA 4JIAA 2BRGA 4O1OA 2CGXA 4DEHA 3OF0A 3AD5A 4GUBA 1XHAA 4LRJA 3DBFA 4QTAA 5BVNA 4PDYA 4I6BA 2OZAA 4YZCA 5HZNA 3RMFA 4IM0A 3TV6A 2WOUA 2ITTA 4HYIA 2C6OA 2C6TA 3F88A 4X21A 4ZSEA 3S00A 1DAYA 4F99A 5L8KA 3OT3A 4BDDA 3L8SA 3LFCA 3BHHA 3FYKX 5HQ0A 5J7HA 4LOQA 3B2WA 3FZRA 4GG5A 2HCKA 3SXFA 4ENYA 3DFAA 3OWJA 3Q3BA 4D55A 3FHIA 5J5SA 3FZPA 4B99A 4I94A 4MH7A 5DWRA 4BI1A 3P7BA 3RAWA 4LL0A 3CE3A 4EQUA 4IX6A 2X4ZA 4BCFA 2C4GA 1BKXA 2QO7A 4XG4A 5CYIA 3U4WA 3BYVA 1RQQA 3EKKA 3C13A 1P4FA 1Z57A 1IRKA 3COHA 3BE9A 3FPMA 3LFEA 1Q8UA 2HY0A 3FI4A 3LCKA 4WNMA 2GHLA 3KB7A 2DYLA 4M69B 5J9LA 4ANSA 5HOAA 1Y57A 4DGMA 1QL6A 4I5MA 3Q53A 3RVGA 1J7LA 2FB8A 3UC4A 5ETIA 2Y6OA 4C34A 4O7WA 4TXCA 5H2UA 3ZO1A 1EH4A 5CVHA 3R7YA 1G8SA 3DK6A 4I5HA 4IVAA 2NPQA 3EFJA 3FKLA 4PDSA 3LFNA 4G2FA 4GK2A 1YXVA 2W1DA 3EFLA 1DS5A 4CMUA 4NWMA 5M07A 2A2AA 4AN3A 2BZKB 3F66A 4YJSA 4MXAA 1WBVA 3W16A 3GU7A 4ZEGA 4CEGA 2E2BA 5BUIA 3NCZA 4FTOA 3OOMA 3NUAA 3Q96A 3A7HA 2REIA 3ET7A 4C2VA 5I9WA 3VAPA 2GU8A 3KL8A 2Z7SA 4RFZA 4TWCA 4L43A 2CGUA 3DFCB 2O8YA 5HO7A 2BFYA 3CTJA 4GS6A 5ACKA 4I24A 3QALE 4WUNA 1AGWA 2WQOA 5BQ0A 2F9GA 5C03A 4F6SA 3QZFA 3ZBXA 2J9MA 3DBEA 3TG1A 2CSNA 5HG9A 4LOPA 3MY5A 4TNDA 2VO3A 4I0RA 4BBFA 4X3FA 3QKKA 2ITXA 2VWUA 4EEVA 3TT0A 2E9OA 4B9DA 4FV6A 1J7IA 2UVXA 2PMLX 2EU9A 5DN3A 4GFOA 4CLIA 5LCJA 5M4UA 1M7QA 3IDBA 5A14A 3H9OA 3K5VA 4IADA 2XZSA 4XS2A 4F9AA 5HTIA 4PX6A 3VS6A 5CALA 5DI1A 2BMCA 5EKNA 4RVMA 2WEVA 3IDCA 3HGKA 5JGBA 5IQIA 2OI4X 3RHKA 4RZVA 4F09A 3ENMA 3MH0A 4FKOA 3MSSA 5EHOA 1GAGA 3R1QA 3NMUF 1PMEA 3BIZA 4QQCA 3OBJA 4H1JA 2A19B 1NVQA 2F2UA 2OXXA 3PPKA 4GIHA 4TNBA 4K1BA 2YM3A 1Y6AA 1LEZA 3G90X 4FEWA 4PPCA 3C4CA 5CF5A 2ZV7A 3OUNB 4D4VA 2Y4IC 2HXLA 4BN1A 2W1HA 3RK9A 1KSWA 2B9JA 4QMOA 2WTVA 4EK5A 3QUEA 3LCOA 4W4YA 3RBWA 2UW7A 3IECA 3MYGA 3HLLA 3Q4CA 5IQDA 3L8PA 4FV7A 5B7VA 2PVHA 4CFVA 4D4SA 3UO4A 4O91A 3PVBA 1V0PA 1XR1A 4V05A 4AW5A 4FYNA 2YACA 4GIIA 3U6IA 3ORIA 2XRUA 2F49A 5AA9A 5LWNA 1PRYA 2BFXA 2UW9A 2CKPA 1NA7A 3C4EA 5FM2A 3RINA 3ZUVA 3TWJA 3DA6A 5LVLA 3D14A 4I20A 4FV4A 4MXZA 1QPDA 4QMVA 4BVUA 4HVGA 3CR0A 4YP8A 4ACMA 2SRCA 2Q83A 1L3RE 3KXHA 3DK3A 2OSCA 4D9UA 1U46A 2I0HA 2XNNA 5AAFA 4IWOA 3V3VA 3SW4A 4WG3A 3IOPA 5HKMA 5HD4A 3IPHA 1W0XC 5KMKA 5LCKA 3L9MA 3HA6A 4QYHA 3VHEA 2PSQA 3U54A 5ANIA 4YU2A 4TTHB 5C8MA 2VTIA 4C59A 2YM4A 2UZUE 3AC5A 3BZ3A 3S95A 3KMWA 4P4CA 5KBRA 2ZYBA 3V5QA 2Y9QA 2QO2A 1JLUE 3LFFA 2UZLA 3QQJA 1BL6A 3OUKA 4RIXA 4GEOA 2YCRA 4AZFA 3QQGA 5E92A 4AW0A 4IDTA 4LL5A 5DT0A 5CQWA 4YJNA 4OGRA 2HXQA 4Y85A 5JKGA 1ERKA 3QTXA 3VBYA 1FOTA 5EM8A 4GJ3A 4OTQA 4H05A 2O65A 3BLHA 1U59A 3GCPA 2YN8A 3DQWA 4G6OA 4K8AA 5JFXA 4GK4A 4O7YA 4XH6A 4CYJA 5AP1A 1JNKA 5HGIA 4FSRA 2ZAZA 3WI6A 2PZPA 2C68A 4FL2A 2VX0A 1LEWA 1OVEA 3VC4A 4FEQA 2QQ7A 2DUVA 4OTRA 5D11A 1O6KA 3DTCA 4ACDA 2FYSA 4X3FB 4BC6A 2QKWB 4BZDA 3PXKA 4FKIA 3BI6A 4ZTNA 3QTRA 4CZTA 5ANEA 2PY3A 3FQHA 3PPZA 4FKPA 4IWPA 4TRLA 5EM7A 5H8BA 4AAAA 3C9WA 3O7LD 4Z3VA 4FG8A 2E9VA 4JRVA 5A6NA 2QOLA 4NW5A 4D5HA 4NSTA 2UW6A 5K9IA 4ZSLA 3EYGA 2J5FA 4XBUA 2X7FA 4QYYA 4XHKB 3D0EA 3ZUTA 2BZIB 3I1AA 4DFUA 4IC7A 2V22A 4M69A 4GW8A 4O38A 4Z9LA 3TZ9A 1IA9A 4QNAA 5IH6A 5JZNA 4YTIA 1SVHA 3CC6A 2CNVA 2QC6A 4DH1A 1Z5MA 3U8WA 5AUWA 3PSCA 4QRCA 4ZK5A 5BYYA 3Q9YA 4CKIA 2B55A 2XK3A 2CLXA 1A9UA 2PMIA 2OK1A 3UP7A 2VUWA 4MF1A 5EW9A 3PTGA 2W5AA 3H9FA 2C3LA 4PQNA 3S1HA 3N4UA 3KRRA 3AD6A 3B8QA 4FNWA 4GVJA 4FTLA 2C5OA 3LVPA 4QMLA 5A9UA 3OOGA 3KKVA 3QHRA 4OBQA 3BBWA 2PVRA 4LV5A 3A61A 4BDEA 3PY0A 4NH1A 4F7LA 3EQHA 3PXFA 4M67A 4OTPA 1M7NA 4XCUA 2ERKA 3DNDA 3MW1A 3MVLA 5CU4A 4DEDA 2OIBA 3ENHA 3PXRA 5DOSA 4CRLA 2X2MA 3M2WA 5LJJA 2GHGA 1PHKA 4RWJA 5FD2A 2AUHA 3GU4A 3IGGA 2ONLA 1ZYSA 1QCFA 2XYNA 3EZRA 3HEGA 3LQ8A 3MVMA 3OBGA 3GU8A 3POZA 4NM7A 4TWNA 3V51A 4MVFA 4NFMA 3TNHA 5HX6A 3SG8A 5IA1A 3ZZWA 4DYMA 4U41A 3C1XA 3PZEA 5DVRA 4CG9A 5IZFA 3NPCA 3PXYA 3ZM9A 2C6MA 4AZEA 5KCVA 3TNWA 2V5QA 3DJ6A 5J8IA 3O2MA 5ANOA 4TYHB 5EOLA 4R5YA 4WBBB 4K9YA 2PE1A 4EH9A 3UVQA 5FBOA 3MFTA 5EYMA 2HOGA 5CU6A 5HG5A 3UMWA 4EWQA 1QMZA 4KKHA 1U5RA 2E9NA 2QR8A 3ITZA 4I3ZA 5CEMA 2PZRA 4WUAA 1T46A 5BVWA 5HLPA 3TZ7A 3WZUA 5AP2A 1JSUA 4AZTA 4FODA 2PULA 5IH5A 3TDWA 2JDTA 3LMGA 4FICA 3CKXA 3R01A 3S3IA 1K9AA 5TOZA 4F65A 2DS1A 1GIIA 2O5KA 3ZSIA 4AZWA 3P4KA 5E8ZA 4H3QA 4DH5A 4KS8A 1OKZA 2R0IA 2Y6MA 3EL7A 4GKHA 4YZDA 4FKRA 2GPHA 2JBPA 1U5QA 1UU3A 4LYNA 4QYEA 2IJMA 3SX9A 4A9SA 4E6AA 5KMMA 4BHNA 3SW7A 3DAJA 4CGAA 4JR7A 2C3JA 4UWBA 5CZHA 3VUIA 4FK6A 3ROCA 3HP5A 3ORKA 4MBIA 4CSVA 4FV0A 2WELA 3KRXA 4S34A 4AX8A 5EG3A 3Q9XA 3DBQA 3AC1A 3EQBA 2RGPA 4C3FA 5A6OA 4J7BA 5LMAA 3QC9A 4AN2A 3FC2A 4IFGA 4NEUA 4PTEA 3HNGA 1UKIA 2WOTA 3ORNA 3QA8A 3QTIA 4H1MA 4LUEA 4ITIA 2I0YA 4YTFA 3DZOA 3ZRLA 4ORKA 1PMNA 2VRXA 1R1WA 2UW4A 5TO8A 4EOSA 5D12A 4PF4A 3C50A 3PP0A 4FV3A 2Y4IB 3RK7A 3NGAA 4G5JA 4YSMA 2R3PA 2GCDA 3F3VA 4FV1A 3R1YA 2WTCA 4CXAA 3I6UA 2YERA 3UMXA 2Q0NA 1QPCA 3GGFA 1KOAA 4APCA 3W33A 4FX3A 1H00A 4EOKA 4J71A 4O6LA 1YHVA 2YM8A 4U9AA 5A4CA 2OG8A 1KE9A 3G6HA 2UW0A 4KIKA 4FKUA 5M08A 4DINA 2C30A 2VO0A 4D0WA 4YUQA 3GI3A 4NU1A 5C9CA 2PVJA 1CSNA 2QLUA 3FMLA 2BZJA 3R7OA 2X7GA 4HCUA 2E9PA 1ZLTA 5KMNA 3LHJA 5IA0A 5AP5A 2VTPA 2WQBA 2ZMCA 4GT5A 3W2SA 2OIQA 2H96A 3IONA 3A7JA 3IW7A 3UPZA 2PVLA 2G2IA 4IC8A 3LJ1A 4FSQA 2XNGA 3GENA 2BRNA 2FO0A 4ZIMA 3T3UA 4EOPA 5LVPA 3SA0A 3L1SA 3OFMA 3QX4A 2WTWA 4U7ZA 5GINE 5I9UA 4UMTA 3CPBA 4CKRA 4IZ5A 2YM5A 3E8DA 1UVRA 4RJ8A 2JIUA 4AOJA 3DB8A 3WF5A 3SOCA 2LGCA 4U3ZA 4B8MA 5IA5A 3UOKA 2JAMA 3KQ7A 5CAPA 3T8OA 2FVDA 3OEZA 5DRDA 3VULA 2WO6A 2OFVA 3KC3A 1ND4A 3FMDA 1P2AA 3F5GA 4LQMA 3HV5A 3TKHA 4YSJA 3SV0A 4USFA 3CEKA 4E4LA 3RM6A 3QAME 4FL1A 3D83A 4XP0A 4I0SA 3LE6A 2V7OA 3Q6WA 4QMWA 1H1SA 3FLSA 3RPOA 5FEQA 3TKUA 3TNPC 1YW2A 3I6WA 4W4VA 4ZY5A 2FSLX 4DN5A 3MY1A 4DFZE 2ZB1A 3EN5A 4RWIA 3UIBA 1YXTA 3TL8A 3VBXA 3MWUA 3BLQA 2PVNA 4EOJA 1OKYA 3BHYA 3FPQA 4H58A 5HU3A 1Q61A 2XKFA 5E4HA 4QP3A 4R77A 4PDOA 4LMNA 2GNLA 4FEVA 1JKKA 2XK9A 3RCDA 3NEWA 4FT9A 3AQVA 1WVWA 4ZSAA 3VJOA 4BHZA 2JIIA 3P78A 5HBJA 4MCVA 1Q62A 2B1PA 4C4JA 5HTBA 4JDIA 4RPVA 5BVEA 3R7IA 3UIXA 4AE6A 4IM2A 3NNXA 5G6VA 1PXKA 3R0TA 4E8AA 2RFSA 3GCUA 3WYXA 4MD7E 4FEUA 5KMLA 3FLZA 3MDYA 1BYGA 2VO6A 1A48A 1GZKA 2G2FA 2HY81 5AUZA 2XIZA 4KNBA 5EOBA 3Q4UA 5AV4A 2ITQA 1E1VA 5CEIA 3LMHA 3BU6A 3GNIB 4QQJA 5IDNA 4L8MA 2JKMA 3TUCA 1H28A 4RIOA 1PYXA 4CFNA 4I41A 3WYYA 3Q52A 2XUUA 4HZRA 4DGOA 4O83A 1RE8A 3FMHA 3PRFA 4MXYA 5EI8A 1IAJA 3I5ZA 3W55A 1OKWA 2ZMDA 3FL4A 4C38A 4CFXA 4S30A 4G6LA 3WOWA 4BDJA 5B2LA 4MHAA 5CU2A 4RIXB 4KWPA 4IZAA 2R2PA 3C4FA 4EH3A 3WZDA 4B6LA 2EB2A 3FXWA 4FSMA 4QP6A 4IANA 3EQRA 2Z02A 2IWIA 4BDFA 5JFVA 5ANJA 4AN9A 4MX9A 4RT7A 3LFQA 2GNHA 3CY2A 4BBMA 4WIHA 4JS8A 4NM0A 3CSVA 4HVDA 4E6DA 2OKRA 3R7VA 1ZZ2A 5F1ZA 2IPXA 4GMYA 3DKOA 1AQ1A 2B54A 1YWVA 4RBLA 3PFQA 1KV2A 4D2SA 1FMKA 3QZGA 5ACBC 4L00A 3VF9A 3W32A 1YXXA 4BTKA 2F7ZE 4G3DA 4KB8A 4NKSA 3HDMA 2QG5A 5DBXA 5TKDA 5D7AA 1ZY5A 4BCIA 3GCSA 3QQKA 3WIKA 4G3EA 5CTPA 4IDVA 2Z7QA 3QTZA 1E1XA 3VS5A 4YMJA 2W06A 4KAOA 2X9EA 3PE1A 3GC9A 3DV3A 4O22A 1J3HA 4O7TA 2WQMA 3M42A 4EHZA 3MTLA 3HMNA 1WCCA 3BEGA 3R9NA 1YXUA 3U9CA 4R3CA 3QU0A 3K3JA 3NIEA 1PXJA 3E88A 4I0TA 1TVOA 2C1AA 5HE2A 1W83A 3RKBA 5GJFA 2BUJA 4FZDB 2JDSA 2W17A 4JLCA 2RFDA 4ITHA 3GFWA 5AMNA 3RTPA 4EC8A 4I21A 4QMQA 5LVOA 3H3CA 1KOBA 4JQ8A 4CQGA 5E8UA 3NUUA 1SZMA 1V0BA 4V01A 4JG7A 2VGOA 3SRVB 3ZDIA 2GFSA 4BCKA 5I3RA 4UALA 2BAJA 4DEEA 3REPA 3ALOA 1LUFA 5T6KA 5A54A 3OWKA 4KIKB 2XF0A 4FIEA 3RM7A 1BI8A 3AGLA 2VNWA 4I5PA 2XCHA 5EI6A 2IVTA 3PYYA 2ITOA 2OJFE 3UP2A 5AFVA 4QP2A 4EONA 1WVYA 2AYPA 3O0GA 4AFEA 1ZOHA 5GIPE 5CU3A 3LZBA 2YCSA 2JITA 2B0QA 3O50A 3VRZA 2VTLA 2GSFA 4RIWA 5FGKA 2V55A 4D9TA 3OD6X 3MVJA 3NWWA 3Q32A 3ZXTA 4EZ7A 1OBGA 4J52A 2YIWA 1H08A 3FHRA 4Z55A 2XH5A 1YI4A 2QU5A 2A27A 3UNKA 1YRPA 5L2SA 2YHVA 4K2RA 1WFCA 5ETCA 3CTQA 4DBNA 4QTEA 3HECA 4QTBA 4NUSA 3ORZA 1MQ4A 2IG7A 4FI1A 4L01A 5AM6A 5C26A 4IAIA 3BBTB 4H3PA 4C4FA 5E8TA 4D4RA 2YJSA 1IG1A 3BV3A 4U42A 4ZZNA 5L2TA 4EK6A 2CKQA 2C6LA 4JDHA 4RVTA 4YJOA 5JFWA 3QKLA 3HDNA 2B52A 4FK3A 4DE4A 4E6CA 2NRUA 4DCAA 4XLIA 4QYFA 2VWWA 4N4SA 4WBOA 3WF9A 3Q04A 5AAEA 2ETKA 2C5YA 4C4HA 4AS0A 1JAMA 1H1QA 4FTAA 4BBEA 3EZVA 3GEQA 4FZ6A 4FA2A 4N70A 4PL3A 4TKSA 3G0EA 1ZYCA 1XH5A 1SM2A 4E26A 2AC3A 4EUTA 5AADA 5J9ZA 5CASA 2YDIA 5KUPA 1GZNA 2BPMA 2UZNA 4ZY4A 4W8EA 4CFFA 4KUJA 4K11A 4RC3A 3VF8A 4QMMA 3QQUA 3HV3A 3ACKA 4MD8E 4IAYA 1OKVA 5CY3A 1M2RA 4D2VA 4A9RA 2IW8A 3N4TA 3VW6A 4GV1A 3P86A 3PY1A 4XG7A 4MBJA 2PE0A 2J2IB 4EH7A 1OPKA 1URCA 3FJQE 4P2KA 3VBVA 5JZJA 2XM8A 2C1BA 5KO1A 4EOOA 4MQ2A 3MI9A 4B8LA 4Z7HA 4BCHA 4UB7A 3AMAA 3VQHA 3N9XA 3ZU7A 3U6JA 3HV6A 4JNWA 3PJCA 4YC3A 3U4UA 3EFKA 4YZMA 1RJBA 3TNQB 3WILA 5A46A 2IW9A 2X4FA 1TQIA 2RG6A 3TCPA 4FTIA 3C7QA 4LFIA 3FKOA 3MY0A 3KCKA 1CTPE 2X7OA 3PVUA 2I1MA 1PXOA 2A0CX 5JSMA 4BY9E 2IZUA 5HIEA 4YJRA 3W8LA 3MFRA 4BR3A 3SLSA 2Z7LA 4QP8A 4I6HA 5I5ZA 5FXSA 4X3JA 3F7WA 2VWXA 3QQLA 1YOMA 3VBTA 4HPTE 2W1FA 5IUIA 3CXWA 5CNNA 5AP4A 5DLSA 3I60A 3G9LX 4J8MA 5AM7A 4A07A 4QMNA 4IFCA 4A9UA 3UZRA 2QU6A 4OAVB 3CGOA 2CLQA 3P9JA 4ASXA 4FKSA 3RJCA 4AT5A 4CTBA 2RG5A 5CEQA 3NW5A 1XH8A 3A4OX 5K5XA 5CT7A 3A99A 5BVDA 3DLSA 4D1ZA 2OBJA 2YWVA 4DBXA 2GMXA 2R3GA 3FMNA 4O27B 4ZJIA 4E4NA 4C58A 2ZV9A 5L6OA 3MJ1A 5FRIA 5JQ8A 4M3QA 4S32A 1YDRE 4UEUA 4CV8A 1H0WA 4ZLYA 3WZKA 3PJ3A 5KMOA 4FOBA 3CGFA 5LMKA 1ZRZA 3DKFA 3EB0A 2VWYA 5IUHA 5K4JA 1TKIA 4ZXTA 5KE0A 4BYIA 1G5SA 2IVVA 5GZAA 2VZ6A 4DCEA 4DGGA 3ZLXA 3ZC6A 1YXSA 2FH9A 3UJGA 2XM9A 5GZ8A 3QGYA 5ANKA 4GUEA 2PE2A 3VNTA 3F5PA 5L8LA 2GNIA 1NVRA 2IN6A 5FQDC 4TYHA 4U79A 3WZEA 2WAJA 5CSHA 2CPKE 4C4EA 4XP2A 2BDJA 3GP0A 5AJQA 3V04A 5T68A 3VBWA 3LLAA 1DAWA 4Y73A 4IZYA 2J0KA 3VW8A 3ODYX 2R9SA 4UN0C 4EJ7A 1H07A 3QA0A 1XWSA 4DC2A 4AW2A 1ZYLA 4WO5A 3OXZA 5ITAA 4WSYA 4BZNA 3ZO2A 2VWIA 3DQXA 3LW0A 1U54A 3L9LA 3GOPA 4U44A 4PV0A 1PMUA 3EFWA 4AACA 5HCXA 4XOZA 4QOXA 5CAQA 2VWZA 3UBDA 1PYEA 4L45A 2PVYA 3UQGA 3F6XA 2BTSA 3A62A 1OIYA 4KKEA 5CI7A 5DT4A 4F6UA 4O84A 4YHTA 3GQLA 4Y5QA 5EQEA 5F95A 4YPDA 3NYNA 4CTCA 3UOJA 3PLAE 3EQFA 2Z60A 2RKUA 2HELA 2QURA 3ZMMA 4F1TA 3DPKA 4EWHA 3AC3A 1H26A 5EDPA 4JBVA 2XBJA 2DQ7X 4U97A 4YHFA 4C37A 4EQMA 1FPUA 4AT4A 4FGRA 1UWJA 4IIRA 3LM0A 4J97A 4NJDA 2O64A 3IW6A 4LMUA 4Y83A 2R64A 1UKHA 5CZIA 1HCKA 4FVPA 4DFBA 3N51A 4F9CA 3BGPA 4QPMA 3UOHA 3GXLA 5DR9A 4K33A 1OPLA 4OTDA 4E3CA 3CP9A 5KKRB 3IGOA 3ANRA 4N6ZA 1OGUA 3EL8A 4H36A 4U40A 4RMZA 3AT3A 1U4DA 5E8WA 4P90A 4TYJA 5M4CA 4IAFA 4CZYB 2YJRA 1SNXA 3LFDA 3OROA 5AIRA 4M13A 4D28A 4IACA 5HNIX 3V5WA 3RPSA 1J7UA 3DNEA 3BWJA 3O96A 4HNIA 4GFMA 2HZNA 3TJCA 3UVPA 3E5AA 4UYAA 4I6QA 3ELJA 3KXXA 3PA5A 4RLLA 5G1XA 3ORMA 2XJ0A 3DAKA 4QTCA 4K0YA 5BNJA 2UUEA 3FZTA 3G51A 4M68A 3H10A 2BIKB 3A4PA 4RJ7A 3VN9A 3WBLA 4DAWA 3R83A 4C4IA 3OXTA 4L67A 3VUGA 4EORA 3R21A 3W8QA 4R8QA 2R3LA 4R7BA 1OL7A 4BKZA 1ZYJA 4IB1A 4ONAA 3C4WA 5TT7A 2UZBA
chains in the Genus database with same CATH superfamily
3OY3A 3QYWA 4RX7A 3UNJA 2HZ4A 3QD3A 1REKA 3O8PA 3ODZX 4JXFA 5L2WA 2WEIA 2QO9A 2UV2A 1FVVA 3G9NA 4MXXA 4YBKA 4FKGA 2OF4A 2VV9A 2J90A 5C8KA 5J79A 4XNEA 2QR7A 5EH0A 2FSOX 2RF9A 3CQWA 3O71A 4FNXA 3OY1A 1OL2A 2C3IB 2WIPA 3ALNA 3HMPA 4F1OA 5IEVA 5IQAA 5M44A 3HMOA 4WD5A 4RA5A 3MVHA 4IWDA 3W2RA 2ZB0A 4EZ5A 3SAYA 2R7BA 2BCJA 2Y8OA 1YHSA 4BFMA 4X6RA 3F5XA 4O0XA 3TEIA 5L3AA 1WZYA 3R7EA 4FV2A 2EVAA 1KE7A 5M51A 3R2YA 1WBNA 2W9FB 4OT5A 4QO9A 4EH8A 4WSQA 5J1WA 5HNBA 4MQ1A 4KKGA 4N0SA 4ZTRA 2X8IA 3U55A 4OBOA 4ZS0A 2LAVA 2V7AA 4D0XA 3KMUA 2XK8A 4QMTA 2ITVA 3G0FA 5JQ5A 4NFNA 2CCIA 2UZWE 4KSQA 4Q9SA 1BLXA 3JVSA 3BQCA 3OTUA 4IVDA 4JI9A 1PXMA 4UWCA 5IMXA 5AR7A 3FZSA 4EH2A 1ZAOA 4V04A 4LI5A 4CFUA 5C4LA 3AC4A 3RGFA 4O0WA 2QKRA 3BU5A 3RWPA 1KE5A 5HD7A 2HENA 4F0FA 2PUPA 1UNLA 1T45A 3D9VA 2IZRA 4M7IA 5FM3A 4ANOA 3F3ZA 1M14A 5EHLA 5AUUA 2C69A 3TIZA 3UPXA 2CKOA 2X6EA 2W1IA 3PPJA 3HAVA 4R78A 5IQFA 3KULA 5M09A 5A4EA 1YHWA 3ZH8A 4TT7A 4I93A 5BX0A 3E7OA 4FKVA 3TN8A 4J1RA 5J9YA 1JKTA 3R9HA 3Q2MA 2IVSA 5KBQA 4I1ZA 2XNBA 4HCVA 3LCTA 3W0RA 3A8WA 1XH6A 2WU6A 3FAAA 4TWPA 3BWFA 5AAGA 3L9PA 4XP3A 4M0ZA 1NW1A 4E6QA 4MXOA 4IBMA 4EHVA 4LRKA 4AWIA 3BPRA 4YTCA 2OW3A 3FMJA 4IAZA 5E7RA 5EKOA 5IA3A 1JKLA 2YABA 4K77A 4YNEA 5CAVA 4PL5A 3K3IA 5KHWA 2Q0BA 3LIJA 3BGZA 4AFJA 4L7SA 4E7WA 3G6GA 1KE8A 3F9NA 3BKBA 4MKCA 3D4QA 3I81A 3NUYA 4JG6A 1H27A 3NNVA 1CMKE 3FQSA 4O4BB 5AP7A 1V0OA 5IQEA 3ZRMA 2UZOA 3VVHA 4FNZA 5IA2A 4NIFB 5GZ9A 2ITPA 5JN2A 2XK4A 3PY3A 4FF8A 2NNWB 3VS3A 2BZHB 1SNUA 5KHXA 5AUYA 2HWPA 4M8TA 5I3OA 1OBDA 3ZBFA 4ACCA 4J99A 1ZMVA 4FT7A 4O2ZA 2IW6A 4YLJA 3NUNA 1GZOA 4UMPA 2JKKA 2WTJA 2PVMA 2NRYA 3I7CA 2WTKB 3OMVA 4BDHA 1GY3A 1VR2A 2C47A 3DJ7A 1ZOEA 2GNGA 2VX1A 2ZV8A 1KUTA 3AKLA 2XIRA 4IHPA 2P2IA 3T9IA 3F2RA 1XBCA 3ANQA 2A1AB 2ETRA 2YAKA 5CLPA 2ESMA 3I0OA 1Q8WA 3MB6A 3SRVA 3TZ8A 5F9EA 3HAMA 4YO6A 4FTJA 3IS5A 2JAVA 1G3NA 1KV1A 1MRYA 4S2ZA 3K5UA 2IVUA 3ZEWA 4D1SA 3GOKA 4A06A 4LV7A 3R04A 1ZMUA 2W5BA 5AR4A 4FT3A 1M2QA 2ZDTA 4D2RA 1JWHA 4BZOA 1SYKA 1OGYA 4AA0A 5FUTA 2YISA 3COKA 3QHWA 4WNPA 1FBNA 5KNJA 5E8SA 3OEFX 5DE2A 1M17A 4G9CA 5DEYA 4BCQA 3ZSHA 2WXVA 2R5TA 2PUUA 2ITZA 3PLSA 3O23A 3G15A 5H3QA 3NW7A 2BRHA 3TJDA 4FG7A 5J1VA 5J7BA 4IQ6A 5IG1A 5AX9A 3DKCA 5AWMA 3ERKA 3ID6C 4O4DA 5CI6A 5DEWA 5K0KA 2OXYA 3QRKA 3VS0A 3ZONA 4N6YA 4L3JA 3JR1A 3FMMA 3RAKA 2XYUA 3AG9A 4ANLA 4KIQA 3EQCA 2C6DA 3T9TA 1Q8TA 3P79A 2VX3A 4NCTA 4AOIA 4EYMA 2XARA 2XS0A 2YM7A 4FSYA 4G34A 4AUAA 1CKJA 2C6IA 3CD3A 4AF3A 4G16A 5AV2A 3I4BA 2OJJA 4TYEA 3TIYA 3VWAA 3ATTA 5J5TA 3P0MA 4IVCA 4YGAA 3HA8A 4BCMA 3QRUA 1W98A 2WMRA 3V5PA 2PMNX 2B53A 3E3BX 4X2GA 2BR1A 4O7SA 3NZ0A 4QMPA 1X8BA 3DK7A 3GUBA 2W05A 5CQUA 3C0HA 4X3FC 5FTQA 4HPUE 4BDBA 2X0GA 3V5LA 3CJFA 3IG7A 4EOQA 2ONLC 3A60A 4OT6A 4BL1A 2RIOA 2X8DA 2GS2A 2PZIA 3Q2JA 4W4WA 4R3RA 1LP4A 3NX8A 3CBLA 3QTQA 4JBPA 4BRXA 2C5NA 3R9OA 2W4JA 2EXMA 2YIRA 4G9RA 2UZDA 1SVGA 3KVXA 1JOWB 1OECA 3E92A 1XBBA 2PU8A 3HVCA 4CG8A 3KK8A 3BRBA 3PVGA 3R8VA 3D5XA 4KSPA 3ROYA 4BKJA 3I5NA 3CPCA 4YC8A 3WF8A 1UV5A 2HYYA 3PSBA 1UWHA 1BL7A 3NYVA 4GSBA 4E93A 4ALVA 3O7LB 5BUEA 3PA3A 4BB4A 4O81A 3OW4A 4DF3A 2G9XA 4IVBA 3II5A 4XOYA 4BTFA 3W2OA 1ZY4A 3HP2A 1LR4A 1QPEA 5CS6A 4RFMA 4CVAA 3DJ5A 5JT2A 1BI7A 2XK6A 4TWOA 4USEA 2GFCA 4F1MA 5AEPA 5F4NA 4J95A 2R7IA 4L9IA 4II5A 4NIFA 4WRGA 4GT3A 2YLFA 3UVRA 4RA4A 4I23A 2X6DA 5HE1A 5A4LA 4M14A 3CQUA 1KE6A 3GVUA 4BF2A 3OC1A 3AOXA 4PDPA 5HO6A 4CKJA 2YCQA 4ZTLA 2BIYA 2NYAA 3EOCA 4BCJA 2W1EA 2B9IA 4FT5A 5HESA 4U0IA 5HIBA 4C2WA 2BTRA 2X2KA 4YJPA 3V6SA 4DGLC 4TL0A 4TYIA 3SC1A 2CGWA 2WKMA 3KXNA 3EN9A 5J95A 5CF6A 3AC8A 1UU9A 3MA3A 4RWKA 2OLCA 2ITNA 2WQNA 4O21A 3U87A 4EK8A 4Q9ZA 5HVKA 3R9DA 3PFYA 2XNMA 1JSVA 3BGQA 5BVFA 1BUHA 2F7XE 4O96A 2HW7A 3C51A 5FEDA 4QT1A 4ZS4A 2VN9A 3HUBA 1XQZA 1BX6A 3IOKA 3QX2A 1NVSA 3W0MA 2JD5A 2VWVA 4GYGA 3R30A 4TN6A 2FUMA 2C0TA 1JSTA 3R8MA 2J0IA 1MRUA 4XBRA 4D2PA 1JPAA 2VTJA 3MIAA 2Z8CA 2UZVA 2XALA 2G2HA 4QP7A 5LQFA 4M97A 5IA4A 3QTSA 3KFAA 5EYDA 3DZQA 3GQIA 4ZZOA 4RC2A 5JGDA 3RAIA 1YOJA 5D10A 2WHBA 4HGTA 3I79A 2VO7A 3NNUA 5DA3A 1J1CA 2UZEA 4WG5A 3B2TA 5HCZA 2R3IA 4M66A 4NM5A 4RX9A 4EK3A 4LOOA 2AEGA 3UO5A 2W1ZA 5DT3A 5HORA 3QXPA 4U6RA 3FC1X 2QOKA 4MBLA 4WG4A 2BROA 4EYJA 2I6LA 2UW3A 4P5ZA 4FV9A 5AV3A 1YI3A 3B8RA 1OL5A 4F63A 5CNOA 4V0GA 5L4QA 3OTVA 3E7VA 5E1EA 1JKSA 1FMOE 3U51A 4FTCA 5EM5A 2BRMA 4CYIA 2QD9A 4FNYA 2I40A 4DEIA 2EWAA 1XH4A 1XMMA 3L9NA 4UMUA 1K2PA 3L8VA 4OUCA 5IEYA 3U6HA 5CF4A 1F5QA 1GIHA 4FTMA 4PY1A 4BIDA 1ZOGA 3AT4A 3BYOA 3Q5ZA 4O86A 2OWBA 3MH3A 2QG7A 3LAUA 2PK9A 4NYEA 2H34A 4DFLA 2OIDA 4MTAA 4JQ7A 4PMTA 1P4OA 4Q5HA 4M84A 5HNGA 1HOWA 4P7EA 3VRYA 4FBXA 4O7NA 1OL1A 3Q6UA 3EN7A 3NLBA 1CKPA 3ORXA 3R2BA 3HL7A 3MFSA 4IAKA 4EBVA 3DXPA 3TDVA 3R7GA 1Q99A 4BGQA 2P33A 2X2LA 3FLQA 5TR6A 3OWPA 3QCXA 4HJOA 1R39A 3QWJA 3SD0A 4FEXA 1QPJA 3ORLA 3QUDA 3EQDA 4OTHA 4R1YA 4BCOA 3GU6A 1W7HA 3KK9A 4JMQA 3FSKA 2W7XA 1MUOA 1OUKA 3Q60A 4KIPA 2IO6A 2R3MA 4RX8A 3BHTA 1WMKA 3CS9A 1Q97A 3PE2A 4C33A 3BV2A 4PL4A 3EQPA 3ZSGA 4EK4A 4WKQA 2GTNA 4QPSA 4FR4A 3OCSA 2VGPA 3LPBA 4XX9A 5LMKC 3MA6A 2PUIA 4R7HA 3UG1A 4Y5HA 1JBPE 2BVAA 1PKGA 4A7CA 5I9VA 4G5PA 4EKKA 1NT2A 4FTUA 4ZP5A 2CJMA 2C0OA 2FSTX 3F2NA 3MPTA 3QTWA 3LQ3A 5KKRC 1PW2A 3UDTA 3NFFB 3R71A 2PZYA 1YVJA 3EMGA 3SKCA 3ZLWA 5HICA 3RCJA 3BE2A 1ST4A 1W2DA 4AGCA 5JFSA 3LFAA 4ASZA 5DHJA 1U54B 5HG8A 3D5UA 4I6FA 4Y95A 4IZ7A 1PJKA 3F2AA 1J91A 2WQEA 4IB3A 2CN5A 4QP1A 5FG8A 4KINA 5AIKA 5HE0A 4BCPA 3P7AA 3OCGA 3RPYA 4IAAA 3ZLYA 4IE9A 4GFGA 3HZTA 4QMSA 5CANA 2JDVA 3D15A 4RRVA 2G01A 5H8EA 3V8WA 4BYJA 2C6KA 4O82A 3KGAA 3QXOA 3IKAA 4GVAA 4O4EA 4O2PA 4CCUA 1MP8A 3DBCA 3TKIA 3D2IA 4FKWA 4G31A 3TV4A 2YDKA 1PKDA 2ITUA 2ZDUA 3DCVA 3UC3A 2C5XA 2QODA 5A4TA 1F0QA 1WBSA 4EKLA 2QOCA 4RJ4A 3PDTA 3QTUA 5HE3A 3DDPA 2BHEA 3F61A 3A2CA 4AU8A 3W2QA 3A8XA 3UQFA 5M55A 3E63A 4R7IA 5DH3A 4DG2E 1DI9A 3UIMA 1UU7A 4NZWB 4DA5A 2YA9A 2ZVAA 4YTHA 3ZO3A 2RL5A 2PWLA 2WMUA 4DG3E 2Y4PA 2Z2WA 4J96A 3V5TA 4JX7A 4I22A 1B6CB 4RIYA 3UE4A 4X0MA 1OB3A 2CHLA 3O17A 5IEXA 4QDVA 2QNJA 3AC2A 3VS7A 4C0TA 5A3XA 3O8TA 1A06A 3TUBA 3DAEA 1GZ8A 5AX3A 3EQIA 5B0XA 3ULIA 4G6NA 1IEPA 4RLKA 4G3FA 3UNZA 3SGCA 4O0SA 3W0PA 2GS7A 2RFEA 2WMAA 3PWDA 3NVMB 2YZAA 2XJ2A 4LRMA 4AGWA 4FG9A 3Q4TA 2JKOA 1M52A 4DFNA 1GNGA 4L53A 3UODA 3TV7A 2X8EA 4I6LA 3P08A 2WMSA 3P5JC 4O7LA 4YJUA 3GC8A 4S31A 5IUGA 5EHYA 2R3FA 2W4OA 3E3PA 3EQGA 3HMMA 4PMMA 5M4FA 3Q4ZA 1H1PA 2WMTA 2VTMA 4OLIA 1XH9A 2O0UA 3JS2A 3M11A 4PWNA 5HVYA 4GT4A 3C0GA 3VBQA 1R0EA 3KY2A 2WD1A 3W10A 3PIXA 3LOKA 5HIDA 4BICA 1NXKA 4AG8A 5CF8A 2X81A 2Y7JA 3BU3A 3F69A 4V0GB 4YR8A 2QI8A 2VTNA 2IF8A 3HKOA 2YCFA 4U8ZA 3QWKA 5I9ZA 3NRMA 2CCHA 2OJGA 1PMVA 2Z7RA 2F57A 3BLAA 3LJ0A 3S4QA 2XKDA 3V8SA 1Q3DA 1Y8GA 4H3BA 5IPJA 3ZYAA 4UXQA 4DDGA 3QF9A 5DPVA 2XP2A 3QRJA 4YZ9A 5CSWA 2ZFYA 3BEAA 4PPAA 4DH3A 4TY1A 5FWKK 4HYSA 2WPAA 3RNIA 4FKQA 3AGMA 4NCTC 4O7RA 4O7VA 5FDXA 2GNFA 3NW6A 4HGLA 4BCGA 1FGKA 5EK7A 3CLYA 3N4VA 4L3PA 4L52A 1Q8YA 3CY3A 4E4MA 2RFNA 5JMSA 4MNEB 1R0PA 4GU6A 3MPMA 4LM5A 1Q5KA 5HO8A 5KZIA 5TE0A 4YURA 2XB7A 2OH0E 3OG7A 4Z16A 3FMKA 3GBZA 4EH5A 2B7AA 4YZBA 3FLNC 3W0OA 4X6QC 4L3LA 4FV8A 5A4QA 5E1SA 4C35A 1WBPA 1OUYA 2OJ9A 2XRWA 4GCJA 2WB8A 4JX3A 5DFPA 4BDAA 3AMYA 3MN3A 2KULA 4YC6A 4U43A 5IQCA 4A9YA 4R6VA 4XMOA 4USDA 5M53A 3U9NA 1Y91A 5C27A 2OH4A 4ERKA 2P3GX 3H0ZA 5BUJA 2XBAA 3R00A 3BELA 1Q41A 3KF4A 2OU7A 3LXKA 3QRIA 4AGUA 4QQ5A 4FIHA 4L42A 5D7VA 4C57A 1SVEA 2XIKA 2ITWA 5DIAA 4QNYA 3JPVA 4FOCA 3ZS5A 4B7TA 2AC5A 3QGWA 4CRSA 4OW8A 4M0YA 5B2MA 3LXPA 3MH1A 4ZSGA 4IEBA 4EC9A 3COIA 1XKKA 2J50A 4WA9A 2ITYA 4XUFA 4ZSJA 3PIYA 4DG0E 5E8YA 3QD2B 3NR9A 3KREA 2R3KA 3GCVA 1OITA 4EBWA 4HVIA 2JFMA 5EW3A 2WNTA 2XKEA 5CAOA 5DRBA 4WNOA 4IX4A 5AR5A 4JVGA 2W1GA 4FMQA 1Z9XA 3BCEA 1W82A 2EXEA 2OICA 3AD4A 4GK3A 5BVKA 4RQKA 4EHGA 4XV1A 2XIYA 3W0QA 2BILB 3UQCA 4AQKA 2WZJA 2R4BA 4OTFA 3PG3A 2ETMA 3CQEA 4IH8A 4RIYB 3RHXA 3DBDA 1REJA 4CV9A 1RW8A 4DFXE 4MXCA 4PP9A 4D2TA 3MJ2A 1PY5A 4RWLA 3TACA 2P0CA 4E5WA 1OMWA 4FC0A 5LMBA 2JIVA 3FDNA 1FVTA 1TZDA 2W0JA 4FT0A 4JR3A 2O63A 5JRQA 3S0OA 2P4IA 3Q5IA 3FKNA 5L6PA 4KABA 1FGIA 4QDEA 5ANDA 3HV7A 4MF0A 4MWHA 3UTOA 5IF1A 2R3NA 2ACXA 1YKRA 3VIDA 4F6WA 4PPBA 5FXQA 3UZTA 4FVQA 3THBA 3OZ6A 3ZHPC 3MESA 3V8TA 5EW8A 3RK5A 5KX8A 4FTQA 3BLRA 3VS1A 5HLWA 4DTKA 5HBEA 3VUMA 4DT9A 4BCNA 4ZTMA 4UMQA 1FQ1B 4PNKA 2HWOA 3NUPA 3JYAA 4YO4A 2R3RA 4HOKA 3HUCA 4W4XA 2J0MB 3PJ1A 3ZTXA 2X1NA 4UBAA 1M2PA 3NUXA 1WBWA 2F4JA 2VU3A 3PWYA 5F20A 3LFSA 2I0VA 2OGVA 5DG5A 4E4XA 2YDJA 5IDPA 2XJ1A 2PVFA 1P5EA 4OAUC 3PUFC 3KXMA 4H39A 3R8PA 1ZWSA 2X0OA 1OIUA 3C5UA 4WNKA 4Y72A 2HAKA 2J6MA 3D7TB 5AR2A 3TNIA 2CNQA 4GRBA 3ZFXA 3HV4A 4DH7A 3W2PA 4JAJA 4MEDA 4W9WA 4QEBA 4AQCA 4X2NA 3QD0A 2VWBA 3FXXA 5HG7A 3NUSA 4A9TA 2GHMA 1FVRA 3FSFA 3LCSA 3R63A 5FDPA 2P55A 4F70A 2CMWA 2OZOA 3CKWA 3OWLA 3VHKA 4KS7A 3RALA 4AZVA 3PZHA 3AMBA 4D2WA 4JRNA 3UYSA 1YWRA 3RWQA 5I0BA 3D94A 3F3UA 3HX4A 4FKTA 4LUDA 2G15A 1W2FA 3PRIA 4JDJA 4RJ3A 1OIQA 1H0VA 4HCTA 3R1SA 3QL8A 4RFYA 3PIZA 1WBTA 4QQTA 3QYZA 4YJVA 4O0VA 1Y6BA 2H8HA 5LVNA 1WVXA 3IDPA 2YITA 3UOLA 4FTKA 5HLNA 2BRBA 1YDSE 2WTKC 4LGDA 2EB3A 3A7FA 4D1XA 3S2PA 1URWA 4FSWA 3ZUUA 4DEBA 2HW6A 2W4KA 4EUUA 5AUTA 5CAUA 5M4IA 4WT6A 3QCSA 2BDFA 4FUYA 4IWQA 2V62A 3MBLA 3D5WA 5H9BA 5I9YA 2XANA 4RG0A 1VYWA 2CKEA 3H9RA 2W96B 1B38A 3DXNA 2UVZA 4KA3A 5L6WL 4CFMA 4D5KA 3PJ2A 4AOTA 4G3CA 1VJYA 5HCYA 2PUNA 4FGBA 4ITJA 4PUZA 3I0QA 4CNHA 4F7SA 1H25A 3F5UA 5C4KA 1Q3WA 1PXPA 4JL9A 3D7ZA 3FY2A 4YBJA 3D5VA 3QQHA 4XRJA 2UZTA 4XV3A 3C4ZA 4F4PA 2OO8X 4PNIA 2XA4A 5CXHA 3ZRKA 2XMYA 3OW3A 5BMSA 4R3PA 3EN4A 3EKNA 4A4LA 5JEBA 5CU0A 3EJ1A 3HRBA 3V6RA 4F9YA 5DR6A 4UWYA 3VQUA 4EQCA 4XEYA 2WMBA 2WMVA 5IISA 5I9XA 3RNYA 4D58A 2J5EA 3KA0A 3PXZA 1OL6A 3LLTA 3WE4A 1XBAA 4Q2AA 3EWHA 3P23A 3NAXA 5FP5A 1H24A 2DWBA 2YIQA 4BIEA 1S9IA 2FGIA 4O1PA 4CCBA 2GNJA 3UZPA 2C6EA 3Q9WA 3NYXA 5CSXA 3WF6A 4B4LA 3GC0A 3F7ZA 5DGZA 3K2LA 2O2UA 4E5BA 4E73A 4BDCA 2YFXA 3FEGA 1ZARA 2EXCX 1GOLA 3FL5A 2UW8A 3ZXZA 3KRJA 5ETFA 2HK5A 2X39A 3IO7A 4EOLA 5L2IA 4DEAA 1G8AA 4ZMEA 4KRCA 5FP6A 4K6ZA 3OT8A 4ZLZA 2QHNA 4UZHA 2FSMX 3EN6A 3IK3A 3NS9A 3PUPA 5CT0A 2VTAA 4NTTA 4OR5A 4ASEA 4Z7GA 4UX9A 2PMOX 4EOMA 3RZBA 3ZC5A 4C3RA 3DKGA 2QOBA 4RSSA 3TZMA 4AZSA 5FLFA 4TW9A 3W18A 5BYLA 4FTRA 5KMIA 2JFLA 1B39A 2R3JA 3G5DA 3GT8A 2R0UA 4JIKA 3QD4A 5JRSA 5HEZA 1UNHA 4F7NA 5C01A 1ATPE 3E8EA 4DFYA 3MGYA 4Q5EA 5CWZA 3E8CA 3G33A 4TZRA 2CN8A 4EI4A 4XRLA 3VJNA 5CEKA 3SXRA 4C61A 4EZ3A 1IAHA 2YIXA 3HRFA 3MV5A 3ZCLA 4HW7A 4DHFA 4O0TA 5LWMA 2I7QA 4C8BA 3A7GA 1WAKA 3LQ5A 5AUVA 4L46A 4ANNA 3QRTA 4UYNA 4ALWA 4CFWA 4LDTA 2R3OA 3LCDA 5KZ0A 2UVYA 2WTIA 3CJGA 3D7TA 4FYOA 4DHJA 5LVMA 4R1VA 4DTBA 2A4LA 3KMMA 3ORTA 4FKLA 4NL0A 3NVKI 4X7QA 3KF7A 3UYTA 2CGVA 3BQRA 4ZOGA 3DGKA 4ARKA 3OS3A 3FUPA 2VTRA 4HVHA 2YEXA 4JBOA 4GH2A 4GG7A 4HYUA 4Y8DA 3TTIA 2XK7A 3ZEPA 2XEYA 4RC4A 2VTSA 5E8XA 1PXIA 4J8NA 3F82A 5EQPA 3R8ZA 4RVKA 3E8NA 1JQHA 2RSVA 5EM6A 4U5JA 4O0YA 3RPRA 4S33A 4ANQA 3GFEA 2OFUA 4BWKA 3UGCA 4QP4A 1UU8A 2ZM3A 4LV8A 4YNOA 4QMYA 3PA4A 4YPSA 3ZFYA 4ACHA 5HVJA 1O6YA 1R3CA 3SVVA 3PG1A 5D41A 1IA8A 2GQGA 4K18A 3V5JA 4BI0A 5E9EA 1TQPA 4PRJA 3QCYA 5GNKA 5ANGA 3M1SA 2ZV2A 4AXAA 4ID7A 1J1BA 5T3QA 4ANMA 4AA5A 4RVLA 2PHKA 3RZFA 2ERZE 4C62A 3DB6A 2PVKA 1MQBA 1YI6A 3FYJX 3CIKA 2V0DA 3GCQA 3RAHA 1CDKA 2ZM1A 1O9UA 2O3PA 3HYHA 5FXRA 3D2KA 4NJ3A 3ZZEA 4APPA 2W99B 3MH2A 4AE9A 2VNYA 2Y0AA 2W9ZB 2WGJA 3FZ1A 4HGSA 4JQEA 4XG2A 3QKMA 3E62A 3WIGA 3OCBA 3E93A 4FE2A 3BHUA 3KULB 4BDIA 3TUDA 4B0GA 3UO6A 3PJ8A 4FTTA 4QD6A 2BKKA 2J0LA 1E9HA 4BKYA 5CSVA 1FINA 2CNUA 2QOOA 1CM8A 2QONA 2WMQA 5JH6A 2VD5A 1AD5A 1H8FA 2G1TA 3MB7A 3BYSA 2C5VA 5BYZA 4F9BA 1WBOA 3NSZA 3JY9A 4Y46A 4XG8A 4XG3A 4HGEA 3G2FA 4ZMFA 4A4OA 4RJ5A 1I09A 1HCLA 2BAKA 3ETAA 3QC4A 2PL0A 3HMIA 3LJ2A 3VUHA 2EUFB 4FIFA 4G1WA 3PSDA 3UDBA 3E64A 3MPAA 4PTGA 5EDRA 1ZMWA 4PMSA 4AT3A 4IB5A 4WHZA 4RJ6A 3FQEA 3SG9A 3VS2A 2VTQA 4KD1A 4RIWB 4ZTHA 4RQVA 3ZFMA 4GYIA 3SDJA 4I5CA 1L8TA 4O0UA 1BMKA 4OTIA 4DITA 3QCQA 3R7UA 2GQRA 2E9UA 3VO3A 1G8JA 3ZLSA 2OJIA 4XV9A 2PTKA 3KRLA 4A4XA 4XG9A 2XNEA 4PMPA 3P7CA 4OTWA 3FI8A 3HRCA 3IW5A 1OM1A 3R02A 5ICPA 2R3HA 1Q24A 5CX9A 4ASDA 4MD9E 2BKZA 4IJ9A 5E90A 2IZSA 4LGHA 4NM3A 4NKAA 5EYCA 5IQBA 4E20A 2HZ0A 3EIDA 1ZZLA 2QOQA 2WTDA 2J7TA 3O8UA 4NT4A 4F9WA 1F3MC 4KBAA 4OTGA 4IX5A 4I92A 4O4FA 4BTJA 4BTMA 2YZLA 3DXQA 4FZFB 5CVGA 3FLYA 3I7BA 3KXZA 3Q9ZA 4QTDA 1KWPA 3F3TA 2H6DA 5EI2A 1LPUA 1IR3A 4MNFA 4X2FA 2B9FA 4MK0A 3WARA 1XH7A 2OF2A 3F3WA 5IKWA 3FXZA 3C5IA 4OBPA 4I4EA 4F0IA 3QUPA 5IH4A 4U3YA 4KRDA 4BDKA 5AP0A 2XVDA 5I4NA 4NTSA 3MTFA 3UDZA 3DT1A 5M06A 4L68A 4J98A 2WFYA 4UV0A 4ANBA 2VAGA 4FZAB 2J4ZA 3JUHA 4YLLA 1YDTE 3L8XA 4EH6A 2PPQA 5EQYA 1GJOA 3OXIA 4FIJA 4DT8A 2YIYA 4LGGA 2OXDA 3R73A 5JK3A 1ST0A 2YLEA 3FE3A 4L7FA 4F0GA 4CQEA 5AA8A 2QOHA 4BWXA 2GS6A 2QOIA 4RGJA 4EH4A 3P5KA 4WRSA 4ALUA 4FRFA 3ZOSA 4KBKA 4R5SA 4ZTSA 5B2KA 4F7JA 4MAOA 4UMRA 3KXGA 5F94A 3WE8A 2KTYA 4ERWA 3LKMA 4FSTA 5HTCA 4MWIA 3NCGA 2GDOA 3PXQA 4JAIA 3VUKA 4O6EA 2HIWA 2JGZA 3QFVA 2XNPA 3QLGA 3FI3A 4IX3A 1PXLA 3VUTA 5AV1A 4E1ZA 4FIGA 4JDKA 5CENA 2BAQA 4YJQA 1H01A 2JDOA 4XYFA 4CLJA 3ULZA 2QOFA 5LARA 4DLJA 5CSPA 2PYWA 1DI8A 1UA2A 3KU2A 2ZOQA 3BHVA 2QVSE 5CVFA 5HBHA 2JKQA 5GHVA 1YQJA 2H9VA 1STCE 3TI1A 3A7IA 3KN5A 4KIOA 3GB2A 1NY3A 3QBNA 3R1NA 5BVOA 2J0JA 5HU9A 3ZO4A 2YM6A 4X2JA 4HYHA 3RI1A 3FWQA 4FIIA 4UXLA 5FEEA 3R8UA 2BDWA 5L2QA 4ZJJA 5CXZA 4MNEA 4HVSA 4U81A 4UY9A 2JBOA 4BIBA 1ZYDA 3DLZA 4F08A 3MFUA 3QLFA 3JVRA 4FKJA 4L6QA 2JEDA 4BI2A 5M57A 3ATSA 5K0XA 5J87A 1TQMA 3LMIA 3CTHA 3SXSA 4PP7A 1XJDA 3EH9A 1R78A 4FSNA 4M15A 4M12A 5FTOA 5H8GA 2QHMA