1BKXA

A binary complex of the catalytic subunit of camp-dependent protein kinase and adenosine further defines conformational flexibility
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
339
structure length
337
Chain Sequence
QESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE
publication title A binary complex of the catalytic subunit of cAMP-dependent protein kinase and adenosine further defines conformational flexibility.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (phosphotransferase/adenosine)
total genus 88
structure length 337
sequence length 339
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 1997-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1bkxA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1bkxA02
2HOGA 1KSWA 5KHWA 3IW8A 4PTGA 4YSMA 4IX3A 3OT8A 2PZRA 3COHA 2ZM3A 4PL4A 4CMTA 2VX3A 2XF0A 3A7IA 2R3FA 3H9OA 4FTJA 4AZWA 4BCGA 3F7ZA 1W83A 2EXCX 5CSVA 1J7LA 4RRVA 2CKQA 1IASA 5T68A 3IW5A 4QP1A 3PY1A 3W2OA 5AUTA 4FK3A 3FMLA 5IQGA 4D2VA 3NWWA 1OB3A 3LLTA 5IUGA 2RGPA 5IZFA 2VGOA 2W5AA 2G2FA 2XIXA 3TWJA 4DEGA 3UNKA 1ATPE 4W4YA 2X39A 1WVYA 3ORTA 1DS5A 2JITA 5J9ZA 4RLLA 3QZFA 4ID7A 4S31A 3I6UA 5AR8A 2XS0A 1E1VA 3OW4A 4HZSA 3U8WA 4CV9A 2O3PA 3MH0A 3VAPA 3Q53A 4UZDA 3TNQB 3W2SA 3CSVA 2XYUA 3ZH8A 4A7CA 4JQEA 4KKEA 4UMRA 3NUXA 4HCUA 1U5QA 4IADA 4OTGA 2YIXA 3I1AA 4LQMA 5C03A 5EG3A 1J7IA 3NW5A 2PUPA 4NEUA 2Y0AA 5TR6A 3WF9A 2PUUA 2XIZA 3ZLSA 5EI2A 4FKPA 4JNWA 2BRNA 2IZTA 3QHRA 2VTHA 3QQGA 3UYSA 4IDTA 2SRCA 2J0MB 1ZMUA 3TEIA 1CKIA 3FY0A 4FTUA 1IA8A 1G8SA 3VULA 2IG7A 1T46A 3E3PA 3DKGA 2NRUA 3MFSA 4YHTA 4CKIA 5FDPA 5A4CA 3EFWA 4LUDA 2WGJA 3Q9ZA 4ZY6A 3ETAA 3A60A 4BCQA 2F2UA 3NIEA 4E4XA 3TJCA 3A7HA 3QCQA 5CEKA 4GVJA 2H96A 3NUNA 4M69B 4TZRA 3ZBXA 4EZ5A 3AD5A 4FSZA 3LHJA 5LOHA 3EOCA 4O21A 3BYUA 1YXUA 2ONLA 5BX0A 4RFMA 2VO6A 5M09A 4TW9A 3ODZX 2ZJWA 1YRPA 2VWYA 4Q9SA 4H1MA 4BYJA 2W4KA 3QGYA 3GU4A 2JC6A 4L44A 3D14A 4RX9A 4AW1A 1STCE 2QOIA 5FGKA 4I21A 3G15A 3D5XA 2QURA 1Q8TA 5CI6A 1VJYA 1OM1A 1H1SA 3AMBA 4A9UA 4UXQA 1JQHA 2R3NA 3VRZA 3CE3A 4MK0A 4TWPA 3BQRA 1Y8GA 5LXMA 3W8QA 2Z7SA 3FKLA 5TE0A 2PVJA 3PLAE 3ZBFA 5HE3A 2IWIA 3KMMA 4WNKA 3ZSGA 5JRQA 5HO8A 4IZAA 2QOQA 2XYNA 2ITWA 2BKKA 2ZV8A 4FKIA 4N4SA 3GU7A 4ASXA 2PMIA 4A4XA 4U8ZA 3DA6A 4NSTA 5C8NA 4J97A 1JOWB 3BELA 3FQSA 4MD7E 3Q4UA 3PP1A 2R9SA 3C4CA 1Q3WA 1JKTA 3MB6A 5J1WA 4UB7A 4CYJA 3ZCLA 4DGGA 5C26A 2ITYA 4OR5A 3PXZA 4DGMA 3ZUTA 1ZWSA 2ZV7A 3KEXA 3TNWA 3VBVA 4EKLA 5L8JA 1ZYJA 4GH2A 5FP5A 3S4QA 3PWYA 5KBRA 5ANOA 2JKMA 1RQQA 3BU3A 3HUBA 3NZ0A 3RCJA 3VBYA 2VTMA 3O0GA 2WMQA 4K6ZA 5E8TA 4R78A 4GW8A 3W55A 2WHBA 4FOCA 5BNJA 4IAKA 3ZU7A 4I0RA 5HORA 1OBDA 4FNZA 4IZYA 3ZXTA 3P7AA 1H1WA 2QLQA 3AD4A 4J8NA 4PQNA 3FV8A 3ZUUA 4BHZA 1QCFA 3A61A 4JQ8A 3FL5A 5H8BA 4FK6A 2WMVA 5ETCA 3TNIA 3QKMA 3COMA 3MTFA 4OT6A 4O0XA 5AP1A 3GBZA 4HVHA 4G3CA 2WTVA 3DBCA 4N70A 2OFUA 3HV5A 5E4HA 5ANEA 1NT2A 3QLGA 3QZHA 3RNYA 5HVKA 4QTCA 3R8PA 3FI4A 3EB0A 3PY0A 2RL5A 4U0IA 3NW6A 2NPQA 3ZO3A 4ZY4A 3PJ1A 5DRBA 3CGOA 2R3HA 1ZY5A 3PUPA 3R9DA 5KMJA 4J95A 3WF5A 4OTDA 5D41A 4AGUA 4X21A 4IM0A 4WKQA 2UW9A 4PL3A 5LCKA 1A06A 3TZ9A 3OCBA 5D12A 4EH2A 2ERZE 5AR4A 2QD9A 5E8ZA 4ZP5A 5L6WL 5EFQA 2YWVA 4F1MA 2WPAA 2YABA 4Y95A 5G6VA 5EM6A 4D5KA 1DM2A 4FSQA 4AS0A 1REKA 3FPQA 1CMKE 3PA5A 5EHYA 2A1AB 3R30A 3R8LA 5D11A 3ZLXA 4AF3A 5AEPA 2X8DA 4JT3A 5HX8A 3OROA 4QP8A 3RGFA 5ITAA 4EHVA 1FBNA 4M7IA 4NCTA 3QX4A 2UZEA 3OBJA 4USEA 3H9RA 5GIOE 4YPDA 1JNKA 4F0FA 4X0MA 1F3MC 2X2KA 4C2VA 3BYVA 2XZSA 2Z8CA 3DTCA 2IO6A 5AADA 2BDWA 4U3YA 5HIBA 5KMNA 2XKCA 4CXAA 3UG1A 4CRSA 3LIJA 2BDFA 3CR0A 4EJ7A 1ZOHA 4PUZA 3W2PA 5FEQA 4KWPA 3CIKA 3M42A 5AX3A 4IACA 3HRCA 3PFQA 3V5JA 3A4OX 4F6SA 4ZEGA 4BDDA 3MBLA 4I23A 3VO3A 4WNMA 3DLZA 2CLQA 3FI3A 4FA2A 1A9UA 3ORKA 4OBQA 4E6CA 1S9JA 2WTKB 3NYVA 3K2LA 4DEBA 4BCIA 3NVKI 3PJ2A 3HVCA 5FTQA 3ZYAA 3BYSA 3L9PA 1IA9A 2OKRA 4UZHA 4W9WA 5ANJA 3S00A 1TQIA 3UVPA 4I1ZA 4QMWA 2BTSA 1J3HA 3MIYA 4ACMA 4ZSLA 4TY1A 4JVGA 4RIXA 3OP5A 2OG8A 4JOAA 3V51A 3TI1A 3NUYA 4IJPA 2YCSA 2E9PA 1M2RA 4AAAA 1ZRZA 5A4LA 5AP2A 2UZUE 2WQNA 4JBPA 3V6SA 3MESA 2C3LA 4RA4A 4RZWA 2PE1A 3E62A 3F5GA 5AV0A 1YWNA 4FKVA 1JAMA 2XIKA 3GFEA 4PF4A 4RIYA 5DG5A 3VS0A 2YM3A 4MXOA 2F7ZE 4CG9A 4R8QA 3SXSA 4BKYA 1SNUA 4EI4A 3KC3A 4F1TA 5HCZA 4BIBA 2EU9A 2WTDA 4XG3A 2PVHA 4AA5A 3ENHA 2OWBA 4O91A 4U44A 5IQBA 1FINA 3D7TA 4R3CA 2YM4A 3BQCA 2FSMX 3H30A 4C7TA 3KGAA 1AGWA 1BL7A 2IW6A 5LCJA 2X8EA 5HBHA 3TXOA 3HV6A 4ZMEA 4GEOA 2W1DA 4I0SA 3RPOA 1J1BA 4EZ3A 5HNBA 3PLSA 4RFYA 5DOSA 3UO5A 4BHNA 1R1WA 2W7XA 4B8MA 3VJOA 2R0IA 2YJSA 2B1PA 2BFYA 4NM0A 2XCKA 3Q2MA 3VUTA 5IH5A 2RFDA 3HRFA 5KMIA 3NVMB 3DAKA 4FV0A 3GOKA 3JY9A 4EC9A 5EK7A 3OCTA 1FVRA 1XBCA 2UVZA 1YQJA 5BMMA 4F09A 5FEDA 4BTKA 3HKOA 5EHLA 3W2QA 5AP7A 4BGGA 4BCMA 1H08A 2IW9A 2OICA 5CASA 2EWAA 1L8TA 3LKMA 2RF9A 4H3PA 4AWIA 4O7WA 1YDRE 4AFJA 5HTBA 3BWFA 4D1XA 4MQ1A 4C34A 4E73A 4G6LA 4GKHA 4QQTA 2YCRA 1Q8UA 4PX6A 4S30A 2PU8A 3C50A 3LFBA 4F70A 2LGCA 2Q83A 2IVVA 4MAOA 2XNOA 2CGXA 2PL0A 3RPVA 4KRDA 2O5KA 5BVKA 3VS4A 4E7WA 1H27A 4XLIA 4RJ6A 4PV0A 1K3AA 3PWDA 3W2RA 3ZFXA 2ITOA 1ZYSA 5A46A 4M13A 3Q04A 4FZ7A 4X6RA 3VS6A 4DFXE 1TVOA 3R04A 5CT7A 3PIXA 4FV1A 5EDRA 3ZRKA 2J5EA 1LPUA 2QO9A 3P7CA 4WUAA 1WBPA 3QTXA 4FVRA 1M17A 4BCOA 2E9VA 1SYKA 4LFIA 1SMHA 2QNJA 4CFFA 4EOOA 5E7RA 1OL6A 3FMNA 2VWUA 5JEBA 1OGUA 4QP3A 4FI1A 4OT5A 1UWJA 3EN5A 3EN9A 1QPEA 1YI6A 1GIHA 2WQBA 4FL2A 4KIKA 5DWRA 2VTTA 5M07A 4YTIA 5I9UA 4DTKA 3BCEA 3HECA 4RWLA 2XCHA 3SV0A 3V04A 3QYWA 4AE9A 3G0EA 4I22A 4A9SA 3OOMA 4FG9A 4OGRA 4BF2A 2A27A 3O8PA 3UMWA 5AP0A 4WA9A 4YZ9A 4NW5A 4BGHA 4EWHA 4FTQA 2YERA 3OW3A 5L2WA 3PRIA 3COIA 5HQ0A 4JR3A 4WBBB 2HK5A 1JSTA 4C3RA 2FO0A 2DYLA 2YWPA 3BBWA 3NNXA 4QNAA 5J7BA 3DBFA 5LVMA 1G5SA 4ZAUA 4RX5A 2QHNA 1YHWA 2ITUA 4JBOA 4NM3A 5HTCA 2KTYA 2XK9A 4FKSA 4FT9A 4ITHA 4CFVA 4EK3A 1Q41A 3FYKX 2HY81 2XK6A 3F3VA 4NW6A 4WHZA 2ZOQA 3NUUA 5K4IA 1K2PA 4J96A 1M14A 1FGKA 2W5HA 3KXZA 5D7VA 4EOSA 4ZJVA 3MJ1A 3HDNA 4O0TA 2C6LA 4O7SA 3DU8A 4QYFA 1XO2B 4G6NA 4NKSA 2VN9A 5AR3A 4QP7A 4EK8A 3EKKA 2BZJA 4GK3A 4I6QA 4RJ3A 5EOLA 4RX8A 2CNQA 1XBAA 4ZMFA 3OXZA 1WBVA 3F66A 5CSPA 3CD3A 1OPJA 5TF9A 2V55A 2XRUA 5BVEA 3U87A 2JKQA 3SQQA 4GG7A 4A06A 4JIAA 5HG7A 3T9TA 3C7QA 3RAHA 4H1JA 3MVJA 4AXAA 4YJSA 3EL8A 5IH4A 2QKWB 3OWJA 2VTQA 2QR7A 4DA5A 1H1QA 4I92A 3TV7A 4ANNA 3UZRA 1XKKA 3LFEA 5HCXA 3FZTA 3KXXA 4BL1A 4N0SA 2X81A 3UPXA 2NO3A 5I3RA 3FXZA 3SG8A 4UXLA 4S32A 1PXIA 3CQEA 4CZUA 3BGPA 2VTRA 3RPSA 4L6QA 2V62A 2Y7JA 4LYNA 2QU5A 4M0ZA 5CSWA 3OY1A 4U42A 1YOLA 3HP5A 1NA7A 4IFCA 3SX9A 1SVGA 5KKRC 4M97A 4Y73A 4AW0A 4AZVA 4IAIA 4QYHA 5JZNA 3KXHA 4L01A 3R7UA 4CG8A 4B4LA 4IC8A 1URWA 2JBPA 3AMYA 4FTIA 5JN2A 5KHXA 5L4QA 5BUIA 3FZOA 5E90A 3SRVB 4IMYA 4DT9A 5DIAA 5AP3A 4BICA 2YLEA 3GGFA 3Q9YA 2V7AA 5K5XA 3E5AA 3OZ6A 3U6IA 2XVDA 2BILB 3E8NA 5C9CA 4RPVA 2BZKB 3T9IA 4ANLA 3LFFA 4BRXA 4OBPA 1GZNA 4ENYA 4JDKA 3HGKA 4D2PA 4BDKA 2Q0NA 4NJ3A 3R7YA 4M69A 3TL8A 2G1TA 1KE7A 4DH3A 3DY7A 2WNTA 2HY0A 3IECA 4KS7A 4MHAA 4O1OA 4BDAA 4D4VA 1ZAOA 5K5NA 2ETKA 5FXQA 4USDA 4JBQA 4W4XA 4D2SA 4F7NA 2NRYA 3IKAA 1DAWA 4DFBA 2CHLA 4YZBA 3AGLA 3FZSA 1WBTA 2B52A 3N51A 4D4SA 5CU0A 1W98A 3QQUA 2VRXA 3KXGA 4UX9A 2UZBA 2PVYA 2X7OA 3UC4A 4YBJA 5HOAA 3DKCA 4BDHA 4F9CA 3C51A 4O0YA 3R01A 3R2YA 3TUBA 4ANSA 3ZFMA 4AX8A 3IQ7A 4BI1A 5A54A 3UZTA 2XBJA 5BVFA 4FV9A 4YZMA 4XJ0A 3OG7A 5KCVA 4TNDA 3DS6A 4Q5EA 2A4LA 5H3QA 3TDVA 4GKIA 4U3ZA 4ZTHA 2OZAB 5I9WA 2BCJA 3D15A 3LPBA 5IKWA 4DBXA 2A19B 4O83A 3WZEA 1H24A 2RFEA 3GC9A 4APPA 5GJGA 4OTWA 3SOAA 2VTNA 3A8WA 3H4JA 4XV2A 3FMMA 3PVGA 5J5SA 2UUEA 3LFNA 4M68A 5HG5A 4QMZA 1OPKA 4AA0A 1OMWA 1H8FA 2YM5A 3G6GA 3NIZA 3REPA 3IGOA 4D55A 5HD4A 1YHSA 3D94A 2GTNA 3GQLA 2CGVA 1W84A 3ZONA 3QQKA 2GU8A 1UU8A 3QC9A 3LFSA 4CQGA 3MJ2A 4MXYA 4XHKB 4MKCA 5CX9A 1HCLA 5E91A 4M14A 2P2IA 3VIDA 4ZZNA 4I94A 4C37A 3BEGA 3V5QA 4OTIA 2PE0A 3FEGA 2H6DA 2CKOA 2VO7A 4F08A 2R5TA 3LW0A 4D58A 4DN5A 2ETRA 2DWBA 4O38A 3GCSA 4QO9A 3VC4A 5A4EA 2VU3A 4L52A 4NK9A 5J8IA 4OBOA 3QTWA 2J4ZA 1DI9A 5EOBA 2WIPA 4IWOA 3NGAA 2O64A 2XNEA 3P23A 3DT1A 2OW3A 2J90A 2YM7A 3EQBA 3IOPA 2WMSA 4G16A 3CJFA 5FEEA 3VJNA 5KKRB 3RNIA 1PJKA 4PMMA 2UZTA 3WF7A 4QD6A 4FL3A 3H10A 2PZIA 3BZ3A 5BVNA 3P79A 3C1XA 3GU8A 4F6UA 4TYGA 5HLPA 1YOJA 4O84A 1BKXA 4I4FA 2O8YA 4C8BA 4WSQA 3QWKA 4ITJA 1FVTA 2WQMA 4MBLA 1OL5A 1YXTA 2WTWA 4FSRA 1JSVA 1PMNA 2YFXA 3KL8A 5IQAA 5DRDA 4W9XA 2ETMA 2GMXA 1IAHA 4BIDA 4Q9ZA 4AE6A 3D5UA 2UW4A 5AUYA 5EKNA 5HLWA 3AOXA 3GT8A 2JEDA 3D5WA 4JDJA 4QYGA 3SW4A 2W4OA 5TO8A 2REIA 2ZV9A 5HTIA 2YIRA 4PDPA 5CU4A 1ZZ2A 1SZMA 4P5ZA 5GHVA 1BYGA 1GAGA 1U59A 4I6HA 4IJ9A 3RI1A 4FT7A 3ZRMA 3UNJA 4CYIA 5E9EA 5DT3A 3QCSA 1YI4A 3FQHA 3CP9A 3AC3A 3M2WA 3JXWA 3A8XA 2HW6A 3O23A 1KV2A 3FMHA 5ANDA 2HELA 3QD0A 4HJOA 3R22A 5E8UA 5BYLA 1YW2A 2ZB0A 1PMEA 4FL1A 5ANKA 1Q8YA 5HE2A 2Y6OA 3FKOA 2WAJA 5FLFA 2OJJA 3AT3A 3ORXA 2UVXA 5BVOA 5CF5A 4AP7A 4KBAA 1B6CB 4QMXA 3P9JA 2J0JA 2UW7A 4FNYA 3FBVA 2QLUA 3QALE 5KE0A 4YJPA 3F82A 4FTCA 2UW3A 4GT4A 4RC3A 1KWPA 3MH3A 2C6IA 5HVYA 2WOUA 1GNGA 3LMGA 3NX8A 3R00A 1URCA 4NWMA 2R3LA 4WD5A 2PK9A 3SKCA 4AUAA 4CRLA 4DGLC 2FGIA 3MVLA 3FJQE 5DH3A 5AP6A 4GYIA 2R3JA 4YURA 3NAXA 3L9LA 1I09A 2VD5A 1YOMA 4YPSA 4O86A 3DOGA 3VQHA 1OITA 2UZWE 3CKXA 4BWXA 4PMTA 4TWOA 3DDPA 2W05A 3KULB 2Z60A 4CT1A 4EQUA 4AOJA 3VW6A 3FY2A 3BLRA 4MQ2A 1MQBA 5C4KA 5ICPA 4P4CA 1FMKA 3ORLA 1Z5MA 3I4BA 4QMTA 3RAKA 3DJ5A 5LMAA 4R3RA 4FUYA 2RIOA 5EHOA 5ETIA 3V6RA 1ZOEA 5KO1A 2PVFA 5FXRA 3CLYA 4MNFA 5AX9A 1UU7A 4YBKA 4BWKA 2YAAA 4FX3A 4U43A 2G15A 4QOXA 2WMWA 4JX3A 3DKFA 2JDSA 4MXCA 5HI2A 3VWAA 1NVRA 4P7EA 3U6JA 2CKPA 2H9VA 1V0BA 4O7LA 3LXKA 4E26A 5LMKA 1OZ1A 2H34A 2JIVA 5J79A 5J9LA 3UYTA 1YI3A 1VEBA 2XEZA 4FSYA 3WF6A 3WE4A 3D0EA 3UQCA 3E93A 4HYSA 3VBXA 3W10A 2RFNA 2VTOA 5HCYA 2C5NA 4WRSA 5I5ZA 3DNEA 3QRJA 5E8XA 3IDPA 5M08A 3JR1A 3F3WA 3DJ6A 3EIDA 3I60A 3TKHA 4CEGA 1W82A 3LJ0A 4RVMA 3H9FA 2OZOA 2KULA 4V0GB 3S0OA 2OU7A 4O7NA 3IG7A 3OUKA 2P2HA 3MWUA 2OJGA 2X7FA 2ZMCA 3R9RA 2JDRA 2PUNA 2GHMA 1XR1A 4JAIA 4O0RA 3R28A 3RCDA 5M4UA 1HOWA 4PDYA 2WEVA 3R1SA 3G0FA 4KINA 2YAKA 3TT0A 4EQMA 5LQFA 4IB5A 3HNGA 2B54A 1IEPA 3BGZA 5DVRA 4RIWB 2J51A 4I5CA 2YJRA 4FEWA 5FP6A 5JQ8A 1P4OA 4PP9A 5CY3A 1BI7A 5GINE 5L6OA 1ZLTA 2VTPA 2W9ZB 3PSDA 4UY9A 5CU3A 3GCPA 4FYOA 4QNYA 3BRBA 2VTAA 4NM5A 5C27A 4X3FC 2GNIA 3DXNA 5GZ8A 3I5NA 1QPDA 2YIYA 3KRWA 4XG6A 4YTCA 3D5VA 4YTHA 4XG2A 3QC4A 2PUIA 4CLJA 4Y5HA 3RK5A 4G3EA 4N6ZA 1P4FA 1SVEA 2R7IA 4FZAB 5CNOA 4YJQA 3V5WA 5GJFA 5B2MA 1OVEA 1M2PA 2I6LA 3DDQA 2QC6A 1P2AA 4DFYA 3F69A 4RC4A 3FZPA 4X6QC 1U5RA 1ZYDA 4CCUA 2WO6A 4FV5A 4DYMA 3K3IA 2J50A 1XWSA 3UOLA 2BKZA 4N57A 3EYHA 2PZYA 4TXCA 5GZAA 3E63A 4A07A 4F9WA 3PA3A 3QTIA 4C2WA 3VS5A 2OIBA 2HXLA 1ZMWA 2IVSA 5DE2A 3FI2A 3QCXA 4XV3A 4KBKA 3R7OA 5JFWA 4D2RA 3LXNA 3A99A 4QMYA 3UOKA 4XEYA 3GQIA 3EJ1A 5IQEA 4EK5A 2E9NA 4YJTA 3HAVA 4CZYB 4JJRA 4EH8A 3S2PA 4L7FA 1YWVA 5CWZA 4EORA 3QKKA 4Y83A 3HA8A 1U46A 3KMUA 5FD2A 4EL9A 1MRYA 4KA3A 4LRMA 1CM8A 1LUFA 3DFAA 3O8TA 3NRMA 4NU1A 4IAZA 3VUGA 4U97A 4F64A 4ACGA 3TN8A 4B99A 2Z7RA 4MWHA 4WOVA 4J98A 2JDVA 2OBJA 3ZC6A 2YDJA 4I4EA 1GY3A 4U45A 2ZM4A 2BROA 4G31A 4JG6A 2PE2A 3E7OA 3EN4A 2XNNA 4TTHB 4IVAA 4HVGA 4I5PA 3IW4A 3LCOA 4EQCA 3EH9A 3VBWA 4D2WA 1OPLA 4FKJA 4G5JA 3GI3A 1Q8WA 4H39A 4PPCA 5DLSA 4EH9A 3FLZA 3OFMA 4YZCA 3DXPA 3LJ1A 4TKSA 5M51A 4FSNA 4RVKA 1AD5A 4WIHA 4YZDA 4RT7A 5F4NA 3EQRA 3TNHA 1OIRA 4OTPA 5DR2A 3MA6A 3P1AA 5BYYA 3ZSIA 3JVRA 1NVQA 2UZNA 3MYGA 3QTSA 2PY3A 4C59A 2CSNA 4HCVA 4M8TA 2CGWA 2CLXA 4KNBA 4M84A 1UV5A 2ITNA 3H3CA 3HP2A 5K4JA 3ZEWA 2Y8OA 1RJBA 5IQDA 4BI0A 4HGSA 4L3PA 2VTSA 4E4LA 3PJ8A 4MXXA 4FR4A 5M06A 4GS6A 3QGWA 5HD7A 4CMOA 3DK6A 3ZM9A 4R5SA 2VO0A 5EYKA 1KOBA 3OXTA 1G8AA 2QODA 4FF8A 1M7NA 5L2IA 5LVPA 2OIQA 4IZ7A 5KUPA 3TUCA 2QOHA 4TNBA 3ZFYA 5JRSA 5AP5A 5EI6A 4XP0A 3SDJA 4RX7A 3UC3A 3EWHA 3UDBA 2CMWA 2BIYA 5AFVA 1P14A 3C4ZA 5I3OA 1V1KA 3G2FA 4F7JA 4OUCA 2WU7A 4UMTA 4FVPA 2HWOA 4IW0A 3OTVA 1VR2A 2JAVA 3AMAA 4YJRA 3RPYA 2G01A 5E1EA 3JVSA 4LGHA 4ZTNA 3V8SA 3VUDA 2W1FA 4L46A 5JGAA 3SRVA 5AR7A 4K11A 4D1SA 3CQUA 2QQ7A 3NLBA 3I81A 4NTTA 4XMOA 3RJCA 4EUTA 5HVJA 3GCUA 3IGGA 1XH6A 1RW8A 2GDOA 2RG6A 1PXNA 3HMNA 3QXPA 4IIRA 3KRRA 3T3UA 4EOPA 3BKBA 3F7WA 4R1VA 1L3RE 3PZHA 5HIEA 2JIIA 3W8LA 3EN7A 3UO6A 4O0VA 2XP2A 4YTFA 3FI8A 3ROYA 5EYDA 3F3ZA 4E4NA 4EOQA 3MH1A 3V8WA 3BIZA 4DCAA 2OGVA 2PMOX 3ZO2A 3FMKA 1H26A 4CSVA 2OO8X 1LP4A 2WMAA 3EQPA 3UJGA 4ASDA 2VWIA 2B4SB 2XA4A 3MVHA 3Q4ZA 2YZAA 4QTDA 3FZ1A 5AIRA 5FXSA 2JKKA 1M7QA 2UW8A 3MVMA 3GUBA 5CVGA 3WYXA 4IDVA 4LL5A 4RVTA 4XX9A 4FVQA 4U5JA 4C4IA 2F9GA 2ZYBA 5KZ0A 4F9YA 1TKIA 4TRLA 3ZOSA 3PZEA 2ITQA 4M3QA 5AIKA 3ZDIA 5CLPA 4E1ZA 5HBEA 4AG8A 1PHKA 1J7UA 2YN8A 2YM8A 3AC2A 4QQ5A 4QMOA 4R5YA 3F61A 4IC7A 2XK4A 4DFNA 1CDKA 1EH4A 4DITA 2C3IB 3TCPA 4KD1A 1KOAA 4ASZA 4MNEA 5CXZA 5DA3A 2OZAA 1G3NA 3MFTA 3LZBA 4RLKA 2Y4PA 3PIZA 4GSBA 2R4BA 3IDCA 4FT5A 3DFCB 4XRLA 4EH5A 2WMBA 3ORZA 3LFAA 4U41A 5HE0A 4JRVA 3HLLA 4TYHB 4U9AA 2GNLA 4MVFA 5CEQA 4APCA 4PDOA 1PYEA 3PXFA 1OIQA 3UP7A 5J5TA 4HGEA 2WU6A 4YO6A 3QUEA 4YUQA 1WMKA 2B53A 2EXMA 3DCVA 2ZDTA 5HNIX 4V04A 3ZDUA 4QYEA 5FTGA 3GVUA 4GG5A 1WBWA 2OJ9A 1YDTE 4J53A 4L9IA 4NIFB 4EKKA 5E92A 4MTAA 2QVSE 5IPJA 1KE8A 5JKGA 3M11A 3HUCA 2YCFA 3PDTA 4ZTRA 5LVLA 5CAVA 4JAJA 4GRBA 2R3IA 3NEWA 3FXXA 1SVHA 2C6OA 4UMPA 4E8AA 4K1BA 4V01A 5ETFA 3QF9A 3I7BA 5AJQA 4KS8A 2J2IB 5H8EA 4DCEA 3RAWA 3DQWA 5FWKK 1FQ1B 1CKPA 4JBVA 4YR8A 4FTNA 4GL9A 3WBLA 3SHEA 2AUHA 4H58A 4BDGA 5DT0A 5LVNA 4KBCA 4R1YA 5FBNC 5L3AA 4II5A 1UNHA 2GS6A 2JDTA 3G33A 5E8YA 4BCPA 4NYEA 5CYIA 4RFZA 4O81A 3AC8A 3KN5A 5EH0A 5K0KA 4ITIA 3QD3A 3NCGA 2WTIA 2C6DA 4KSPA 2WIHA 3QQLA 4A9TA 4XG7A 3O2MA 3U6HA 1YDSE 1XBBA 1KE9A 5J9YA 3DZQA 5EQEA 1YXSA 3WZDA 1UVRA 3ORNA 5HESA 4X3JA 3MS9A 5AV1A 3NNVA 5CAOA 5IDPA 4BCNA 1GIIA 2BDJA 4FNXA 2C3JA 3LCKA 3Q60A 3CTQA 1BI8A 4ZTLA 3V5LA 2P33A 4DFLA 4EWQA 2ACXA 4ORKA 1DAYA 4Y46A 1BUHA 4K2RA 3EFKA 4X2FA 2GHGA 3VHEA 4FKWA 4KUJA 2VUWA 4HVSA 4FKLA 3E7VA 3QQHA 1V0OA 3BYOA 2RKUA 3UQGA 1V0PA 4DG2E 5M4IA 3HA6A 4BN1A 4I20A 3BI6A 4KSQA 4E5AX 1ZARA 4RWIA 5FG8A 4AT5A 2J0LA 4NZWB 5I9VA 2R7BA 3VF9A 4BI2A 5IA2A 3Q9XA 4FKGA 4AOIA 4EOMA 3P0MA 1MP8A 4FV3A 3DLSA 4BTFA 2BIKB 5HGIA 3A7FA 4UYNA 3BHTA 4L53A 1SM2A 2PTKA 3LOKA 2UV2A 3LCSA 5CEOA 5J95A 1JKLA 5FDXA 3QQFA 4K33A 4G3FA 1JKSA 4TT7A 3SOCA 3VS2A 3R8MA 3ZO1A 1H25A 4A9YA 4KABA 4DLIA 3C0HA 4K0YA 2YA9A 4YJVA 3UBDA 3UO4A 4XG8A 3UIXA 5K9IA 4FTKA 4GYGA 4RWKA 4PPAA 4LV8A 3Q4TA 3UODA 1YWRA 4FC0A 5DR6A 3EN6A 2W1HA 3P5KA 4E20A 5B7VA 4GV1A 1LEZA 2C6MA 2JKOA 2WEIA 2WMUA 4CFUA 4J99A 3IOKA 2BUJA 4QYYA 5F95A 3MIAA 2CCHA 3RK9A 4UWYA 3EQIA 5KMKA 2PYWA 2GNJA 4E5WA 2XM8A 4U6RA 4ZS4A 4JRNA 5FTOA 3U9CA 2BTRA 5CENA 4WUNA 2OSCA 1QL6A 3LCTA 5EYCA 4DH5A 3E88A 4KRCA 4L3LA 2Y4IC 3KULA 3QQJA 3B8RA 3W1FA 5LMBA 2C5OA 4G3GA 2WELA 3O7LD 3CTJA 2XNGA 3TG1A 3KVWA 2GHLA 1LR4A 4HGLA 2ITVA 4D28A 4L00A 3TV6A 4CT2A 4BDJA 4DEEA 5CVFA 3FLSA 3Q5ZA 3SG9A 2OXXA 4ONAA 1O6KA 3E64A 3IK3A 5DHJA 5CXHA 3U9NA 4EHEA 5CF4A 4FV4A 5JSMA 2CCIA 1UU9A 4W8EA 3U54A 2C47A 4WT6A 4AFEA 2PVMA 4C4HA 2X9FA 2Z2WA 3U51A 2UW5A 3OWPA 4FV8A 4JR7A 4K77A 1FPUA 3BYMA 2J7TA 4X2KA 2W06A 2YZLA 5AUUA 4QMLA 4UYAA 4XV1A 5DBXA 1H0WA 1OUKA 2LAVA 4OW8A 4FEUA 2WOTA 5CAQA 3HV4A 3K5VA 1WFCA 3L9MA 4O27B 3S3IA 5DT4A 4ZLZA 1OBGA 4IVBA 2P3GX 4MYGA 5AUVA 1A48A 2J9MA 3Q4CA 3W18A 1UKIA 3EL7A 2X2MA 3PJCA 2CN8A 2C6KA 3O51A 2R3GA 3WILA 5JZJA 3OHTA 3NSZA 3AQVA 5HG9A 3L8VA 3WOWA 4V0GA 3ORPA 1WVWA 3DK3A 3ZUVA 3QD4A 2HXQA 2WTJA 3QRUA 2P55A 3HZTA 5FRIA 4QQCA 1WBNA 2OF4A 4ZOGA 4KAOA 3COKA 4E93A 1R0EA 3FLQA 2XH5A 4Z7GA 5M57A 3WIKA 1YKRA 2AC5A 4O7RA 5CI7A 4BCFA 5IA0A 1F0QA 5L8KA 2WXVA 3GB2A 4PL5A 4RIWA 2UVYA 5AAFA 3TIZA 4O7ZA 5CU6A 3SGCA 3VVHA 5BUEA 2B9JA 4XLVA 4XOYA 1Y8YA 2I1MA 3A7JA 3C4WA 4W4WA 2HZIA 1ZZLA 4U7ZA 2J6MA 1XH5A 2JDOA 4PPBA 3VUMA 1DI8A 1MRVA 2VX0A 2BHHA 4IB1A 2XEYA 4HYUA 4RGJA 4M66A 2GTMA 3MDYA 4UWBA 5ANIA 1HCKA 5I9YA 3BEAA 4JG7A 5FM3A 4I5MA 5EDPA 4FYNA 1KV1A 2XJ1A 3TM0A 2WMTA 5EQPA 3GC7A 3C0GA 3UPZA 3BU6A 3WF8A 4FG8A 4ALWA 2BFXA 3PXKA 4O96A 2X4FA 2PMLX 3NUAA 4NJDA 2OK1A 4MNEB 3HMMA 4CGAA 3PE1A 4DBNA 2BAQA 3ITZA 3OY3A 1PXLA 3F88A 4WBOA 4Y72A 4OAUC 4FGRA 2EUFB 1Q5KA 5ACKA 5E8WA 5IISA 4FSUA 3NNWA 4RIOA 2ITXA 4EH4A 4FT0A 4J52A 3VQUA 2C4GA 5EW9A 4A4OA 5FQDC 5HX6A 3DAEA 5A3XA 5LWNA 4MX9A 3QU0A 3RZFA 2XKFA 4LMUA 4GVAA 2J5FA 4X7QA 4DH1A 4QQJA 1SNXA 3D2IA 1E9HA 5CT0A 4O0SA 2XNMA 2BRHA 3FHIA 1Q97A 3QBNA 4FSTA 4IX6A 2A2AA 3VBTA 3R73A 2OH0E 2BALA 3OS3A 3WZJA 4D5HA 3MI9A 2PVRA 4E6QA 4I6FA 4BC6A 3NYOA 3KY2A 2QCSA 5JGDA 3KFAA 4BKJA 3SVVA 1Q8ZA 3ODYX 3RKBA 3AC5A 5IA5A 4UWCA 4J8MA 1M52A 4QRCA 1OL1A 3QAME 5LJJA 4GT3A 4YMJA 1QMZA 1O6YA 3OOGA 4HYIA 4I3ZA 5T3QA 4PTEA 3FMEA 3FKNA 5E8VA 3VS7A 3E3BX 3BV3A 4A9RA 2GSFA 2VNWA 5CZHA 4G6OA 4AZTA 4KIQA 2ESMA 3M1SA 4CFXA 4JS8A 3U4UA 3RM7A 4EOKA 2HAKA 4E5BA 3CD8A 3C4FA 3QX2A 4TYEA 5M44A 3MY1A 4BZNA 5IMXA 3ZZEA 1F5QA 2BRMA 5J87A 3LMHA 4QMNA 3ACKA 3GOPA 4YJNA 4RWJA 5CTPA 2C1AA 3TUDA 2BVAA 3FPMA 3RHKA 4BKZA 3A7GA 5AMNA 3EKNA 3B2TA 4PDSA 3N9XA 2FSOX 4M15A 4WNPA 5GNKA 1XH4A 2GNGA 4IVDA 4QP9A 2AC3A 3L8PA 3R2BA 4L3JA 4XOZA 5DYJA 4AOTA 1XJDA 4MXZA 2CNUA 1YXXA 3QYZA 2QOLA 1OECA 3SD0A 3SA0A 5JGBA 3P4KA 5HHWA 2BHEA 5L6PA 1FVVA 4YLLA 4X2GA 3GP0A 3MFUA 2Z7LA 3UGCA 3K5UA 4UBAA 4AN9A 4QP6A 3FWQA 2BAKA 4GIIA 1WBSA 5D1JA 3A2CA 1OKYA 3S95A 3ERKA 4BDEA 2QO7A 3QUDA 3DB6A 5CEMA 4RC2A 4AN2A 3G9NA 4HGTA 2O2UA 2I7QA 4CTCA 2QOFA 5BVWA 3IW6A 4DEDA 4C0TA 4F99A 4Q5HA 2C6TA 3VUHA 3AGMA 3OEZA 5KZIA 3DBDA 3PTGA 4L42A 2G2HA 3LXPA 3CY2A 3E8EA 2UZDA 4KKGA 2XKDA 4BGQA 4QP2A 5CEPA 5AUXA 4PMSA 2P0CA 2Z02A 1PXOA 4CLIA 3R7GA 4L43A 3MFRA 2B0QA 5FM2A 2IVUA 4R7IA 5A6OA 1B38A 2G9XA 3FQEA 4IHPA 5ETAA 3N4TA 2ZVAA 4HPUE 3WIGA 3PPKA 2X4ZA 2B9HA 1BLXA 4HZRA 5C4LA 3KCKA 3ANRA 4BDBA 5A14A 2CNVA 4AGDA 2VWZA 3PIYA 3NR9A 4G3DA 4BCJA 2GNFA 4EH6A 5CAUA 2FSTX 2PMNX 3QKLA 3KK9A 4JL9A 4CZTA 5KBQA 5DI1A 3ULZA 3NUPA 2JAMA 4CMUA 2R3QA 3R02A 1OIYA 2GFCA 3GU5A 1W8CA 4CCBA 5A4QA 3CY3A 5B2KA 1PXPA 1UA2A 3NPCA 3R1YA 1PXKA 2E9UA 4BY9E 4GCJA 5H9BA 2XMYA 2OI4X 2PSQA 5JT2A 5A6NA 2B9FA 5JFSA 3BBTB 3BHVA 4TWNA 4AN3A 1Z9XA 5B2LA 3KU2A 3QZGA 4EYJA 2F49A 4F65A 5BMSA 3FDNA 2YDKA 3PVBA 3QD2B 5HG8A 3VS1A 2ZB1A 2X9EA 1JBPE 3QXOA 1J91A 2I0HA 3ULIA 2CGUA 2OJIA 2OFVA 4AACA 4QMQA 4ZSGA 4QP4A 3UIMA 2C0TA 3F2NA 4D4YA 4BBMA 3B8QA 5HZNA 3D2KA 4XRJA 5D7AA 2OLCA 3OF0A 4FEVA 2IZSA 4TYHA 2GNHA 4C02A 4XV9A 2FVDA 3L8XA 3LQ5A 5DN3A 4EONA 3AT4A 5IDNA 1KE5A 2C1BA 4I41A 1R3CA 3ZRLA 4AT3A 4HW7A 1OKWA 3UOHA 1UNGA 4DG3E 4I5HA 3OBGA 1ERKA 3DNDA 4L45A 3UZPA 4NIFA 3Q5IA 4G2FA 3HRBA 4FKOA 4FV2A 3CGFA 4O7VA 2IPXA 4QMVA 4WG5A 4FKRA 1WVXA 3ENMA 4RZVA 3OCSA 2C69A 3DBEA 2R64A 3DXQA 4LOQA 4GUBA 2C30A 5CALA 5DR9A 4FIJA 3PG3A 3V5PA 3VHKA 3DGKA 5CZIA 5C1QB 2VNYA 3O71A 3QWJA 2W1EA 4BTMA 3KRXA 2OXYA 4DT8A 4GFMA 3IO7A 2XKEA 4DEAA 4FKUA 4I0TA 4CKRA 5KMMA 4FTMA 2XJ2A 2YLFA 5EI8A 3CEKA 4TWCA 4IZ5A 4FTLA 4H05A 3CS9A 3FXWA 5EYMA 2DQ7X 4FTRA 3LQ3A 2EB2A 2HZNA 4AW5A 3I5ZA 3KF4A 1MQ4A 3F3TA 4XNEA 1PF8A 2CDZA 3CTHA 3UIUA 1TQMA 4BCKA 2NNWB 4FMQA 4R6VA 3KQ7A 2O63A 2JFMA 2FA2A 3NAYA 4HYHA 4XH6A 3UE4A 4IQ6A 2WMXA 4O0WA 1R0PA 3ET7A 4MD8E 4KKHA 4QMMA 1JSUA 4FZ6A 3NW7A 4RMZA 4ASEA 3NCZA 4IWPA 4NTSA 3ZO4A 5F9EA 1X8BA 4DEIA 4W8DA 2ITZA 2W96B 4BZDA 2BZIB 5HO7A 2VTJA 3R63A 4XS2A 2XJ0A 1K9AA 1UU3A 3NYXA 3WZKA 2VV9A 4NUSA 1OKZA 1PMUA 2YCQA 4M67A 3AC4A 4WG4A 2WMRA 5AAGA 4FSWA 2WFYA 4EC8A 1XQZA 4P5QA 1IAJA 3LJ2A 3UTOA 5IEXA 4CFMA 3R1QA 4AW2A 4MH7A 4NM7A 3IPHA 3RK7A 5BQ0A 4XBRA 3P08A 4C33A 3E8DA 4G5PA 4LV5A 4L7SA 2VAGA 3SAYA 4D9UA 2Z7QA 4Z16A 2WTCA 3C13A 5IQFA 2Y9QA 4IWQA 3RBWA 4EOIA 3DZOA 3QUPA 4J71A 3DJ7A 5IA1A 4YC6A 3UOJA 3EFLA 2PZPA 3W33A 4EHGA 3RPRA 5IEYA 5I0BA 4ZTMA 5LVOA 4BIEA 4BCHA 3ID6C 1H1RA 3DQXA 2WTKC 3UVRA 1RE8A 3PSBA 5EKOA 3UIBA 4B7TA 5IEVA 1PXJA 4C57A 2B55A 5F20A 4EOJA 2EB3A 4AT4A 4QTBA 3VNTA 5TOZA 4Y5QA 4O6LA 5AM6A 4IE9A 4YHFA 3EZRA 4YNEA 4LUEA 4M0YA 1ZOGA 3WYYA 4EJNA 4YU2A 4TYJA 4PP7A 4BR3A 1XH9A 2FH9A 3FLWA 3I0OA 1I44A 3RZBA 4E6AA 4C4GA 4BBFA 4FE2A 4ZLYA 3Q6UA 4DFUA 3UVQA 5CS6A 2F2CB 3HMIA 4DH8A 5C8KA 2QOBA 1Y6BA 4J7BA 5AR2A 1MUOA 4I24A 4ZJIA 1VZOA 5IF1A 1PYXA 5TT7A 3ZLYA 1P5EA 2GFSA 3NUSA 1CSNA 3LQ8A 5AP4A 3QTQA 4E4MA 5HNGA 3GXLA 2J0KA 1GJOA 2F57A 4NFNA 4HVIA 4F7LA 3HV7A 4D4RA 4FV6A 4D1ZA 2W5BA 5EDQA 3OTUA 1YHVA 4RBLA 4RVLA 3R1NA 3V8TA 3HX4A 1XH7A 3GU6A 5D9HA 4BDFA 5F94A 4FICA 4LRKA 4O0UA 5JH6A 2R3MA 3QTRA 3BHHA 5L2TA 1GZKA 2BR1A 3JPVA 5HU3A 3H0YA 2F4JA 4F4PA 4FIEA 2FUMA 1FGIA 4S33A 4MBIA 5CEIA 3RHXA 5LMKC 2C3KA 4I6BA 4DGNA 5I9XA 3QA8A 3T3VA 2GS2A 4BFMA 4X3FB 5E8SA 3VS3A 4BBEA 3EYGA 4MF0A 4IANA 4UV0A 5IUIA 3E87A 3OCGA 1PKDA 3PYYA 3MY0A 4ACDA 4NH1A 3A4PA 2XRWA 2RSVA 3WE8A 1UWHA 5EM8A 1NY3A 3ORMA 4IBMA 1W7HA 4IX5A 1OUYA 2XM9A 3BX5A 1JLUE 3PY3A 4F6WA 1T45A 3GC8A 4QPMA 2XNBA 3R83A 1OKVA 4FODA 4UMUA 4HCTA 2VWBA 4BYIA 3DBQA 4ALUA 3DPKA 4GUEA 3C4XA 5H8GA 3RTPA 2QG7A 2W17A 3BPRA 3LFQA 3TIYA 3MY5A 1Q62A 1BL6A 3H0ZA 3QCYA 1PRYA 3P86A 5AR5A 1OL7A 4ERWA 5I4NA 2QKRA 3EQDA 3GCVA 5HLNA 5IUHA 3IONA 4U81A 3S1HA 2GQGA 3PXYA 3MTLA 2OF2A 4CFNA 3RVGA 2ONLC 3MPMA 4USFA 4HNFA 2HZ4A 3KCFA 1Y57A 5AUZA 3HMOA 4LL0A 5FBOA 3Q2JA 5M4CA 4YC8A 2W4JA 3C5UA 3ZXZA 4CTBA 2JFLA 4DEHA 4YC3A 2XIRA 2E2BA 4IVCA 3CXWA 4K18A 3UP2A 5J7HA 4I93A 4RJ5A 4PMPA 5C01A 3OT3A 2HZ0A 3TKUA 2QR8A 4K8AA 2WQOA 2QOOA 4FV7A 3UMXA 4C3FA 4PNKA 4JI9A 4QMPA 2HCKA 4B8LA 2JD5A 2UW6A 1H1PA 3LXLA 3QRKA 4YHJA 3R9OA 4F1OA 4P90A 4ZY5A 5KNJA 1NXKA 2JLDA 4OTFA 5AV2A 4ZS0A 1U54B 4QT1A 1IR3A 5CQWA 3O8UA 2I40A 3MB7A 4GMYA 3FMJA 3POOA 3POZA 3C0IA 3I7CA 2I0YA 2WB8A 3SXFA 4DFZE 3QL8A 5GIPE 4E3CA 4ERKA 5M4FA 3TACA 4OAVB 3EHAA 3R6XA 2WD1A 4XP3A 4C4EA 3HEGA 5JFXA 2F7XE 3L8SA 1H01A 4FIFA 4O2ZA 5HEZA 5LWMA 2BZHB 1H4LA 2PWLA 2HYYA 2PULA 4FKTA 3DTWA 3BLQA 3C9WA 1PKGA 3LFCA 3PRFA 4H3BA 5CSHA 5EW3A 3DV3A 3LM5A 3HMPA 3FL4A 5IU2A 4O6EA 5GZ9A 3ZMMA 4F9BA 4FTOA 3KMWA 3C4EA 1AQ1A 4LMNA 1UKHA 4WRGA 1H00A 3MPAA 5M55A 4UEUA 4IFGA 3FSFA 3G51A 1ZXEA 5DEWA 3EFJA 4O7YA 1BX6A 1U4DA 2VZ6A 4YJUA 4H36A 3KVXA 1ND4A 4NT4A 4FKQA 3DAJA 3P78A 4LM5A 4AZEA 3FHRA 2DUVA 2ZAZA 4TN6A 5TKDA 3N4VA 1GZ8A 2C5YA 2I0VA 3NNUA 4QTEA 2W1GA 1H07A 2HW7A 4B0GA 5AV3A 3ATSA 2EVAA 2CKEA 3G6HA 4OLIA 4LI5A 5CSXA 2ITPA 2VWXA 2W9FB 3L9NA 3R9NA 4RJ4A 4RJ8A 2R3OA 5M53A 4QMUA 3WI6A 3PJ3A 4ANOA 3PA4A 3QZIA 4KB8A 2GQSA 4DF3A 4YZNA 2IZUA 3R71A 1APME 3Q32A 4G1WA 4BDCA 2O65A 3EQFA 4CVAA 2XK8A 3VUIA 4MBJA 3BWJA 3GNIB 3QTUA 2BMCA 2BRBA 3FAAA 3AG9A 5IH6A 3LMIA 3BHUA 1YVJA 3LFDA 4FTAA 5EQYA 1TQPA 4KIPA 3EZVA 5EW8A 5CF8A 3MW1A 2ZM1A 1XH8A 2V5QA 4DH7A 5CF6A 3ZTXA 4EHZA 1Y6AA 3JYAA 3LVPA 3SXRA 1OL2A 4FNWA 4AGCA 2IN6A 3U55A 4R7HA 3NS9A 4EYMA 2IZRA 5DNRA 3K54A 4YGAA 4DG0E 2W1ZA 5AA8A 5HBJA 4AQCA 3QFVA 4C36A 5CAPA 1KUTA 3VN9A 3PP0A 3GEQA 1UNLA 1JWHA 4C3PA 4XCUA 3N4UA 4FBXA 3EQHA 4YNOA 4NCTC 5ACBC 1LEWA 2NP8A 4FUXA 4V05A 1GIJA 2IW8A 1MRUA 3A62A 4ARKA 3BU5A 4EBVA 3ANQA 3Q96A 5JQ5A 2CJMA 3DB8A 3P7BA 4FSMA 4O7TA 3HL7A 4O22A 4ZIMA 2XNPA 3AXWA 5A9UA 3E8CA 4C4FA 2YIWA 1H0VA 3D4QA 4X2NA 3OMVA 3FC1X 4AU8A 4O82A 4PRJA 2I0EA 3G90X 4LGGA 3LAUA 3LM0A 5CU2A 5HO6A 4E6DA 5I9ZA 3TDWA 2QO2A 3CPCA 3Q9WA 1Q24A 3QLFA 5HIDA 1JVPP 3GC0A 5EM5A 4LRJA 2XUUA 2X8IA 3BE9A 5HE1A 4IAAA 3TV4A 2X7GA 2QONA 5AV4A 3FZRA 2VX1A 3GCQA 3PVUA 3ROCA 5T6KA 4EBWA 5CANA 4HNIA 2XBAA 2WQEA 3RINA 3R8ZA 2R3PA 4Z7HA 4HOKA 5DEYA 3T8OA 4ZK5A 4ENXA 2ITTA 4C61A 3R8VA 1IRKA 4TL0A 2HENA 4O1PA 4BWPA 5L8LA 2CN5A 4XP2A 3I79A 3PXQA 4YJOA 4C58A 5BPYA 3VW8A 3JS2A 4DTBA 2PZ5A 4ACHA 4IM2A 4DLJA 2QG5A 5CVHA 3CBLA 3R9HA 2OH4A 4ALVA 4S2ZA 1Q61A 4DAWA 3QRTA 4MD9E 3KF7A 4DGOA 2FB8A 5BYZA 2C5VA 2J0IA 2UZLA 2YISA 1FMOE 3CC6A 3GFWA 2EXEA 1B39A 4ANBA 4LG4A 3HAMA 4LGDA 3WARA 5GJDA 3ATTA 2VWVA 2PVLA 2Y6MA 5JK3A 3L1SA 4CV8A 3ALOA 2R3RA 2ZMDA 3KXNA 4C62A 4DC2A 2X6EA 4WG3A 3FUPA 4GFGA 2VTIA 4X2JA 4IXPA 4DHFA 2R2PA 5A4TA 5IG1A 1CKJA 2B9IA 3HV3A 3UNZA 5BVDA 4NFMA 2VO3A 4R77A 4FTTA 2C5XA 5IQHA 1OIUA 2JIUA 2O0UA 2YIQA 3CJGA 4S34A 4AGWA 3V5TA 3ZHPC 2ERKA 4IAYA 4UN0C 2C6EA 4RSSA 3TTIA 3EQCA 3TTJA 1IG1A 1E1XA 4N6YA 4QMSA 5AWMA 3K3JA 4ZSAA 4C35A 4ZZMA 2JGZA 3KN6A 4JG8A 1ZMVA 2H8HA 2RG5A 3PXRA 4XG9A 2IJMA 4FZDB 4D2TA 4H3QA 1RDQE 3KREA 1VYZA 2V7OA 2PVNA 4DINA 3OUNB 2HWPA 3EQGA 4HPTE 4L68A 4CNHA 1Z57A 4FIIA 4RA5A 2F7EE 3RM6A 3QA0A 4YSJA 3G5DA 4JDIA 3W2CA 2X6DA 2OIDA 1WCCA 4K9YA 4J1RA 4L8MA 1GZOA 3MPTA 4Z9LA 3CPBA 5KX8A 1NVSA 3EMGA 5CNNA 3QTZA 3W32A 5AA9A 5M56A 3DKOA 4P2KA 5KMLA 1PW2A 3THBA 4IX4A 5IA4A 3OD6X 3FSKA 4JIKA 4F0IA 4OTHA 4R3PA 3BV2A 3RMFA 1JPAA 4EEVA 1KE6A 3RWQA 3BE2A 4BVUA 3PPJA 2WZJA 4JDHA 4OTRA 5DMZA 3D83A 1ZYLA 3KB7A 3FE3A 4ZLOA 3ORIA 4AZSA 4Z55A 2OXDA 4GK2A 5HICA 3ZLWA 3QHWA 4XG4A 3BHYA 4FG7A 3ZC5A 1CTPE 3U4WA 3I6WA 2PVKA 4UALA 4YLJA 3VUKA 4DTAA 2CPKE 3D7ZA 3IW7A 3KRJA 2GCDA 1ZY4A 3VF8A 2BPMA 5G1XA 2R3KA 3LCDA 4B6LA 2OJFE 3F2AA 4ZZOA 2GQRA 2RFSA 3IS5A 3R21A 4DE4A 3IDBA 1WBOA 3TJDA 2XIYA 2Q0BA 4RIXB 4EK4A 4FEXA 4ZTSA 4BDIA 4D0WA 4RQKA 3NMUF 4Y8DA 3BLHA 2Y4IB 2P4IA 3TKIA 4PTCA 3O17A 1NW1A 2VGPA 2W0JA 5IMEA 3V3VA 3Q52A 4G17A 3MGYA 2X2LA 3ZEPA 2UZVA 4RJ7A 1OI9A 4ZSEA 4RIYB 4U79A 2XK7A 2R0UA 4FT3A 1O9UA 4FIGA 4W4VA 5B0XA 3PE2A 3O7LB 3QRIA 4O2PA 3PG1A 3F9NA 5CQUA 4MXAA 3OVVA 4GJ2A 3F3UA 1H28A 5LARA 4TYIA 2GS7A 2YACA 1R39A 1M2QA 3O50A 3ALNA 3JY0A 4BTJA 3FC2A 4EOLA 5KMOA 3D7TB 4G9CA 2G2IA 2IVTA 3OXIA 4CFWA 4IM3A 1ZYCA 4WO5A 1PXMA 4ZTQA 4GIHA 1WZYA 3TZMA 4CQEA 4F9AA 1GOLA 2BAJA 3F5PA 2ZV2A 4U80A 1JKKA 4MEDA 3W16A 4HVDA 2B7AA 3PVWA 4OTQA 1Q99A 2PPQA 3C5IA 5H2UA 4FZFB 4WNOA 5ANGA 2C0IA 3OWLA 3KXMA 4PWNA 5AAEA 3OWKA 4WSYA 3MSSA 1VYWA 4NL0A 3HDMA 3MV5A 3KRLA 4JLCA 3F5XA 4F7SA 4ZJJA 4JQ7A 4M12A 4EUUA 3LLAA 4XBUA 4FEQA 4IH8A 2WKMA 2X1NA 3AD6A 3D9VA 4BZOA 3CCNA 2PHKA 4L67A 4CKJA 4JXFA 4XYFA 4G9RA 3NYNA 3FMDA 2W99B 3R7VA 4B9DA 4Z3VA 4JX7A 2YHVA 2C68A 3TZ7A 4IWDA 3VBQA 2YITA 2FYSA 2W1CA 3RALA 3F2RA 4ZXTA 4YLKA 3V01A 5IQIA 1J1CA 4ANMA 4D9TA 1R78A 3AT2A 2JBOA 1Y91A 3FLYA 1PMVA 3OEFX 4GFOA 4GJ3A 4XUFA 5EM7A 4R7BA 2YM6A 3KK8A 5J1VA 2AYPA 4U40A 4X3FA 5HU9A 4FOBA 3MH2A 3II5A 4IEBA 3UQFA 4YO4A 5JFVA 2VWWA 1W0XC 5AUWA 1QPJA 5JMSA 5IA3A 3ZSHA 2QI8A 1BMKA 2X0GA 3SW7A 4AZFA 2BRGA 3ELJA 4IB3A 4Y85A 3MN3A 3ZZWA 2QHMA 5IQCA 2DS1A 3R0TA 4GT5A 3R7EA 1XHAA 2A0CX 3ACJA 3PSCA 4MF1A 3B2WA 3F5UA 4G34A 4C38A 1O6LA 2C0OA 2XK3A 4UMQA 4EK6A 3CKWA 4EH7A 2YDIA 1FOTA 3RP9A 5K0XA 4KIKB 3RAIA 3DK7A 3NDMA 3AC1A 4CD0A 4EZ7A 3BGQA 4GK4A 2QOCA 3GENA 4IAFA 4A4LA 4PNIA 3VRYA 2V0DA 4ZSJA 3MA3A 2GPHA 5DFPA 5E1SA 2HIWA 5C8MA 4MCVA 5DPVA 3TZ8A 4GU9A 4NKAA 4LOOA 4RG0A 1WAKA 3HYHA 4TPTA 4RQVA 3KKVA 5HKMA 4IB0A 4ANQA 3WZUA 4F63A 4GU6A 1PY5A 2ZDUA 4Q2AA 3ZS5A 3Q6WA 1YXVA 4YP8A 1QPCA 3E92A 3Q3BA 3R8UA 3KA0A 4FIHA 4QPAA 3FYJX 2QU6A 3TNPC 1Q4LA 5L2QA 4D0XA 2W1IA 3O96A 4C4JA 2QOKA 3JUHA 1Q3DA 3UG2A 5BUJA 3CQWA 3LE6A 4KIOA 4LOPA 4F0GA 4ACCA 2UW0A 3R7IA 5K3YA 3ZM4A 4BB4A 1U54A 2E9OA 3OC1A 4QPSA 3FLNC 2FSLX 4FGBA 5DGZA 4EH3A 3F6XA 3SC1A 2XB7A 1REJA 5F1ZA 4AA4A 2V22A 2UZOA 1S9IA 2YEXA 4PY1A 5AM7A 5FUTA 3I0QA 3RWPA 5D10A 2VTLA 4MWIA 3PPZA 3G9LX 5L2SA 3SLSA 4QTAA
chains in the Genus database with same CATH superfamily
2HOGA 1KSWA 5KHWA 3IW8A 4PTGA 4YSMA 4IX3A 3OT8A 2PZRA 3COHA 2ZM3A 4PL4A 4CMTA 2VX3A 2XF0A 3A7IA 2R3FA 3H9OA 4FTJA 4AZWA 4BCGA 3F7ZA 1W83A 2EXCX 5CSVA 1J7LA 4RRVA 2CKQA 1IASA 5T68A 3IW5A 4QP1A 3PY1A 3W2OA 5AUTA 4FK3A 3FMLA 5IQGA 4D2VA 3NWWA 1OB3A 3LLTA 5IUGA 2RGPA 5IZFA 2VGOA 2W5AA 2G2FA 2XIXA 3TWJA 4DEGA 3UNKA 1ATPE 4W4YA 4O4DA 2X39A 1WVYA 3ORTA 1DS5A 2JITA 5J9ZA 3W0OA 4RLLA 3QZFA 4ID7A 4S31A 3I6UA 5AR8A 2XS0A 1E1VA 3OW4A 4HZSA 3U8WA 4CV9A 2O3PA 3MH0A 3VAPA 3Q53A 4UZDA 3TNQB 3W2SA 3CSVA 2XYUA 3ZH8A 4A7CA 4JQEA 4KKEA 4UMRA 3NUXA 4HCUA 1U5QA 4IADA 4OTGA 2YIXA 3I1AA 4LQMA 5C03A 5EG3A 1J7IA 3NW5A 2PUPA 4NEUA 2Y0AA 5TR6A 3WF9A 2PUUA 2XIZA 3ZLSA 5EI2A 4FKPA 4JNWA 2BRNA 2IZTA 3QHRA 2VTHA 3QQGA 3UYSA 4IDTA 2SRCA 2J0MB 1ZMUA 3TEIA 1CKIA 3FY0A 4FTUA 1IA8A 1G8SA 3VULA 2IG7A 1T46A 3E3PA 3DKGA 2NRUA 3MFSA 4YHTA 4CKIA 5FDPA 5A4CA 3EFWA 4LUDA 2WGJA 3Q9ZA 4ZY6A 3ETAA 3A60A 4BCQA 2F2UA 3NIEA 4E4XA 3TJCA 3A7HA 3QCQA 5CEKA 4GVJA 2H96A 3NUNA 4M69B 4TZRA 3ZBXA 4EZ5A 3AD5A 4FSZA 3LHJA 5LOHA 3EOCA 4O21A 3BYUA 1YXUA 2ONLA 5BX0A 4RFMA 2VO6A 5M09A 4TW9A 3ODZX 2ZJWA 1YRPA 2VWYA 4Q9SA 4H1MA 2IF8A 4BYJA 2W4KA 3QGYA 3GU4A 2JC6A 4L44A 3D14A 4RX9A 4AW1A 1STCE 2QOIA 5FGKA 4I21A 1OGYA 3G15A 3D5XA 2QURA 1Q8TA 5CI6A 1VJYA 1OM1A 1H1SA 3AMBA 4A9UA 4UXQA 1JQHA 2R3NA 3VRZA 3CE3A 4MK0A 4TWPA 3BQRA 1Y8GA 5LXMA 3W8QA 2Z7SA 3FKLA 5TE0A 2PVJA 3PLAE 3ZBFA 5HE3A 2IWIA 3KMMA 4WNKA 3ZSGA 5JRQA 5HO8A 4IZAA 2QOQA 2XYNA 2ITWA 2BKKA 2ZV8A 4FKIA 4N4SA 3GU7A 4ASXA 2PMIA 4A4XA 4U8ZA 3DA6A 4NSTA 5C8NA 4J97A 1JOWB 3BELA 3FQSA 4MD7E 3Q4UA 2X0QA 3PP1A 2R9SA 3C4CA 1Q3WA 1JKTA 3MB6A 5J1WA 4UB7A 4CYJA 3ZCLA 4DGGA 5C26A 2ITYA 4OR5A 3PXZA 4DGMA 3ZUTA 1ZWSA 2ZV7A 3KEXA 3TNWA 3VBVA 4EKLA 5L8JA 1ZYJA 4GH2A 5FP5A 3S4QA 3PWYA 5KBRA 5ANOA 2JKMA 1RQQA 3BU3A 3HUBA 3NZ0A 3RCJA 3VBYA 2VTMA 3O0GA 2WMQA 4K6ZA 5E8TA 4R78A 4GW8A 3W55A 2WHBA 4FOCA 5BNJA 4IAKA 3ZU7A 4I0RA 5HORA 1OBDA 4FNZA 4IZYA 3ZXTA 3P7AA 1H1WA 2QLQA 3AD4A 4J8NA 4PQNA 3FV8A 3ZUUA 4BHZA 1QCFA 3A61A 4JQ8A 3FL5A 5H8BA 4FK6A 2WMVA 5ETCA 3TNIA 3QKMA 3COMA 3MTFA 4OT6A 4O0XA 5AP1A 3GBZA 4HVHA 4G3CA 2WTVA 3DBCA 4N70A 2OFUA 3HV5A 5E4HA 5ANEA 1NT2A 3QLGA 3QZHA 3RNYA 5HVKA 4QTCA 3R8PA 3FI4A 3EB0A 3PY0A 2RL5A 4U0IA 3NW6A 2XAOA 2NPQA 3ZO3A 4ZY4A 3PJ1A 5DRBA 3CGOA 2R3HA 1ZY5A 3PUPA 3R9DA 4AXFA 5KMJA 4J95A 3WF5A 4OTDA 5D41A 4AGUA 4X21A 4IM0A 4DHZA 4WKQA 2UW9A 4PL3A 5LCKA 1A06A 3TZ9A 3OCBA 5D12A 4EH2A 3VONA 2ERZE 5AR4A 2QD9A 4DHIB 5E8ZA 4ZP5A 5L6WL 5EFQA 2YWVA 4F1MA 2WPAA 2YABA 4Y95A 5G6VA 5EM6A 4D5KA 1DM2A 4FSQA 4AS0A 1REKA 3FPQA 1CMKE 3PA5A 5EHYA 2A1AB 3R30A 3R8LA 5D11A 3ZLXA 4AF3A 5AEPA 2X8DA 4JT3A 5HX8A 3OROA 4QP8A 3RGFA 5ITAA 4EHVA 1FBNA 4M7IA 4NCTA 3QX4A 2UZEA 3OBJA 4USEA 3H9RA 5GIOE 4YPDA 1JNKA 4F0FA 4X0MA 1F3MC 2X2KA 4C2VA 3BYVA 2XZSA 2Z8CA 3DTCA 2IO6A 5AADA 2BDWA 4U3YA 5HIBA 5KMNA 2XKCA 4CXAA 3UG1A 4CRSA 3LIJA 2BDFA 3CR0A 4EJ7A 1ZOHA 4PUZA 3W2PA 5FEQA 4KWPA 3CIKA 3M42A 5AX3A 4IACA 3HRCA 3PFQA 3V5JA 3A4OX 4F6SA 4ZEGA 4BDDA 3MBLA 3TYKA 4I23A 3VO3A 4WNMA 3DLZA 2CLQA 3FI3A 4FA2A 1A9UA 3ORKA 4OBQA 4E6CA 1S9JA 2WTKB 3NYVA 3K2LA 4DEBA 4BCIA 3NVKI 3PJ2A 3HVCA 5FTQA 3ZYAA 3BYSA 3L9PA 1IA9A 2OKRA 4UZHA 4W9WA 5ANJA 3S00A 1TQIA 3UVPA 4I1ZA 4QMWA 2XALA 2BTSA 1J3HA 3MIYA 4ACMA 4ZSLA 4TY1A 4JVGA 1W2DA 3OP5A 4RIXA 2OG8A 4JOAA 3V51A 3TI1A 3NUYA 4IJPA 2YCSA 2E9PA 1M2RA 4AAAA 1ZRZA 5A4LA 5AP2A 2UZUE 2WQNA 4JBPA 3V6SA 3MESA 2C3LA 4RA4A 4RZWA 2PE1A 3E62A 3F5GA 5AV0A 1YWNA 4FKVA 1JAMA 2XIKA 3GFEA 4PF4A 4RIYA 5DG5A 3VS0A 2YM3A 4MXOA 2F7ZE 4CG9A 4R8QA 3SXSA 4BKYA 1SNUA 4EI4A 3KC3A 4F1TA 5HCZA 4BIBA 2EU9A 2WTDA 4XG3A 2PVHA 4AA5A 3ENHA 2OWBA 4O91A 4U44A 5IQBA 1FINA 3D7TA 4R3CA 2YM4A 3BQCA 2FSMX 3H30A 4C7TA 3KGAA 1AGWA 1BL7A 2IW6A 5LCJA 2X8EA 5HBHA 3TXOA 3HV6A 4ZMEA 4GEOA 2W1DA 4I0SA 3RPOA 1J1BA 4EZ3A 5HNBA 3PLSA 4RFYA 5DOSA 3UO5A 4BHNA 1R1WA 2W7XA 4B8MA 3VJOA 2R0IA 2YJSA 2B1PA 2BFYA 4NM0A 2XCKA 3Q2MA 3VUTA 5IH5A 2RFDA 3HRFA 5KMIA 3NFGB 3NVMB 3DAKA 4FV0A 3GOKA 3JY9A 4EC9A 5EK7A 3OCTA 1FVRA 1XBCA 2UVZA 1YQJA 5BMMA 4F09A 5FEDA 4BTKA 3HKOA 5EHLA 3W2QA 5AP7A 4BGGA 4BCMA 1H08A 2IW9A 2OICA 5CASA 2EWAA 1L8TA 3LKMA 2RF9A 4H3PA 4AWIA 4O7WA 1YDRE 4AFJA 5HTBA 3BWFA 4D1XA 4MQ1A 4C34A 4E73A 4G6LA 4O4BB 4QQTA 4GKHA 2YCRA 1Q8UA 4PX6A 4S30A 2PU8A 3C50A 3LFBA 4F70A 4DDGA 2ZFYA 2LGCA 2Q83A 2IVVA 4MAOA 2XNOA 2CGXA 2PL0A 3RPVA 4KRDA 2O5KA 5BVKA 3VS4A 4E7WA 1H27A 4XLIA 4RJ6A 4PV0A 1K3AA 3PWDA 3W2RA 3ZFXA 2ITOA 1ZYSA 5A46A 4M13A 3Q04A 4FZ7A 4X6RA 3VS6A 4DFXE 1TVOA 3R04A 5CT7A 3PIXA 4FV1A 5EDRA 3ZRKA 2J5EA 1LPUA 2QO9A 3P7CA 4WUAA 1WBPA 3QTXA 4FVRA 1M17A 4BCOA 2E9VA 1SYKA 4LFIA 1SMHA 2QNJA 4CFFA 4EOOA 5E7RA 1OL6A 3FMNA 2VWUA 5JEBA 1OGUA 4QP3A 4FI1A 4OT5A 1UWJA 3EN5A 3EN9A 1QPEA 1YI6A 1GIHA 2WQBA 4FL2A 4KIKA 5DWRA 2VTTA 5M07A 4YTIA 5I9UA 4DTKA 3BCEA 3HECA 4RWLA 2XCHA 3SV0A 3V04A 3QYWA 4AE9A 3G0EA 4I22A 4A9SA 3OOMA 4FG9A 4OGRA 4BF2A 2A27A 3O8PA 3UMWA 5AP0A 4WA9A 4YZ9A 4NW5A 4BGHA 4EWHA 4FTQA 2YERA 3OW3A 5L2WA 3PRIA 3COIA 5HQ0A 4JR3A 4WBBB 2HK5A 1JSTA 4C3RA 2FO0A 2DYLA 2YWPA 3BBWA 3NNXA 4QNAA 5J7BA 3DBFA 5LVMA 1G5SA 4ZAUA 4RX5A 2QHNA 1YHWA 2ITUA 4JBOA 4NM3A 5HTCA 2KTYA 2XK9A 4FKSA 4FT9A 4ITHA 4CFVA 4EK3A 1Q41A 3FYKX 2HY81 2XK6A 3F3VA 4NW6A 4WHZA 2ZOQA 3NUUA 5K4IA 1K2PA 4J96A 1M14A 1FGKA 2W5HA 3KXZA 5D7VA 4EOSA 4ZJVA 3MJ1A 2IEWA 3HDNA 4O0TA 2C6LA 4O7SA 3DU8A 4QYFA 1XO2B 4G6NA 4NKSA 2VN9A 5AR3A 4QP7A 4EK8A 3EKKA 2BZJA 4GK3A 4I6QA 4RJ3A 5EOLA 4RX8A 2CNQA 1XBAA 4ZMFA 3OXZA 1WBVA 3F66A 5CSPA 3CD3A 1OPJA 5TF9A 2V55A 2XRUA 5BVEA 3U87A 2JKQA 1ST0A 3SQQA 4GG7A 4A06A 4JIAA 5HG7A 3T9TA 3C7QA 3RAHA 4H1JA 3MVJA 4AXAA 1XMMA 4YJSA 3UDZA 3EL8A 5IH4A 2QKWB 3OWJA 2VTQA 2QR7A 4DA5A 1H1QA 4I92A 3TV7A 4ANNA 3UZRA 1XKKA 3LFEA 5HCXA 3FZTA 3KXXA 4BL1A 4N0SA 2X81A 3UPXA 2NO3A 5I3RA 3FXZA 3SG8A 4UXLA 4S32A 1PXIA 3CQEA 4CZUA 3BGPA 2VTRA 3RPSA 4L6QA 2V62A 2Y7JA 4LYNA 2QU5A 4M0ZA 5CSWA 3OY1A 4U42A 1YOLA 3HP5A 1NA7A 4IFCA 3SX9A 1SVGA 5KKRC 4M97A 4Y73A 4AW0A 4AZVA 4IAIA 4QYHA 5JZNA 3KXHA 4L01A 3R7UA 4CG8A 4B4LA 4IC8A 1URWA 2JBPA 3AMYA 4FTIA 5JN2A 5KHXA 5L4QA 5BUIA 3FZOA 5E90A 3SRVB 4IMYA 4DT9A 5DIAA 5AP3A 4BICA 2YLEA 3GGFA 3Q9YA 2V7AA 5K5XA 3E5AA 3OZ6A 3U6IA 2XVDA 2BILB 3E8NA 5C9CA 4RPVA 2BZKB 3T9IA 4ANLA 3LFFA 4BRXA 4OBPA 1GZNA 4ENYA 4JDKA 3HGKA 4D2PA 4BDKA 2Q0NA 4NJ3A 3R7YA 4M69A 3TL8A 2G1TA 1KE7A 4DH3A 3DY7A 2WNTA 2HY0A 3IECA 4KS7A 4MHAA 4O1OA 4BDAA 4D4VA 1ZAOA 5K5NA 2ETKA 5FXQA 4USDA 4JBQA 4W4XA 4D2SA 4F7NA 2NRYA 3IKAA 1DAWA 4DFBA 1W2CA 2CHLA 4YZBA 3AGLA 3UDTA 3FZSA 1WBTA 2B52A 3N51A 4D4SA 5CU0A 4O4EA 1W98A 3QQUA 2VRXA 3KXGA 4UX9A 2UZBA 2PVYA 2X7OA 3UC4A 4YBJA 5HOAA 3DKCA 4BDHA 4F9CA 3C51A 4O0YA 3R01A 3R2YA 3TUBA 4ANSA 3ZFMA 4AX8A 3IQ7A 4BI1A 5A54A 3UZTA 2XBJA 5BVFA 4FV9A 4YZMA 4XJ0A 3OG7A 5KCVA 4TNDA 3DS6A 4Q5EA 2A4LA 5H3QA 3TDVA 4GKIA 4U3ZA 4ZTHA 2OZAB 5I9WA 2BCJA 3D15A 3LPBA 5IKWA 4DBXA 2A19B 4O83A 3WZEA 1H24A 2RFEA 3GC9A 4APPA 5GJGA 4OTWA 3SOAA 2VTNA 3A8WA 3H4JA 4XV2A 3FMMA 3PVGA 5J5SA 2UUEA 3LFNA 4M68A 5HG5A 4QMZA 1OPKA 4AA0A 1OMWA 1H8FA 2YM5A 3G6GA 3NIZA 3REPA 3IGOA 4D55A 5HD4A 1YHSA 3D94A 2GTNA 3GQLA 2CGVA 1W84A 3ZONA 3QQKA 2GU8A 1UU8A 3QC9A 3LFSA 4CQGA 3MJ2A 4MXYA 4XHKB 4MKCA 5CX9A 1HCLA 5E91A 4M14A 4LDTA 2P2IA 3VIDA 4ZZNA 4I94A 4C37A 3BEGA 2AQXA 4OTIA 3V5QA 2PE0A 3FEGA 2H6DA 2CKOA 2VO7A 4F08A 2R5TA 3LW0A 4D58A 4DN5A 2ETRA 2DWBA 4O38A 3GCSA 4QO9A 3VC4A 4JMQA 5A4EA 2VU3A 4L52A 4NK9A 3KIOC 5J8IA 4OBOA 3QTWA 2J4ZA 1DI9A 5EOBA 2WIPA 4IWOA 3NGAA 2O64A 2XNEA 3P23A 3DT1A 2OW3A 2J90A 2YM7A 3EQBA 3IOPA 2WMSA 4G16A 2NYAA 3CJFA 5FEEA 3VJNA 5KKRB 3RNIA 1PJKA 4PMMA 2UZTA 3WF7A 4QD6A 4FL3A 3H10A 2PZIA 3BZ3A 5BVNA 3P79A 3C1XA 3GU8A 4F6UA 4TYGA 5HLPA 1YOJA 4O84A 1BKXA 4I4FA 2O8YA 4C8BA 4WSQA 3W0PA 3QWKA 4ITJA 1FVTA 2WQMA 4MBLA 1OL5A 1YXTA 2WTWA 4FSRA 1JSVA 1PMNA 2YFXA 3KL8A 5IQAA 5DRDA 4W9XA 2ETMA 2GMXA 1IAHA 4BIDA 4Q9ZA 4AE6A 3D5UA 2UW4A 5AUYA 5EKNA 5HLWA 3AOXA 3GT8A 2JEDA 3D5WA 4JDJA 4QYGA 3SW4A 2W4OA 5TO8A 2REIA 2ZV9A 5HTIA 2YIRA 4PDPA 5CU4A 1ZZ2A 1SZMA 4P5ZA 5GHVA 1BYGA 1GAGA 1U59A 4I6HA 4IJ9A 3RI1A 4FT7A 3ZRMA 3UNJA 4CYIA 5E9EA 5DT3A 3QCSA 1YI4A 3FQHA 3CP9A 3AC3A 3M2WA 3JXWA 3A8XA 2HW6A 3O23A 1KV2A 3FMHA 5ANDA 2HELA 3QD0A 4HJOA 3R22A 5E8UA 5BYLA 1YW2A 2ZB0A 1PMEA 4FL1A 5ANKA 1Q8YA 5HE2A 2Y6OA 3FKOA 2WAJA 5FLFA 2OJJA 3AT3A 3ORXA 2UVXA 5BVOA 5CF5A 4AP7A 4KBAA 4LV7A 1B6CB 4QMXA 3P9JA 2J0JA 2UW7A 2X0PA 4FNYA 3FBVA 2QLUA 3QALE 5KE0A 4YJPA 3F82A 4FTCA 2UW3A 4GT4A 4RC3A 1KWPA 3MH3A 2C6IA 5HVYA 2WOUA 1GNGA 3LMGA 3NX8A 3R00A 1URCA 4NWMA 2R3LA 4WD5A 2A98A 2PK9A 3SKCA 4AUAA 4CRLA 4DGLC 2FGIA 3MVLA 3ML1A 3FJQE 5DH3A 5AP6A 4GYIA 2R3JA 4YURA 3NAXA 3L9LA 1I09A 2VD5A 1YOMA 4YPSA 4O86A 3DOGA 3VQHA 1OITA 2UZWE 3CKXA 4BWXA 4PMTA 4TWOA 3DDPA 2W05A 3KULB 2Z60A 4CT1A 4EQUA 4AOJA 3VW6A 3FY2A 3BLRA 4MQ2A 1MQBA 5C4KA 5ICPA 4P4CA 1FMKA 3ORLA 1Z5MA 3I4BA 4QMTA 3RAKA 3DJ5A 5LMAA 4R3RA 4FUYA 2RIOA 5EHOA 5ETIA 3V6RA 1ZOEA 5KO1A 2PVFA 5FXRA 3CLYA 4MNFA 5AX9A 1UU7A 4YBKA 4BWKA 2YAAA 4FX3A 4U43A 2G15A 4QOXA 2WMWA 4JX3A 3DKFA 2JDSA 4MXCA 5HI2A 3VWAA 1NVRA 4P7EA 3U6JA 2CKPA 2H9VA 1V0BA 4O7LA 3LXKA 4E26A 5LMKA 1OZ1A 2H34A 2JIVA 5J79A 5J9LA 3UYTA 1YI3A 1VEBA 2XEZA 4FSYA 3WF6A 3WE4A 3D0EA 3UQCA 3E93A 4HYSA 3VBXA 3W10A 2RFNA 2VTOA 5HCYA 2C5NA 4WRSA 5I5ZA 3DNEA 3QRJA 5E8XA 3IDPA 5M08A 3JR1A 3F3WA 3DJ6A 3EIDA 3I60A 3TKHA 4CEGA 1W82A 3LJ0A 4RVMA 3H9FA 2OZOA 2KULA 4V0GB 3S0OA 2OU7A 4O7NA 3IG7A 3OUKA 2P2HA 3MWUA 2OJGA 2X7FA 2ZMCA 3R9RA 2JDRA 2PUNA 2GHMA 1XR1A 4JAIA 4O0RA 3R28A 3RCDA 5M4UA 1HOWA 4PDYA 2WEVA 3R1SA 3G0FA 4KINA 2YAKA 3TT0A 4EQMA 5LQFA 4IB5A 3HNGA 2B54A 1IEPA 3BGZA 5DVRA 4RIWB 2J51A 4I5CA 2YJRA 4FEWA 5FP6A 5JQ8A 1P4OA 4PP9A 5CY3A 1BI7A 5GINE 5L6OA 1ZLTA 2VTPA 2W9ZB 3PSDA 4UY9A 5CU3A 3GCPA 4FYOA 4QNYA 3BRBA 2VTAA 4NM5A 5C27A 4X3FC 2GNIA 3DXNA 5GZ8A 3I5NA 1QPDA 2YIYA 3KRWA 4XG6A 4YTCA 3D5VA 4YTHA 4XG2A 3QC4A 2PUIA 4CLJA 4Y5HA 3RK5A 4G3EA 4N6ZA 1P4FA 1SVEA 2R7IA 4FZAB 5CNOA 4YJQA 3V5WA 5GJFA 5B2MA 1OVEA 1M2PA 2I6LA 3DDQA 2QC6A 1P2AA 4DFYA 2XAMA 3F69A 4RC4A 3FZPA 4X6QC 1U5RA 1ZYDA 4CCUA 2WO6A 4FV5A 4DYMA 3K3IA 2J50A 1XWSA 3UOLA 2BKZA 4N57A 3EYHA 2PZYA 4TXCA 5GZAA 3E63A 4A07A 4F9WA 3PA3A 3QTIA 4C2WA 3VS5A 2OIBA 2HXLA 1ZMWA 2IVSA 5DE2A 3FI2A 3QCXA 4XV3A 4KBKA 3R7OA 5JFWA 4D2RA 3LXNA 3A99A 4QMYA 3UDSA 3UOKA 4XEYA 3GQIA 3EJ1A 5IQEA 4EK5A 2E9NA 4YJTA 3HAVA 4CZYB 2XARA 4JJRA 4EH8A 3S2PA 4L7FA 1YWVA 5CWZA 4EORA 3QKKA 4Y83A 3HA8A 1U46A 3KMUA 5FD2A 4EL9A 1MRYA 4KA3A 4LRMA 1CM8A 1LUFA 3DFAA 3O8TA 3NRMA 4NU1A 4IAZA 3VUGA 4U97A 4F64A 4ACGA 3TN8A 4B99A 2Z7RA 4MWHA 4WOVA 4J98A 2JDVA 2OBJA 3ZC6A 2YDJA 4I4EA 1GY3A 4U45A 2ZM4A 2BROA 4G31A 4JG6A 2PE2A 3E7OA 3EN4A 2XNNA 4TTHB 1G8JA 4IVAA 4HVGA 4I5PA 3IW4A 3LCOA 4EQCA 3EH9A 3VBWA 4D2WA 1OPLA 4FKJA 4G5JA 3GI3A 1Q8WA 4H39A 4PPCA 5DLSA 4EH9A 3FLZA 3OFMA 4YZCA 3DXPA 3LJ1A 4TKSA 5M51A 4FSNA 4RVKA 1AD5A 4WIHA 4YZDA 4RT7A 5F4NA 3EQRA 3TNHA 1OIRA 4OTPA 5DR2A 3MA6A 3P1AA 5BYYA 3ZSIA 3JVRA 1NVQA 2UZNA 3MYGA 3QTSA 2PY3A 4C59A 2CSNA 4HCVA 4M8TA 2CGWA 2CLXA 4KNBA 4M84A 1UV5A 2ITNA 3H3CA 3HP2A 5K4JA 3ZEWA 4AXDA 2Y8OA 1RJBA 5IQDA 4BI0A 4HGSA 4L3PA 2VTSA 4E4LA 3PJ8A 4MXXA 4FR4A 5M06A 4GS6A 3QGWA 5HD7A 4CMOA 3DK6A 3ZM9A 4R5SA 2VO0A 5EYKA 1KOBA 3OXTA 1G8AA 2QODA 4FF8A 1M7NA 5L2IA 5LVPA 2OIQA 4IZ7A 5KUPA 3TUCA 2QOHA 4TNBA 3ZFYA 5JRSA 5AP5A 5EI6A 4XP0A 3SDJA 4RX7A 3UC3A 3EWHA 3UDBA 3NFFB 2CMWA 2BIYA 5AFVA 1P14A 3C4ZA 5I3OA 1V1KA 3G2FA 4F7JA 4OUCA 2WU7A 4UMTA 4FVPA 2HWOA 4IW0A 3OTVA 1VR2A 2JAVA 3AMAA 4YJRA 3RPYA 2G01A 5E1EA 3JVSA 4LGHA 4ZTNA 3V8SA 3VUDA 2W1FA 4L46A 5JGAA 3SRVA 5AR7A 4K11A 4D1SA 3CQUA 2QQ7A 3NLBA 3I81A 4NTTA 4XMOA 3RJCA 4EUTA 5HVJA 3GCUA 3IGGA 1XH6A 1RW8A 2GDOA 2RG6A 3BLAA 1PXNA 3HMNA 3QXPA 4IIRA 3KRRA 3T3UA 4EOPA 3BKBA 3F7WA 4R1VA 1L3RE 3PZHA 5HIEA 2JIIA 3W8LA 3EN7A 3UO6A 4O0VA 2XP2A 4YTFA 3FI8A 4QDVA 3ROYA 5EYDA 3F3ZA 4E4NA 4EOQA 3MH1A 3V8WA 3BIZA 4DCAA 2OGVA 2PMOX 3ZO2A 3FMKA 1H26A 4CSVA 2OO8X 1LP4A 2WMAA 3EQPA 3UJGA 4ASDA 2VWIA 2B4SB 2XA4A 3MVHA 3Q4ZA 2YZAA 4QTDA 3FZ1A 5AIRA 5FXSA 2JKKA 1M7QA 2UW8A 3MVMA 3GUBA 5CVGA 3WYXA 4IDVA 4LL5A 4RVTA 4XX9A 4FVQA 4U5JA 4C4IA 2F9GA 2ZYBA 5KZ0A 4F9YA 1TKIA 4TRLA 3ZOSA 3PZEA 2ITQA 4M3QA 5AIKA 3ZDIA 5CLPA 4E1ZA 5HBEA 4AG8A 1PHKA 1J7UA 2YN8A 2YM8A 3AC2A 4QQ5A 4QMOA 4R5YA 3F61A 4IC7A 2XK4A 4DFNA 1CDKA 1EH4A 4DITA 2C3IB 3TCPA 4KD1A 1KOAA 4ASZA 4MNEA 5CXZA 5DA3A 2OZAA 1G3NA 3MFTA 3LZBA 4RLKA 2Y4PA 3PIZA 4GSBA 2R4BA 3IDCA 4FT5A 3DFCB 4XRLA 4EH5A 2WMBA 3ORZA 3LFAA 4U41A 5HE0A 4JRVA 3HLLA 4TYHB 4U9AA 2GNLA 4MVFA 5CEQA 4APCA 4PDOA 1PYEA 3PXFA 1OIQA 3UP7A 5J5TA 4HGEA 2WU6A 4YO6A 3QUEA 4YUQA 1WMKA 2B53A 2EXMA 3DCVA 2ZDTA 5HNIX 4V04A 3ZDUA 4QYEA 5FTGA 3GVUA 4GG5A 1WBWA 2OJ9A 1YDTE 4J53A 4L9IA 4NIFB 4EKKA 5E92A 4MTAA 2QVSE 5IPJA 1KE8A 5JKGA 3M11A 3HUCA 2YCFA 3PDTA 4ZTRA 5LVLA 5CAVA 4JAJA 4GRBA 2R3IA 3NEWA 3FXXA 1SVHA 2C6OA 4UMPA 4E8AA 4K1BA 4V01A 5ETFA 3QF9A 3I7BA 5AJQA 4KS8A 2J2IB 5H8EA 4DCEA 3RAWA 3DQWA 5FWKK 1FQ1B 1CKPA 4JBVA 4YR8A 4FTNA 4GL9A 3WBLA 3SHEA 2AUHA 4H58A 4BDGA 5DT0A 5LVNA 3W0MA 4KBCA 4R1YA 5FBNC 5L3AA 4II5A 1UNHA 2GS6A 2JDTA 3G33A 5E8YA 4BCPA 4NYEA 5CYIA 4RFZA 4O81A 3AC8A 3KN5A 5EH0A 5K0KA 4ITIA 3QD3A 3NCGA 2WTIA 2C6DA 4KSPA 2WIHA 3QQLA 4A9TA 4AXCA 4XG7A 3O2MA 3U6HA 1YDSE 1XBBA 1KE9A 5J9YA 3DZQA 5EQEA 1YXSA 3WZDA 1UVRA 3ORNA 5HESA 4X3JA 3MS9A 5AV1A 3NNVA 5CAOA 5IDPA 4BCNA 1GIIA 1G8KA 2BDJA 4FNXA 2C3JA 3LCKA 3Q60A 3CTQA 1BI8A 4ZTLA 3V5LA 2P33A 4DFLA 4EWQA 2ACXA 4ORKA 1DAYA 4Y46A 1BUHA 4K2RA 3EFKA 4X2FA 2GHGA 3VHEA 4FKWA 4KUJA 2VUWA 4HVSA 4FKLA 3E7VA 3QQHA 1V0OA 4O4CA 3BYOA 2RKUA 3UQGA 1V0PA 4DG2E 5M4IA 3HA6A 4BN1A 4I20A 3BI6A 4KSQA 4E5AX 1ZARA 3W0NA 4RWIA 5FG8A 4AT5A 2J0LA<