1BKXA

A binary complex of the catalytic subunit of camp-dependent protein kinase and adenosine further defines conformational flexibility
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
339
structure length
337
Chain Sequence
QESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (phosphotransferase/adenosine)
molecule keywords CAMP-DEPENDENT PROTEIN KINASE
publication title A binary complex of the catalytic subunit of cAMP-dependent protein kinase and adenosine further defines conformational flexibility.
pubmed doi rcsb
source organism Mus musculus
total genus 88
structure length 337
sequence length 339
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 1997-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1bkxA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1bkxA02
4CQGA 2ITQA 5IH4A 3HNGA 4XJ0A 4KBAA 3D14A 4FKVA 4KKGA 4BDIA 4O86A 3QQJA 4FUXA 3QWKA 5CNNA 3MY0A 4GT3A 2J0KA 4J53A 3RZBA 4AW2A 3BYOA 3PJCA 4XBRA 4UYNA 2R4BA 4C3PA 3WF6A 3LXPA 4FT7A 3DB8A 3AD6A 4RIWA 5HE0A 3A2CA 4ACDA 1PMVA 2PSQA 3R0TA 2B9JA 4RLLA 4FKRA 4UMQA 4B8LA 4GCJA 2JIUA 4DFYA 4DEGA 3HA8A 4I6BA 3KA0A 5HORA 4F7JA 2PE2A 2C3IB 3DT1A 3IW4A 4GK4A 4L7SA 3AC3A 4L9IA 4DFZE 5AAGA 4DF3A 4XCUA 1NY3A 5JQ5A 5GIPE 4FIEA 4GG5A 5AV1A 4FV9A 5BYYA 4IB3A 3L9LA 4F08A 3PVGA 3A8WA 3Q04A 4EH6A 4QRCA 3ALNA 4XOYA 3R9NA 4DCEA 5ITAA 3R7EA 4QTCA 4FL2A 2FYSA 3NNWA 2AC3A 3O8UA 4Q9ZA 3I5ZA 3TZMA 5D7VA 3FMEA 5C4KA 3QWJA 3EQPA 5FP5A 4OAUC 3FHIA 1SNXA 3RHXA 4R1YA 3QLFA 1IRKA 3HZTA 4CFVA 3FLZA 4IJ9A 3CY2A 4FTTA 1B38A 4CCBA 4B0GA 1ZOGA 3BU6A 4XG6A 4WIHA 3CKWA 3DBFA 4AT5A 1ZRZA 3CSVA 5E8VA 4MTAA 3OXIA 4IAKA 5DA3A 2X9FA 4I6QA 2A27A 3THBA 4MCVA 4IVCA 3VRZA 4BDFA 4EOMA 1W7HA 2QNJA 2R3MA 4APCA 2CNVA 2Y8OA 2YN8A 3R00A 3II5A 2YITA 3UOLA 3VF8A 3QGYA 3BV2A 3MSSA 5HU9A 2C5OA 4TKSA 3P08A 4V0GA 2IVUA 3WARA 1P14A 2C68A 4BTJA 4EK8A 4LUEA 4X3FC 1H24A 3IOKA 4O1OA 1ZOEA 4ACMA 4FA2A 5CZHA 3HX4A 2C6KA 3WZEA 3HV4A 5CASA 3NLBA 5H3QA 2XH5A 4CFXA 3HMMA 1L3RE 5DRDA 4AGCA 3ATTA 1UU7A 4UXQA 3H3CA 3TNHA 3MH3A 1QPCA 2JDSA 5HVYA 3F3ZA 2WZJA 4PNIA 1MUOA 3N4VA 2XKCA 1RE8A 3C51A 5CLPA 5DEYA 3KULA 1JNKA 4M66A 4LGDA 5HX6A 2DUVA 2XYUA 3DK6A 3EOCA 3MS9A 2CHLA 2HZIA 4D2WA 3I60A 2BROA 2G01A 2HAKA 1U54A 5KZ0A 1BUHA 4YHJA 4JS8A 2X9EA 3ZRMA 4I94A 4FV8A 4BHNA 4FIIA 4GIIA 2WQMA 2YLFA 3D15A 3SOCA 3R9DA 3KRLA 3M11A 2BHEA 4O0VA 3BGZA 4FGRA 5TE0A 3QRTA 5AP0A 5KMOA 3SG8A 4DH1A 3FXZA 1CKIA 2W1EA 3MTLA 3O7LB 3F66A 4L01A 1OBGA 2GQGA 3GU5A 3R1SA 1OIUA 2GU8A 3LCDA 5AP5A 3UGCA 3FAAA 4PTGA 4HPUE 4DEIA 4YMJA 3DZOA 3UJGA 2UVXA 2E9NA 1U5RA 1X8BA 3R8ZA 4FVQA 1IAJA 2X7OA 3A7IA 3UP2A 4RC3A 3W55A 5L8KA 3DBEA 1H1PA 2P4IA 3A99A 3NEWA 4D4RA 4FGBA 3WZUA 3C4ZA 3HRFA 2VO3A 2PVJA 5FLFA 4G34A 3TJCA 2VN9A 1LEWA 1URCA 3AC2A 3E88A 2XZSA 5HICA 3RWPA 3SOAA 2I0VA 3U9CA 3DDPA 3SG9A 4EWHA 1ATPE 2FSLX 1DI9A 3PJ3A 5CVHA 3W8QA 4DN5A 3E62A 4FNZA 3R22A 4EOQA 4FV2A 1A9UA 3C4CA 3GT8A 4WNOA 4AT4A 5CEMA 2IVSA 4MBLA 3HECA 3MV5A 1U46A 5M51A 5J79A 4BZOA 3R7OA 4K33A 3UP7A 5EK7A 4JG8A 4AS0A 5BQ0A 5JRQA 3W32A 3QUPA 4R77A 2VTNA 5AUYA 2QI8A 3ZO1A 3GC8A 2PWLA 3QCXA 4RG0A 4AFJA 4R5YA 4Y95A 4XRLA 5C4LA 4IWDA 1OZ1A 2J50A 4YJSA 2VWYA 3BE2A 3BYSA 4PMPA 4IACA 3GCQA 3IK3A 4XNEA 4BDDA 2CN5A 1BL6A 3OS3A 4MXOA 4YJVA 2OXDA 2Q0NA 5FEDA 3WZDA 3UVPA 5GNKA 3PXFA 4RPVA 2PVNA 2WU6A 2Y7JA 3MPTA 3OOMA 5C01A 3ATSA 2ZVAA 4ORKA 1P5EA 2C3KA 3EYHA 4U45A 5HE3A 5EFQA 3JUHA 3KK9A 4EHZA 2R0IA 4ZSGA 3FI4A 4A9SA 5AUWA 4BCHA 2YHVA 1WAKA 4IBMA 5EDQA 2NO3A 3R28A 4WUNA 1VJYA 2C6EA 4EYJA 5EQEA 3KY2A 1VZOA 4FG7A 3LJ2A 4MD8E 2C6TA 3N51A 3ZUUA 2QVSE 1QPJA 3QYWA 3RAWA 2HY0A 4EQMA 5C8NA 3FEGA 3CQWA 5B7VA 4RSSA 1REKA 2BFYA 2OZAB 4G3FA 4KKEA 3SAYA 2XK6A 3PG1A 3FSKA 3VULA 3NVMB 3C1XA 4H39A 2J0JA 3VBWA 2Y6MA 5BVDA 5JEBA 1PXNA 5IA5A 3NUSA 2FSMX 2IZTA 2B1PA 4AP7A 2UUEA 2X6DA 3R01A 4I6HA 2UW0A 4KINA 4DBXA 1NVSA 3Q53A 2PUNA 5FWKK 2R9SA 5CSPA 5I3RA 1UNLA 3Q9ZA 5JGDA 4FSMA 3I4BA 5EI2A 4CZYB 4G6NA 4JOAA 5CU0A 2Y4IC 3I0QA 1H1QA 4CMTA 2P33A 2QD9A 4X21A 3FPQA 4CNHA 4OLIA 4PDPA 1FINA 3WOWA 3ZXTA 4EH3A 4AW5A 5C8KA 5KNJA 2FSOX 3FMKA 4GEOA 4RIXB 3GU6A 4DEAA 5BMMA 4E6DA 2JDOA 4USFA 4RWLA 3BPRA 1ZAOA 3TNWA 4DLJA 3VJNA 3QRJA 4S32A 4UV0A 3ZSIA 3RJCA 3ZZEA 5IA1A 3G90X 1SVEA 1PF8A 1GOLA 3U4UA 2O5KA 5CS6A 4OTPA 5KZIA 4KUJA 3ODYX 2XJ0A 2YAAA 4FZFB 2YIWA 4KBCA 3GC7A 4QMWA 2AYPA 2RGPA 2X2MA 4V04A 5IA4A 5CXZA 2A19B 2QOLA 4EOLA 4YO4A 5EM5A 4WBBB 2C5YA 4FKOA 4G3CA 3UQGA 4BCKA 2W4OA 4J98A 3QQUA 3TTJA 1ZY4A 1PYEA 4O91A 4ALWA 4FODA 4HZSA 2R3RA 3PSDA 4EZ7A 4ZTNA 1H4LA 4BI1A 4II5A 4MF0A 5M07A 5C1QB 2Y9QA 5KBRA 4HGLA 3CR0A 3FL4A 4F9BA 2PHKA 3Q4CA 2QG5A 5EI6A 4OBQA 5EQPA 3BZ3A 4CKRA 3MVLA 3R1NA 5LCKA 3ULIA 2QLUA 3S00A 3PVWA 5EOLA 3CBLA 3GNIB 5EM8A 3KFAA 4EOIA 4OUCA 5K0XA 2QO2A 5LMKA 2ITWA 3LFFA 3D2KA 4AOJA 3BBWA 5HBHA 2V22A 2W9FB 4M0ZA 4OTGA 3FJQE 2PZPA 1GZKA 3FC1X 3P23A 3PXQA 4GUEA 4MXYA 4WA9A 3GCVA 5ANKA 3U55A 4XG3A 5ICPA 3COKA 4F09A 1GIHA 1RJBA 4GW8A 3FC2A 3LXNA 5DHJA 5AR8A 5LARA 5K4IA 4U43A 2C6LA 4D4YA 4M8TA 2NP8A 2R7IA 1S9IA 2JKMA 2VTSA 2XF0A 3LFEA 4Q9SA 5AA8A 3TUDA 3P7AA 4RX5A 2WEIA 5AFVA 2CGVA 1R78A 4YZCA 3UMXA 3FUPA 5HG8A 4KAOA 2XMYA 3PP0A 5EW9A 5FXQA 1LR4A 3ZEPA 4APPA 3OWPA 3VUIA 3KMMA 3LIJA 3LFBA 3ZRLA 5ACKA 3S3IA 3RZFA 4IAYA 4L43A 1M14A 2JKOA 4BYJA 3D5VA 3EFWA 4JQ7A 2WTCA 1J7IA 3QTZA 4QMSA 3R7GA 1KE5A 4IVBA 1GIIA 4FL3A 4C58A 4FNYA 4OTHA 5DT4A 5AV2A 3C7QA 5CEKA 5HLPA 5TR6A 4L3LA 4IC7A 5CQUA 3COMA 2YDKA 4M13A 5GZ9A 3HUCA 5AUXA 4PMSA 3VN9A 3SA0A 1M52A 2A0CX 2I7QA 1YKRA 4GT4A 5CYIA 4J95A 1NT2A 4NU1A 2C0TA 4ZSAA 2GS2A 1Q3WA 5HD4A 4FTUA 1FPUA 4KA3A 2YACA 4UMUA 2JGZA 2PE0A 3QQFA 3D9VA 5CY3A 4YTHA 5IUGA 5JRSA 4QPAA 4U3YA 3RI1A 3WZKA 5B2MA 4P5QA 5TO8A 4D1ZA 3G5DA 3G51A 3W2CA 3HP2A 3R71A 5IH6A 3R8LA 3P79A 4NL0A 5E4HA 5AM6A 3ZU7A 1F5QA 2JBPA 3FE3A 4IHPA 4MK0A 3ZDUA 5J1WA 3BU5A 3ETAA 4QPSA 2WOUA 4EZ5A 3WBLA 2CPKE 3IECA 5KHWA 2XJ1A 4JL9A 1XH5A 2YZLA 1OIRA 4ZTLA 4IX3A 2I6LA 4A06A 4E3CA 5EYKA 1Q8TA 2X6EA 4FSZA 4FSNA 2JEDA 1W82A 5BVOA 1M7NA 2VWVA 4C4IA 3BHTA 5CU3A 4FYOA 3RMFA 3LKMA 1OL7A 1OI9A 2ZB1A 4XLIA 4J99A 2YDJA 4EUTA 5KMNA 3OT8A 4QP4A 3UOHA 2QR7A 4ASZA 2R3JA 3V5QA 4JIAA 2WQNA 2F2UA 3E8NA 4N6ZA 3O71A 4PTEA 4A9TA 2OZAA 5H8EA 3KXGA 2DQ7X 1M17A 4GFOA 4G2FA 2O64A 3QXOA 3HUBA 4JNWA 1ZARA 3ZO3A 2BRMA 4LOQA 3H9FA 2VD5A 2W7XA 4MWIA 4CFNA 4E6AA 4FZAB 1ND4A 2QOQA 2Q0BA 4BWXA 3Q5ZA 4R1VA 3W2QA 4DEEA 3CP9A 4HCVA 3NYNA 3UIBA 4J71A 3F3UA 3FI8A 2YIYA 4YJPA 2C6OA 2FSTX 3FXXA 4RA5A 4RQKA 3DK7A 3BKBA 3QTQA 4G5JA 4CG9A 5I3OA 4YBJA 3PXKA 4NEUA 4RIXA 2BALA 4BCNA 1XR1A 3HV6A 4U7ZA 4EK4A 4QMMA 3TDVA 2C3JA 1UKIA 4IWOA 4BDGA 3FI2A 4RX9A 3AG9A 2OW3A 1PXLA 3VHEA 4ZS4A 2VTOA 4FSYA 5HESA 1OUYA 2XB7A 3OFMA 3CPCA 1FQ1B 2OKRA 4QYEA 5EW3A 3REPA 3ROCA 3VS2A 2CNUA 1APME 3V01A 1ZYSA 4FTIA 3NZ0A 2XK3A 3OHTA 5KMMA 3QZHA 2JIIA 3QTXA 3ORLA 3TKHA 2QHNA 1WFCA 3UPXA 4CQEA 3H9OA 2WHBA 3QTUA 3WZJA 2Z7RA 2ZV8A 3Q6WA 4X2GA 3U51A 4H05A 3UIUA 1XKKA 4PPBA 4WT6A 2IG7A 4V05A 5AP4A 1FVVA 3CTQA 2IN6A 4UWBA 3OZ6A 2JD5A 5AR7A 4ENYA 1F0QA 4GVJA 4ZY4A 1JKLA 2ITVA 5M4FA 3PRFA 5CSWA 1ZMWA 4PL4A 4FK3A 2YAKA 3KXHA 4IFGA 4HGEA 4ALUA 4EOSA 2R3QA 3PTGA 4O2PA 4TN6A 3COHA 3V5WA 5CSVA 3VVHA 2GCDA 3RCDA 3RK7A 1PXIA 2XVDA 1CSNA 4R3RA 3R8VA 1Z57A 4C38A 5AMNA 2BTSA 3PZEA 2O0UA 3OG7A 3OVVA 5D7AA 3VNTA 2C3LA 3SW7A 4BICA 5IUIA 4G17A 5HBEA 2BZJA 2XYNA 5EI8A 3QUDA 2PULA 3Q9WA 3O8PA 3QTWA 4TWOA 3GB2A 4QQCA 4FG9A 4RVLA 4RA4A 2XBJA 1ZOHA 4DEBA 2WQEA 4X3FB 2W1DA 4E6QA 2DYLA 3QAME 4IAFA 4TYIA 5FTOA 2F57A 1P4FA 5CF4A 4EKLA 5E8YA 4BDJA 3E64A 3AGLA 3E87A 3DFAA 4UWYA 4FKJA 1P2AA 4CTBA 3FMNA 4K11A 1O6LA 3F82A 1A48A 3G9NA 4FKSA 1NA7A 4YP8A 5HI2A 1J91A 4GV1A 4YNEA 3BU3A 5ETFA 3B8QA 5BVKA 3ZFYA 3LQ3A 1YHSA 5IQCA 3GOKA 2OH0E 3DJ7A 2UW8A 3SQQA 1IA9A 2ITPA 3FZ1A 3RINA 3HAMA 2YIRA 4QMQA 4IB0A 4DE4A 4I23A 3EH9A 2R64A 2W96B 3QA0A 1STCE 2VWIA 4QMYA 4J52A 4XG8A 3VHKA 1UNGA 4EQUA 3ANQA 1GNGA 2J90A 4RBLA 5M4CA 4AGWA 3PRIA 1YDRE 4FEUA 4BGGA 2OIBA 4EBVA 5J9YA 3U6IA 4XG2A 3RPSA 3Q60A 3R8PA 2BKKA 2EB2A 1WCCA 2GNIA 2F7EE 3F2AA 4JLCA 4P2KA 3R7VA 4C0TA 2YFXA 3MTFA 2QONA 4MYGA 3DXPA 2RFNA 4U41A 1T45A 5E8XA 4NM5A 4HW7A 3KF4A 3HV3A 2ZV9A 1JQHA 4S34A 4DA5A 3QD2B 4AWIA 2B4SB 3R83A 4BBMA 5J5SA 4L67A 3QUEA 4WOVA 2WGJA 1E1XA 4L45A 3I6UA 4NFNA 1YXSA 3OCGA 3V6SA 5EM7A 4DFXE 5J7HA 4FE2A 3MB6A 4Z9LA 4FEVA 4QP2A 2UZBA 2PUIA 1SMHA 4GYIA 3BV3A 5F4NA 2W5BA 4IAZA 3QCSA 4E4NA 4K9YA 1B39A 5EG3A 2G2HA 1XQZA 4FSQA 1YQJA 5JK3A 4YJNA 5DE2A 5C27A 2NPQA 3HEGA 3OWKA 4RIYB 2HOGA 3ZFXA 2G9XA 3OEFX 4UY9A 4ASDA 2CKPA 3K2LA 5A4EA 4FNXA 4CVAA 4ANSA 2Y4PA 2V7AA 1PXKA 5J9ZA 4UYAA 1GZNA 4CLJA 3JPVA 5IEVA 3C50A 2OZOA 3DKGA 2HELA 4CFWA 4UBAA 2BAKA 5KUPA 3QD0A 4ZSJA 3EN7A 4BDHA 4W8EA 3GOPA 3QQGA 2YM8A 3TCPA 4FKPA 5AP7A 4ZSEA 4CKJA 3NX8A 4BC6A 4USDA 4BZDA 4PY1A 4IX4A 2EXEA 5C26A 4BCPA 3MFTA 2C6MA 3RK9A 4FTAA 4LI5A 4C4GA 2O8YA 2ONLA 1WBOA 3HMNA 3GU4A 4D0XA 3HVCA 3VS7A 5CT0A 2UZLA 3AGMA 2UZWE 3G9LX 1PY5A 3OW3A 3GENA 3ZUVA 4FT9A 5T3QA 3PDTA 3L9NA 3ZLWA 4QP8A 4AF3A 1KE8A 5GZAA 1YDTE 2R3OA 3Q4ZA 2JLDA 2JDVA 2VRXA 3P86A 4I92A 2QO9A 4IWQA 4WSYA 4E4LA 4F0FA 4JR3A 4DH5A 2OICA 5HOAA 4EOKA 3OEZA 5HX8A 2R3HA 2OJ9A 5DGZA 4O0UA 3FLQA 3OT3A 2NRYA 2YM4A 4LRJA 3MBLA 3CGFA 4PX6A 4Q5HA 5AP2A 3IW8A 3ZM9A 1PXOA 1YHVA 2UVYA 5IDPA 5F95A 5KBQA 2YM3A 4ZTHA 3VJOA 1ZZLA 1Y57A 3KXXA 1YDSE 3TN8A 5IQHA 3SLSA 3OCTA 3C4WA 3DTWA 4QP9A 4M84A 1NXKA 3W18A 3V6RA 4ANMA 4KB8A 5CAOA 2V62A 4O2ZA 3F88A 3RPVA 3UIMA 1SNUA 3KK8A 1KOAA 2WTVA 4FG8A 4PMTA 4O96A 4U42A 4I3ZA 4UB7A 4BDKA 4ZY6A 3MJ2A 2BCJA 2OF2A 1SVGA 5IDNA 3BLQA 1WVWA 3WYYA 2Y4IB 3COIA 5HE2A 3RAIA 5AADA 3O50A 2WIHA 1RDQE 5E8ZA 2ZM4A 5HU3A 4U97A 4PF4A 2VWWA 3BLHA 3B8RA 5DOSA 4BN1A 5LXMA 4CGAA 3A7JA 5BVFA 1ZLTA 4XLVA 2ACXA 3BBTB 3U87A 2BILB 3PA4A 1FVTA 2XCHA 4WBOA 3CGOA 2PUUA 4RJ8A 2PVYA 4BCJA 2X1NA 3U6JA 4YC8A 2J51A 2HZ0A 4I20A 3IGGA 4MD9E 4DTAA 3JYAA 3FDNA 4RGJA 2GS6A 1KWPA 3U9NA 4UZDA 2VZ6A 2GHLA 4YJOA 4AU8A 3ZDIA 3CLYA 4C2WA 2OLCA 2XNPA 4RWJA 5KKRB 3VBXA 4AZVA 4NJ3A 2HENA 3F5GA 1XH7A 4RT7A 2XM8A 2BRGA 2E9VA 5LOHA 3QTIA 3D94A 1FGKA 4UWCA 4X3FA 4Z16A 3BGQA 1WZYA 3ODZX 4MNEB 3RGFA 3ZONA 2WMXA 3IW6A 4QMNA 4BCIA 2W1GA 3QA8A 3KREA 3VUTA 4HJOA 2UV2A 3DU8A 4C3RA 4UALA 2OJIA 4G16A 4NW6A 5CEIA 4ZZNA 3FMMA 5F20A 3VQUA 4AE9A 3C4FA 4FKUA 1PXJA 1A06A 4S2ZA 2R3GA 3LW0A 4RLKA 4BY9E 1ZY5A 2VX0A 3KMWA 1O6YA 4NKSA 4U5JA 1ZWSA 5E90A 5FM3A 4D55A 2G1TA 5AUTA 5HTIA 4CEGA 3PVUA 5K5XA 2G2IA 3QD4A 3POOA 4ZLYA 2HY81 2IZUA 4OAVB 4WD5A 3VBYA 3HV7A 3R02A 3DKFA 5E8WA 3ZRKA 5CNOA 4Y73A 4EOOA 3L8SA 2WTDA 5KX8A 5IG1A 3LXLA 4D4SA 4XH6A 4EH9A 3NUPA 4MAOA 4BGQA 3CJGA 4WHZA 3MVMA 4F1OA 4B99A 3UYTA 4L3PA 3BHHA 2WMTA 3PY3A 3LLAA 2HCKA 3U54A 3PJ8A 4AUAA 3HP5A 4BI0A 4O0TA 2QO7A 5KO1A 1RQQA 4MWHA 4CT1A 5LVPA 2OF4A 4X6RA 3UZRA 2O63A 2JKKA 3NIEA 5AJQA 4NSTA 4X2FA 4DTBA 1J3HA 4TNBA 3DGKA 4RIYA 1YOJA 4PL3A 4IJPA 4Q2AA 4FUYA 2XIXA 3NW5A 3QU0A 4DAWA 1EH4A 4EJ7A 3KN6A 5H8BA 4F0GA 4QNYA 4AA5A 4BR3A 4B8MA 4YTCA 4XEYA 5BUEA 2XRUA 2UZUE 4X7QA 5D9HA 4JBPA 4JQ8A 4FOBA 4L46A 1T46A 4DG2E 3C0GA 3EB0A 3QZIA 5AR3A 4CMOA 3Q9YA 3FZRA 1LUFA 2E9UA 3MVHA 5EKOA 3VS6A 4C4HA 4LRKA 4U40A 4O7YA 4I93A 4BL1A 1TQMA 4AW0A 4NM7A 3KXMA 5HLWA 1M2RA 2DS1A 1Y91A 2J5EA 3TNIA 2FO0A 4JX3A 4DT9A 5M09A 4RVMA 3W33A 5L6OA 4ANQA 5HNIX 5AR2A 5L2TA 3E93A 4CFMA 5IUHA 3HL7A 4UMPA 4L7FA 2VU3A 3A7FA 3KRJA 4I4EA 4ZP5A 4E4XA 2XKDA 3E92A 4D0WA 1Z9XA 2GHGA 3V8WA 3W10A 4EC8A 4QMXA 2BDWA 4GFMA 5DT3A 4AZTA 4HVHA 2BZKB 2QLQA 3L8PA 3H9RA 4I5MA 1Q61A 3G6GA 4ZTMA 3OBGA 2W1HA 3LJ1A 2OFVA 4XOZA 4K6ZA 3GGFA 5E91A 3R7UA 4H1JA 3VW6A 3FQSA 3BQCA 4J8NA 4MD7E 3VO3A 1Q5KA 3BX5A 3GC9A 3NAXA 4CTCA 2RFEA 2VTRA 2CDZA 2YDIA 5L2SA 3LFDA 1OKWA 3G0EA 4R8QA 2PTKA 3DBCA 3MY5A 4MH7A 5JZNA 5ETAA 1ZYDA 3RALA 2OU7A 1JKSA 1NVQA 2V5QA 3LZBA 3F3WA 3MPMA 3CCNA 4O1PA 3ROYA 5M53A 4PTCA 5AAEA 2VNWA 1SVHA 2FVDA 5DT0A 4QQJA 4EH5A 2W1FA 4IB1A 4E5BA 4TXCA 1OBDA 3GCUA 2PE1A 4FV3A 2IZSA 4E4MA 3R1QA 5DRBA 4AFEA 5GIOE 1R3CA 4U8ZA 3AT4A 5T6KA 3SHEA 3R9HA 3IPHA 4E73A 5IMXA 1BMKA 4D1SA 3NRMA 4F0IA 1LEZA 4K2RA 3E8DA 5ANIA 5GJGA 1FMOE 4XUFA 3PFQA 2V7OA 5HE1A 5HBJA 1K3AA 4IQ6A 4LMUA 4DGLC 1H28A 3AD5A 4ONAA 4DC2A 4O7RA 4QNAA 4XP2A 5HG7A 5H9BA 2R3NA 2RFSA 4ASXA 5IZFA 4TTHB 4WNMA 3AC5A 2RF9A 5CVFA 2GSFA 5EHYA 3EJ1A 2W5AA 4EUUA 4C2VA 1VR2A 2AUHA 4IE9A 5LCJA 2EXMA 2BVAA 4K1BA 3PLAE 2GNLA 2ZV7A 4TZRA 4KIPA 4ENXA 3VWAA 1R0PA 4PPCA 3OWLA 2JFLA 1PMEA 3G6HA 5CQWA 3W1FA 3WI6A 4M69B 2QKRA 3RVGA 4AN3A 3TNPC 5I9XA 1H1RA 1IASA 3OTVA 4RWIA 4DG0E 3QC9A 4GMYA 4JT3A 4OBOA 3FMDA 2WU7A 2YIXA 2PMNX 2W5HA 2R3IA 4QMLA 5HO6A 4C59A 4MNEA 5HKMA 4CRSA 2OWBA 3NYVA 3VS1A 3IW7A 5CF6A 4JDKA 5KMKA 3MN3A 4HCTA 3LFAA 4YZMA 2W4JA 2BDJA 3T8OA 4Y8DA 3W16A 5AX3A 4D9TA 2PZRA 2NNWB 4FV6A 2XKFA 4O0SA 5HEZA 2CKQA 1WVYA 1WMKA 4ZTRA 2SRCA 2VUWA 4RJ4A 3O96A 5E8SA 4BCFA 4Y85A 1I44A 1OL6A 4X2NA 4RQVA 1IA8A 4I4FA 1E9HA 4ZMEA 3FKLA 5FTGA 3EL8A 4AQCA 3ZUTA 3OXZA 4FT3A 2P2IA 3ORMA 5H2UA 1OPKA 1B6CB 2XCKA 3KN5A 3O0GA 4FMQA 3UBDA 3EKNA 3V3VA 4F70A 5JFWA 3PWDA 3C5IA 3EZVA 3QKLA 4FTQA 4TRLA 3AT2A 3HYHA 2YISA 4FTLA 4MBIA 3RNYA 3PG3A 5IA3A 3TUBA 4LL0A 2J0MB 2BRHA 5KKRC 4U79A 4C4FA 2C6IA 2VTTA 3IG7A 3PSBA 4W4VA 2B7AA 3H4JA 4H58A 1JKKA 4IFCA 3BYMA 4DH7A 4NTTA 2PMOX 4N70A 4FTCA 4FV4A 3ZO2A 2NRUA 5BMSA 1GZ8A 4G1WA 5I0BA 3BWJA 3QFVA 2CN8A 2XNNA 3CEKA 2QOHA 2ZYBA 5A14A 3AC8A 2F7XE 4C35A 2GNJA 4JDHA 5L6PA 3CTHA 3V8TA 1BI8A 3OUNB 5IQAA 5HVKA 2WTWA 3GU8A 1P4OA 3K54A 3ELJA 2IW8A 4KIOA 4BKJA 2J7TA 4O0XA 4RX8A 5K0KA 2PZ5A 3QX4A 4Z7GA 3CQEA 2PMLX 4I0RA 2IO6A 1TQPA 2VTIA 5DMZA 4O83A 4BDEA 3D5WA 4R7HA 2W9ZB 3A7GA 5FGKA 5LVLA 2VAGA 4BIEA 4BYIA 4LYNA 4I1ZA 2J0IA 4H1MA 4O7VA 3DA6A 4G3GA 4EI4A 3O17A 2H34A 4YHFA 3C13A 3QZFA 2UW3A 3IOPA 2HW6A 2UZDA 2H96A 5CU6A 3DOGA 4QOXA 2FA2A 3MDYA 2JFMA 3NCGA 3NCZA 4A4LA 1GIJA 3DLZA 3DNDA 5FRIA 4GYGA 4AA4A 2W1CA 3LQ5A 4EZ3A 5CF5A 4CFUA 2ZAZA 1Q8UA 2GDOA 2ITUA 3F5PA 1CKPA 4FF8A 3CD8A 4K77A 3V5PA 5A54A 3HMIA 2BDFA 2VWUA 3SC1A 1OPJA 4ZEGA 5CEQA 5A4TA 2P0CA 5CAVA 5CENA 2W17A 2HK5A 5FXSA 2JC6A 2IJMA 3CS9A 3FY0A 3L9PA 4O21A 1UWHA 3VS5A 5IMEA 3OOGA 4JVGA 2YCRA 5JGAA 2H8HA 4ACCA 2OG8A 2WEVA 4IAAA 1ZMUA 3CXWA 3RM7A 4NUSA 5F94A 3LFQA 1AD5A 3Q9XA 3QQHA 4HYHA 3BRBA 2GQSA 4ERKA 3FYJX 4K8AA 1V1KA 3EL7A 5D10A 5CZIA 3ZZWA 3D7TB 4EK5A 3FMLA 4Z3VA 1M2PA 3LCKA 5K5NA 4FKLA 5FBOA 3F5UA 1OM1A 2OIQA 4WSQA 1Q8ZA 4TYJA 3KRRA 1FMKA 1LPUA 5JQ8A 2B54A 4I24A 4IADA 2ETRA 3CJFA 4BBFA 3EQBA 3TM0A 2XA4A 4OTFA 3F69A 4OTIA 4D5HA 4XHKB 3P78A 4JI9A 2FUMA 2VO6A 3PPZA 4O38A 4BB4A 3S0OA 4EJNA 2W1IA 3EN6A 1KE9A 2XKEA 4IC8A 1KE6A 4O7WA 3DKOA 4QO9A 1YXUA 2Z7QA 4HPTE 4AW1A 4A9RA 4C33A 5KCVA 4BF2A 4BFMA 3P4KA 4S33A 5ACBC 1MRUA 3ERKA 4IAIA 2XNBA 2WQOA 4ZY5A 2UVZA 2XRWA 4FX3A 2HW7A 2C69A 1KUTA 4IH8A 4FZ6A 3NW6A 3JXWA 3DBQA 3OCSA 2ZM1A 4YZNA 3C4EA 4AE6A 4V01A 4IXPA 4ITHA 2AC5A 4DG3E 5DNRA 4EH7A 5FBNC 4L68A 3RWQA 2FB8A 5LQFA 3PLSA 4BGHA 4YUQA 4LM5A 5JMSA 4HVSA 4NTSA 5AV0A 2RSVA 3TZ7A 2OBJA 5EQYA 2OI4X 2OXXA 4MQ1A 5IQGA 5B0XA 5L8LA 4WG4A 3LXKA 3IDBA 1UU9A 3C5UA 4QMTA 4RJ7A 4O7SA 2FH9A 4J96A 3CC6A 4M69A 3MH1A 4YLKA 2I0EA 2F49A 3DB6A 4I5CA 4E1ZA 4KWPA 3UG2A 3WF9A 4DGOA 5AIRA 4E5AX 1PRYA 4P4CA 3SXSA 2LAVA 3QD3A 4MVFA 4G9RA 5E8UA 4AZEA 3PXRA 5KMLA 4AZFA 3SXFA 4NIFB 1H0VA 4FIFA 2VWZA 4E93A 4ZJVA 5E92A 1W84A 3ZO4A 3MH0A 3GEQA 3UNJA 5E7RA 4XP3A 4WO5A 4JIKA 5IQIA 4YU2A 4FT5A 4FSRA 4PP7A 3RBWA 4DYMA 2WD1A 5JSMA 4IVAA 3QTRA 3FBVA 3PXZA 2O2UA 2GTNA 2WMBA 3RM6A 4BCGA 4BTFA 5LVNA 3NUNA 4MF1A 3VC4A 2H9VA 1R0EA 1HOWA 2YM6A 3HMOA 3PSCA 2C1AA 4FKIA 1OIYA 4B9DA 1MRVA 2OH4A 3PA5A 3A61A 2ITYA 3P1AA 3FLSA 3ZEWA 4RC2A 1JAMA 4ARKA 2WMWA 2JDTA 4JBOA 3WF8A 1VYWA 3IW5A 4LGHA 4FEWA 4JAIA 1G5SA 2W1ZA 4C37A 5A4LA 4FBXA 3O23A 4RX7A 5TT7A 2XIKA 4WNKA 4F1TA 1WBNA 2VV9A 3O7LD 4AT3A 3TZ9A 3K5UA 3WILA 5B2LA 2ZM3A 1YXXA 2BFXA 2YABA 4QP1A 3BEAA 4FOCA 1XBCA 3MH2A 3S95A 4ANLA 3FMJA 2GNFA 3MB7A 4PPAA 3ZC5A 4A4OA 3BWFA 3A62A 2IZRA 5AV4A 2JITA 3OXTA 4QP6A 1GZOA 4KD1A 2UZNA 2RL5A 3DZQA 3OW4A 3UOKA 4C8BA 3F2RA 4R7IA 3CY3A 4DEDA 2XIYA 2REIA 4FKGA 1W98A 4IDVA 4JQEA 4YSMA 3VRYA 1BLXA 1DM2A 4FTMA 4FEXA 3UO5A 4KSQA 4AAAA 5JT2A 4M12A 4MQ2A 1IAHA 5A9UA 4Y5HA 2BKZA 4HCUA 1YXVA 4I41A 4EEVA 4M67A 4NZWB 3ZM4A 5M44A 4FVRA 3W2SA 4H3PA 4D2TA 2VNYA 3MW1A 1OECA 2IPXA 5EDPA 4QMVA 3HA6A 4PMMA 2Y6OA 4XS2A 3ZXZA 3I5NA 1J7LA 2JAMA 2VWBA 4D2VA 3MGYA 3GFEA 3R7IA 4CZUA 2Z02A 4GRBA 5HIBA 5DIAA 5KE0A 3OWJA 3PJ2A 1G3NA 3UO6A 3FL5A 4B6LA 2Z7LA 4BTMA 5JGBA 3KEXA 3QQLA 4FC0A 2VGOA 3SW4A 5I4NA 4PV0A 3F9NA 3DXNA 3EHAA 5J7BA 3VBTA 3DCVA 1XBBA 4JDJA 3MJ1A 3CIKA 4XV1A 3TJDA 1JLUE 3OROA 3UYSA 4D5KA 3NNXA 2HXQA 3FYKX 3S2PA 3LMIA 4J8MA 3L8XA 5AP1A 3HV5A 2WMAA 3GU7A 3R8MA 2UW7A 2XNMA 3EN4A 4GJ3A 4CD0A 5AA9A 2QOBA 3MIAA 1XBAA 1U4DA 3KL8A 4FSUA 4U44A 3E7VA 3D7TA 5EDRA 1UNHA 1BKXA 5T68A 4U6RA 3RNIA 1S9JA 4ID7A 4D4VA 3NS9A 3ORTA 2PVMA 4FIHA 4ANOA 3C9WA 3AMAA 3RPRA 2BRBA 3QHRA 4FIJA 3TV7A 4E7WA 4E5WA 3TIZA 4ITIA 4MKCA 1CKJA 5FEEA 5CAQA 2X81A 4LOPA 4OTDA 3W8LA 1XWSA 3KMUA 2X4FA 1PMUA 4UEUA 5G6VA 1KE7A 4EORA 3O8TA 5IEYA 4YZBA 2OGVA 4IB5A 2Z7SA 3QCQA 4YTIA 3UZTA 1ERKA 1QPEA 4P90A 4CLIA 4YC6A 4FYNA 5E8TA 2J6MA 3WE8A 4JAJA 1YI6A 3QKKA 3JY9A 4H36A 4CG8A 4DT8A 4GH2A 1OPLA 3DAKA 2QKWB 5KMIA 3OP5A 5CVGA 4NJDA 1JPAA 1OITA 4KRCA 2OSCA 3ZYAA 4QPMA 5HNGA 2C4GA 3V04A 5IQBA 1GAGA 2GNHA 5AP3A 4Z55A 5CSHA 1PXMA 3FLNC 3WIKA 4J97A 4BVUA 1JSTA 2B55A 2OJGA 2A2AA 2P55A 3DJ5A 3KB7A 3L9MA 4IZYA 4IM2A 4D28A 5AEPA 5IPJA 5ANEA 4CRLA 3KCKA 4IW0A 2X8IA 5JFVA 2X2LA 5HG5A 1QCFA 4F9AA 4DFNA 2UZEA 3ITZA 2WQBA 1WBTA 3MY1A 4AN2A 4AA0A 3NYOA 4AN9A 4L44A 5LMAA 1ZZ2A 1XH9A 4RJ6A 4QTEA 4DBNA 4EK3A 3PZHA 4X2JA 3Q6UA 4YJQA 4F9YA 1OL2A 4MNFA 4FSWA 2ITZA 4DGNA 4MX9A 4CKIA 2PZIA 1REJA 4PWNA 3O2MA 2GTMA 2J0LA 2P2HA 2OXYA 2QQ7A 4NWMA 5JZJA 4GK3A 5LVOA 5A4QA 4ANNA 3PIYA 2X4ZA 4I22A 2UZOA 4NIFA 4F6SA 3R2BA 4MHAA 5TOZA 3VUHA 3TV6A 1XH4A 4IVDA 5DFPA 3HRBA 4DTKA 3H10A 4DINA 4EQCA 2WAJA 3ID6C 3IQ7A 4L52A 3RKBA 2R0UA 4OR5A 2B0QA 3DY7A 1DAWA 4DFUA 2RG6A 2JBOA 2C0OA 2ETKA 2GMXA 1H00A 1MRYA 3SXRA 4DH3A 2QOKA 5HGIA 4AGDA 1BI7A 1Y6AA 2BIKB 4O6LA 4XG9A 1YI4A 2XNOA 3IKAA 3L8VA 4BBEA 5CI6A 3EQGA 2UW5A 1PXPA 3TG1A 4O0WA 2GHMA 3F3VA 4ALVA 5AR4A 3R73A 5L4QA 2R3PA 3Q52A 3PPJA 3W2PA 3E3PA 4IIRA 5EHOA 3ZC6A 3QRUA 4DEHA 2WIPA 2X8EA 2OFUA 3JY0A 2VX3A 2PVLA 4NW5A 1RW8A 1J7UA 5CSXA 1DI8A 4ZTQA 2CMWA 1YI3A 3CQUA 4MXZA 3RPOA 4TL0A 4O7TA 4PL5A 2CSNA 3LFSA 3BCEA 4PRJA 3NVKI 3FLYA 3A7HA 3U6HA 4F99A 2VTHA 4E8AA 2DWBA 1YWVA 4H3QA 4QP7A 4JR7A 3I6WA 4OTRA 3NUYA 2C30A 4CCUA 1O9UA 1Q8YA 3HDNA 3WF7A 2QG7A 3VW8A 4X0MA 4RFZA 5DYJA 3BYVA 2CGWA 4C36A 1MP8A 5AWMA 1Y6BA 2HZ4A 3K3IA 5HVJA 3GBZA 2VTPA 3O51A 4F7NA 4C61A 3I81A 4ZS0A 5BYZA 4LV8A 5HG9A 4MXXA 5J8IA 5C03A 3ZFMA 5HQ0A 3LM0A 4UZHA 1JBPE 4LRMA 5KHXA 1YWNA 1XO2B 1OIQA 3HKOA 3MFSA 1IG1A 4ZJIA 2ZOQA 3UQFA 2VTLA 5EHLA 2C5VA 3TV4A 4EOPA 5G1XA 3BEGA 1L8TA 2J2IB 4XYFA 3SDJA 4U9AA 2ZMCA 1SZMA 1HCLA 3OUKA 4FI1A 5IEXA 3PXYA 3PPKA 4F7SA 2GNGA 4KNBA 3OC1A 4M68A 2IVVA 4E20A 4I6FA 2YCQA 2Z60A 2ZJWA 5AIKA 3VBQA 5I9YA 1W83A 2YA9A 3ORNA 4AZWA 5BX0A 5GJFA 3JR1A 4RJ5A 4JDIA 4WRGA 2A1AB 3P7CA 4W4YA 2YCSA 3KXZA 5KMJA 5EKNA 4B4LA 4S30A 4F9CA 1SM2A 3P7BA 4EONA 4HZRA 4U81A 1Z5MA 4RVKA 4Y72A 2W4KA 2P3GX 4HYSA 4KABA 4GVAA 4TYGA 3FKOA 4GKIA 3AC4A 4EKKA 5CEOA 3Q5IA 4KRDA 3QC4A 4QYYA 3N4UA 5A3XA 4I5HA 4LV5A 4ERWA 3BIZA 3FZTA 4BKYA 2XEZA 1NVRA 2XJ2A 5ETIA 5HO8A 5JH6A 2RKUA 4L8MA 5CF8A 4FKQA 5E1EA 4ITJA 2QOFA 1Y8YA 4W9WA 2EXCX 2BAQA 4LOOA 4JX7A 4N6YA 3Q32A 5ANOA 4EBWA 3UC4A 1UVRA 2CJMA 2BRNA 2RIOA 3BELA 2XP2A 4IWPA 3EFJA 5HZNA 3ZBXA 2VTMA 2YJSA 3LMGA 4ASEA 5A6OA 3IDPA 3V5JA 3I7CA 2EU9A 1HCKA 2IW9A 5EYDA 3UVRA 3NPCA 4ZOGA 2VO7A 1AGWA 5AR5A 2EUFB 1H1WA 1Q62A 2YLEA 3RCJA 4IZ5A 3ZBFA 5L6WL 1FOTA 2RFDA 4BDCA 2WMUA 3EZRA 3HRCA 2WMSA 4HVIA 4BCMA 4D1XA 3ZSHA 1LP4A 5I9VA 4M0YA 1CDKA 3LQ8A 3NWWA 4HYIA 4BCQA 2XIZA 4TYHB 4G5PA 3LLTA 4HVGA 1H8FA 5DBXA 5BPYA 2KULA 3TL8A 2HXLA 3EN9A 3W2RA 3VS0A 5CU4A 4GKHA 4D9UA 2YCFA 3TWJA 3WE4A 5CX9A 2XS0A 4ACGA 4EH2A 2E9PA 4U3ZA 3UMWA 3SGCA 4O84A 3AT3A 3Q2JA 4JXFA 5M4UA 4DGGA 3A60A 3RAKA 3EKKA 4XV2A 4X6QC 5DVRA 2ERZE 2W05A 4OGRA 2BMCA 3KF7A 4QYGA 4ZXTA 4GK2A 5CXHA 4KS7A 3KC3A 2XEYA 1W0XC 4GS6A 4YPSA 2IWIA 2C0IA 3WYXA 3ZCLA 2X0GA 1ZYJA 1KV1A 3KQ7A 4ZSLA 4O22A 2ITXA 3QZGA 4QMOA 2QHMA 3FZPA 3ZHPC 4BWKA 5J5TA 3G15A 1GY3A 2ZB0A 4QMPA 4R78A 1QL6A 2BIYA 3QHWA 3QRKA 4EC9A 3QRIA 1YVJA 3DTCA 3F7ZA 4L6QA 4WG3A 2A4LA 2HZNA 1XJDA 3NW7A 4Y83A 5AX9A 3SV0A 4TYEA 5DH3A 5HD7A 3ORPA 3TNQB 3A4PA 5CANA 4QYHA 1PHKA 4JBQA 2ITNA 3ORIA 2Z8CA 3G33A 4M15A 4W4XA 3VUKA 3F6XA 4X3JA 5CTPA 1V0OA 2IW6A 1Q97A 4EHEA 3DNEA 3EMGA 4WKQA 4FV1A 4IDTA 5TF9A 5FP6A 4ZIMA 3D83A 4HOKA 4KIKB 4YJRA 5EH0A 4PDSA 4G6OA 2E9OA 4N4SA 1H1SA 4FV5A 4BRXA 3OY3A 2W99B 2CCHA 4BIBA 2YIQA 1BL7A 3DQWA 3MA6A 4QQ5A 2FGIA 3AD4A 3D5XA 4H3BA 3QBNA 4YZDA 5K9IA 3BHYA 4Q5EA 5D12A 3NIZA 3DDQA 3DFCB 4A9UA 5FDPA 4U0IA 3RPYA 1BYGA 3PE1A 1BX6A 3EQIA 5H8GA 3KKVA 3Q3BA 3VQHA 2ZMDA 3FHRA 4AZSA 2XK8A 4BDAA 4KBKA 2BUJA 3ZLXA 4ACHA 5LMBA 3P9JA 1ZMVA 3KVXA 4TY1A 5LJJA 4FSTA 4KIQA 3ZMMA 3LFNA 2B9FA 5FTQA 5BVNA 3CPBA 4JJRA 5HIDA 3T3VA 4YGAA 4TT7A 3SD0A 4E26A 3D4QA 1YOLA 2EWAA 3OTUA 3DBDA 3TTIA 5JKGA 2LGCA 3W2OA 4GJ2A 2I1MA 3NYXA 2OJJA 1NW1A 2GPHA 3NNUA 1Y8GA 4JG6A 5DR9A 5M08A 5CU2A 5HCZA 3QL8A 4DFLA 1CMKE 2VTQA 4XV3A 2BAJA 3E63A 2PZYA 2ETMA 3V5TA 1OVEA 3DKCA 3V51A 2CLQA 1KSWA 3GP0A 4OBPA 3TT0A 5IF1A 2EVAA 4G9CA 3JVSA 3VUDA 3PVBA 3KRWA 5J95A 3PY0A 3HLLA 3OF0A 3TI1A 4CV9A 5JFSA 4OT5A 4AXAA 2PUPA 3R63A 4YLJA 1PW2A 5F9EA 1OB3A 4KSPA 4YTFA 4FV7A 3WF5A 3KVWA 2PMIA 3I7BA 4YNOA 2QR8A 2WKMA 1M7QA 1KOBA 2BZIB 3N4TA 3MFRA 4N57A 3ENHA 3E5AA 3D5UA 3CTJA 5LWMA 5HLNA 1F3MC 2YM7A 3OMVA 3GXLA 2R7BA 2PU8A 3E8CA 2H6DA 4O0YA 3VS4A 3LCOA 4QYFA 3UC3A 3ZLYA 4QD6A 4ZZMA 3PE2A 3RK5A 3NMUF 3GFWA 3T9TA 3LCTA 3BGPA 5CEPA 4GUBA 1JVPP 4AX8A 2JIVA 4JG7A 1Q24A 4NM3A 4NKAA 3QX2A 4GU9A 2GS7A 4Y5QA 4GFGA 4FZ7A 4TWNA 1MQ4A 4GT5A 3UZPA 1DAYA 4UMTA 3IS5A 3M42A 3UVQA 2F7ZE 4FTJA 4I0SA 1G8AA 3A8XA 3DPKA 3TZ8A 2IVTA 3D0EA 3PY1A 3NR9A 2G2FA 3VUGA 3MESA 2QU5A 1R1WA 4RIOA 5AM7A 3MYGA 3Q4TA 2UW9A 1OL1A 2ESMA 3MI9A 4GSBA 3OBJA 4YPDA 3RHKA 4A07A 4CV8A 3GQLA 2F9GA 3IONA 4OW8A 5DR6A 4CSVA 1JSUA 1J1CA 5DN3A 3M2WA 4WUAA 3V5LA 5F1ZA 4DLIA 3P0MA 2ITOA 3VUMA 5I9WA 1YW2A 3R9RA 2WOTA 4D2SA 5CAPA 3QQKA 4DH8A 2VO0A 3I79A 2C5XA 1YXTA 1CM8A 1V0PA 2HIWA 2HWOA 4AOIA 4B7TA 2WELA 4ZLOA 3EFKA 4JBVA 2C1BA 5K3YA 5C8MA 3HMPA 3G2FA 3QXPA 2I0HA 3DAEA 4A4XA 2C5NA 3EIDA 3EQRA 4G6LA 2Y0AA 4TYHA 2JAVA 5BUIA 4FEQA 5E9EA 3IDCA 3R1YA 5GJDA 4C62A 2R3KA 4QT1A 4TNDA 3F61A 5IISA 2Z2WA 3UTOA 3S4QA 3DS6A 3QYZA 4C57A 4LUDA 4RFMA 4N0SA 3C4XA 4TWPA 3MIYA 2VX1A 4M97A 5L2QA 5JN2A 2YEXA 2B53A 4FT0A 4UN0C 2JKQA 3FPMA 4FZDB 4GL9A 2UW4A 5D11A 4WG5A 1M2QA 2YZAA 3JS2A 4AGUA 5J9LA 2VTAA 3MA3A 4HNFA 3UODA 5CAUA 4KS8A 3NUAA 4DCAA 2OK1A 4FNWA 1DS5A 2XNEA 3ACKA 1PYXA 2GQRA 3ZLSA 4C4JA 3UG1A 4ZMFA 2PK9A 4RVTA 3ORKA 1KV2A 2PVKA 4LGGA 4CZTA 3G0FA 5HCXA 3QGWA 3F3TA 4O81A 4TPTA 2OIDA 1OGUA 2XK4A 2V55A 4P5ZA 4U80A 5AUUA 2Q83A 1H07A 4HVDA 1H01A 5LMKC 4HGTA 5HTCA 3OD6X 4GIHA 3UQCA 4M7IA 3RTPA 4EH4A 4AG8A 1H25A 2WMRA 3TKUA 3LHJA 5DLSA 4F1MA 1H27A 3DLSA 4YJUA 2QCSA 4WRSA 5BNJA 1IR3A 4O7NA 1JOWB 4ZK5A 4EWQA 1PMNA 4MEDA 4C4EA 4YSJA 2R2PA 3RAHA 5L3AA 5C9CA 3T3UA 3MVJA 4NCTA 3UO4A 1JWHA 4JRNA 4QTBA 4W8DA 3R8UA 3A4OX 5HIEA 5FDXA 3KRXA 3KCFA 4FTKA 2WTKB 4KIKA 4P7EA 3EWHA 4RFYA 1WVXA 3TDWA 1PKGA 3C0IA 1OL5A 3ALOA 4A9YA 1H0WA 2X7FA 5DPVA 3LAUA 4UX9A 4BKZA 3DQXA 4M3QA 3MPAA 2XBAA 4LG4A 1R39A 4D2PA 3ZTXA 2YM5A 3FKNA 4RMZA 3VS3A 3ZH8A 4CMUA 4YZ9A 2WPAA 5M57A 2WMQA 5M4IA 4PP9A 1OKZA 3ORXA 1Q8WA 5IQEA 3QALE 3EYGA 3BHUA 3FLWA 2PVFA 2BZHB 4NFMA 4X2KA 4AACA 4EYMA 3UPZA 1UKHA 2BR1A 4I5PA 3PIZA 4XRJA 2R5TA 2B9IA 1PKDA 2VTJA 4IM3A 4L00A 4L42A 4O0RA 4OTWA 4F7LA 1PJKA 3BLRA 5AV3A 1G8SA 3FXWA 4NCTC 4YR8A 3AC1A 3BHVA 3NSZA 1UA2A 4IANA 4IMYA 5EYCA 5L2IA 4KKHA 1XHAA 2BHHA 3NUXA 4FIGA 1TVOA 5CI7A 3M1SA 4WNPA 3L1SA 2QOCA 4NYEA 3UE4A 1E1VA 1ZYLA 2CLXA 4IM0A 3VBVA 1YWRA 2ZV2A 5HCYA 4F6WA 3F5XA 1H08A 3NDMA 5GINE 1OMWA 3LJ0A 4MXCA 5D41A 4NT4A 3PJ1A 5ANGA 1FBNA 1K9AA 2XM9A 1H26A 4RWKA 5CWZA 5FM2A 4BWPA 4NK9A 5DG5A 1VEBA 3KXNA 4XG4A 1UWJA 1VYZA 3IO7A 4PUZA 5IKWA 3AQVA 2OO8X 2O65A 3SVVA 3PP1A 1WBSA 1XH8A 2BTRA 1U5QA 4F6UA 4IEBA 1O6KA 2XK9A 3LM5A 4GG7A 4CFFA 4DITA 3EQFA 5EYMA 4FL1A 3S1HA 3LMHA 3LFCA 3POZA 4CYJA 2BPMA 4HGSA 3GI3A 4L3JA 2XK7A 4OTQA 5ANDA 4ZZOA 3TACA 2E2BA 3FV8A 5M55A 1JSVA 3SX9A 3QKMA 1OKVA 2X2KA 4GU6A 4I21A 4ZAUA 5IU2A 3SRVB 5HO7A 3BQRA 3FMHA 4Y46A 4FTOA 3K3JA 5AUZA 2WMVA 1XH6A 3R04A 5CALA 1QPDA 4QP3A 4TW9A 4G31A 3D7ZA 2JDRA 5HHWA 5LWNA 2F2CB 1ZYCA 3N9XA 3OY1A 4RC4A 5BVWA 3TUCA 3Q96A 3VAPA 4BCOA 2WB8A 5ETCA 3IGOA 3ACJA 5FXRA 3UOJA 4C3FA 2J4ZA 4IZAA 4QTAA 2PYWA 2R3LA 1V0BA 4F65A 4EK6A 4RIWB 3HDMA 5IA0A 4MBJA 4FKWA 1MQBA 3FI3A 3PWYA 4RJ3A 5L8JA 3I0OA 4BIDA 2HYYA 5IA2A 2O3PA 3AMYA 5BVEA 3CKXA 2WO6A 4O27B 5I9UA 4CT2A 3RP9A 5IQFA 4YHTA 4TWCA 5CT7A 5BUJA 3BYUA 1K2PA 4YC3A 3ULZA 2QODA 1TKIA 4FV0A 3ET7A 2ITTA 3FQHA 4FKTA 4R6VA 5DR2A 1QMZA 3PIXA 4D58A 3GUBA 1WBVA 4JRVA 4EOJA 5JFXA 5DWRA 1YHWA 3H30A 3EQDA 3R9OA 4FTRA 4QTDA 1WBWA 5A46A 5E1SA 5AUVA 4E6CA 2G15A 2KTYA 1UV5A 2X39A 1YRPA 3HGKA 4IZ7A 4RRVA 4XX9A 4FICA 4QQTA 5LVMA 3ANRA 3FZSA 3QCYA 2WFYA 2CCIA 4ZTSA 5EW8A 3TKIA 3D2IA 3LVPA 4DGMA 3ORZA 4L53A 4ZLZA 3OCBA 2PPQA 4O7LA 2J9MA 3Q4UA 3ZS5A 4K18A 4F4PA 3UNKA 4NH1A 4BHZA 3F7WA 3CD3A 3EFLA 5K4JA 4LFIA 1WBPA 4BDBA 3BI6A 4Z7HA 2ZDTA 3AOXA 3FY2A 2CKOA 3B2WA 3DK3A 3F2NA 1U59A 3TEIA 5EOBA 2W0JA 1UU3A 3Q2MA 5FD2A 4PQNA 4YBKA 4W9XA 3GCSA 5M56A 3C0HA 4YLLA 2YERA 2X8DA 4V0GB 1FVRA 4LMNA 5DEWA 1TQIA 2V0DA 2VGPA 1UU8A 2W06A 2QOOA 2QC6A 3AXWA 5GZ8A 4FK6A 4XMOA 4DHFA 3H0ZA 2HWPA 4PDOA 4R3PA 1SYKA 3SKCA 3R21A 2WTJA 4ZJJA 5AAFA 2OJFE 2CKEA 4UXLA 1Q99A 4XBUA 5IQDA 3LE6A 3R6XA 3UDBA 5A4CA 3KU2A 4R7BA 5FQDC 1ZXEA 3JVRA 2YWPA 3NUUA 4QMUA 4HYUA 5D1JA 4F64A 4PNKA 2I0YA 3VIDA 1W8CA 2XUUA 3LOKA 4M14A 4EL9A 4YO6A 4BTKA 4AOTA 3KULB 5FEQA 3T9IA 2VWXA 2XIRA 3DV3A 2WTIA 3FSFA 4HNIA 1YOMA 3E7OA 3R7YA 3DXQA 4MXAA 1U54B 5L2WA 3R2YA 1OUKA 4FR4A 3ENMA 2J5FA 3EQCA 5J87A 4J7BA 4LL5A 2PY3A 4W4WA 3NAYA 3H0YA 3PYYA 4YURA 2B9HA 4S31A 5B2KA 2YWVA 2F4JA 2PL0A 5GHVA 3LCSA 2PVRA 4G3EA 4C34A 2GFSA 1GJOA 4OT6A 2QU6A 1Q41A 4QMZA 4BI2A 5BYLA 2XNGA 3GC0A 3TIYA 3I1AA 4EH8A 4UMRA 1IEPA 2C6DA 3MFUA 2CGXA 3EQHA 4R5SA 3GCPA 4F9WA 2I40A 4F63A 1AQ1A 4RZWA 5FUTA 2WTKC 3QTSA 2ZDUA 5J1VA 4BZNA 3FWQA 3DJ6A 4NM0A 4G3DA 5AP6A 4R3CA 5A6NA 4IX5A 5HTBA 5FG8A 1I09A 1FGIA 1URWA 3NNVA 4XV9A 3FZOA 4DFBA 3GVUA 3HAVA 3DAJA 4FTNA 2C47A 3UNZA 4RZVA 3V8SA 1OKYA 1Q3DA 3ZOSA 2EB3A 3E3BX 2PVHA 3K5VA 3EN5A 3PUPA 3P5KA 4USEA 1J1BA 4XG7A 2UW6A 4I0TA 5DI1A 2B52A 3WIGA 3QF9A 4K0YA 3BE9A 3MWUA 3AMBA 3U4WA 4LQMA 4PDYA 4CXAA 2ERKA 2CNQA 5ANJA 2CGUA 5HNBA 2RG5A 3KGAA 1JKTA 3TXOA 4FVPA 4A7CA 2QOIA 3GQIA 3CE3A 4O6EA 5I5ZA 4XP0A 1CTPE 3FQEA 3VF9A 5I9ZA 4ANBA 2ONLC 4EHVA 3ZSGA 3QLGA 3UIXA 4CYIA 4C7TA 4O82A 2QURA 3U8WA 5TKDA 2UZVA 5IH5A 4IX6A 3LPBA 2X7GA 2YJRA 3PA3A 3SRVA 4O7ZA 4EHGA 2R3FA 2WXVA 2GFCA 3E8EA 4C02A 5M06A 2WNTA 3R30A 4J1RA 5EM6A 4D2RA 4YJTA 1Q4LA 2UZTA 3NGAA 3B2TA
chains in the Genus database with same CATH superfamily
4CQGA 2ITQA 5IH4A 3HNGA 4XJ0A 4KBAA 3D14A 4FKVA 4KKGA 4BDIA 4O86A 3QQJA 4FUXA 3QWKA 5CNNA 3MY0A 4GT3A 2J0KA 4J53A 3RZBA 4AW2A 3BYOA 3PJCA 4XBRA 4UYNA 2R4BA 4C3PA 3WF6A 3LXPA 4FT7A 3DB8A 3AD6A 4RIWA 5HE0A 3A2CA 4ACDA 1PMVA 2PSQA 3R0TA 2B9JA 4RLLA 4FKRA 4UMQA 4B8LA 4GCJA 2JIUA 4DFYA 4DEGA 3HA8A 4I6BA 3KA0A 5HORA 4F7JA 2PE2A 2C3IB 3DT1A 3IW4A 4GK4A 4L7SA 3AC3A 4L9IA 4DFZE 5AAGA 4DF3A 4XCUA 1NY3A 5JQ5A 5GIPE 4FIEA 3W0OA 4GG5A 5AV1A 4FV9A 5BYYA 4IB3A 3L9LA 4F08A 3PVGA 3A8WA 3Q04A 4EH6A 4QRCA 3ALNA 4XOYA 3R9NA 4DCEA 5ITAA 3R7EA 4QTCA 4FL2A 2FYSA 3NNWA 2AC3A 3O8UA 4Q9ZA 3I5ZA 3TZMA 5D7VA 3FMEA 5C4KA 3QWJA 3EQPA 5FP5A 4OAUC 3FHIA 1SNXA 3RHXA 4R1YA 3QLFA 1IRKA 3HZTA 4CFVA 3FLZA 4IJ9A 3CY2A 4FTTA 1B38A 3TMOA 4CCBA 4B0GA 1ZOGA 3BU6A 4XG6A 4WIHA 3CKWA 3DBFA 4AT5A 1ZRZA 3CSVA 5E8VA 4MTAA 3OXIA 4IAKA 5DA3A 2X9FA 4LDTA 4I6QA 2A27A 3THBA 4MCVA 4IVCA 3VRZA 4BDFA 4EOMA 1W7HA 2QNJA 2R3MA 4APCA 2CNVA 2Y8OA 2YN8A 3R00A 3II5A 2YITA 3UOLA 3VF8A 3QGYA 3BV2A 3MSSA 5HU9A 2C5OA 4TKSA 3P08A 4V0GA 2IVUA 3WARA 1P14A 2C68A 4BTJA 4EK8A 4LUEA 4X3FC 1H24A 3IOKA 4O1OA 1ZOEA 4ACMA 4FA2A 5CZHA 3HX4A 2C6KA 3WZEA 3HV4A 5CASA 3NLBA 5H3QA 2XH5A 4CFXA 3HMMA 1L3RE 5DRDA 4AGCA 3ATTA 1UU7A 4UXQA 3H3CA 3TNHA 3MH3A 1QPCA 2JDSA 5HVYA 3F3ZA 2WZJA 4PNIA 1MUOA 3N4VA 2XKCA 1RE8A 3C51A 5CLPA 5DEYA 3KULA 1JNKA 4M66A 4LGDA 5HX6A 2DUVA 2XYUA 3DK6A 3EOCA 3MS9A 2CHLA 2HZIA 4D2WA 3I60A 2BROA 2G01A 2HAKA 1U54A 5KZ0A 1BUHA 4O4EA 4JS8A 2X9EA 4YHJA 3ZRMA 4I94A 4FV8A 4BHNA 4FIIA 4GIIA 2WQMA 2YLFA 3D15A 3SOCA 3R9DA 3KRLA 3M11A 2BHEA 4O0VA 3BGZA 4FGRA 5TE0A 3QRTA 5AP0A 5KMOA 3SG8A 4DH1A 3FXZA 1CKIA 2W1EA 3MTLA 3O7LB 3F66A 4L01A 1OBGA 2GQGA 3GU5A 3R1SA 1OIUA 2GU8A 3LCDA 5AP5A 3UGCA 3FAAA 4PTGA 4HPUE 4DEIA 4YMJA 3DZOA 3UJGA 2UVXA 2E9NA 1U5RA 1X8BA 3R8ZA 4FVQA 1IAJA 2X7OA 3A7IA 3UP2A 4RC3A 3W55A 5L8KA 3DBEA 1H1PA 3AKJA 2P4IA 4AXDA 3A99A 3NEWA 4D4RA 4FGBA 3WZUA 3C4ZA 3HRFA 2VO3A 2PVJA 5FLFA 4G34A 3TJCA 1ST4A 2VN9A 1LEWA 1URCA 3AC2A 3E88A 2XZSA 5HICA 3RWPA 3SOAA 2I0VA 3U9CA 3DDPA 3SG9A 4EWHA 1ATPE 2FSLX 2XANA 1DI9A 3PJ3A 5CVHA 3W8QA 4DN5A 3E62A 4FNZA 3R22A 4EOQA 4FV2A 1A9UA 3C4CA 3GT8A 4WNOA 4AT4A 5CEMA 2IVSA 4MBLA 3HECA 3MV5A 1U46A 5M51A 5J79A 4BZOA 3R7OA 4K33A 3UP7A 5EK7A 4JG8A 4AS0A 5BQ0A 5JRQA 3W32A 3QUPA 4R77A 2VTNA 5AUYA 2QI8A 3ZO1A 3GC8A 2PWLA 3QCXA 4RG0A 4AFJA 4R5YA 4Y95A 4XRLA 5C4LA 4IWDA 1OZ1A 2J50A 4YJSA 2VWYA 3BE2A 3BYSA 4PMPA 4IACA 3GCQA 3IK3A 4XNEA 4BDDA 2CN5A 1BL6A 3OS3A 4MXOA 4YJVA 2OXDA 2Q0NA 5FEDA 3WZDA 3UVPA 5GNKA 3PXFA 4RPVA 2PVNA 2WU6A 2Y7JA 3MPTA 3OOMA 5C01A 3ATSA 2ZVAA 4ORKA 1P5EA 2C3KA 3EYHA 4U45A 5HE3A 5EFQA 3JUHA 4I6LA 3KK9A 4EHZA 2R0IA 4ZSGA 3FI4A 4A9SA 5AUWA 4BCHA 2YHVA 1WAKA 4IBMA 5EDQA 2NO3A 3R28A 4WUNA 1VJYA 2C6EA 4EYJA 5EQEA 3KY2A 1VZOA 4FG7A 3LJ2A 4MD8E 2C6TA 3N51A 3ZUUA 2QVSE 1QPJA 3QYWA 3RAWA 2HY0A 4EQMA 5C8NA 3FEGA 3CQWA 5B7VA 4RSSA 1REKA 2BFYA 2OZAB 4G3FA 4KKEA 3SAYA 2XK6A 3PG1A 3FSKA 3VULA 3NVMB 3C1XA 4H39A 2J0JA 3VBWA 2Y6MA 5BVDA 4AXFA 5JEBA 1PXNA 5IA5A 3NUSA 2FSMX 2IZTA 2B1PA 4AP7A 2UUEA 2X6DA 3ML1A 3R01A 4I6HA 2UW0A 4KINA 4DBXA 1NVSA 3Q53A 2PUNA 5FWKK 2R9SA 5CSPA 5I3RA 1UNLA 3Q9ZA 5JGDA 4FSMA 3I4BA 5EI2A 4CZYB 4G6NA 4JOAA 5CU0A 2Y4IC 3I0QA 1H1QA 4CMTA 2P33A 2QD9A 4X21A 3FPQA 4CNHA 4OLIA 4PDPA 1FINA 3WOWA 3ZXTA 4EH3A 4AW5A 5C8KA 5KNJA 2FSOX 3FMKA 4GEOA 4RIXB 3GU6A 4DEAA 5BMMA 4E6DA 2JDOA 4USFA 4RWLA 3BPRA 1ZAOA 3TNWA 4DLJA 3VJNA 3QRJA 4S32A 4UV0A 3ZSIA 3RJCA 3ZZEA 5IA1A 3G90X 1SVEA 1PF8A 1GOLA 3U4UA 2O5KA 5CS6A 4OTPA 5KZIA 4KUJA 3ODYX 2XJ0A 2YAAA 4FZFB 2YIWA 4KBCA 3GC7A 4QMWA 2AYPA 2RGPA 2X2MA 4V04A 5IA4A 5CXZA 2A19B 2QOLA 4EOLA 4YO4A 5EM5A 4WBBB 2C5YA 4FKOA 4G3CA 3UQGA 4BCKA 2W4OA 4J98A 4DHIB 3QQUA 3TTJA 1ZY4A 1PYEA 4O91A 4ALWA 4FODA 4HZSA 2R3RA 3PSDA 4EZ7A 4ZTNA 1H4LA 4BI1A 4II5A 4MF0A 5M07A 5C1QB 2Y9QA 5KBRA 4HGLA 3CR0A 3FL4A 4F9BA 2PHKA 3Q4CA 2QG5A 5EI6A 4OBQA 5EQPA 3BZ3A 4CKRA 3MVLA 3R1NA 5LCKA 3ULIA 2QLUA 3S00A 3PVWA 5EOLA 3CBLA 3GNIB 5EM8A 3KFAA 4EOIA 4OUCA 5K0XA 2QO2A 5LMKA 2ITWA 3LFFA 3D2KA 4AOJA 3BBWA 5HBHA 2V22A 2W9FB 4M0ZA 4OTGA 3FJQE 2PZPA 1GZKA 3FC1X 3P23A 3PXQA 4GUEA 4MXYA 4WA9A 3GCVA 5ANKA 3U55A 4XG3A 5ICPA 3COKA 4F09A 1GIHA 1RJBA 4GW8A 3FC2A 3LXNA 4BJJB 5DHJA 5AR8A 5LARA 5K4IA 4U43A 2C6LA 4D4YA 4M8TA 2NP8A 2R7IA 1S9IA 2JKMA 2VTSA 2XF0A 3LFEA 4Q9SA 5AA8A 3TUDA 3P7AA 4RX5A 2WEIA 5AFVA 2CGVA 1R78A 4YZCA 3UMXA 3FUPA 5HG8A 4KAOA 2XMYA 3PP0A 5EW9A 5FXQA 1LR4A 3ZEPA 4APPA 3OWPA 3VUIA 3KMMA 3LIJA 3LFBA 3ZRLA 5ACKA 3S3IA 3RZFA 4IAYA 4L43A 1M14A 2JKOA 4BYJA 3D5VA 3EFWA 4JQ7A 2WTCA 1J7IA 3QTZA 4QMSA 3R7GA 1KE5A 4IVBA 1GIIA 4DDGA 4FL3A 4C58A 4FNYA 4OTHA 5DT4A 5AV2A 3C7QA 5CEKA 5HLPA 5TR6A 4L3LA 4IC7A 5CQUA 3COMA 2YDKA 4M13A 5GZ9A 3HUCA 5AUXA 4PMSA 3VN9A 3SA0A 1M52A 2A0CX 3TYKA 2I7QA 1YKRA 4GT4A 5CYIA 4J95A 1NT2A 4NU1A 2C0TA 4ZSAA 2GS2A 1Q3WA 5HD4A 4FTUA 1FPUA 4KA3A 2YACA 4UMUA 2JGZA 2PE0A 3QQFA 3D9VA 5CY3A 4YTHA 5IUGA 5JRSA 4QPAA 4U3YA 3RI1A 3WZKA 5B2MA 4P5QA 5TO8A 4D1ZA 3G5DA 3G51A 3W2CA 3HP2A 3R71A 5IH6A 3R8LA 3P79A 4NL0A 5E4HA 5AM6A 3ZU7A 1F5QA 2JBPA 3FE3A 4IHPA 4MK0A 3ZDUA 5J1WA 3BU5A 3ETAA 4QPSA 2WOUA 4EZ5A 3WBLA 2CPKE 3IECA 5KHWA 2XJ1A 4JL9A 1XH5A 2YZLA 1OIRA 4ZTLA 4IX3A 2I6LA 4A06A 4E3CA 5EYKA 1Q8TA 2X6EA 4FSZA 4FSNA 4QDEA 2JEDA 1W82A 5BVOA 1M7NA 2VWVA 4C4IA 3BHTA 5CU3A 4FYOA 3RMFA 3LKMA 1OL7A 1OI9A 2ZB1A 4XLIA 4J99A 2YDJA 4EUTA 5KMNA 3OT8A 4QP4A 3UOHA 2QR7A 4ASZA 2R3JA 3V5QA 4JIAA 2WQNA 2F2UA 3E8NA 4N6ZA 3BL7A 3O71A 4PTEA 4A9TA 2OZAA 5H8EA 3KXGA 2DQ7X 1M17A 4GFOA 4G2FA 2O64A 3QXOA 3HUBA 4JNWA 1ZARA 3ZO3A 2BRMA 4LOQA 3H9FA 2VD5A 2W7XA 4MWIA 4CFNA 4E6AA 4FZAB 1ND4A 2QOQA 2Q0BA 4BWXA 3UDSA 3Q5ZA 4R1VA 3W2QA 4DEEA 3CP9A 4HCVA 3NYNA 3UIBA 4J71A 3F3UA 3FI8A 2YIYA 4YJPA 2C6OA 2FSTX 3FXXA 4RA5A 4RQKA 3DK7A 3BKBA 3QTQA 4G5JA 4CG9A 5I3OA 4YBJA 3PXKA 4NEUA 4RIXA 2BALA 4BCNA 1XR1A 3HV6A 4U7ZA 4EK4A 4QMMA 3TDVA 2C3JA 1UKIA 4IWOA 4BDGA 3FI2A 4RX9A 3AG9A 2OW3A 1PXLA 3VHEA 4ZS4A 2VTOA 4FSYA 5HESA 1OUYA 2XB7A 3OFMA 3CPCA 1FQ1B 2OKRA 4QYEA 5EW3A 3REPA 3ROCA 3VS2A 2CNUA 1APME 3V01A 1ZYSA 4FTIA 3NZ0A 2XK3A 3OHTA 5KMMA 3QZHA 2JIIA 3QTXA 3ORLA 3TKHA 2QHNA 1WFCA 3UPXA 4CQEA 3H9OA 2WHBA 3QTUA 3WZJA 2Z7RA 2ZV8A 3Q6WA 4X2GA 3U51A 4H05A 3UIUA 1XKKA 4PPBA 4WT6A 2IG7A 4V05A 5AP4A 1FVVA 3CTQA 2IN6A 4UWBA 3OZ6A 2JD5A 5AR7A 4ENYA 1F0QA 4GVJA 4ZY4A 1JKLA 2ITVA 5M4FA 3PRFA 5CSWA 1ZMWA 4PL4A 4FK3A 2YAKA 3KXHA 4IFGA 4HGEA 4ALUA 4EOSA 2R3QA 3PTGA 4O2PA 4TN6A 3COHA 3V5WA 5CSVA 3VVHA 2GCDA 3RCDA 3RK7A 1PXIA 2XVDA 1CSNA 4R3RA 3R8VA 1Z57A 4C38A 5AMNA 2BTSA 3PZEA 2O0UA 3OG7A 3OVVA 5D7AA 3VNTA 2C3LA 3SW7A 4BICA 5IUIA 4G17A 5HBEA 2BZJA 2XYNA 5EI8A 3QUDA 2PULA 3Q9WA 3O8PA 3QTWA 4TWOA 3GB2A 4QQCA 4FG9A 4RVLA 4BJJA 4RA4A 2XBJA 1ZOHA 4DEBA 2WQEA 4X3FB 2W1DA 4E6QA 2DYLA 3QAME 4IAFA 4TYIA 5FTOA 2F57A 1P4FA 5CF4A 4EKLA 5E8YA 4BDJA 3E64A 3AGLA 3E87A 3DFAA 4UWYA 4FKJA 1P2AA 4CTBA 3FMNA 4K11A 1O6LA 3F82A 1A48A 3G9NA 4FKSA 1NA7A 4YP8A 5HI2A 1J91A 4GV1A 4YNEA 3NFGB 3BU3A 5ETFA 3B8QA 5BVKA 3ZFYA 3LQ3A 1YHSA 2X0PA 5IQCA 3GOKA 2OH0E 3DJ7A 2UW8A 3SQQA 1IA9A 2ITPA 3FZ1A 3RINA 3HAMA 2YIRA 4QMQA 4IB0A 4DE4A 4I23A 3EH9A 2R64A 2W96B 3QA0A 1STCE 2VWIA 4QMYA 2IF8A 4J52A 4XG8A 1UNGA 3VHKA 4EQUA 3ANQA 1GNGA 2J90A 4RBLA 5M4CA 4AGWA 3PRIA 1YDRE 4FEUA 4BGGA 2OIBA 4EBVA 5J9YA 3U6IA 4XG2A 3RPSA 3Q60A 3R8PA 2BKKA 2EB2A 1WCCA 2GNIA 2F7EE 3F2AA 4JLCA 4P2KA 3R7VA 4C0TA 2YFXA 3MTFA 2QONA 4MYGA 3DXPA 2RFNA 4U41A 1T45A 5E8XA 4NM5A 4HW7A 3KF4A 3HV3A 2ZV9A 1JQHA 4O4CA 4S34A 4DA5A 3QD2B 4AWIA 2B4SB 3R83A 4BBMA 5J5SA 4L67A 3QUEA 4WOVA 2WGJA 1E1XA 4L45A 3I6UA 4NFNA 1YXSA 3OCGA 3V6SA 5EM7A 4DFXE 5J7HA 4FE2A 3MB6A 4Z9LA 4FEVA 4QP2A 2UZBA 2PUIA 1SMHA 4GYIA 3BV3A 5F4NA 2W5BA 4IAZA 3QCSA 4E4NA 4K9YA 1B39A 5EG3A 2G2HA 1XQZA 4FSQA 1YQJA 5JK3A 4YJNA 5DE2A 5C27A 1TFFA 2NPQA 3HEGA 3OWKA 4RIYB 2HOGA 3ZFXA 2G9XA 3OEFX 4UY9A 4ASDA 2CKPA 3K2LA 5A4EA 4FNXA 4CVAA 4ANSA 2Y4PA 2V7AA 1PXKA 5J9ZA 4UYAA 1GZNA 4CLJA 3JPVA 5IEVA 3C50A 2OZOA 3DKGA 2HELA 4CFWA 4UBAA 2BAKA 5KUPA 3QD0A 4ZSJA 3EN7A 4BDHA 4W8EA 3GOPA 3QQGA 2YM8A 3TCPA 4FKPA 5AP7A 4ZSEA 4CKJA 3NX8A 4BC6A 4USDA 4BZDA 4PY1A 4IX4A 2EXEA 5C26A 4BCPA 3MFTA 2C6MA 3RK9A 4FTAA 4LI5A 4C4GA 2O8YA 2ONLA 1WBOA 3HMNA 3GU4A 4D0XA 3HVCA 3VS7A 5CT0A 2UZLA 3AGMA 2UZWE 3G9LX 1PY5A 3OW3A 3GENA 3ZUVA 4FT9A 5T3QA 3PDTA 3L9NA 3ZLWA 3W0NA 4QP8A 4AF3A 1KE8A 5GZAA 1YDTE 2R3OA 3Q4ZA 2JLDA 2JDVA 2VRXA 3P86A 4I92A 2QO9A 4IWQA 4WSYA 4E4LA 4F0FA 4JR3A 4DH5A 2OICA 5HOAA 4EOKA 3OEZA 5HX8A 2R3HA 2OJ9A 5DGZA 4O0UA 3FLQA 3OT3A 2NRYA 2YM4A 4LRJA 3MBLA 3CGFA 4PX6A 4Q5HA 5AP2A 3IW8A 3ZM9A 1PXOA 1YHVA 2UVYA 5IDPA 5F95A 5KBQA 2YM3A 4ZTHA 3VJOA 1ZZLA 1Y57A 3KXXA 1YDSE 3TN8A 5IQHA 3SLSA 3OCTA 3C4WA 3DTWA 1W2FA 4M84A 1NXKA 4QP9A 3V6RA 3W18A 4KB8A 4ANMA 2V62A 5CAOA 4O2ZA 3F88A 3RPVA 3UIMA 1SNUA 3KK8A 1KOAA 2WTVA 4FG8A 4PMTA 4O96A 4U42A 4I3ZA 4UB7A 4BDKA 4ZY6A 3MJ2A 2BCJA 2OF2A 1SVGA 4AAYA 5IDNA 3BLQA 1WVWA 3WYYA 2Y4IB 3COIA 5HE2A 1TZDA 3RAIA 5AADA 3O50A 2WIHA 1RDQE 5E8ZA 2ZM4A 5HU3A 4U97A 4PF4A 2VWWA 3BLHA 3B8RA 5DOSA 4BN1A 5LXMA 4CGAA 3A7JA 5BVFA 1ZLTA 4XLVA 2ACXA 3BBTB 3U87A 2BILB 3PA4A 1FVTA 2XCHA 4WBOA 3CGOA 2PUUA 4RJ8A 2PVYA 4BCJA 2X1NA 3U6JA 4YC8A 2J51A 2HZ0A 4I20A 3IGGA 4MD9E 4DTAA 3JYAA 3FDNA 4RGJA 2GS6A 1KWPA 3U9NA 4UZDA 2VZ6A 2GHLA 4YJOA 4AU8A 3ZDIA 3CLYA 4C2WA 2OLCA 2XNPA 4RWJA 5KKRB 3VBXA 4AZVA 4NJ3A 2HENA 3F5GA 1XH7A 4RT7A 2XM8A 2BRGA 2E9VA 5LOHA 3QTIA 3D94A 1FGKA 4UWCA 4X3FA 4Z16A 3BGQA 1WZYA 3ODZX 4MNEB 3RGFA 3ZONA 2WMXA 3IW6A 4QMNA 4BCIA 2W1GA 3QA8A 3KREA 3VUTA 4HJOA 2UV2A 3DU8A 4C3RA 4UALA 2OJIA 4G16A 4NW6A 5CEIA 4ZZNA 3FMMA 5F20A 3VQUA 4AE9A 3C4FA 4FKUA 1PXJA 1A06A 4S2ZA 2R3GA 3LW0A 4RLKA 4BY9E 1ZY5A 2VX0A 3KMWA 1O6YA 4NKSA 4U5JA 1ZWSA 5E90A 5FM3A 4D55A 2G1TA 5AUTA 5HTIA 4CEGA 3PVUA 5K5XA 2G2IA 3QD4A 3POOA 4ZLYA 2HY81 2IZUA 4OAVB 4WD5A 3VBYA 3HV7A 3R02A 3DKFA 5E8WA 3ZRKA 5CNOA 4Y73A 4EOOA 3L8SA 2WTDA 5KX8A 5IG1A 3LXLA 4D4SA 4XH6A 4EH9A 3NUPA 4MAOA 4BGQA 3CJGA 4WHZA 3MVMA 4F1OA 4B99A 3UYTA 4L3PA 3BHHA 2WMTA 3PY3A 3LLAA 2HCKA 3U54A 3PJ8A 4AUAA 3HP5A 4BI0A 4O0TA 2QO7A 5KO1A 1RQQA 4MWHA 4CT1A 5LVPA 2OF4A 4X6RA 3UZRA 2O63A 2JKKA 3NIEA 5AJQA 4NSTA 3P5JC 4X2FA 4DTBA 1J3HA 4TNBA 3DGKA 4RIYA 1YOJA 4PL3A 4IJPA 4Q2AA 4FUYA 2XIXA 3NW5A 3QU0A 4DAWA 1EH4A 4EJ7A 3KN6A 5H8BA 4F0GA 4QNYA 4AA5A 4BR3A 4B8MA 4YTCA 4XEYA 5BUEA 2XRUA 2UZUE 4X7QA 5D9HA 4JBPA 4JQ8A 4FOBA 4L46A 1T46A 4DG2E 3C0GA 3EB0A 3QZIA 5AR3A 4CMOA 3Q9YA 3FZRA 1LUFA 2E9UA 3MVHA 5EKOA 3VS6A 4C4HA 4LRKA 4U40A 4O7YA 4I93A 4BL1A 1TQMA 4AW0A 4NM7A 3KXMA 5HLWA 1M2RA 2DS1A 1Y91A 2J5EA 3TNIA 2FO0A 4JX3A 4DT9A 5M09A 4RVMA 3W33A 5L6OA 4ANQA 5HNIX 5AR2A 5L2TA 3E93A 4CFMA 5IUHA 3HL7A 4UMPA 4L7FA 2VU3A 3A7FA 3KRJA 4I4EA 4AXCA 4ZP5A 4E4XA 2XKDA 3E92A 4D0WA 1Z9XA 2GHGA 3V8WA 3W10A 4EC8A 4QMXA 2BDWA 4GFMA 5DT3A 4AZTA 4HVHA 2BZKB 2QLQA 3L8PA 3H9RA 4I5MA 1Q61A 3G6GA 4ZTMA 3OBGA 2W1HA 4FJVA 3LJ1A 2OFVA 4XOZA 4K6ZA 3GGFA 5E91A 3R7UA 4H1JA 3VW6A 3FQSA 3BQCA 4J8NA 4MD7E 3VO3A 1Q5KA 3BX5A 3GC9A 3NAXA 4CTCA 2RFEA 2VTRA 2CDZA 2YDIA 5L2SA 3LFDA 1OKWA 3G0EA 4R8QA 2PTKA 3DBCA 3MY5A 4MH7A 5JZNA 5ETAA 1ZYDA 3RALA 2OU7A 1JKSA 1NVQA 2V5QA 3LZBA 3F3WA 3MPMA 3CCNA 4O1PA 3ROYA 5M53A 4PTCA 5AAEA 2VNWA 1SVHA 2FVDA 5DT0A 4QQJA 4EH5A 2W1FA 4IB1A 4E5BA 4TXCA 1OBDA 3GCUA 2PE1A 4FV3A 2IZSA 4E4MA 3R1QA 5DRBA 4AFEA 5GIOE 1R3CA 4U8ZA 3AT4A 5T6KA 3SHEA 3R9HA 3IPHA 4E73A 5IMXA 1BMKA 4D1SA 3NRMA 4F0IA 1LEZA 4K2RA 3E8DA 5ANIA 5GJGA 1FMOE 4XUFA 3PFQA 2V7OA 5HE1A 5HBJA 1K3AA 4IQ6A 4LMUA 2NYAA 4DGLC 1H28A 3AD5A 4ONAA 4DC2A 4O7RA 4QNAA 4XP2A 5HG7A 5H9BA 2R3NA 2RFSA 4ASXA 5IZFA 4TTHB 4WNMA 3AC5A 2RF9A 5CVFA 2GSFA 5EHYA 3EJ1A 2W5AA 4EUUA 4C2VA 1VR2A 2AUHA 4IE9A 5LCJA 2EXMA 2BVAA 4K1BA 3PLAE 2GNLA 2ZV7A 4TZRA 4KIPA 4ENXA 3VWAA 1R0PA 4PPCA 3OWLA 2JFLA 1PMEA 3G6HA 5CQWA 3W1FA 3WI6A 4M69B 2QKRA 3RVGA 4AN3A 3TNPC 5I9XA 1H1RA 1IASA 3OTVA 4RWIA 4DG0E 3QC9A 4GMYA 4JT3A 4OBOA 3FMDA 2WU7A 2YIXA 2PMNX 2W5HA 3W0RA 2R3IA 4QMLA 5HO6A 4C59A 4MNEA 5HKMA 4CRSA 2OWBA 3NYVA 3VS1A 3IW7A 5CF6A 4JDKA 5KMKA 3MN3A 4HCTA 3LFAA 3AKKA 4YZMA 2W4JA 2BDJA 3T8OA 4Y8DA 3W16A 5AX3A 4D9TA 2PZRA 2NNWB 4FV6A 2XKFA 2XALA 4O0SA 5HEZA 2CKQA 1WVYA 1WMKA 4ZTRA 2SRCA 2VUWA 4RJ4A 3O96A 5E8SA 4BCFA 4Y85A 1I44A 1OL6A 4X2NA 4RQVA 1IA8A 4I4FA 1E9HA 4ZMEA 3FKLA 5FTGA 3EL8A 4AQCA 3ZUTA 3OXZA 4FT3A 2P2IA 3ORMA 5H2UA 1OPKA 1B6CB 2XCKA 3KN5A 3O0GA 4FMQA 3UBDA 3EKNA 3V3VA 4F70A 5JFWA 3PWDA 3C5IA 3EZVA 3QKLA 4FTQA 4TRLA 3AT2A 3HYHA 2YISA 4FTLA 4MBIA 3RNYA 3PG3A 5IA3A 3TUBA 4LL0A 2J0MB 2BRHA 5KKRC 4U79A 4C4FA 2C6IA 2VTTA 3IG7A 3PSBA 4W4VA 2B7AA 3H4JA 4H58A 1JKKA 4IFCA 3BYMA 4DH7A 4NTTA 2PMOX 4N70A 4FTCA 4FV4A 3ZO2A 2NRUA 5BMSA 1GZ8A 4G1WA 5I0BA 3BWJA 3QFVA 2CN8A 2XNNA 3CEKA 2QOHA 2ZYBA 5A14A 3AC8A 2F7XE 4C35A 2GNJA 4JDHA 5L6PA 3CTHA 3V8TA 1BI8A 3OUNB 5IQAA 5HVKA 2WTWA 3GU8A 1P4OA 3K54A 3ELJA 2IW8A 4KIOA 4BKJA 2J7TA 4O0XA 4RX8A 5K0KA 2PZ5A 3QX4A 4Z7GA 3CQEA 2PMLX 4I0RA 2IO6A 1TQPA 2VTIA 5DMZA 4O83A 4BDEA 3D5WA 1G8KA 4R7HA 2W9ZB 3A7GA 5FGKA 5LVLA 2VAGA 4BIEA 4BYIA 4LYNA 4I1ZA 2J0IA 4H1MA 4O7VA 3DA6A 4G3GA 4EI4A 3O17A 2H34A 4YHFA 3C13A 3QZFA 2UW3A 3IOPA 2HW6A 2UZDA 2H96A 5CU6A 3DOGA 4QOXA 2FA2A 3MDYA 2JFMA 3NCGA 3NCZA 4A4LA 1GIJA 3DLZA 3DNDA 5FRIA 4GYGA 4AA4A 2W1CA 3LQ5A 4EZ3A 5CF5A 4CFUA 2ZAZA 1Q8UA 2GDOA 2ITUA 3F5PA 1CKPA 4FF8A 3CD8A 4K77A 3V5PA 5A54A 3HMIA 2BDFA 2VWUA 3SC1A 1OPJA 4ZEGA 5CEQA 5A4TA 2P0CA 5CAVA 5CENA 2W17A 2HK5A 5FXSA 2JC6A 2IJMA 3CS9A 3FY0A 3L9PA 4O21A 1UWHA 3VS5A 5IMEA 3OOGA 4JVGA 2YCRA 5JGAA 2H8HA 4ACCA 2OG8A 2WEVA 4IAAA 1ZMUA 3CXWA 3RM7A 4NUSA 5F94A 3LFQA 1AD5A 3Q9XA 3QQHA 4HYHA 3BRBA 2GQSA 4ERKA 3FYJX 4K8AA 1V1KA 3EL7A 5D10A 5CZIA 3ZZ