1BKXA

A binary complex of the catalytic subunit of camp-dependent protein kinase and adenosine further defines conformational flexibility
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
339
structure length
337
Chain Sequence
QESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE
publication title A binary complex of the catalytic subunit of cAMP-dependent protein kinase and adenosine further defines conformational flexibility.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (phosphotransferase/adenosine)
total genus 88
structure length 337
sequence length 339
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 1997-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1bkxA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1bkxA02
4C33A 2J0JA 2HY81 5DRDA 5KMKA 3ZCLA 5IPJA 2IPXA 5A14A 4WUAA 2XJ2A 2VTTA 5LMKC 1FMOE 4KIQA 3HGKA 4KKHA 1TVOA 4FTRA 5EW3A 3TTIA 5IUHA 3UG2A 3RK7A 3W55A 4XX9A 5IQHA 3CJGA 3EFKA 2YHVA 3OF0A 3RVGA 4LMNA 4BCIA 2CCHA 4OT6A 4GH2A 3COKA 5T6KA 5KMNA 2R3RA 4FTQA 2JC6A 4B0GA 4IAFA 2CGVA 2WTWA 4LQMA 4N6YA 3WZUA 4CGAA 4FODA 4C3PA 3EZRA 2PE2A 3FDNA 3E62A 5E8TA 2JGZA 4L3JA 1Q3DA 2R9SA 4MD9E 4BCQA 4BBFA 5IU2A 4O82A 2XK7A 3CKWA 4KD1A 1XQZA 2YM4A 4O0TA 1YQJA 2C6IA 4FICA 4YBKA 4FV1A 2GFSA 2PVLA 4GW8A 2NO3A 2WO6A 3H4JA 3KB7A 4RLLA 1DAYA 2WTVA 3D4QA 3GT8A 1H1RA 4HZRA 2UZVA 4JJRA 2FSTX 4IZ5A 4RIYA 4Y5QA 4FOCA 2HYYA 3UP2A 4AZEA 4CKIA 4EYJA 4C62A 1XBAA 5J9YA 2WQMA 4CZTA 1OIUA 4TWNA 2HZ0A 2XNOA 4HYUA 5HVJA 5BPYA 2VTLA 4CLIA 4RWKA 1ZYLA 4X2JA 4BGGA 4C8BA 5HVKA 3LXNA 4BDKA 1G3NA 4HYIA 3RALA 4FEXA 3R73A 4IW0A 2HXQA 5H3QA 4F7LA 4LGDA 4C59A 2PE1A 4FSQA 2BFYA 4KINA 4AQCA 3AOXA 3UIBA 2UZWE 3MIAA 4XG2A 5I9UA 4AAAA 3RPVA 3F82A 4KBKA 3RPOA 3NAXA 4HCTA 5E8XA 5EOLA 5AADA 5I9WA 5A4QA 4TYGA 4E5AX 5IA4A 4P5ZA 3FPQA 4BGHA 4O2ZA 5ETCA 4G9CA 5HBEA 5CSPA 4FKTA 3FV8A 2VTHA 4R1YA 2PUPA 1FGIA 3C13A 2W1FA 3W8LA 1ZXEA 3JPVA 4WG3A 4OUCA 2GQGA 5D10A 2UZBA 4JQ7A 5DI1A 2VWZA 3T9TA 3WE8A 4XLIA 5KCVA 3ZTXA 1ZYCA 3DXNA 4O27B 1U46A 1XHAA 3KGAA 4KIPA 5CAQA 4G3CA 3MTFA 4DEDA 5JSMA 5HD4A 4CRSA 3CR0A 2BUJA 4JDJA 4EUUA 2ITTA 4M12A 3QCXA 4K0YA 3HUBA 2BDJA 4YJQA 3IDPA 1HCLA 2YAAA 4FZDB 1OIYA 4M66A 4AFEA 4PP7A 5L8KA 4BCJA 4F1OA 4RVMA 3U9NA 1LP4A 3HMNA 4KSQA 2XMYA 4U81A 1R39A 4Z9LA 4G6OA 4IE9A 5HG9A 4ACGA 4EI4A 2A19B 2EXMA 4AGCA 4XV2A 5EYDA 5K5NA 4CCUA 3OS3A 4RIYB 4O21A 4BRXA 4GCJA 2XKDA 3BLRA 3A8WA 4YLKA 4F9CA 2GQRA 4ZJIA 3BHVA 4EHVA 5EW9A 3QRKA 4FTKA 3DAEA 1YHSA 2F7XE 2ITZA 2QOLA 3GC9A 3QTRA 1ZY4A 4F7JA 4FSWA 3QYZA 4Y5HA 3RJCA 5JFXA 3KC3A 4KKGA 3ZO4A 4XNEA 4QQCA 1S9IA 2CGXA 1E1XA 3F5PA 5HQ0A 2ZMDA 2W5AA 4D58A 3JXWA 4R7BA 3QA0A 4QMLA 4GUBA 3UIMA 4R5SA 3FWQA 1A06A 3HRFA 3MSSA 3R1SA 5LVOA 3FEGA 2WMVA 4JX3A 3QQHA 5HCXA 1ZMVA 4B9DA 4HZSA 4GVJA 3LCKA 5JT2A 3OUNB 2NPQA 4YJVA 2ZDTA 4IEBA 5E8VA 2VRXA 2Z7RA 5HO7A 3ZFMA 4AX8A 4OGRA 4FT0A 3AC2A 4AW0A 4D5KA 2G9XA 3BZ3A 3GXLA 3AC1A 3JY9A 1A9UA 1R3CA 4JDKA 4NJDA 3BU3A 1JSUA 2CLQA 1WZYA 2YM8A 4IIRA 4Q5HA 4ALUA 5L2TA 2JLDA 3ERKA 2XRUA 4F0IA 5DR9A 5L2IA 4J8MA 3EWHA 4G3FA 2BVAA 4CNHA 2OG8A 4ZY4A 2XM8A 4P4CA 1GIJA 3LJ0A 4OAVB 3I7CA 5CX9A 3M11A 1Y57A 1YDRE 2IO6A 4YMJA 3SAYA 3BRBA 4G3GA 4IHPA 2C6OA 1VZOA 2X6EA 3MVLA 4FYNA 4OW8A 5AIKA 3TI1A 3RWPA 5DN3A 4ONAA 2YABA 1FVVA 4J99A 4PPCA 3NUXA 2F49A 2IZTA 2XEYA 1H1WA 5IKWA 3D5XA 4FT7A 4JG8A 5EI2A 3S2PA 5KKRC 3T3VA 3DV3A 2ZV8A 3FUPA 4KA3A 3GU5A 4XCUA 4IX5A 4DG0E 2ITWA 5E4HA 3F9NA 4S32A 4I5MA 1F0QA 2R3QA 3IGGA 4ARKA 4WT6A 2R3MA 2Y9QA 2W1EA 4TYEA 5EG3A 3OXIA 2IVVA 3OUKA 4PNKA 4YC6A 2R4BA 2X6DA 4R7IA 5H8EA 1NXKA 3FLYA 4ZSEA 2XBAA 2PZ5A 3O51A 4RFMA 4RZVA 3L8XA 5M08A 1YKRA 3AG9A 3R8VA 4FKOA 4LL5A 4UX9A 4BCPA 4EKLA 3H9FA 4KAOA 4DYMA 2UW3A 3UIUA 5B0XA 4O2PA 2FA2A 1SVEA 3N4TA 3BGPA 5G6VA 3FZTA 4E73A 2QHNA 2A0CX 3OROA 4L68A 3AT4A 3EKKA 4UXQA 3NPCA 4HW7A 4ZZNA 4L67A 5A4LA 4Y73A 4J98A 4FKQA 3BLQA 2C6TA 5BNJA 5J1VA 2BALA 3C4CA 3KXMA 5BVDA 5IA2A 5KHXA 1ZMWA 2OGVA 3VS0A 4YTCA 5C8NA 3E3BX 3O96A 3DAKA 2YAKA 3D94A 3RPSA 3FYKX 4FMQA 4Z55A 1PYXA 2QR8A 3IONA 4DEBA 2O3PA 3QUEA 2WIHA 4YTFA 4QYYA 3I79A 3RM7A 4QT1A 1OKZA 4F0FA 5FLFA 2WQNA 5C4LA 3HAMA 3MDYA 2BCJA 3D2IA 1YI6A 2VD5A 2XK8A 4TYHA 4ACHA 1QPDA 2CN8A 3H0ZA 3EN6A 4IC8A 3ZFYA 3PXZA 4IMYA 4TXCA 4U80A 3Q96A 4NKAA 4A9TA 1R0EA 3ZO2A 2XNNA 3LXLA 4WNOA 1OPLA 2X4ZA 2C5YA 2J0LA 1OGUA 1QPEA 2C5VA 3VS5A 3C0IA 1YXUA 4A4LA 3Q9WA 4JG7A 5EQEA 4QMUA 3IPHA 3BU5A 3N51A 4K1BA 4AE6A 5CXZA 2AYPA 5EQPA 1KUTA 1MP8A 2GHLA 5CT0A 5BVWA 4DLJA 5AWMA 5IISA 3AD4A 2W4KA 3PG3A 3CQUA 4YLLA 1NVRA 1PHKA 5JQ5A 4NM7A 4C4IA 1JAMA 1R78A 1Z57A 3LLTA 3PLSA 4FIGA 4IB3A 4RX7A 3L9NA 4PDPA 1Q99A 5FQDC 4PWNA 4XRJA 4A4OA 5EYKA 1ZWSA 4D1ZA 5AA8A 2W17A 3QTSA 4H3QA 5CAPA 3FHRA 2DUVA 3LQ5A 2F2UA 5AP1A 4F70A 2I7QA 4TKSA 4B99A 5C03A 3C4EA 2QOOA 3A8XA 4X0MA 5HI2A 5LARA 3GC0A 2WTDA 4U44A 3OCGA 3VS4A 2GS2A 4XP3A 3UOLA 1XH6A 5B2LA 4F09A 4ZLZA 1ND4A 5HLWA 4OTIA 5CWZA 1OM1A 3E7OA 2IZSA 1OL6A 4JI9A 3MVHA 3MH3A 3QKKA 4RRVA 4U7ZA 3WYYA 2NNWB 2WMSA 4QD6A 4UWYA 4F08A 2AC5A 3GUBA 2E9OA 5EW8A 2H9VA 5I9YA 5J5TA 5JZJA 3P9JA 1UU8A 3OFMA 4DN5A 3R7GA 4BCOA 2YM6A 4MD7E 1U54B 5AJQA 4CKJA 4QMXA 2CCIA 2PZYA 3ORZA 3JVRA 3L8VA 3RPRA 4TYHB 1WBWA 5ANEA 3GQLA 4RVLA 2XIKA 3A7GA 3KXZA 3OZ6A 4OTPA 5LWMA 2WKMA 3R8MA 3RHXA 3TIZA 3MY0A 3MJ1A 4C4JA 3ZBFA 2ZV2A 3D5WA 4RGJA 5J87A 3V5PA 4LRKA 1Q8YA 2VUWA 5TT7A 2YDIA 5BX0A 3S1HA 1PJKA 3UQCA 4JXFA 3HP2A 4BBMA 2WMAA 2XNEA 2J0MB 4ITIA 3WZEA 1JOWB 2JD5A 3BBWA 3KN6A 3QGWA 3PVUA 5D7AA 4YU2A 3DPKA 3R9OA 1OBDA 3PZHA 1ZOEA 3F5UA 5C9CA 4X3FB 3V5QA 2WQBA 5EYCA 2XIRA 2GSFA 1OPKA 3BELA 5LMAA 2UZEA 3DQXA 4ACDA 5T68A 4FKRA 3AQVA 3DBEA 1CM8A 2ZOQA 5CZIA 2XKEA 4LMUA 4YLJA 5DPVA 5FG8A 4IAKA 4PMPA 3PDTA 5IQEA 3QC4A 3VO3A 3QL8A 1PKDA 3KL8A 4O81A 3NR9A 5JQ8A 4FKJA 4BTFA 4M97A 2BR1A 3ORPA 4MQ2A 4NEUA 5AR2A 1Q61A 2OXDA 4N70A 3W32A 1XH8A 5CZHA 4YO6A 2XK3A 5AP2A 2B9FA 3HEGA 2FH9A 3ENMA 4YJRA 2A1AB 4RJ6A 2W05A 2BMCA 4FG7A 4O96A 4RC3A 4W4XA 3UGCA 1CMKE 5C27A 1MUOA 5M4UA 3EQRA 3TV4A 5JGBA 1ZAOA 4ITJA 3LJ2A 2JDTA 5CSVA 4Y8DA 5CENA 2IZRA 3GFWA 3OBJA 3PIZA 2VX1A 3PVWA 4LUDA 5J79A 3S00A 5D1JA 4I1ZA 1Q97A 5HCZA 1QCFA 3UC3A 4QPAA 2VAGA 3F3ZA 4I92A 4BKYA 2BAJA 4XBUA 4C2VA 4CV8A 3FLSA 4A07A 3R21A 2JAVA 2C3JA 3R7UA 4IH8A 4UB7A 4LGHA 4CV9A 4DTKA 1Q8ZA 2ZB0A 4U45A 5M55A 1FOTA 2R7IA 1U59A 4QMWA 4HVHA 4D0XA 4D2TA 3OW3A 4JAIA 5BYYA 4Z7GA 3CQWA 4EOJA 2RFSA 3NNUA 1KV2A 3IQ7A 3CTJA 4FK6A 4BVUA 4EOLA 3EFJA 3SKCA 3U6JA 3E8EA 5DHJA 1NVSA 4ENXA 4L52A 5CI7A 4YTHA 4JNWA 5CYIA 2JDOA 2W4OA 4UMTA 4F64A 1H0VA 3MPAA 3QX4A 4AE9A 2IG7A 4EH7A 3FMLA 1J3HA 1WBOA 2WIPA 4IACA 4IC7A 4H1JA 4J52A 2ITUA 2UZNA 4QOXA 4DCEA 4TWOA 4YR8A 4XOZA 3CQEA 2WOTA 4L6QA 1O6LA 3K5VA 3A60A 3EOCA 3PIYA 3R6XA 4N0SA 4FT9A 2XIXA 3MGYA 5DH3A 3F2AA 3KULA 2Z2WA 4ZTHA 4ERWA 1M2PA 3VUTA 2IVUA 1ZZ2A 3ZYAA 4QTEA 3CTQA 2VWBA 3FY0A 2C1BA 3PE1A 3UMXA 3O7LB 3KCKA 3R02A 2VWIA 4NSTA 3TUDA 3FYJX 4EC8A 2VWXA 5FEQA 5IA3A 1J1CA 3PJ1A 5FBOA 2XKFA 3DJ5A 3KK9A 1H07A 3FSKA 5AM6A 2Y4PA 1YXXA 3C50A 2UZTA 5ETAA 4PNIA 4DEEA 4USEA 2P4IA 4LOPA 4BWXA 2W5HA 3QALE 1WBNA 1S9JA 4QMPA 3PRFA 2QG5A 5AAGA 1PXLA 5IH4A 2BZKB 3WOWA 3G90X 2W99B 4BBEA 5L8JA 3WIKA 1P2AA 3NW7A 4RPVA 3U9CA 4DGMA 2P2IA 4RJ4A 3RCDA 5KMJA 4OTGA 2BHHA 2PZPA 3EQBA 2BROA 3ZO1A 5I3OA 3R7EA 5CF4A 4GRBA 4H05A 1K9AA 1NY3A 3TKIA 3V51A 1PW2A 2Q0NA 4F9WA 4ZAUA 5DE2A 3VBQA 3GCVA 3NVMB 5B2MA 4FIHA 2XCHA 3PSBA 3LLAA 3VQUA 3WIGA 4BC6A 4P2KA 1PMEA 5HZNA 5H2UA 5IZFA 3HYHA 2V55A 5HO8A 4E5BA 5KO1A 1XH5A 3ZSGA 4O7RA 5IH6A 3QWJA 3DNEA 3POZA 3SGCA 2RF9A 2CGWA 3MWUA 3HDNA 1PMNA 3LFNA 1PY5A 2W9ZB 4K18A 4RJ3A 4HVDA 3UO6A 3ATTA 1M2RA 1Z5MA 2KULA 2G2HA 4G3DA 2R3FA 5EQYA 4U0IA 5CTPA 4U6RA 3SW4A 2DQ7X 3MH2A 2ZAZA 3DBQA 3TM0A 2WTKB 1PMUA 3KF4A 4TNDA 5GZ9A 5HG8A 4W4WA 3O2MA 2X39A 3VRZA 2C0TA 4R7HA 5J1WA 3NCZA 4AZWA 4ZLOA 4DFLA 4F63A 4FVRA 4I4FA 4MNFA 2W06A 2FUMA 3DB6A 4O0WA 2C47A 2FO0A 4Z16A 4J53A 5HNGA 3DTCA 1ZY5A 4RG0A 2ZM1A 3BBTB 4P5QA 5AUWA 2YIYA 4C4GA 4MXZA 4YSMA 4YJUA 3TIYA 5IQGA 3M42A 3TZMA 4DGGA 3BX5A 4BIBA 3DU8A 3BYVA 4UY9A 4TW9A 2OIDA 3PWYA 3COIA 1YI3A 4IXPA 3UOHA 1STCE 4BDHA 5LVLA 5GHVA 3CTHA 3L9LA 3OTVA 4AF3A 3D5VA 3QQLA 5D12A 3SA0A 4USDA 3HP5A 3NGAA 2ITVA 2X4FA 3FMHA 2C3LA 2QD9A 3LFQA 4FGBA 3QQKA 3HNGA 3LOKA 4F7SA 4XV9A 5DR6A 3RAHA 3R9DA 1Q3WA 2UW0A 1BMKA 2PZRA 4ZZMA 3ZZEA 5GZAA 2OH0E 3KXNA 2WPAA 4M7IA 3Q6UA 5ICPA 3E8DA 3VVHA 3IECA 4L46A 2W1DA 3PTGA 2ITOA 1YVJA 4BKJA 2Z02A 3JUHA 3WF8A 1AD5A 1UVRA 2IW6A 3K2LA 4ZLYA 4Z7HA 1BI8A 1UNLA 2QG7A 3MB7A 4FNWA 3EQPA 3QFVA 2F9GA 5EI6A 3KK8A 4UZDA 5GIPE 1XJDA 4HPTE 5CEKA 3KN5A 4C61A 3ZLWA 1B39A 1G8AA 3SX9A 3FL4A 3MY1A 3LPBA 1ZRZA 2PL0A 1EH4A 4FNXA 2QOIA 4XG4A 3PPKA 4PX6A 4ASEA 3B2WA 3G51A 4QQTA 2W5BA 4D9UA 4CFUA 5DWRA 1NA7A 3C0HA 4PTEA 3CD3A 2ETKA 3LCTA 3PA5A 3WARA 4B8MA 3K54A 1SVGA 2AUHA 2FGIA 5ANGA 4FEUA 4FGRA 4FF8A 4FKSA 4BZOA 3R7YA 1A48A 1RDQE 2YWVA 2WMRA 1JKSA 1OB3A 1ZARA 5FTQA 3TZ7A 2J90A 5CF6A 2HW7A 4OBOA 1JPAA 2I6LA 5AIRA 5A4CA 4ID7A 3PXQA 2QO7A 4YNOA 4O0VA 4O7NA 5EDQA 3Q2JA 5JGAA 1PYEA 3P7BA 4X2GA 1UU7A 1KE8A 3DLZA 4HVSA 1UWHA 4BZDA 4DEIA 2CHLA 4JBPA 4EBVA 5ANKA 4EH6A 1M14A 2RKUA 3HECA 3GP0A 2WOUA 3PA3A 4MVFA 4NKSA 4ZSGA 2E9NA 4ANQA 2FSLX 4FEVA 4NH1A 3V6SA 2XRWA 4I6BA 2YJSA 3MW1A 1JKKA 3ZMMA 4QP3A 4EKKA 2BKZA 4DBNA 2YJRA 1CKIA 5L2SA 2YWPA 2G2FA 1V0OA 4UWBA 2O65A 3BQRA 3I7BA 2VO3A 2EB2A 3QXPA 4M0YA 2IZUA 4MK0A 4FOBA 4O83A 4BZNA 4K11A 5LVNA 2UW7A 3OOMA 3QRTA 4EEVA 2GDOA 4X2NA 1MQ4A 4Q5EA 3ZXZA 4BDIA 3RHKA 1W84A 1FMKA 2FYSA 4IB5A 4WHZA 4DTBA 2B55A 3U4WA 2YM3A 3T9IA 3E8CA 4LV8A 5LJJA 3O0GA 3RBWA 3O8PA 2HK5A 2Z7QA 5DG5A 3I0QA 2YN8A 3KXXA 4FV5A 3F2NA 1WBVA 3A61A 5AP3A 4DFXE 4C02A 2QNJA 3CD8A 3QTIA 4I23A 1OPJA 4IDVA 4QMMA 4Q9ZA 3LMHA 2ZM4A 4GIHA 2BRBA 1FQ1B 4IVBA 5CSHA 5TOZA 4OTWA 4ZP5A 3EQCA 5ETFA 3PYYA 2PHKA 4PDYA 5ANIA 3ZU7A 5JRQA 2OLCA 4ZY5A 1NW1A 3SV0A 3LE6A 4DINA 1XH7A 3IDBA 2ZMCA 3CPCA 4FTIA 3VULA 4AZVA 5E8ZA 3DK7A 1ERKA 3HV6A 4GG7A 4RJ5A 4EOPA 5AA9A 4E4XA 4FYOA 5CU4A 3D15A 4M3QA 3EQFA 3R8PA 4EK4A 3SDJA 4QMNA 5HO6A 5JFVA 1OITA 2GNHA 2ZB1A 3EFWA 4HCUA 3UNKA 4N57A 4W8DA 2YLEA 3COHA 1JVPP 3LFBA 4RVKA 1XH4A 2WAJA 3RWQA 4O84A 4YURA 4L45A 1K3AA 3KCFA 3LW0A 3GENA 3QRJA 4PPAA 5CVGA 4AOIA 4G16A 4OBQA 4ZS4A 2HXLA 4C0TA 5AUYA 3I6UA 3ACJA 3ANQA 2OU7A 1WAKA 3EZVA 3PXRA 5AUUA 1SNUA 4JDIA 3TTJA 1YWVA 2ITNA 4FI1A 3QKMA 5DOSA 5LCJA 4GT3A 4ZTMA 4FTAA 2I0VA 1OECA 3R7VA 3FMNA 1YXSA 3GU4A 5HTBA 3PY1A 4FTMA 4QP8A 3T8OA 4YJSA 3UQGA 4M8TA 4FG9A 3R7IA 5L6PA 4UEUA 4IAZA 2QI8A 3I60A 4BTJA 2CKOA 3EQHA 2VWYA 4JOAA 5AUXA 5JK3A 5IQCA 2JKOA 3D9VA 3NUYA 2GTMA 2VWUA 2BDFA 3KU2A 4G6LA 4HNIA 4HYSA 4FNYA 3HMPA 3NMUF 2WHBA 1G8SA 3PXFA 2PVMA 5K4JA 5CASA 3VW6A 4QP4A 3LM0A 3EFLA 4EK3A 4GKHA 4JRNA 2ITXA 1FVTA 4X3FC 2YA9A 3TKUA 3RZFA 5CNOA 2E9UA 4WA9A 2BHEA 4MAOA 1PF8A 3F2RA 4FKWA 1H24A 2EXEA 5CANA 3O8UA 4QMSA 1OL2A 5CEQA 3Q2MA 4XG8A 2J6MA 3RK9A 4PQNA 4S2ZA 4ZSJA 1WBPA 4U43A 3AC8A 4FL3A 3BWJA 2XNPA 3UQFA 2WTCA 4GU9A 4YC3A 3LFSA 4MQ1A 1NVQA 4AT5A 3CP9A 5DEYA 2RG5A 3GU7A 5KMLA 2HENA 4J71A 5I9VA 3V8TA 4R78A 3PXKA 4KS8A 4C57A 3PWDA 3JYAA 2X8IA 2WMXA 5HIBA 3FC2A 2XB7A 4JR3A 5F1ZA 3BWFA 3W10A 1W98A 3TDVA 2R64A 4O7YA 4W8EA 3E87A 3FMMA 4JDHA 4HGEA 4NTSA 2YZLA 4GJ2A 3TNWA 4JVGA 3R8LA 5AR4A 4I3ZA 2ZDUA 2JDRA 5HIDA 4WOVA 5M06A 2C1AA 2XIZA 3D7ZA 4ZK5A 3FC1X 4CTBA 1HCKA 1GZOA 4QP9A 4JS8A 2WGJA 2G1TA 3AC3A 2EXCX 3TXOA 5IMEA 2ZV9A 3KRJA 3QD4A 4AWIA 3Q9ZA 3R1NA 1P4OA 1T46A 4TL0A 3EB0A 1J7LA 4FV7A 4ZJVA 2WU7A 4JBQA 4AGUA 2XYNA 3IO7A 4IDTA 4CXAA 2I0EA 4PDSA 3V5TA 3FMKA 2PK9A 3QUPA 4JIKA 5AM7A 4NT4A 2FVDA 4Q2AA 3BQCA 3R1QA 4AN2A 3A7JA 2OF4A 5TKDA 4JLCA 4U5JA 5K4IA 3Q4TA 5CLPA 2R0UA 5EOBA 2JFMA 3DBCA 3IW5A 1OUYA 4FL2A 4FTTA 4QO9A 4Y83A 4YZNA 2VNYA 5GJDA 3TZ9A 3QD3A 4ENYA 4EH2A 3P08A 5AFVA 5DIAA 4DHFA 3BPRA 3EJ1A 5BVOA 4WD5A 4IZAA 3HV3A 4GG5A 3Q04A 4ZMEA 4G17A 5HHWA 4MEDA 4WKQA 4EOQA 4TT7A 3VBTA 5L8LA 5M44A 3ITZA 4ACCA 1TKIA 3PJ3A 5EM7A 4IANA 2JIIA 3DFAA 5I4NA 4EQCA 4L00A 3FJQE 2UZDA 3ODZX 5CT7A 2GCDA 4MF0A 2XYUA 5AAEA 5IF1A 5LQFA 5D7VA 3DFCB 1KE5A 4D28A 4F99A 4BTMA 3LXPA 3MVMA 5AUZA 4O1OA 4EYMA 5E8YA 5EM5A 2REIA 3FMDA 3R83A 3DKGA 5AV1A 4RBLA 4RSSA 3P7CA 4APPA 3DXPA 5IH5A 3P79A 3UOKA 3A7FA 2OF2A 3RM6A 2VTQA 3EYGA 4O38A 3P78A 4DH1A 2ONLA 4BCKA 3DDQA 4RLKA 5A4TA 1GZKA 3EL8A 1LPUA 2QHMA 2X9EA 3C4XA 4F0GA 2OFUA 5CY3A 4RIWA 3QHRA 3R8UA 5HVYA 4NW5A 1DS5A 5BVKA 4EK6A 4F1TA 2XP2A 4DEGA 5FRIA 3DS6A 3LFAA 1GAGA 3IW4A 2R3HA 3JVSA 3ETAA 3GOPA 4YZ9A 4X21A 4NIFA 3OCBA 3KQ7A 5EHLA 2BRGA 2G01A 3BIZA 5EH0A 1YOMA 2WMTA 1JBPE 2VTPA 4I5HA 4O22A 3GCUA 4R3PA 3F5XA 5AP4A 4I5CA 4WO5A 1UA2A 4X2FA 5DT3A 3NVKI 1U54A 4MF1A 4XG9A 3FLNC 4QTCA 3LHJA 3ODYX 3TUBA 2HZNA 2Y4IB 4O91A 1OIRA 2YM5A 3DDPA 4I24A 2OJ9A 3HL7A 1WBTA 4V05A 3CS9A 4YSJA 3EH9A 1JKLA 3FZOA 4S33A 2P2HA 2XH5A 3ZDUA 2PUUA 1OUKA 2WTKC 2IW9A 4BDEA 1LR4A 3MA3A 3DK6A 1GOLA 3LCDA 5JZNA 4QMOA 3LFCA 3C1XA 3F7ZA 3C4ZA 3ZH8A 4C58A 4C2WA 3P4KA 1SMHA 4X3FA 4IWQA 4C7TA 1T45A 4DG3E 5CAVA 4CYJA 4CFMA 4E6CA 2CKQA 2JIUA 3FMJA 3BLHA 5TR6A 4AGWA 4FV4A 3ZLYA 4RIXA 1UNGA 4WSYA 4D0WA 5KHWA 4ZZOA 1Y8GA 4I0TA 2BAQA 3ALOA 4KWPA 3FQHA 2WTIA 4MBLA 5EHYA 3V6RA 3AXWA 4ZMFA 2ITYA 4ZTQA 4RIWB 2R3OA 2EVAA 1IEPA 3Q4ZA 5B7VA 3PSDA 4IVDA 3VBWA 3UNZA 2YEXA 4E3CA 2GNGA 4IFGA 4CQGA 1IRKA 2XS0A 1H00A 3ACKA 3I6WA 2B53A 2C0IA 2Z7LA 3M1SA 4NIFB 5HG5A 1YOJA 5I9XA 1BL7A 2Z60A 3MY5A 2UUEA 4LM5A 4YC8A 3CGFA 4PF4A 5J8IA 2HWPA 4FTOA 4OTFA 3MI9A 2UZLA 4ANMA 4RWJA 5BYLA 1OIQA 5AEPA 4O86A 3QZIA 5I9ZA 1CDKA 3RGFA 1Q8WA 3E64A 3H9OA 5M57A 5JRSA 1URWA 5CQWA 5JEBA 5DYJA 4YZCA 4KKEA 4A9UA 2CNVA 3MESA 3C9WA 2WTJA 4KBAA 5CI6A 4IM3A 5J9LA 4DTAA 5JH6A 4MNEB 3R63A 3UPXA 3I1AA 4U97A 5CU2A 5EI8A 5M09A 1OKYA 3E5AA 3QQJA 5M56A 1JKTA 2OJIA 1MQBA 3D0EA 3FXXA 4BI2A 4F9YA 2QODA 3PFQA 2UZOA 3TWJA 2X8EA 3NW6A 5CSXA 2CJMA 4JBVA 4QYGA 1J91A 3KXGA 4ANNA 4FKGA 4TY1A 1KV1A 3Q5IA 5EKNA 3EQGA 4FC0A 3W16A 3QGYA 4DEAA 4E93A 3SVVA 2YIQA 1XH9A 3IW8A 5KE0A 2GHMA 3Q32A 4RQVA 3OCTA 3PA4A 4MXAA 5CQUA 4XH6A 4CFWA 2GS7A 3P0MA 4CMUA 4DG2E 5DT4A 3IOKA 3PP1A 3GCSA 5C01A 3II5A 3SXRA 4AACA 5AP7A 4HNFA 4RIXB 4I21A 1W7HA 3WI6A 2VU3A 3A7IA 1FPUA 2UVXA 3OY3A 2X7OA 5A3XA 4NYEA 4R77A 2VNWA 3I81A 3L9MA 3TKHA 1WMKA 3ZLXA 2RFDA 3MPTA 3O8TA 5DFPA 3TJCA 2UZUE 3OT3A 4G31A 5M07A 3EIDA 3VUDA 4L42A 2UW4A 3KY2A 2CKPA 4GKIA 3ELJA 3FI2A 3FLQA 4K33A 4BDJA 2VTAA 3DGKA 2H8HA 4IB0A 3HV5A 1FINA 3UIXA 4A9YA 4F1MA 2V5QA 4QYFA 2VO0A 2WB8A 4F6WA 4YO4A 3C51A 4H36A 4IBMA 4LRMA 4R3CA 2OI4X 4MXCA 3CJFA 3QCYA 4C35A 2E9VA 3QQGA 4CFFA 4EOMA 2YFXA 4BI1A 4ZTNA 5E1EA 2O8YA 2I40A 4FX3A 3B2TA 3ZM9A 4RWIA 2X2KA 2AC3A 2BTRA 2RFEA 3HRBA 4BCGA 4GYGA 3TV7A 3LCSA 4WBBB 3NZ0A 1PXJA 3DZOA 3GC7A 3Q4CA 3R2YA 4GFOA 5CEMA 5EFQA 3UZTA 3RK5A 4NM3A 1E9HA 4OTQA 4A9RA 3C5IA 4QTBA 4UN0C 2F7EE 5HU9A 2B4SB 4EZ5A 3R2BA 2J50A 3VF9A 2WELA 1YWRA 3ZS5A 2H34A 5EHOA 4CZYB 2VTIA 3W2OA 3W1FA 2JAMA 1IR3A 2RL5A 1PXOA 3ANRA 3D7TA 3F69A 2WU6A 3MIYA 2PE0A 3CSVA 3SHEA 3B8RA 4TZRA 3N4VA 3AC4A 4D2RA 5DT0A 4C3RA 2XIYA 4J1RA 4ANOA 3PY0A 3ORXA 4DT8A 3UZPA 3MN3A 4NZWB 4WIHA 3R30A 4QPMA 4AW1A 2EB3A 5A4EA 5BUJA 2R3JA 4V0GA 5ETIA 3ORNA 4FZAB 5E1SA 3UG1A 5C4KA 2VX3A 2JBOA 4UZHA 5A54A 4HCVA 3K5UA 3SD0A 5M51A 4X6QC 2BIYA 2YACA 4XV1A 1OZ1A 4G2FA 3DY7A 3BU6A 4I5PA 4KRDA 3WF5A 4E26A 4EOKA 4J7BA 4WNPA 4D9TA 5IQFA 2ETRA 4YUQA 3DB8A 4B8LA 3D14A 3NAYA 3NWWA 4LGGA 4BDDA 3V5JA 2JKKA 3MFUA 5HESA 3SOAA 2XNGA 3EQDA 5AAFA 4HOKA 4EWQA 4MBJA 3WF6A 1KWPA 2C6DA 3TV6A 3UJGA 4IVAA 3QD2B 3MFSA 4AT3A 4EH4A 2V7AA 2ZV7A 4BY9E 1GJOA 3QZFA 4BCNA 1BYGA 2QOBA 4NFNA 4W9WA 4KS7A 1OL7A 4AUAA 3OWJA 4BCMA 5IEYA 1GZ8A 2PMIA 2W1CA 3RZBA 2OZAA 4OLIA 3VS6A 1BL6A 2RFNA 1MRVA 3R7OA 3OBGA 4AW2A 4GFGA 1KE9A 2IJMA 4EH3A 1OKVA 2YDKA 5JGDA 1J7IA 3AGLA 4U3ZA 4BCHA 3WBLA 5F94A 2NRYA 1OVEA 4GL9A 3D7TB 5EM8A 2PVKA 3AGMA 3ROYA 1Y91A 4BDAA 3KRXA 3BYOA 3ZEPA 2H96A 4I4EA 4DH3A 3F61A 3QQFA 3KRWA 3PY3A 2ZVAA 1LEZA 4HGLA 3RINA 3VJNA 3VN9A 2JBPA 2FB8A 4O0RA 4CSVA 5G1XA 2C5XA 2BDWA 5HKMA 5FXRA 4O7TA 4V0GB 3IKAA 2QQ7A 1Z9XA 5HBHA 5HLPA 5KUPA 2QCSA 4FG8A 4BN1A 3ULIA 4E6QA 3NYXA 4IAYA 4GK4A 4DFZE 3OD6X 4A7CA 4MHAA 3AC5A 2QKRA 3HMMA 4EJNA 4QMQA 4A4XA 4EUTA 4PTGA 3AD5A 4YGAA 5L4QA 3L1SA 3MS9A 4XRLA 5I0BA 4MD8E 2HZIA 2XNMA 5ACBC 4CEGA 3KXHA 4ORKA 2PU8A 4RA5A 2QOHA 3VF8A 2X81A 3CC6A 4IX6A 5HOAA 3G2FA 3LXKA 5KZ0A 3FXZA 4HPUE 4L7FA 2VX0A 5FM3A 3ZDIA 4RJ7A 1SNXA 1X8BA 4NU1A 3ZM4A 1WVXA 3QTZA 4W9XA 4ZS0A 2P3GX 4HGSA 4QMVA 3O17A 2QVSE 2JITA 4YJNA 3V3VA 5E92A 1E1VA 2OZAB 2A27A 3F3VA 1AGWA 2PTKA 4ASXA 4H3BA 5M4CA 4WG5A 3GVUA 1W83A 4M69B 3SXSA 5LMBA 3AT3A 4FSZA 1OI9A 5C1QB 4KUJA 3GU8A 2OW3A 3UO5A 3DLSA 3R9NA 3RKBA 2BRNA 4AZFA 4OBPA 3DA6A 2IN6A 4IFCA 4CFNA 5K9IA 4O7LA 3NW5A 4BR3A 3TEIA 3QRIA 3M2WA 4R8QA 3UE4A 3O7LD 1GIIA 2Y6OA 5AP6A 3Q9XA 4ANBA 3D2KA 2GNLA 5KZIA 2LGCA 2X8DA 4PMTA 3HA6A 4DE4A 4B6LA 3DNDA 4DFYA 4KSPA 4NCTC 3CE3A 3UVQA 4BFMA 1JQHA 4OTRA 3ZZWA 2F2CB 3S4QA 4LOOA 4U42A 3OP5A 4FKIA 1B38A 4O0SA 5F9EA 3QUDA 1H1SA 1WVYA 4CKRA 3BI6A 5KBRA 3TNPC 3QA8A 2OH4A 2X7GA 4G5PA 4A06A 2BILB 4BIDA 3MVJA 5E90A 2BTSA 5DRBA 3A4PA 2QO2A 4F6SA 2J51A 3LMIA 5FP5A 4DFUA 5LWNA 1F5QA 2B7AA 4FV3A 2PWLA 3MFRA 3CY3A 4Q9SA 4X3JA 5KNJA 3OWLA 4CZUA 3VJOA 1H08A 3F3WA 4QP7A 3QZHA 5FXQA 5IEVA 1P5EA 4RJ8A 4BDCA 4RIOA 4CVAA 3C0GA 3BYMA 5ANDA 4EH5A 3NUUA 4RA4A 3VAPA 1NT2A 2R3PA 3PRIA 5EKOA 4ANSA 2BKKA 2GHGA 3RI1A 3ZLSA 5HNBA 4M68A 1SVHA 5IA1A 3R71A 3LQ3A 2X2MA 4PUZA 5BUEA 1SM2A 4CCBA 4EOOA 4PRJA 1K2PA 4DAWA 5IEXA 3SXFA 4PP9A 5CXHA 3S95A 3DBFA 4RT7A 1O9UA 3F7WA 5EYMA 5T3QA 3VS1A 3QTQA 2QONA 4GUEA 4UWCA 4KIKA 4USFA 4YPDA 3F3UA 4NM0A 5FDPA 2RGPA 2HW6A 3AMBA 4FT5A 3G15A 3DKCA 5IQBA 3EN9A 4RZWA 3ET7A 5FWKK 4BWPA 1QMZA 4F65A 5BQ0A 4ZTLA 5HX8A 5E9EA 1DI9A 3QLGA 2XJ0A 4OTHA 3VNTA 3VS2A 4EORA 5IA0A 5KBQA 2YCSA 2YLFA 3UMWA 4EC9A 1TQPA 4YHTA 3GFEA 1I09A 1G5SA 5DVRA 2XK9A 3E88A 4D1XA 4ZIMA 4L44A 3OY1A 1CSNA 1UU9A 1Q5KA 4K9YA 4IZYA 5CS6A 1QPCA 3DQWA 3GU6A 3R01A 4FZ7A 5HU3A 1Q8UA 2XUUA 3NYNA 4I94A 3NUPA 3QCQA 2YCQA 4QRCA 3QYWA 1BLXA 2FSMX 4QYHA 5DEWA 4E20A 3EN7A 4XOYA 2C3IB 4GFMA 4PL3A 3JR1A 2W1HA 4JG6A 3PJ8A 3FZSA 2IVTA 5AMNA 3BV2A 4I0RA 1KE7A 2WMWA 4FUXA 4G9RA 3NYOA 4I93A 4LUEA 2H6DA 2WMQA 3D5UA 5B2KA 3HV7A 4QQ5A 3MV5A 5FEEA 3V5WA 3W8QA 4D55A 2OJGA 3TNIA 2PVYA 3FAAA 3W2PA 4FSNA 4BDBA 4LG4A 3GGFA 3QF9A 4FKPA 4FV2A 3H0YA 4Y46A 4NJ3A 3IG7A 3G0FA 1F3MC 4ALWA 3EHAA 4ASZA 4XYFA 5I5ZA 2WEIA 2A4LA 2GMXA 3P1AA 4QP6A 4UXLA 3VUGA 4EH8A 4DF3A 2Y4IC 2IVSA 2CNUA 2XBJA 4RVTA 4D2PA 2F4JA 4DA5A 4FK3A 2GU8A 4L01A 4CG9A 2VTOA 4C4HA 4NL0A 2HZ4A 4X2KA 4KIKB 4DGOA 4QNYA 5GINE 4R6VA 4ZEGA 3G33A 1WCCA 3OHTA 5AR3A 2X7FA 4FZFB 5AP5A 2YZAA 4C36A 2O2UA 4IAAA 1OMWA 2YITA 3TG1A 5C26A 3QXOA 2ESMA 3FKOA 3G6GA 5LXMA 3Q53A 4AN9A 5IG1A 2QLUA 2OIBA 4PV0A 2XZSA 3KF7A 4XBRA 2CNQA 5KMMA 1IAHA 4L53A 2UW9A 2W4JA 3ZBXA 2GTNA 3NUNA 3L9PA 2ZM3A 4E7WA 4J95A 2BIKB 2EWAA 1JSTA 3HLLA 3WILA 3NUAA 2R3KA 2UW6A 2OICA 1R1WA 2ONLC 3OMVA 2C3KA 3VHKA 5HE1A 2QOKA 2PY3A 5FP6A 2GNIA 1YW2A 3KMUA 3FBVA 2WXVA 3P23A 4HVIA 4I6HA 4DLIA 3EN5A 4FR4A 2VTSA 3FI3A 3NSZA 4YTIA 5EK7A 3ORMA 3LJ1A 4FNZA 1IAJA 3QBNA 4ASDA 4AA5A 5E7RA 3WZJA 5C8MA 3GCPA 3IW7A 2OFVA 4QMYA 3TNQB 1REJA 4YZBA 2UW8A 4L3PA 4WNMA 2NRUA 3HA8A 4J97A 2QOFA 3EKNA 2C0OA 3KRLA 4KB8A 4FSUA 4NCTA 4AS0A 4CLJA 3I5ZA 5AV0A 4IX4A 4MWHA 2WMBA 5BMMA 4E5WA 5FUTA 4OT5A 2WEVA 3DJ6A 4K6ZA 4WBOA 1GZNA 1HOWA 3F88A 3FY2A 4UMUA 2ITPA 5DLSA 5ITAA 3PVGA 5HE3A 2WNTA 4FSYA 3ZFXA 3C4FA 5E8WA 3ZOSA 1Q62A 3Q52A 4XV3A 4E4LA 2BRHA 4FTCA 4BTKA 4GV1A 2CLXA 2PUIA 3FE3A 4H3PA 2J9MA 3PE2A 4QYEA 3R1YA 3U87A 3KFAA 5DBXA 3RAIA 3FSFA 5GNKA 4O1PA 4PL5A 4YJTA 1BUHA 1XBCA 1O6KA 2W1IA 4FUYA 4UYNA 4ACMA 5I3RA 3AT2A 3GB2A 2PVFA 1PXMA 5H8BA 3TT0A 4V04A 4JIAA 2E2BA 2PMOX 4YZMA 3KVWA 1DI8A 5F95A 3UO4A 4GS6A 3NIEA 4IX3A 2J2IB 3ENHA 3VHEA 3LVPA 3GEQA 3FKLA 3V04A 5EM6A 1BI7A 4EHGA 2WQOA 1IASA 5A46A 4A9SA 3WZDA 4EK5A 4BWKA 3OWKA 5HICA 2WQEA 2QOQA 3TN8A 5CEIA 3FPMA 2X9FA 4W4YA 1H26A 3FZ1A 3PIXA 3R0TA 3P7AA 1P14A 2QOCA 4XG7A 2PVJA 3W2SA 5FGKA 3VBXA 4CG8A 3P86A 3NIZA 3OW4A 2ZYBA 3UC4A 1Q41A 4ZXTA 1JWHA 4XG6A 5AR5A 2WD1A 4YPSA 2RSVA 1M2QA 4JX7A 4GMYA 2QURA 4L43A 4MX9A 2CN5A 5IUIA 1L3RE 3W18A 3QTUA 1KSWA 3GC8A 4E1ZA 5AUTA 5BVNA 5FM2A 4S30A 4BCFA 3T3UA 2GS6A 2V0DA 5E91A 4DCAA 3ORTA 1H1QA 1P4FA 1W0XC 4M13A 4MWIA 4MXOA 4XP0A 5EDRA 3THBA 5CEPA 4XJ0A 3OWPA 4R1VA 3RNIA 5J95A 1B6CB 3QQUA 4GJ3A 2P55A 1RQQA 4D2SA 4H1MA 5A6OA 5L6OA 5AUVA 5IQIA 3OEFX 4TPTA 4UBAA 4ZTRA 5LVPA 4CMTA 3BCEA 3L8PA 2CMWA 3UNJA 1M52A 2OJJA 3PG1A 3FZPA 3RCJA 3VUKA 3BE9A 4FTJA 3W2RA 4IJ9A 4RMZA 5HNIX 2X1NA 2OXXA 3NX8A 1FGKA 3KA0A 4GT4A 5D9HA 3FQEA 1OL5A 1ATPE 2KTYA 3FHIA 3LZBA 4IM0A 3H9RA 2R0IA 3QHWA 2R3GA 4FSRA 4RX9A 4AA4A 3NEWA 5L3AA 2Q83A 4LV5A 4HGTA 3G9LX 4U8ZA 3GQIA 4EQUA 3LFEA 3UZRA 3R22A 3NCGA 3V8SA 2Z7SA 4C4FA 3FMEA 4DH7A 5FTGA 2GNJA 3ZRMA 2EUFB 4F9BA 3BYUA 3H3CA 1R0PA 1JSVA 2PMLX 3G9NA 1APME 4I0SA 3Q4UA 3BHYA 2B54A 1JLUE 2OKRA 1ZYJA 3PJCA 2BRMA 3QKLA 3ZHPC 4PDOA 5TE0A 4X7QA 5LMKA 2GQSA 1V0BA 3SG9A 1XBBA 5AX9A 4GVAA 5K3YA 1SYKA 3MJ2A 2O64A 5TO8A 3KRRA 3LM5A 3K3JA 1ZMUA 2E9PA 3MA6A 4XS2A 2C5NA 3V8WA 2DYLA 5IA5A 4IQ6A 4WUNA 3VUIA 4DFBA 3JY0A 2JFLA 2R3IA 4GU6A 5CVHA 4XG3A 3F5GA 5HIEA 2C5OA 2W1GA 4B4LA 3NNVA 4AT4A 3S3IA 3BHTA 3Q6WA 4TRLA 4DH5A 1YXVA 1YRPA 4RFZA 3I0OA 3MH0A 3H30A 3AD6A 1URCA 2XJ1A 5LOHA 4MYGA 3F3TA 4PY1A 2OJFE 4IZ7A 4IJPA 4NTTA 3ZUTA 4C3FA 4BYIA 4FTNA 4WNKA 5GIOE 5K0KA 2YIWA 3VC4A 5CF5A 4P90A 1UKIA 3MB6A 4QP2A 4XLVA 3R8ZA 1OKWA 2R5TA 4PL4A 3E93A 4RX5A 2Y0AA 1VYZA 4GEOA 3U6HA 2QC6A 2VWWA 4AP7A 3CGOA 4M14A 4U3YA 3S0OA 3KEXA 3VBYA 5HBJA 1J7UA 4FIJA 2BZHB 4FKLA 4L9IA 1VJYA 3DK3A 4WRSA 4Y72A 2A2AA 4TNBA 4NW6A 2C6LA 4ZY6A 2PZIA 4MNEA 4EWHA 3LFDA 4FEWA 3PPZA 3QD0A 3U4UA 5CAUA 2W96B 4EZ3A 1REKA 4DFNA 2YERA 3EMGA 4M84A 3DBDA 3Q9YA 4JAJA 3WYXA 2XF0A 5BVEA 4M15A 2UVYA 2W1ZA 3HAVA 4WSQA 4Z3VA 2CSNA 1YDTE 2V62A 4J8NA 4KNBA 2QU6A 3ZO3A 1AQ1A 4QMZA 1ZYDA 3WE4A 4WG4A 4RFYA 1ZYSA 2JKQA 1H25A 4YJPA 5A6NA 5GJGA 4FZ6A 4CFXA 5FEDA 1W82A 5C8KA 4CTCA 4D2WA 4DGNA 3BKBA 1H0WA 2P0CA 2XCKA 3QWKA 4FIFA 2J5FA 2Y6MA 4KABA 4LI5A 4NWMA 4DITA 1FBNA 3VS7A 1BKXA 3E92A 2HOGA 5H8GA 2XKCA 3MFTA 4F6UA 4FA2A 2W9FB 4V01A 1Q24A 2YM7A 2GNFA 4LRJA 4MKCA 4DGLC 3Q5ZA 4IAIA 4HYHA 3COMA 3O71A 3WF7A 3SW7A 4FEQA 3UVPA 5E8SA 2CKEA 4I41A 1SZMA 3K3IA 4MXYA 2VV9A 3LMGA 3VW8A 1FVRA 3W33A 3U54A 1CKJA 4EOIA 5ANJA 4QTDA 2GPHA 4ZSLA 3CBLA 4KIOA 2XNBA 4CQEA 2B9IA 4AFJA 5TF9A 3W2QA 1IA9A 3GCQA 1U4DA 5IUGA 1RJBA 4YJOA 3UBDA 3AMAA 4W4VA 3QU0A 3G5DA 2YCRA 1UWJA 3REPA 4ERKA 2YCFA 4R3RA 4HVGA 3ZRKA 4C34A 3E3PA 1YXTA 3F66A 4AW5A 3EL7A 4BHZA 3FXWA 4FTUA 1DAWA 2EU9A 3UPZA 1I44A 3DJ7A 3LKMA 4NUSA 3W2CA 1MRUA 4AXAA 1H27A 1Y6AA 2O63A 3TZ8A 5AV3A 4YBJA 4FSMA 3I5NA 4TN6A 1Q4LA 4PTCA 3A62A 4QMTA 2X0GA 4XMOA 2O5KA 3U8WA 4I6QA 4II5A 3VRYA 4EBWA 3L8SA 4GK2A 3FZRA 3QX2A 1H1PA 4TWPA 2BAKA 5ANOA 1H01A 4O0YA 5FBNC 3UYSA 3ALNA 4ZSAA 1WBSA 3QLFA 1U5RA 4I6FA 3RAKA 4MTAA 1H28A 3FLWA 3U55A 4XP2A 3DTWA 2W7XA 2UW5A 2X2LA 2Y7JA 4DEHA 3GNIB 4LYNA 5CEOA 3BE2A 3KMWA 5L2WA 2IWIA 3RAWA 3C7QA 4F7NA 3PZEA 2OSCA 3OXZA 3UOJA 3NUSA 2PYWA 3CCNA 4BKZA 4FV6A 3TJDA 4AG8A 1KE6A 4QNAA 5K5XA 3FKNA 5CAOA 4UMQA 2G2IA 5H9BA 3TACA 3EN4A 4G3EA 3G0EA 4FV9A 4BICA 5AP0A 2NP8A 3VBVA 2Z8CA 4DC2A 2YDJA 1LEWA 3IS5A 3FL5A 4PMSA 4LL0A 5CSWA 3N9XA 4L3LA 3HDMA 5ACKA 4IM2A 4D1SA 4FT3A 3G6HA 4PPBA 3DCVA 3TL8A 3MTLA 3BHHA 5CALA 2J4ZA 3LAUA 1UU3A 1RW8A 1LUFA 2YIXA 3E8NA 5HEZA 4NM5A 3HMIA 2I0YA 4BDFA 5LCKA 2SRCA 3IDCA 2HELA 5HGIA 3ZUVA 2R3LA 5HTCA 2PPQA 4L8MA 5CU6A 1YHWA 1DM2A 3R9HA 3JS2A 3OOGA 3QAME 1PXKA 4RC4A 5AV2A 2ACXA 3OT8A 3DXQA 5M4FA 3QTXA 4FBXA 2R3NA 3H10A 1XO2B 3BGQA 5BMSA 3VUHA 5HCYA 2B52A 3SC1A 5DR2A 4G6NA 4FKVA 5HORA 2BFXA 3QZGA 4TWCA 3V5LA 2JIVA 4OAUC 2PSQA 2C6KA 4O6LA 3GI3A 4WRGA 4QTAA 2XM9A 2UV2A 4E4MA 1Y8YA 3BHUA 3OG7A 3PP0A 4EH9A 5KKRB 3HKOA 2WZJA 4CMOA 4IB1A 4RQKA 3ZSHA 1U5QA 3OXTA 4ANLA 4EK8A 2ERZE 3DAJA 4D4YA 3RPYA 4AOJA 1RE8A 1VEBA 4AZTA 4E4NA 4H58A 3TNHA 2VN9A 2VTJA 5DMZA 4MH7A 2QKWB 4N4SA 4Y85A 4BI0A 4M0ZA 5CU0A 4KRCA 3LCOA 4C4EA 4APCA 2RIOA 2VTRA 3QTWA 4FTLA 4AU8A 2I0HA 3SRVA 3I4BA 4OTDA 5F4NA 4M69A 3DKOA 3MYGA 5AX3A 3ZC6A 2Y8OA 4O0UA 4U40A 4YNEA 5FTOA 5IDNA 4X6RA 2VZ6A 4FE2A 3R04A 4DT9A 1XR1A 4YZDA 5HE0A 4J96A 3CIKA 3A99A 3KVXA 2C6EA 3NNWA 3PUPA 3UTOA 4ZJJA 1PXIA 3WZKA 1MRYA 1QPJA 5BYZA 4D4SA 3OCSA 2PVRA 2QLQA 3ZRLA 4IWOA 3OVVA 1KOAA 4IWDA 2G15A 3VQHA 2VTNA 4M67A 4ZTSA 4F9AA 5BUIA 3MBLA 3CXWA 3BGZA 4EHEA 2PULA 1WFCA 4R5YA 4FKUA 4RWLA 2QR7A 2BPMA 3IK3A 3B8QA 3PXYA 1J1BA 3SOCA 5L2QA 4BL1A 3AMYA 4O7SA 3ZC5A 4O7VA 2B9HA 4G5JA 5GJFA 4NFMA 4QP1A 3NRMA 4Y95A 2J0KA 4CD0A 4D4VA 4E6DA 4I20A 5JMSA 5EDPA 3LFFA 3P5KA 1TQIA 4BHNA 3IOPA 3POOA 5KMIA 4D4RA 1Q8TA 2HIWA 4P7EA 2OO8X 5BVFA 4GSBA 5IQDA 1GIHA 4AOTA 4XHKB 2VO6A 4D2VA 2DS1A 4O7ZA 1M7NA 1OL1A 3ZXTA 3TCPA 2C68A 2OZOA 3BEGA 1BX6A 4RC2A 3ORIA 4GT5A 3WF9A 5J9ZA 3LQ8A 4HJOA 2ZJWA 1XKKA 3MH1A 2OBJA 2BZIB 3NDMA 3KULB 4JR7A 4MBIA 4LFIA 2B1PA 2VTMA 3FLZA 4MXXA 2OK1A 2PMNX 3DZQA 5HG7A 4EJ7A 5HTIA 1GNGA 1PXPA 1M17A 2QO9A 3SRVB 3R28A 1M7QA 3UVRA 5F20A 4EHZA 4AZSA 2B9JA 3NYVA 5HLNA 2J5EA 4U41A 1YOLA 3ULZA 2WMUA 5CU3A 4NK9A 4YP8A 3QCSA 5DNRA 4BF2A 3VIDA 2JDVA 4E6AA 3BV3A 5CVFA 4F4PA 3HZTA 5JFWA 2XK6A 5KX8A 1ZOHA 3QRUA 2C69A 3HRCA 4BYJA 1UNHA 5AR7A 2JDSA 1V0PA 2W0JA 4FV0A 3RNYA 4CRLA 2OIQA 3GBZA 4YHJA 2YIRA 2PVNA 4YHFA 4UALA 2JEDA 3O23A 4BDGA 3NS9A 5GZ8A 2C30A 2CGUA 3IGOA 4CT1A 1YDSE 3TUCA 3FI8A 4JBOA 4ALVA 3CLYA 2ETMA 4S31A 5M53A 3LIJA 4LOQA 2HCKA 5J7BA 2PVHA 4EL9A 2P33A 2OXYA 1WVWA 3CY2A 3DOGA 4UV0A 4KBCA 2V7OA 5FD2A 2DWBA 2LAVA 4G34A 2F57A 2ITQA 4JL9A 2XVDA 4C38A 3C5UA 4L7SA 1GY3A 4S34A 2Q0BA 3HV4A 4FIEA 4TYIA 3ZUUA 3UP7A 1IA8A 3PVBA 1YWNA 1PRYA 2J7TA 3CPBA 4TTHB 3SLSA 4ZOGA 4UMPA 4EQMA 3R00A 3EYHA 5D11A 3VUMA 5JN2A 1V1KA 3ORKA 4IADA 5CNNA 1QL6A 4K2RA 5FXSA 4O7WA 1CKPA 3F6XA 4QPSA 2XA4A 4FV8A 3KKVA 3RP9A 3GOKA 5L6WL 2VGOA 3FI4A 5K0XA 1H4LA 4BGQA 4OR5A 1ZLTA 4GIIA 3UYTA 4FVQA 2C4GA 4E8AA 4O0XA 5IDPA 4D5HA 3IW6A 1CTPE 3PPJA 1L8TA 3A2CA 3U51A 4U9AA 4K8AA 3D83A 2WFYA 3C4WA 3EQIA 3ZSIA 4GYIA 1H8FA 2UVZA 4BB4A 3TDWA 3UDBA 2OWBA 2GFCA 3U6IA 1JNKA 3PLAE 4GK3A 2XEZA 4EONA 4H39A 4RX8A 5E8UA 4AN3A 3ATSA 4DBXA 3CKXA 1YHVA 3RMFA 4UYAA 2XK4A 2V22A 2VWVA 4I22A 2IW8A 1KOBA 1VR2A 3Q60A 4CT2A 4JRVA 3N4UA 2CDZA 3NLBA 3ID6C 5IQAA 1XWSA 4QQJA 3DT1A 1ZZLA 2RG6A 5A9UA 3Q3BA 2B0QA 4XUFA 3KREA 4FIIA 3QC9A 5FDXA 3KMMA 4FSTA 1W8CA 3PJ2A 1PMVA 2VGPA 4AA0A 2R2PA 4IVCA 2FSOX 5J5SA 3E7VA 1OBGA 2YISA 3A4OX 5AV4A 2HWOA 2I1MA 4B7TA 3UODA 3SG8A 3CEKA 3E63A 4MCVA 4ITHA 2HY0A 4EZ7A 3OTUA 5DGZA 3RTPA 5D41A 4DH8A 4U79A 3PSCA 5IMXA 1TQMA 2C6MA 3HX4A 4JQ8A 1UV5A 2HAKA 2F7ZE 2R7BA 5KMOA 1PKGA 3ORLA 3R9RA 4C37A 3ZONA 1PXNA 5HX6A 4K77A 5JFSA 4G1WA 3DKFA 4XEYA 4CFVA 3OEZA 3ZEWA 4EOSA 3O50A 2BZJA 3HMOA 4TYJA 2PUNA 5M4IA 5J7HA 2J0IA 3V01A 1UKHA 3HVCA 2VO7A 3OC1A 1YI4A 4FVPA 5JKGA 1ZOGA 4PMMA 2QU5A 5LVMA 3ROCA 3BEAA 3NNXA 5AR8A 5HD7A 2ERKA 3HUCA 4FL1A 4UMRA 4N6ZA 3BYSA 4CYIA 5DA3A 1IG1A 4IWPA 3A7HA 1O6YA 1VYWA 2JKMA 2CPKE 2O0UA 5HE2A 4JQEA 3SQQA 3VWAA 4O6EA 3MPMA 5CF8A 3FQSA 4JT3A 3VS3A 1Y6BA 4BIEA 4AGDA
chains in the Genus database with same CATH superfamily
4C33A 2J0JA 2HY81 5DRDA 5KMKA 3ZCLA 5IPJA 2IPXA 5A14A 4AXEA 4WUAA 2XJ2A 2VTTA 5LMKC 1FMOE 4KIQA 3HGKA 4KKHA 1TVOA 4FTRA 5EW3A 3TTIA 5IUHA 3UG2A 3RK7A 3W55A 4XX9A 5IQHA 3CJGA 3EFKA 2YHVA 3OF0A 3RVGA 4LMNA 4BCIA 2CCHA 4OT6A 4GH2A 3COKA 5T6KA 5KMNA 2R3RA 1ST0A 4FTQA 2JC6A 4B0GA 4IAFA 2CGVA 2WTWA 4LQMA 4N6YA 3WZUA 4CGAA 4FODA 4C3PA 3EZRA 2PE2A 3FDNA 3E62A 5E8TA 2JGZA 4L3JA 1Q3DA 2R9SA 4MD9E 4BCQA 4BBFA 5IU2A 4O82A 2XK7A 3CKWA 4KD1A 1XQZA 2YM4A 4O0TA 1YQJA 2C6IA 4FICA 4YBKA 4FV1A 2GFSA 2IEWA 2PVLA 4GW8A 2NO3A 2WO6A 3H4JA 3KB7A 4RLLA 1DAYA 2WTVA 3D4QA 3GT8A 1H1RA 4HZRA 2UZVA 4JJRA 2FSTX 4IZ5A 4RIYA 4Y5QA 4FOCA 2HYYA 3UP2A 4AZEA 4CKIA 4EYJA 4C62A 1XBAA 5J9YA 2WQMA 4CZTA 1OIUA 4TWNA 2HZ0A 2XNOA 4HYUA 5HVJA 5BPYA 2VTLA 4CLIA 4RWKA 1ZYLA 4X2JA 4BGGA 4C8BA 5HVKA 3LXNA 4BDKA 1G3NA 4HYIA 3RALA 4FEXA 3R73A 4IW0A 2HXQA 5H3QA 4F7LA 4LGDA 4C59A 2PE1A 4FSQA 2BFYA 4KINA 4AQCA 3AOXA 3UIBA 2UZWE 3MIAA 4XG2A 5I9UA 4AAAA 3RPVA 3F82A 4KBKA 3RPOA 3NAXA 4HCTA 5E8XA 5EOLA 5AADA 5I9WA 5A4QA 4TYGA 4E5AX 5IA4A 4P5ZA 3FPQA 4BGHA 4O2ZA 5ETCA 4G9CA 5HBEA 5CSPA 4FKTA 3FV8A 2VTHA 4R1YA 2PUPA 1FGIA 3C13A 2W1FA 3W8LA 1ZXEA 3JPVA 4WG3A 4OUCA 2GQGA 5D10A 2UZBA 4JQ7A 5DI1A 2VWZA 3T9TA 3WE8A 4XLIA 5KCVA 3ZTXA 1ZYCA 3DXNA 4O27B 1U46A 1XHAA 3KGAA 4KIPA 5CAQA 4G3CA 3MTFA 4DEDA 5JSMA 5HD4A 4CRSA 3CR0A 2BUJA 4JDJA 4EUUA 2ITTA 1G8KA 4M12A 3QCXA 4K0YA 3HUBA 2BDJA 4YJQA 3IDPA 1HCLA 2YAAA 4FZDB 1OIYA 4M66A 4AFEA 4PP7A 5L8KA 4BCJA 4F1OA 4RVMA 3U9NA 1LP4A 3HMNA 4KSQA 2XMYA 4U81A 1R39A 4Z9LA 4G6OA 4IE9A 5HG9A 4ACGA 4EI4A 2A19B 2EXMA 4AGCA 4XV2A 5EYDA 5K5NA 4CCUA 3OS3A 4RIYB 4O21A 4BRXA 4GCJA 2XKDA 3BLRA 3A8WA 4YLKA 4F9CA 2GQRA 4ZJIA 3BHVA 4EHVA 5EW9A 3QRKA 4FTKA 3DAEA 1YHSA 2F7XE 2ITZA 2QOLA 3GC9A 3QTRA 1ZY4A 4F7JA 4FSWA 3QYZA 4Y5HA 3RJCA 5JFXA 3KC3A 4KKGA 3ZO4A 4XNEA 4QQCA 1S9IA 2CGXA 1E1XA 3F5PA 5HQ0A 2ZMDA 2W5AA 4D58A 3JXWA 4R7BA 3QA0A 4QMLA 4GUBA 3UIMA 4R5SA 3FWQA 1A06A 3HRFA 3MSSA 3R1SA 5LVOA 3FEGA 2WMVA 4JX3A 3QQHA 5HCXA 1ZMVA 4B9DA 4HZSA 4GVJA 3LCKA 5JT2A 3OUNB 2NPQA 4YJVA 2ZDTA 4IEBA 5E8VA 2VRXA 2Z7RA 5HO7A 3ZFMA 4AX8A 4OGRA 4FT0A 3AC2A 4AW0A 4D5KA 2G9XA 3BZ3A 3GXLA 3AC1A 3JY9A 1A9UA 1R3CA 4JDKA 4NJDA 3BU3A 1JSUA 2CLQA 1WZYA 2YM8A 4IIRA 4Q5HA 4ALUA 5L2TA 2JLDA 3ERKA 2XRUA 4F0IA 5DR9A 5L2IA 4J8MA 3EWHA 4G3FA 2BVAA 4CNHA 2OG8A 4ZY4A 2XM8A 4P4CA 1GIJA 3LJ0A 4OAVB 3I7CA 5CX9A 3M11A 1Y57A 1YDRE 2IO6A 4YMJA 3SAYA 3BRBA 4G3GA 4IHPA 2C6OA 1VZOA 2X6EA 3MVLA 4FYNA 4OW8A 5AIKA 3TI1A 3W0MA 3RWPA 5DN3A 4ONAA 2YABA 1FVVA 4J99A 4PPCA 3NUXA 2F49A 2IZTA 2XEYA 1H1WA 5IKWA 3D5XA 4FT7A 4JG8A 5EI2A 3S2PA 5KKRC 3T3VA 3DV3A 2ZV8A 3FUPA 4KA3A 3GU5A 4XCUA 4IX5A 4DG0E 2ITWA 5E4HA 3F9NA 4S32A 4I5MA 1F0QA 2R3QA 3IGGA 4ARKA 4WT6A 2R3MA 2Y9QA 2W1EA 4TYEA 5EG3A 3OXIA 2IVVA 3OUKA 4PNKA 4YC6A 2R4BA 2X6DA 4R7IA 5H8EA 1NXKA 3FLYA 4ZSEA 2XBAA 1W2DA 2PZ5A 3O51A 4RFMA 4RZVA 3L8XA 5M08A 1YKRA 3AG9A 3R8VA 4FKOA 4LL5A 4UX9A 4BCPA 4EKLA 3H9FA 4KAOA 4DYMA 2UW3A 3UIUA 5B0XA 4O2PA 2FA2A 1SVEA 3N4TA 3BGPA 5G6VA 3FZTA 4E73A 2QHNA 2A0CX 3OROA 4L68A 3AT4A 3EKKA 4UXQA 3NPCA 4HW7A 4ZZNA 4L67A 5A4LA 4Y73A 4J98A 4FKQA 3BLQA 2C6TA 5BNJA 5J1VA 2BALA 3C4CA 3KXMA 5BVDA 5IA2A 5KHXA 1ZMWA 2OGVA 3VS0A 4YTCA 5C8NA 3E3BX 3O96A 3DAKA 2YAKA 3D94A 3RPSA 3FYKX 4FMQA 4Z55A 1PYXA 2QR8A 3IONA 4DEBA 2O3PA 3QUEA 2WIHA 4YTFA 4QYYA 3I79A 3RM7A 4QT1A 1OKZA 4F0FA 5FLFA 2WQNA 5C4LA 3HAMA 3MDYA 2BCJA 3D2IA 1YI6A 2VD5A 2XK8A 4TYHA 4ACHA 1QPDA 2CN8A 3H0ZA 3EN6A 4IC8A 3ZFYA 3PXZA 4IMYA 4TXCA 4U80A 3Q96A 4NKAA 4A9TA 1R0EA 3ZO2A 2XNNA 3LXLA 4WNOA 1OPLA 2X4ZA 2C5YA 2J0LA 1OGUA 4MUQA 1QPEA 2C5VA 3VS5A 3C0IA 1YXUA 4A4LA 3W0OA 3Q9WA 4JG7A 5EQEA 4QMUA 3IPHA 1G8JA 3BU5A 3N51A 4K1BA 4AE6A 5CXZA 2AYPA 5EQPA 1KUTA 1MP8A 2GHLA 5CT0A 5BVWA 4DLJA 5AWMA 5IISA 3AD4A 2W4KA 3PG3A 3CQUA 4YLLA 1NVRA 1PHKA 5JQ5A 4NM7A 4C4IA 1JAMA 3TYKA 1R78A 1Z57A 3LLTA 3PLSA 4FIGA 4IB3A 4RX7A 3L9NA 4PDPA 1Q99A 5FQDC 4PWNA 4XRJA 4A4OA 5EYKA 1ZWSA 4D1ZA 5AA8A 2W17A 3QTSA 4H3QA 5CAPA 3FHRA 2DUVA 3LQ5A 2F2UA 5AP1A 4F70A 2I7QA 4TKSA 4B99A 5C03A 3C4EA 2QOOA 3A8XA 4X0MA 5HI2A 5LARA 3GC0A 2WTDA 4U44A 3OCGA 3VS4A 2GS2A 4XP3A 3UOLA 1XH6A 5B2LA 4F09A 4ZLZA 1ND4A 5HLWA 4OTIA 5CWZA 1OM1A 3E7OA 2IZSA 1OL6A 4JI9A 3MVHA 3MH3A 3QKKA 4RRVA 4U7ZA 3WYYA 2NNWB 2WMSA 4QD6A 4UWYA 4F08A 2AC5A 3GUBA 2E9OA 5EW8A 2H9VA 5I9YA 5J5TA 5JZJA 3P9JA 1UU8A 3OFMA 4DN5A 3R7GA 4BCOA 2YM6A 4MD7E 1U54B 5AJQA 4CKJA 4QMXA 2CCIA 2PZYA 3ORZA 3JVRA 3L8VA 3RPRA 4TYHB 1WBWA 5ANEA 3GQLA 4RVLA 2XIKA 3A7GA 3KXZA 3OZ6A 4OTPA 5LWMA 2WKMA 3R8MA 3RHXA 3TIZA 3MY0A 3MJ1A 4C4JA 3ZBFA 2ZV2A 3D5WA 4RGJA 5J87A 3V5PA 4LRKA 1Q8YA 2VUWA 5TT7A 2YDIA 5BX0A 3S1HA 1PJKA 3UQCA 4JXFA 3HP2A 4BBMA 2WMAA 2XNEA 2J0MB 4ITIA 3WZEA 1JOWB 2JD5A 3BBWA 3KN6A 3QGWA 3PVUA 5D7AA 4YU2A 3DPKA 3R9OA 1OBDA 3PZHA 1ZOEA 3F5UA 5C9CA 4X3FB 3V5QA 2WQBA 5EYCA 2XIRA 2GSFA 1OPKA 3BELA 5LMAA 2UZEA 3DQXA 4ACDA 5T68A 4FKRA 3AQVA 3DBEA 1CM8A 2ZOQA 5CZIA 2XKEA 4AXCA 4LMUA 4YLJA 5DPVA 5FG8A 4IAKA 4PMPA 3PDTA 5IQEA 3QC4A 3VO3A 3QL8A 1PKDA 3KL8A 4O81A 3NR9A 5JQ8A 4FKJA 4BTFA 4M97A 2BR1A 3ORPA 4MQ2A 4FRFA 4NEUA 1Q61A 2OXDA 4N70A 5AR2A 3W32A 1XH8A 5CZHA 4YO6A 2XK3A 5AP2A 2B9FA 3HEGA 2FH9A 3ENMA 4YJRA 2A1AB 4RJ6A 2W05A 2BMCA 4FG7A 4O96A 4RC3A 4W4XA 3UGCA 1CMKE 5C27A 1MUOA 5M4UA 3EQRA 3TV4A 5JGBA 1ZAOA 4ITJA 3LJ2A 2JDTA 5CSVA 4Y8DA 5CENA 2IZRA 3GFWA 3OBJA 3PIZA 2VX1A 3PVWA 4LUDA 5J79A 3S00A 5D1JA 4I1ZA 1Q97A 5HCZA 1QCFA 3UC3A 4QPAA 2VAGA 3F3ZA 4I92A 4BKYA 2BAJA 4XBUA 4C2VA 4CV8A 3FLSA 4A07A 3R21A 2JAVA 2C3JA 3R7UA 4IH8A 4UB7A 4LGHA 4CV9A 4DTKA 1Q8ZA 2ZB0A 4U45A 5M55A 1FOTA 2R7IA 1U59A 4QMWA 4HVHA 4D0XA 4D2TA 3OW3A 4JAIA 5BYYA 4Z7GA 3CQWA 4EOJA 2RFSA 3NNUA 1KV2A 3IQ7A 3CTJA 4FK6A 4BVUA 4EOLA 3EFJA 3SKCA 3U6JA 3E8EA 5DHJA 1NVSA 4ENXA 4L52A 5CI7A 4YTHA 4JNWA 5CYIA 2JDOA 2W4OA 4UMTA 4F64A 1H0VA 3MPAA 3QX4A 4AE9A 2IG7A 4EH7A 3FMLA 1J3HA 1WBOA 2WIPA 4IACA 4IC7A 4H1JA 4J52A 2ITUA 2UZNA 4QOXA 4DCEA 4TWOA 4YR8A 4XOZA 3CQEA 2WOTA 4L6QA 1O6LA 3K5VA 3A60A 3EOCA 3PIYA 3R6XA 4N0SA 4FT9A 2XIXA 3MGYA 5DH3A 3F2AA 3KULA 2Z2WA 4ZTHA 4ERWA 1M2PA 4BJJA 3VUTA 2IVUA 1ZZ2A 3ZYAA 4QTEA 3CTQA 2VWBA 3FY0A 2C1BA 3PE1A 3UMXA 3O7LB 3KCKA 3R02A 2VWIA 4NSTA 3TUDA 3FYJX 4EC8A 2VWXA 5FEQA 5IA3A 1J1CA 3PJ1A 5FBOA 2XKFA 3DJ5A 3KK9A 1H07A 3FSKA 5AM6A 2Y4PA 1YXXA 3C50A 2UZTA 5ETAA 4PNIA 4DEEA 4USEA 2P4IA 4LOPA 4BWXA 2W5HA 3QALE 1WBNA 1S9JA 4QMPA 3PRFA 2QG5A 5AAGA 1PXLA 5IH4A 2BZKB 3WOWA 3G90X 2W99B 4BBEA 5L8JA 3WIKA 1P2AA 3NW7A 4RPVA 3U9CA 4DGMA 2P2IA 4RJ4A 3RCDA 4O4FA 5KMJA 4OTGA 2BHHA 2PZPA 3EQBA 2BROA 3ZO1A 5I3OA 3R7EA 5CF4A 4GRBA 4H05A 1K9AA 1NY3A 3TKIA 3V51A 1PW2A 2Q0NA 4F9WA 4ZAUA 5DE2A 3VBQA 3GCVA 3NVMB 5B2MA 4FIHA 2XCHA 3PSBA 3LLAA 3VQUA 3WIGA 4BC6A 4P2KA 1PMEA 5HZNA 5H2UA 5IZFA 3HYHA 2V55A 5HO8A 4E5BA 5KO1A 1XMMA 1XH5A 3ZSGA 4O7RA 5IH6A 3QWJA 3DNEA 3POZA 3SGCA 2RF9A 2CGWA 3MWUA 3HDNA 1PMNA 3LFNA 4DDGA 1PY5A 2W9ZB 4K18A 4RJ3A 4HVDA 3UO6A 3ATTA 1M2RA 1Z5MA 2KULA 2G2HA 4G3DA 2R3FA 5EQYA 4U0IA 5CTPA 4U6RA 3SW4A 4BJJB 2DQ7X 3MH2A 2ZAZA 3DBQA 3TM0A 2WTKB 1PMUA 3KF4A 4TNDA 5GZ9A 5HG8A 4W4WA 3O2MA 2X39A 3VRZA 2C0TA 4R7HA 5J1WA 3NCZA 4AZWA 4ZLOA 4DFLA 4F63A 4FVRA 4I4FA 4MNFA 2W06A 2FUMA 3DB6A 4O0WA 2C47A 2FO0A 4Z16A 4J53A 5HNGA 3DTCA 1ZY5A 4RG0A 2ZM1A 3BBTB 4P5QA 5AUWA 2YIYA 4C4GA 4MXZA 4YSMA 4YJUA 3TIYA 4FJVA 5IQGA 3M42A 3TZMA 4DGGA 3BX5A 4BIBA 3DU8A 3BYVA 4UY9A 4TW9A 2OIDA 3PWYA 3COIA 1YI3A 4IXPA 3UOHA 1STCE 4BDHA 3NFGB 5LVLA 5GHVA 3CTHA 3L9LA 3OTVA 4AF3A 3D5VA 3QQLA 5D12A 3SA0A 4USDA 3HP5A 3NGAA 2ITVA 2X4FA 3FMHA 2C3LA 2QD9A 3LFQA 4FGBA 3QQKA 3HNGA 3LOKA 4F7SA 4XV9A 5DR6A 3RAHA 3R9DA 1Q3WA 2UW0A 1BMKA 2PZRA 4ZZMA 3ZZEA 5GZAA 2OH0E 3KXNA 2WPAA 4M7IA 3Q6UA 5ICPA 3E8DA 3VVHA 3IECA 4L46A 2W1DA 3PTGA 2ITOA 1YVJA 4BKJA 2Z02A 3JUHA 3WF8A 1AD5A 1UVRA 2IW6A 3K2LA 4ZLYA 4Z7HA 1BI8A 1UNLA 2QG7A 3MB7A 4FNWA 3EQPA 3QFVA 2F9GA 5EI6A 3KK8A 4UZDA 5GIPE 1XJDA 4HPTE 5CEKA 3KN5A 4C61A 3ZLWA 1B39A 1G8AA 3SX9A 2AQXA 3FL4A 3MY1A 3LPBA 1ZRZA 2PL0A 1EH4A 4FNXA 2QOIA 4XG4A 3PPKA 4PX6A 4ASEA 3B2WA 3G51A 4QQTA 2W5BA 4D9UA 4CFUA 5DWRA 1NA7A 3C0HA 4PTEA 3CD3A 2ETKA 3LCTA 3PA5A 3WARA 4B8MA 3K54A 1SVGA 2AUHA 2FGIA 5ANGA 4FEUA 4FGRA 4FF8A 4FKSA 4BZOA 3R7YA 1A48A 1RDQE 2YWVA 2WMRA 1JKSA 1OB3A 1ZARA 5FTQA 3TZ7A 2J90A 5CF6A 2HW7A 4OBOA 1JPAA 2I6LA 5AIRA 5A4CA 4ID7A 3PXQA 2QO7A 4YNOA 4O0VA 4O7NA 5EDQA 3Q2JA 5JGAA 1PYEA 3P7BA 4X2GA 1UU7A 1KE8A 3DLZA 4HVSA 1UWHA 4BZDA 4DEIA 2CHLA 4JBPA 4EBVA 5ANKA 4EH6A 1M14A 2RKUA 3HECA 3GP0A 2WOUA 3PA3A 4MVFA 4NKSA 4ZSGA 2E9NA 4ANQA 2FSLX 4FEVA 4O4DA 4NH1A 3V6SA 2XRWA 4I6BA 2YJSA 3MW1A 1JKKA 3ZMMA 4QP3A 4EKKA 2BKZA 4DBNA 2YJRA 1CKIA 5L2SA 2YWPA 2G2FA 1V0OA 4UWBA 3VONA 2O65A 3BQRA 3I7BA 2VO3A 2EB2A 3QXPA 4M0YA 2IZUA 4MK0A 4FOBA 4O83A 4BZNA 4K11A 5LVNA 2UW7A 3OOMA 3QRTA 4EEVA 2GDOA 4X2NA 1MQ4A 4Q5EA 3ZXZA 4BDIA 3RHKA 1W84A 1FMKA 2FYSA 4IB5A 1W2CA 4WHZA 4DTBA 2B55A 3U4WA 2YM3A 3T9IA 3E8CA 4LV8A 5LJJA 3O0GA 1TZDA 3RBWA 3O8PA 2HK5A 2Z7QA 5DG5A 3I0QA 2YN8A 3KXXA 4FV5A 3F2NA 1WBVA 3A61A 5AP3A 4DFXE 4C02A 2QNJA 3CD8A 3QTIA 4I23A 1OPJA 4IDVA 4QMMA 4Q9ZA 3LMHA 2ZM4A 4GIHA 2BRBA 1FQ1B 4IVBA 5CSHA 5TOZA 4OTWA 4ZP5A 3EQCA 5ETFA 3PYYA 2PHKA 4PDYA 5ANIA 3ZU7A 5JRQA 2OLCA 4ZY5A 1NW1A 3SV0A 3LE6A 4DINA 1XH7A 3IDBA 2XALA 2ZMCA 3CPCA 4FTIA 3VULA 4AZVA 5E8ZA 3DK7A 1ERKA 3HV6A 4GG7A 4RJ5A 4EOPA 5AA9A 4E4XA 4FYOA 5CU4A 3D15A 4M3QA 3EQFA 3R8PA 4EK4A 3SDJA 4QMNA 5HO6A 5JFVA 1OITA 2GNHA 2ZB1A 3EFWA 4HCUA 3UNKA 4N57A 4W8DA 2YLEA 3COHA 1JVPP 3LFBA 4RVKA 1XH4A 2WAJA 3RWQA 4O84A 4YURA 4L45A 1K3AA 3KCFA 3LW0A 3GENA 3QRJA 4PPAA 5CVGA 4AOIA 4G16A 4OBQA 4ZS4A 2HXLA 4C0TA 5AUYA 3I6UA 3ACJA 3ANQA 2OU7A 1WAKA 3EZVA 3PXRA 5AUUA 1SNUA 4JDIA 3TTJA 1YWVA 2ITNA 4FI1A 3QKMA 5DOSA 5LCJA 4GT3A 4ZTMA 4FTAA 2I0VA 1OECA 3R7VA 3FMNA 1YXSA 3GU4A 5HTBA 3PY1A 4FTMA 4QP8A 3T8OA 4YJSA 3UQGA 4M8TA 4FG9A 3R7IA 5L6PA 4UEUA 4IAZA 2QI8A 3I60A 4BTJA 2CKOA 3EQHA 2VWYA 4JOAA 5AUXA 5JK3A 5IQCA 2JKOA 3D9VA 3NUYA 2GTMA 2VWUA 2BDFA 3KU2A 4G6LA 4HNIA 4HYSA 4FNYA 3HMPA 3NMUF 2WHBA 1G8SA 3PXFA 2PVMA 5K4JA 5CASA 3VW6A 4QP4A 3LM0A 3EFLA 4EK3A 4GKHA 4JRNA 2ITXA 3W0NA 1FVTA 4X3FC 2YA9A 3TKUA 3RZFA 5CNOA 2E9UA 4WA9A 2BHEA 4MAOA 1PF8A 3F2RA 4FKWA 1H24A 2XARA 2EXEA 5CANA 3O8UA 4QMSA 1OL2A 5CEQA 3Q2MA 4XG8A 2J6MA 3RK9A 4PQNA 4S2ZA 4ZSJA 1WBPA 4U43A 3AC8A 4FL3A 3BWJA 2XNPA 3UQFA 2WTCA 4GU9A 4YC3A 3LFSA 4MQ1A 1NVQA 4AT5A 3CP9A 5DEYA 2RG5A 3GU7A 5KMLA 2HENA 4J71A 5I9VA 3V8TA 4R78A 3PXKA 4KS8A 4C57A 3PWDA 3JYAA 2X8IA 2WMXA 5HIBA 3FC2A 2XB7A 4JR3A 5F1ZA 3BWFA 3W10A 1W98A 3TDVA 2R64A 4O7YA 4W8EA 3E87A 3FMMA 4JDHA 4HGEA 4NTSA 2YZLA 4GJ2A 3TNWA 4JVGA 3R8LA 5AR4A 4I3ZA 2ZDUA 2JDRA 4O4BB 5HIDA 4WOVA 5M06A 2C1AA 2XIZA 3D7ZA 4ZK5A 3FC1X 4CTBA 3BL7A 1HCKA 1GZOA 4QP9A 4JS8A 2WGJA 2G1TA 3AC3A 2EXCX 3TXOA 5IMEA 2ZV9A 3KRJA 3QD4A 4AWIA 3Q9ZA 3R1NA 1P4OA 1T46A 4TL0A 3EB0A 1J7LA 4FV7A 4ZJVA 2WU7A 4JBQA 4AGUA 2XYNA 3IO7A 4IDTA 4CXAA 2I0EA 4PDSA 3V5TA 3FMKA 2PK9A 3QUPA 4JIKA 5AM7A 4NT4A 2FVDA 4Q2AA 3BQCA 3R1QA 4AN2A 3A7JA 2OF4A 5TKDA 3UDSA 4JLCA 4U5JA 5K4IA 3Q4TA 5CLPA 2R0UA 5EOBA 2JFMA 3DBCA 3IW5A 1OUYA 4FL2A 4FTTA 4QO9A 4Y83A 4YZNA 2VNYA 5GJDA 3TZ9A 3QD3A 4ENYA 4EH2A 3P08A 5AFVA 5DIAA 4DHFA 3BPRA 3EJ1A 5BVOA 4WD5A 4IZAA 3HV3A 4GG5A 3Q04A 4DHIB 4ZMEA 4G17A 5HHWA 4MEDA 4WKQA 4EOQA 4TT7A 3VBTA 5L8LA 5M44A 3ITZA 4ACCA 1TKIA 3PJ3A 5EM7A 4IANA 2JIIA 3DFAA 5I4NA 4EQCA 4L00A 3FJQE 2UZDA 3ODZX 5CT7A 2GCDA 4MF0A 2XYUA 5AAEA 5IF1A 5LQFA 5D7VA 3DFCB 1KE5A 4D28A 4F99A 4BTMA 3LXPA 3MVMA 5AUZA 3W0RA 4O1OA 4EYMA 5E8YA 5EM5A 2REIA 3FMDA 3R83A 3DKGA 5AV1A 4RBLA 4RSSA 3P7CA 4APPA 3DXPA 5IH5A 3P79A 3UOKA 3A7FA 2OF2A 3RM6A 2VTQA 3EYGA 4O38A 3P78A 4DH1A 2ONLA 4BCKA 3P5JC 3DDQA 4RLKA 5A4TA 1GZKA 3EL8A 1LPUA 2QHMA 2X9EA 3C4XA 4F0GA 2OFUA 4AAYA 5CY3A 4RIWA 3QHRA 3W0SA 3R8UA 5HVYA 4NW5A 1DS5A 5BVKA 4EK6A 4F1TA 2XP2A 4DEGA 5FRIA 3DS6A 2X0PA 3LFAA 1GAGA 3IW4A 2R3HA 3JVSA 3ETAA 3GOPA 4YZ9A 4X21A 4NIFA 3OCBA 3KQ7A 5EHLA 2BRGA 2G01A 3BIZA 5EH0A 1YOMA 2WMTA 1JBPE 2VTPA 4I5HA 4O22A 3GCUA 4R3PA 3F5XA 5AP4A 4I5CA 4WO5A 1UA2A 4X2FA 5DT3A 4AXFA 3NVKI 1U54A 4MF1A 4XG9A 3FLNC 4QTCA 1W2FA 3LHJA 3ODYX 3TUBA 2HZNA 2Y4IB 4O91A 1OIRA 2YM5A 3DDPA 4I24A 2OJ9A 3HL7A 1WBTA 4V05A 3CS9A 4YSJA 3EH9A 1JKLA 3FZOA 4DHJA 4S33A 2P2HA 2XH5A 3ZDUA 2PUUA 1OUKA 2WTKC 2IW9A 4BDEA 1LR4A 3MA3A 3DK6A 1GOLA 3LCDA 5JZNA 4O4EA 4QMOA 3LFCA 3C1XA 3F7ZA 3C4ZA 3ZH8A 4C58A 4C2WA 3P4KA 1SMHA 4X3FA 4IWQA 4C7TA 1T45A 4DG3E 5CAVA 4CYJA 4CFMA 2ZFYA 4E6CA 2CKQA 2JIUA 3FMJA 3BLHA 5TR6A 4AGWA 4FV4A 3ZLYA 3UDZA 4RIXA 1UNGA 4WSYA 4D0WA 5KHWA 4ZZOA 1Y8GA 4I0TA 2BAQA 3ALOA 4KWPA 3FQHA 2WTIA 4MBLA 5EHYA 3V6RA 3AXWA 4ZMFA 2ITYA 4ZTQA 4RIWB 2R3OA 2EVAA 1IEPA 3Q4ZA 2XANA 5B7VA 3PSDA 4IVDA 3VBWA 3UNZA 2YEXA 4E3CA 2GNGA 4IFGA 4CQGA 1IRKA 2XS0A 1H00A 3ACKA 3I6WA 2B53A 2C0IA 2Z7LA 3M1SA 3AKJA 4NIFB 5HG5A 1YOJA 5I9XA 1BL7A 2Z60A 3MY5A 2UUEA 4LM5A 4YC8A 3CGFA 4PF4A 5J8IA 2HWPA 4FTOA 4OTFA 3MI9A 2UZLA 4ANMA 4RWJA 5BYLA 1OIQA 5AEPA 4O86A 3QZIA 5I9ZA 1CDKA 3RGFA 1Q8WA 3E64A 3H9OA 5M57A 5JRSA 1URWA 5CQWA 5JEBA 5DYJA 4YZCA 4KKEA 4A9UA 2CNVA 3MESA 3C9WA 2WTJA 4KBAA 5CI6A 4IM3A 5J9LA 4DTAA 5JH6A 4MNEB 3R63A 3UPXA 3I1AA 4U97A 5CU2A 5EI8A 5M09A 1OKYA 3E5AA 3QQJA 5M56A 1JKTA 2OJIA 1MQBA 3D0EA 3FXXA 4BI2A 4F9YA 2QODA 3PFQA 2UZOA 3TWJA 2X8EA 3NW6A 5CSXA 2CJMA 4JBVA 4QYGA 1J91A 3KXGA 4ANNA 4FKGA 4TY1A 1KV1A 3Q5IA 5EKNA 3EQGA 4FC0A 3W16A 3QGYA 4DEAA 4E93A 3SVVA 2YIQA 1XH9A 3IW8A 5KE0A 2GHMA 3Q32A 4RQVA 3OCTA 3PA4A 4MXAA 5CQUA 4XH6A 4CFWA 2GS7A 3P0MA 4CMUA 4DG2E 5DT4A 3IOKA 3PP1A 3GCSA 5C01A 3II5A 3SXRA 4AACA 5AP7A 4HNFA 4RIXB 4I21A 1W7HA 3WI6A 2VU3A 3A7IA 1FPUA 2UVXA 3OY3A 2X7OA 5A3XA 4NYEA 4R77A 2VNWA<