1SNUA

Crystal structure of the unphosphorylated interleukin-2 tyrosine kinase catalytic domain
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
263
structure length
245
Chain Sequence
VIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAESG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Crystal structures of interleukin-2 tyrosine kinase and their implications for the design of selective inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 245
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1snuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1snuA01
3UP2A 2XRWA 5EI2A 4CKRA 3KCKA 4IB5A 4EBVA 3HV7A 3NUXA 4L44A 4OW8A 2QOFA 4EH8A 4E7WA 2BILB 5KMMA 3VQHA 4Q9ZA 3OF0A 1G3NA 2UW5A 4S30A 4IC7A 2ZB0A 4C36A 4QQTA 3RHXA 3I5ZA 2OJFE 3NUYA 4NCTA 4XP3A 2FVDA 4E8AA 4ITIA 2W9ZB 3OP5A 2WU6A 4UWBA 3RM6A 4TYJA 5GJDA 4RIXB 5AUZA 5DWRA 4UV0A 4RX9A 4DT8A 2Y7JA 2WU7A 4RGJA 3FLSA 5HTIA 3S1HA 5J7HA 4E6CA 1IASA 2YIRA 4NKAA 4AT5A 4ERKA 2W5AA 5J1WA 4ZOGA 4ACCA 4GG5A 4N4SA 4XHKB 5E7RA 1JVPP 3DAKA 4QNYA 4NH1A 3QUPA 4JQEA 4L52A 4RJ3A 5L6WL 3R7OA 3C0GA 3ZRMA 4AZWA 4HJOA 5K3YA 4FKVA 4FSRA 2W1EA 5KUPA 3ZYAA 5JQ5A 1F0QA 1P4OA 4K77A 3LKMA 2CLXA 4I3ZA 3CQEA 4HZRA 1QMZA 4PDOA 3GQIA 4I0RA 4E4NA 2ZB1A 1W83A 4Q9SA 2QU6A 2VTNA 3SQQA 5HCZA 3TV6A 4LG4A 4R5YA 5CZHA 1Q61A 4I5HA 2JD5A 5EHLA 3KA0A 1HOWA 4YLJA 4CSVA 2I40A 3W2CA 2HW6A 5FTOA 4DGNA 2YWVA 5IH4A 3SC1A 4ZY4A 4UMUA 4RJ5A 3VBYA 5CEOA 1Y8YA 2EWAA 4A07A 1ZARA 4G16A 4XG2A 3ZZEA 5CX9A 5AP4A 4DEEA 4FUYA 2ZV7A 4XG4A 3RM7A 3UJGA 3WYYA 2XYNA 5ETAA 2DUVA 5JZJA 4BWPA 4M3QA 2C0OA 2QOOA 2R3MA 2YA9A 4RX8A 5CTPA 3DBCA 3PSDA 5GZ8A 3UO4A 3UC3A 5AR5A 3Q9YA 2CKEA 4J98A 1EH4A 4BDCA 3P78A 5E8TA 3LCTA 4PP9A 5CSVA 4H58A 4UYNA 2CKPA 3EN9A 2JBOA 4L8MA 3MDYA 3F5UA 4NM5A 4DFLA 3NLBA 4L46A 2GFSA 2C5VA 4F9YA 2UZVA 4BIDA 4RVKA 4NFNA 4YJUA 2CCIA 1OKZA 4ASEA 2XM9A 2QONA 3KU2A 3VRYA 3FMDA 4AOTA 5KBQA 2QG7A 3V8SA 2JIIA 2BRNA 4O0WA 1JQHA 4NM3A 4C3PA 5I9XA 2JDVA 2YN8A 1ZWSA 3BI6A 3O71A 3B8RA 2CN5A 4JAIA 5CASA 4N0SA 4U6RA 4CV8A 3A4PA 4QP9A 2E9NA 3DT1A 4S34A 4TNBA 4U8ZA 2C6EA 5E8WA 1P4FA 2F7ZE 2QR7A 4ZSLA 4CGAA 4EH3A 2REIA 1XH7A 5B0XA 4IAAA 3EIDA 5IA3A 2PUIA 2UW8A 4JVGA 2GNJA 4YR8A 2HOGA 5EM8A 4KRCA 1TVOA 1H1WA 5FWKK 3SOAA 2XNMA 4QMWA 2CKQA 3H9RA 1ZMWA 3V5PA 2GHMA 4WBBB 3PJCA 2CKOA 2A0CX 1WBOA 3KK8A 3FV8A 3E87A 2W96B 3QTIA 4FGBA 4AX8A 3LJ1A 3HP5A 4MXCA 4QPSA 3QTQA 2ONLA 3UIXA 4DE4A 2PE2A 3MJ2A 3OBGA 1GAGA 4G9RA 3CD8A 4EOJA 3SX9A 1PKGA 3GC9A 2JAMA 4BBEA 3G0FA 5HCYA 3QALE 3AD4A 4BCNA 5LVPA 2R0IA 4F7NA 2A27A 4FZ6A 3PY1A 3M42A 4CYIA 4UWYA 2PTKA 2PZPA 3PLSA 2C68A 4BCFA 2P55A 5AR8A 4RX7A 2G9XA 2OH4A 5AV4A 3UOKA 4BWXA 3SOCA 5ANEA 4FG7A 3Q9XA 4U3ZA 4JL9A 4L6QA 4NFMA 3B8QA 5M56A 3WF6A 5M06A 2Z7SA 4BGQA 2YM6A 3D5WA 1R0EA 3LM0A 2UZBA 2YDIA 3HDNA 4XP0A 3U6IA 3S00A 3TN8A 3RAKA 3DBFA 3HV3A 4MQ2A 4CZTA 5IEXA 5HGIA 2XK3A 3ROCA 3P7BA 1Q3DA 4DTKA 1JKLA 2C6KA 4DC2A 4IJ9A 3G9NA 3TV4A 5BVFA 1DAWA 3NUSA 4O7SA 1JPAA 2VTQA 3E92A 3KVWA 4YP8A 4LI5A 3IK3A 2W4KA 3TNQB 2X8EA 1HCLA 1XR1A 2VNYA 5ITAA 4HPTE 4YJSA 1ZYCA 3A7FA 4DH7A 4IWQA 5TF9A 1M7QA 3VHKA 3R7EA 4WNMA 4F9AA 4I0SA 4X2GA 2XK6A 2OJIA 4F4PA 5FBNC 3F2AA 1ZLTA 3LFAA 2E2BA 4IAFA 3ZHPC 1G5SA 3UGCA 2C6IA 4BDHA 1J7LA 5JH6A 4GKHA 4DFUA 2VWBA 3CGFA 3F5PA 3PRIA 4I23A 2V7AA 1J1CA 5A4TA 2B9JA 4YJPA 2OICA 4IX4A 3WYXA 5CT0A 5L2WA 3KEXA 4FNYA 1ZOGA 1YI3A 5CF8A 3EN4A 4O7ZA 4M14A 3PA3A 2X0GA 5LWMA 3FEGA 5HE1A 5ANKA 2C3LA 2XIZA 2XS0A 2I0YA 3GOPA 3ATSA 1ZYDA 2VTLA 4P5ZA 3TUCA 3OTVA 2WIPA 3F7WA 4MWHA 4ASZA 4FL1A 4DFXE 3H10A 3D5VA 4HW7A 1ZXEA 3VUGA 4O0YA 4QMQA 5IH5A 2R3FA 1YI4A 2ERKA 4DH5A 4ZEGA 4C62A 4CMOA 4D2VA 4D2SA 4EH5A 3UIMA 2XZSA 2W0JA 3LFDA 4GFOA 2OJ9A 4AUAA 3L1SA 4BI2A 2PVLA 2J90A 4IDVA 3ZOSA 4AP7A 4ANNA 4B99A 5J8IA 4M69A 4O91A 4IFGA 4DTAA 2CNVA 5HU3A 3ZM4A 3L9MA 3WIKA 3UO5A 5KKRB 5IQHA 5BPYA 4GRBA 3RWQA 4UMQA 1OI9A 2R64A 4TNDA 5EI6A 4YBKA 2NNWB 2VO3A 4JR3A 3EFKA 3KY2A 1CSNA 3QCXA 4MHAA 5IKWA 4AZEA 4D5KA 5JKGA 1UNHA 4D4YA 3BE2A 4LMNA 2YERA 3FI4A 3EMGA 4ITJA 4XUFA 1Q8UA 4HYIA 5CNNA 5DA3A 3F3ZA 1Z9XA 3P08A 3RKBA 2X7OA 2QLQA 4BWKA 2BUJA 1LP4A 3KN5A 1Q97A 3MFRA 3NNVA 2QQ7A 4ENXA 4FTRA 3KL8A 4FEQA 2B53A 4RSSA 3E8EA 4BB4A 5DMZA 2XK4A 5HLWA 1M14A 3EN6A 4CXAA 1I09A 4HGSA 4NEUA 4M15A 4UZDA 4E20A 4PPAA 2GTMA 3DXQA 3F9NA 2CN8A 5CEMA 2RIOA 2WMUA 1W98A 1BUHA 4PF4A 3C4ZA 5J79A 5H8BA 5IG1A 3T9TA 3HAMA 4EHZA 3AC3A 5HD4A 4WO5A 4CMTA 2AC5A 5E90A 1H28A 3FI2A 3NIEA 4ZSAA 5HHWA 5L8LA 2VAGA 5F4NA 2B4SB 2BZIB 4QTDA 4R3CA 4EOSA 3ZS5A 3KCFA 4MD8E 4WNKA 4EORA 5KBRA 4O7LA 1TQIA 2PVRA 4ZJIA 4FVPA 1H00A 5AUVA 5A9UA 4RFZA 2JAVA 3D7TB 2R4BA 3BWFA 2IVUA 3IS5A 4BGHA 2QG5A 4LMUA 3HV4A 1AGWA 4XG6A 2BZKB 4QD6A 2VWVA 4RMZA 5CYIA 4M12A 4D4SA 4FODA 3DZQA 3RZFA 3FQSA 2EB2A 3SAYA 3ZDUA 4C33A 4FV7A 4ALVA 2UVYA 4CFWA 1PY5A 3R73A 4M97A 2X81A 3OWKA 1R1WA 1OGUA 2UV2A 4L42A 4RWJA 3K5VA 5CVFA 4I4EA 5HLPA 4BCKA 4CQEA 4FUXA 2XYUA 3CC6A 4QMLA 5B2KA 4EYJA 2X6EA 2BAQA 2CLQA 5JEBA 3VUHA 2GPHA 3GI3A 5LMKC 2OXXA 1H1QA 2V5QA 1YXXA 2WB8A 3NCZA 4WHZA 3TWJA 3W33A 4KNBA 4Y95A 3KRWA 1FMKA 2W05A 3F3VA 1GZKA 3ZUUA 3NUPA 2IVVA 3SXSA 2R3GA 3DY7A 3LLAA 4G5JA 1KOBA 2VWZA 4RIYA 1Y6BA 3QBNA 5CSPA 3H4JA 2X2KA 3QAME 3QTRA 2OW3A 3T3UA 4G3EA 3D2KA 5FQDC 5AP5A 3ZEPA 4ZMEA 3PVWA 2ESMA 4JRVA 4FV3A 1Q5KA 1JOWB 1ERKA 2VWIA 2XKCA 3PA4A 2C6TA 4X3JA 3UYTA 4XRLA 3UO6A 4B9DA 2FYSA 2UVXA 4BTKA 5AIKA 1U54B 3ET7A 4KWPA 4B8LA 5HG5A 3S4QA 2C3IB 5H8EA 4AA4A 3BYSA 4UZHA 2BHEA 4OTIA 1DI9A 3UOHA 4CEGA 5LVLA 5AM6A 3SW7A 4I41A 3C13A 3OWJA 2BRHA 2OZOA 3DK6A 3G0EA 4EKKA 4LFIA 5CEKA 2J0LA 4FKSA 4QYYA 4AOJA 4M68A 3A4OX 3VJNA 2YM8A 4DFYA 4IWPA 4FKIA 4GU9A 3NZ0A 4FIFA 3F5XA 4MF1A 3MTLA 3EL8A 1RDQE 5BUEA 2G2IA 4OTWA 1V0OA 4BC6A 4J99A 3ZO3A 2XA4A 3R9NA 4E4LA 4MAOA 3EFWA 4TPTA 2FH9A 4DAWA 5FTQA 5G1XA 4AACA 4EH6A 2Z8CA 4E3CA 2YCFA 3G5DA 4JIKA 3TUBA 4S32A 2UW9A 5AR2A 4MWIA 4CKIA 1YXTA 2EUFB 2F9GA 5DN3A 4DINA 4ZJVA 4NIFA 2WTKB 4FI1A 4AQCA 5KMLA 2PUNA 4YLKA 1PXIA 2PPQA 4TWCA 3I0QA 4FSUA 2VTSA 3COHA 4XG9A 4YTHA 5DR9A 3R9HA 3TIYA 1U4DA 3EOCA 4ZTSA 3B2WA 4AU8A 4HCUA 1Y8GA 3EYGA 3R22A 3PXFA 4ANSA 1M2PA 4BDGA 2BZJA 4R3RA 2X4ZA 4GCJA 2YIQA 4FT0A 2J0JA 3ZXTA 5M4IA 3G9LX 3Q6UA 3HRBA 1W82A 4IX5A 4K6ZA 3JPVA 5AIRA 2C5YA 2B55A 4L3LA 4ZJJA 4BFMA 1R78A 4EOLA 5BYLA 2YCRA 4QP6A 1PXMA 3MY5A 4UALA 3VUKA 4AFJA 1JSUA 4G6LA 2QHNA 4A4XA 3GFEA 3LCDA 4NKSA 3V6SA 4O6LA 3PRFA 4OGRA 2HK5A 2YLEA 3CTHA 2UZEA 1J7UA 3CY2A 3PVBA 3GUBA 4R8QA 4FTIA 1YHSA 4ZLZA 2XB7A 4PTCA 5KZIA 3SRVA 4BZNA 4PMSA 2YJSA 5EW9A 4BGGA 5J9ZA 1H0WA 3FYJX 1QPJA 3NEWA 2QC6A 4A9TA 4TYIA 5CU4A 3FZ1A 3LCKA 1ZAOA 3EN7A 3TV7A 3C4EA 4FGRA 1ZZ2A 3MSSA 5E1EA 5LVMA 4ANLA 2R3IA 2P4IA 5JFXA 3RWPA 1WCCA 4K9YA 4KKGA 2OZAA 4PMMA 5AP3A 2RFNA 1T45A 4R3PA 3ID6C 2WZJA 1OITA 3QC9A 4GIHA 2HZNA 3FHIA 4YJVA 4BYJA 2I1MA 1GOLA 2WQBA 4QTCA 5EDRA 2JC6A 4USDA 5D12A 3MIYA 4FT9A 5CT7A 4CTCA 4J71A 4RFYA 5H8GA 3PXYA 4UX9A 3GCPA 3BLRA 5KMIA 4HZSA 5ANGA 2H9VA 4BDKA 4YUQA 3JR1A 3EQPA 3DA6A 2HWOA 2E9VA 4O38A 3UG2A 3ZFXA 3UOJA 3R8LA 2RFDA 2VX1A 2JDOA 4GG7A 3TNPC 4AE9A 4USEA 3FSKA 3N51A 3OCGA 3ALOA 5EW3A 3UVPA 5KMKA 2WOTA 5LCJA 2A1AB 1XH6A 1ZYLA 3DTCA 3ZC6A 2R3LA 3CEKA 1UV5A 2OI4X 1OBDA 3HRCA 3TTJA 2QOCA 4KB8A 3UVRA 2KTYA 4FKUA 4AOIA 5TKDA 3O7LB 4TXCA 1G8AA 3TL8A 1H26A 4YTFA 5IDPA 2X7GA 5IUGA 2PMLX 4L3JA 2B9IA 2WTWA 3VBXA 4ARKA 4IZ7A 5F95A 4G1WA 3KN6A 3O17A 2BAKA 5HTBA 3W16A 2XBAA 1YXUA 2O3PA 3E7OA 2YIYA 2C6LA 3DV3A 4RLKA 4FTLA 3MIAA 2QHMA 4F7LA 5HBJA 2PK9A 5LMBA 4FKPA 3S0OA 3AT4A 3JXWA 1MRVA 3PPJA 2I7QA 3FSFA 3PJ8A 4L9IA 5E1SA 4NTSA 2PVKA 5CENA 4FEWA 2C6MA 4AW5A 5HX6A 4KKEA 1KE7A 3O8PA 3AC1A 3Q5ZA 5DYJA 3FZPA 2Y4PA 4XP2A 2W1ZA 3QD4A 4LOOA 4JG6A 2BROA 1OPLA 2UW4A 2HXLA 4GH2A 3FLZA 4J8MA 5CNOA 3QZGA 5M51A 1JKKA 4TTHB 1MRYA 1Y91A 2P3GX 4GU6A 4HCVA 3JUHA 2EVAA 3QTUA 5EQPA 5LMKA 3QCQA 1YDTE 4UMPA 3AGLA 3H9FA 4P4CA 4EBWA 1E9HA 4TT7A 5I9UA 3HRFA 4XCUA 4BI1A 3IECA 4EZ3A 4OBPA 2Z7QA 4PL3A 2WNTA 3PA5A 5FM2A 2O5KA 4OTHA 3OD6X 3MH2A 4GUBA 1UVRA 1B6CB 4FEXA 3GU8A 4O0RA 5E4HA 3TDVA 5CU2A 5GINE 2WOUA 3POOA 4YC3A 2AC3A 2YM5A 3EKNA 3BKBA 1YDSE 4RVLA 3SXRA 3OFMA 2IG7A 3DLSA 4G5PA 3VF9A 1B38A 2JEDA 3GOKA 2Y6OA 4IAYA 4QP8A 5IQFA 4IX6A 2G15A 4QPAA 4S33A 3VNTA 4AGDA 2X2MA 5EKNA 3VAPA 3DPKA 3C4FA 2C6DA 3EQHA 2H96A 3QHWA 2WTVA 3PLAE 3LXKA 2QCSA 3U9NA 1OPJA 2YM4A 5CALA 3BEGA 5K4IA 3OWLA 4AGCA 5A6NA 4O7TA 4USFA 4PMTA 2VNWA 3C4CA 4QO9A 5C27A 1DI8A 5CEQA 3JS2A 2QR8A 3ZRKA 3HA6A 1JNKA 4DYMA 4ZY5A 3R8UA 3TTIA 1M52A 1QPCA 2JLDA 3F2NA 2KULA 4QMZA 4FIEA 5LMAA 5JQ8A 3LJ2A 2I0HA 5HG7A 3L9LA 4ASXA 4AZSA 4UMRA 2VWXA 3P5KA 3VS7A 2W4OA 5E8VA 4DN5A 2Z2WA 2XJ2A 3PYYA 3U6JA 5FUTA 4PDPA 4JQ8A 3HL7A 4CFXA 3HKOA 1FGKA 4W4WA 5C01A 1OBGA 3IDPA 4ANQA 5BMSA 5HE2A 5IA1A 3ODZX 3IOKA 3QYWA 5TOZA 3K54A 3RHKA 4ID7A 3V8TA 4BCJA 2HY81 1H27A 3KB7A 2GNHA 4HGEA 4PL4A 4WA9A 4IWDA 4AN9A 4NJ3A 4ACMA 2RFEA 1REKA 2JKQA 4FR4A 5J87A 3H3CA 2NO3A 3DKCA 3O51A 2HXQA 4RVMA 2BALA 4GK4A 3ANRA 4OTDA 4D9UA 4C34A 5K0XA 4P5QA 1F5QA 4KBKA 4DBNA 3LMIA 4L45A 1H08A 3PG1A 4HGLA 2BIKB 2Q0NA 4S2ZA 4WT6A 4YTCA 3NDMA 3LQ3A 3MESA 5GIOE 2PVYA 3ELJA 3OHTA 4P2KA 4FK6A 5D9HA 3OC1A 4KRDA 4O1PA 4EYMA 1J1BA 1WMKA 2HELA 4FT7A 4YHTA 1K9AA 1UU8A 4FV9A 5IEYA 2PZ5A 3BYOA 3OEFX 2CJMA 4JAJA 4QYEA 3TZ9A 3IGGA 2RKUA 3O7LD 4FV8A 3UTOA 5AR4A 1PYEA 3VBQA 3UQFA 3NIZA 3DBEA 3W18A 4D1XA 3MH0A 5IQDA 4G3GA 4X7QA 3K5UA 5AUYA 3V6RA 2JDSA 2ZMDA 3ZSGA 5IMXA 4AT3A 4UY9A 3GC8A 3VN9A 5JFVA 4OT6A 3OW4A 5LARA 4A4LA 4GUEA 1YXVA 4YZ9A 2VTIA 3LM5A 3SA0A 5M09A 2FA2A 4FSMA 1MRUA 4BKZA 3IOPA 4YJTA 3VUIA 3HNGA 2CNUA 3ZLYA 4DFZE 3MN3A 3IW8A 4PDSA 3EQDA 5FRIA 5A54A 2BCJA 2ETRA 3UIBA 3IW5A 4FYNA 1CDKA 2P2HA 2AYPA 3R71A 4O96A 3NUAA 4FEVA 2HY0A 5L8KA 4FT5A 4ONAA 2OU7A 1KE6A 3OMVA 2GS6A 4ITHA 2BKZA 4N70A 1XBBA 3LIJA 2X4FA 3CSVA 3FL5A 2XRUA 5CU6A 3C0IA 5JGBA 2RGPA 3E88A 2XP2A 3PXQA 5AP6A 3G6GA 5FG8A 5GJFA 5D41A 1WBTA 3TKUA 4EEVA 4KUJA 3COKA 2F2CB 3NYOA 3I60A 4R77A 3T8OA 1P14A 1PXKA 2IJMA 4ZP5A 3WZKA 1IAHA 2R3PA 4I24A 5HOAA 3LQ5A 4E26A 2R3OA 2UW7A 4AFEA 4DFBA 3AXWA 1K3AA 3GB2A 3VS2A 3G2FA 4FZDB 3RZBA 3ZBFA 4MBLA 4Q2AA 2YIWA 5EI8A 2Z7RA 5CY3A 3ZEWA 4E6QA 1OECA 4MEDA 2Q0BA 2ITZA 3E62A 2PVNA 3MVJA 4FTNA 3E3PA 2VTJA 4HVIA 1JSTA 4MXZA 4EUTA 4C8BA 4IIRA 5HKMA 4E4MA 3KMWA 3ODYX 4RIOA 3T9IA 2V55A 4UBAA 3RINA 5JN2A 2JBPA 4FV6A 4AW2A 3MGYA 4D4RA 3BRBA 5EM6A 4M69B 4XG8A 4F9WA 2PMNX 3WF9A 4BI0A 3ORKA 1U5RA 5EYCA 4DEHA 3GU7A 3QXPA 5L2TA 3DQXA 2GS2A 4K0YA 4BL1A 3RTPA 4A4OA 3AMAA 3M1SA 2ITNA 2YISA 2JKKA 3D7ZA 4WG3A 5ACKA 3UDBA 5BUIA 4XRJA 3NVMB 3LOKA 5CS6A 4D2WA 4LGGA 2R3JA 4BCMA 4F9BA 4XV2A 2UUEA 3R7YA 3Q60A 3QGWA 4IAZA 3VRZA 4CRLA 3NW7A 3ORIA 4V0GA 2BPMA 2C5NA 1Q99A 3W8QA 5CAQA 1PMVA 1Q8TA 2WFYA 3BHTA 5D1JA 3TM0A 1URWA 5AP0A 3PE1A 4MXYA 3UG1A 4AAAA 2X8IA 1TQPA 3W55A 3FXXA 3Q5IA 3EB0A 4FE2A 3QQUA 4U42A 5CAUA 3HA8A 3QWKA 3WARA 4M0ZA 2VU3A 3A99A 2VTMA 1WVWA 5BVNA 5BVOA 3CPCA 3GFWA 5CSHA 1CKIA 3FMKA 4E73A 4IZAA 3Q4TA 4AGUA 4I6HA 4BCIA 1QL6A 2WMRA 5HI2A 4BCGA 2WXVA 2PULA 2GNFA 4C3FA 3ORPA 4QRCA 3P79A 3V3VA 4E5WA 3SG8A 4E6AA 1GNGA 3FY0A 4YZBA 2ITXA 3DAEA 3NPCA 3BYUA 2A2AA 3BGQA 4AA0A 4G17A 2WQOA 4AWIA 2ZDUA 3GBZA 4XJ0A 4GEOA 3FHRA 3QTZA 1U59A 2WMAA 5BUJA 1GIJA 4ZZNA 1NXKA 5CI6A 1Q8ZA 3DU8A 2BRMA 3ITZA 4AA5A 4II5A 4C0TA 4QNAA 1XWSA 4TW9A 3RAHA 4J8NA 5IUIA 4YZMA 4R7BA 2VUWA 3A62A 3IW7A 4GK3A 4DLIA 1M7NA 1MQ4A 4F6UA 3PZHA 3GENA 5IISA 2BIYA 4RIYB 1H07A 4BTMA 2R3HA 4RT7A 2WPAA 2VO6A 3NYNA 4H3PA 1OUKA 2PHKA 4LGHA 3CJGA 3I81A 3NNWA 2W99B 1FGIA 3EZVA 3QA8A 1BLXA 4PL5A 4U9AA 5M44A 1IA9A 4O2PA 3UVQA 4EZ7A 2BRBA 3R8PA 5CAPA 3WZUA 2XKFA 5IU2A 4OAUC 4TZRA 3FC1X 2PZIA 5E8YA 4ZZMA 3C5IA 4ALWA 4BR3A 3ORNA 3F66A 2PVFA 3BQRA 5A4LA 2W7XA 4JJRA 4U80A 2CDZA 3ZC5A 3I1AA 3TEIA 3U4UA 1O9UA 1OL1A 2VWUA 3TUDA 2I0VA 4FKQA 4MBIA 4FG8A 4O22A 4O1OA 4YSJA 2YZLA 2ITQA 4RIWA 1O6YA 4FSZA 4TWNA 4BKYA 5HIBA 3AOXA 2W9FB 5ICPA 5JFSA 3MI9A 4CG9A 4YO6A 5IF1A 4NYEA 3LFCA 1ZY5A 3GP0A 4CLIA 2WD1A 2C0IA 2ZV8A 4D5HA 3FZRA 3QCYA 4WD5A 4DG0E 3FAAA 2LGCA 1UU9A 2QU5A 3OXIA 4L43A 4NM0A 3QL8A 3F88A 3R1SA 4EHGA 3FL4A 4NIFB 2VGOA 4QQJA 2H6DA 4K18A 3DXNA 4A9UA 5M07A 2VTHA 3E3BX 1DAYA 2OIDA 2XEZA 2XUUA 4GSBA 2ETKA 2GNGA 2OJJA 2WQMA 5CQWA 1GIIA 3MW1A 3HMMA 3GCQA 1B39A 1IEPA 2QO7A 4FOCA 1YWRA 2JDRA 3QD3A 2J4ZA 4M13A 2PSQA 3AQVA 3L8PA 4U3YA 3GT8A 3TNIA 3FDNA 4IEBA 5EYMA 1BL6A 5A46A 3EYHA 5CF5A 3MY0A 4GJ2A 1WFCA 2VWYA 2BDJA 2G2FA 3V8WA 4EC8A 2VO7A 3FPQA 1APME 1V0BA 2PYWA 4BBFA 2VTRA 4UYAA 3R28A 4U79A 2O63A 4QTAA 4C38A 3KXZA 4AZFA 2W1FA 1FMOE 4ANOA 5EW8A 3IKAA 1A48A 2BR1A 4IACA 4NUSA 2FSLX 1O6LA 2VRXA 5DEWA 3BHYA 4EK3A 4FSYA 5DBXA 2C5OA 4J96A 4L00A 5CSXA 4F08A 4GT3A 5TO8A 3SRVB 3HMIA 3P86A 5KKRC 4RFMA 4ACHA 3PWDA 4L7SA 1H1RA 2QODA 3NX8A 4M84A 5M57A 2PVHA 5J1VA 3FI8A 3AMYA 4AN3A 4J7BA 3AC5A 3A60A 3H0YA 2IVTA 5EYDA 3UZRA 4RC4A 5C4KA 2WGJA 5T6KA 3QZFA 4I20A 4JDIA 2OZAB 3FQEA 2J6MA 4QTBA 5DT4A 4EH4A 2V62A 4I5MA 5C8NA 4O84A 5CF4A 1BL7A 3DFAA 4WUNA 4AG8A 4BTJA 4LUEA 5HTCA 3SLSA 4U7ZA 3MBLA 1BYGA 4NU1A 4NW5A 1UNLA 3R2YA 3R1YA 4CCBA 4I5PA 4D9TA 4DGLC 3PXRA 5G6VA 3PSBA 3V51A 4KIKA 4RX5A 2HWPA 4MXAA 4X3FC 3DDQA 3DB6A 3ZM9A 4MD7E 3FMEA 5TR6A 4YHJA 3HVCA 4K11A 3WZJA 2BHHA 4NW6A 3RAIA 4XV1A 4CCUA 1W7HA 2B9FA 4G34A 3NNXA 4LYNA 1U5QA 2YABA 4LOPA 3DOGA 3AD5A 3NAXA 2VN9A 4U43A 3C51A 3WI6A 3FQHA 2ACXA 4PWNA 1ZMVA 4I6QA 3FE3A 4GJ3A 4EOOA 3CLYA 2V22A 5AAGA 3IDBA 4OBOA 5CXHA 1ZOHA 2ZM4A 2BTSA 4YZNA 2XJ1A 4AW0A 1H0VA 2YIXA 3HMOA 3LPBA 4Y83A 3UMXA 2V7OA 3IG7A 3ZMMA 1RE8A 3DJ5A 3TKIA 3U51A 3NGAA 2PMOX 4E1ZA 3KXNA 3OXZA 4L68A 4MCVA 4BKJA 1S9IA 1OUYA 3ANQA 1CTPE 3E5AA 4U0IA 5DOSA 3RPOA 2RG6A 1OIUA 3QUDA 1PXPA 4PTEA 4IAIA 5AFVA 4GFMA 4IBMA 4WRSA 2QLUA 3PWYA 2R0UA 4E4XA 4D2PA 3H30A 3NRMA 3UPXA 4JS8A 1PJKA 2OWBA 4YHFA 2WTJA 4KKHA 4QMYA 5FEQA 5IA2A 3F82A 3WE4A 4UWCA 4O81A 3CKWA 1SVGA 2XH5A 3CY3A 4RJ8A 3VBVA 3PPZA 4PMPA 4MNEA 3QRIA 4XOYA 3RALA 3LFQA 1ZYSA 4JDKA 4KBCA 3RI1A 3C7QA 4CZUA 3MA6A 3Q32A 1YW2A 3K2LA 3NR9A 5HESA 3OOMA 3P9JA 4RRVA 2X1NA 3SHEA 3CP9A 4JT3A 1O6KA 4IDTA 4D4VA 4ZAUA 2BDWA 5DFPA 3SW4A 4BYIA 5AUTA 2WHBA 3TG1A 2RL5A 3QTWA 3C0HA 3CQUA 4I6FA 4H3QA 4IB0A 4XLIA 3DK3A 3WILA 4B7TA 2UVZA 3KMMA 3PSCA 3R83A 3TI1A 3O50A 3PY0A 5BVKA 3HX4A 4FMQA 1OL6A 4CT1A 4KSPA 3EFLA 1KOAA 4TKSA 4H39A 2YHVA 4N6YA 4X0MA 1BKXA 2H34A 4X6RA 2W5BA 4BDEA 4C57A 3VVHA 2B54A 4ANBA 4Z7HA 3RPRA 2A19B 4GK2A 5DE2A 1SVHA 3EKKA 4Z9LA 5L3AA 5DLSA 5FGKA 3DFCB 3ETAA 3W2OA 3ZBXA 4E6DA 4NTTA 4X2FA 4CG8A 1JLUE 3F2RA 1IRKA 4CFVA 4FTJA 4KBAA 1OIQA 2ZAZA 3WF5A 4U97A 1H01A 3RPVA 4LQMA 5HBEA 3PFQA 4HNIA 4XEYA 2RSVA 3SGCA 4EH7A 4AZVA 4G3DA 4OAVB 3H0ZA 3F5GA 3PTGA 5EDPA 3WZDA 5CU3A 5FEDA 1Z57A 3HDMA 5FLFA 1YOMA 2VTPA 4U5JA 5ETCA 4G6NA 4D28A 5EHOA 2OXYA 4GYIA 2C0TA 3VBTA 1XJDA 4BIEA 2C1AA 4UB7A 2IW9A 2YDJA 2J2IB 2J0KA 5CWZA 5C8KA 5CLPA 1YHVA 3R1NA 5AV2A 4EI4A 4DA5A 2A4LA 3TKHA 1YI6A 1MQBA 3N9XA 1MUOA 2PUUA 3DTWA 4IADA 4PNIA 1YQJA 4IB1A 5HBHA 4DEDA 3LFEA 2BTRA 3NNUA 2QOLA 3GU5A 5B7VA 2WTDA 1OIRA 3UMWA 5BVDA 3MPMA 1BX6A 4Z7GA 3IGOA 4AGWA 4AT4A 1ZYJA 3HEGA 1PW2A 2J5EA 3ZLSA 5AA9A 5E92A 4ZTQA 5AJQA 4IFCA 4GIIA 1J91A 2F2UA 3Q2JA 3PG3A 1JKTA 4JX3A 5C03A 3SDJA 4HCTA 5DT0A 2BDFA 4XNEA 2EB3A 3V5TA 3E64A 3RP9A 2I0EA 1Q3WA 4FIGA 1A06A 4U81A 4I93A 3V5LA 5HQ0A 3R04A 4XG3A 4ZSEA 4I21A 5TT7A 1MP8A 2WMVA 4OTRA 1PF8A 4O2ZA 5GJGA 1SNUA 2IWIA 4ACDA 3DBQA 4FIIA 4F64A 4Z16A 5DT3A 4YJOA 5DI1A 5HNBA 4WSQA 5FXRA 5M53A 4FEUA 4HVDA 4O7NA 4E5BA 1SVEA 2W17A 4EQCA 4QMPA 4EH9A 3TJDA 4BTFA 3SKCA 1FBNA 2OO8X 4TYEA 4FKTA 1OL7A 4OTFA 1Y6AA 3QD0A 3R1QA 3MFTA 5M4FA 3LXLA 3KXHA 3VO3A 3WF8A 1M2QA 4XMOA 5J9LA 4FV4A 2O2UA 2C47A 2XNOA 5J5SA 2XIYA 5J7BA 4Y5HA 5J9YA 3VS6A 4IX3A 2ZV9A 2NRYA 2YCSA 3GCUA 3I5NA 1XQZA 3OY1A 3PJ1A 3QLGA 4I92A 4L01A 4LOQA 2W4JA 3KXGA 4MD9E 4EOQA 5BMMA 1V0PA 4CFUA 5EQYA 3TXOA 1WBVA 3CTQA 3GU6A 3ZUVA 4KA3A 3D0EA 1S9JA 5AM7A 3CPBA 1YVJA 2X8DA 1YOJA 4O82A 1NVQA 3PJ2A 4X3FA 4R6VA 2CSNA 2ZOQA 3GVUA 4JDJA 4Y46A 3T3VA 3ORTA 3KF7A 1OZ1A 4BCHA 3BV3A 3HAVA 4MNFA 3D15A 4EK8A 2WAJA 2YWPA 4AZTA 2ITPA 4YBJA 4GV1A 2Y4IC 5HG9A 5KE0A 2UZDA 3EWHA 4PQNA 1CKPA 5K5XA 3AMBA 3BYMA 4IVAA 3V01A 4NJDA 5E8XA 4CZYB 1PMNA 2DQ7X 3DDPA 4RJ6A 4X2NA 3W8LA 4EQUA 4O7RA 1JWHA 2HENA 1ZRZA 4J53A 3VBWA 1LEZA 5DRBA 3MV5A 5ETIA 4DF3A 4EJ7A 3UP7A 3Q4UA 3QQHA 3TZMA 3CKXA 5HICA 2ZM3A 1URCA 3PVGA 4EK4A 5LVOA 4C59A 4D58A 3C4WA 4QYFA 2XF0A 5H2UA 4ACGA 5BQ0A 4XV3A 5C9CA 3Q9ZA 4DEBA 4PP7A 3F3WA 3CGOA 5HO7A 2C3KA 4I1ZA 4J1RA 4F7JA 5KX8A 1FOTA 4RJ7A 3HMNA 4GT5A 3WZEA 3AD6A 4O0TA 1XO2B 2XKEA 3W2QA 3R7VA 3RNYA 3GGFA 3QX2A 4OT5A 3BU5A 4Y5QA 3UPZA 5I3RA 3QKKA 4MQ1A 3TZ8A 1FINA 3ZO4A 5F20A 2BFXA 3MFSA 3D4QA 4FZFB 3PIZA 4MKCA 3VUMA 2OKRA 1GZNA 3A7GA 4XH6A 4FVQA 3CXWA 4C4EA 4QMTA 3M2WA 4C02A 1QPDA 3RJCA 5CEPA 4YC6A 4LV8A 3P0MA 1ZY4A 4IC8A 4C4FA 4IVCA 2YEXA 1NT2A 3VHEA 1ZOEA 4M8TA 1X8BA 2XEYA 3FJQE 4IZ5A 4NK9A 4F0GA 5A4CA 3QF9A 4IXPA 5A14A 2UZUE 4EHVA 2EXCX 2NP8A 3FXZA 2R3NA 3LXNA 2G01A 4RZVA 4WNOA 5AADA 5E9EA 4R5SA 2X2LA 1TQMA 3OUNB 3S2PA 1RW8A 2PL0A 3V5WA 1GIHA 3O23A 3FMJA 1IAJA 4ZTHA 4V0GB 2HIWA 2HZ4A 2XIRA 2Y8OA 4OLIA 2EU9A 3QRUA 2FSOX 4LM5A 1Q8YA 4Y73A 1WBPA 4QQ5A 5AP2A 4JG8A 5AA8A 5M08A 4BHZA 1TKIA 3KRLA 4FNXA 3P4KA 5I3OA 3DB8A 3MY1A 5FP5A 2G2HA 4MTAA 1H25A 4G3CA 3KK9A 4IE9A 4C61A 1W0XC 1SM2A 4D1SA 5GZAA 5IUHA 5HD7A 1LUFA 2X6DA 4DBXA 2OIBA 3HUCA 4R1VA 1Y57A 5AR3A 3NAYA 4PV0A 4O6EA 4H1MA 5HORA 4FTKA 3S3IA 5M4CA 2R7IA 1WAKA 1YWVA 2XCHA 1RQQA 3FMMA 4FTMA 4FTOA 5DR2A 1LPUA 2IN6A 1NW1A 1IA8A 5IA5A 1WBSA 3EQCA 4FV1A 2ONLC 4QMVA 3RAWA 1CMKE 4QTEA 4EK6A 5DPVA 4JBPA 3SD0A 4RZWA 4EOKA 2XIKA 3VS4A 5EM5A 5CVGA 5A3XA 3L8VA 4YURA 5FEEA 1E1XA 4GW8A 5JK3A 5CQUA 3MB6A 3LAUA 4MYGA 5KZ0A 3OCBA 3QQFA 3LFFA 4FSQA 5HIEA 5IH6A 4CKJA 3QUEA 1H1SA 4IM2A 4GFGA 1UNGA 2C30A 2CPKE 4OBQA 3LE6A 3KRRA 3U9CA 1PXNA 3AC4A 4PRJA 4AN2A 1DS5A 3COIA 2GTNA 4DHFA 1OIYA 3HV5A 3IDCA 5AP1A 5HVJA 4P7EA 2X9FA 4DH3A 2W1CA 3G51A 4GS6A 3VW8A 2WQEA 2ETMA 4QPMA 2BAJA 2Z60A 4KIPA 4RJ4A 5ANJA 3PP0A 4CYJA 1L3RE 1REJA 5J5TA 3LFBA 1ZMUA 4FG9A 3MB7A 2O8YA 4BDJA 4G2FA 4WG5A 4I94A 5FTGA 4XX9A 1SNXA 2JFMA 3R63A 1VYWA 4CVAA 5AP7A 1KUTA 1KV1A 3IONA 1QCFA 3ZO2A 2XM8A 3R01A 5AX9A 2ZDTA 1H8FA 1STCE 1T46A 4K2RA 3QQKA 5HX8A 1K2PA 3TZ7A 1UWHA 3KRJA 4RIWB 3H9OA 5EK7A 3RCJA 3ZSIA 3JVSA 3DZOA 3F61A 4F63A 3MVLA 2WTCA 2C1BA 4XBUA 5L2QA 2ZYBA 3CIKA 2Z7LA 3KULA 4DITA 4A9SA 5AV3A 5ANOA 2E9UA 3P1AA 4QMXA 3VUTA 4W9XA 3L8XA 1LR4A 4ZTRA 5HLNA 4GVJA 5FXSA 4QMUA 4FV5A 3CCNA 2IZUA 3FBVA 3KGAA 3MJ1A 4J97A 4RWIA 5BVWA 5JMSA 4FZAB 5FDPA 5C1QB 4OUCA 1A9UA 3NW6A 2VWWA 2UW0A 3BIZA 1YXSA 2C69A 3FMHA 1GZ8A 3AC8A 3MWUA 3QZIA 1FVTA 1Q41A 3E63A 4DEAA 3KQ7A 5IQIA 4IM3A 4AE6A 2YZAA 5HVKA 3QC4A 1QPEA 2J50A 3BQCA 3RMFA 3WOWA 4I22A 4C3RA 4X21A 4O86A 3C4XA 2NRUA 3R00A 2CCHA 4FX3A 2FO0A 3QKMA 2ITVA 2YM7A 3IW4A 4FKWA 4QP3A 4C2VA 4BRXA 3DLZA 2J7TA 4UN0C 3AGMA 4EL9A 5L8JA 1UKHA 1XBAA 5JT2A 2OJGA 4FVRA 3ZH8A 4IANA 4ZS0A 4MXXA 1YKRA 4M0YA 5AWMA 3JVRA 3P7CA 4JBQA 4WKQA 4CFNA 1FPUA 4PPCA 5C8MA 2WMWA 4ZTLA 2YCQA 3I0OA 3DAJA 4C4GA 4C4HA 3F6XA 5B2LA 3UNJA 2R3KA 3VW6A 2CGUA 3GC0A 4DGOA 5JRSA 3QRJA 3BBTB 4TYHA 1GZOA 5T68A 4F0FA 3ACJA 3V5JA 3TNHA 3S95A 3POZA 4D2RA 2BVAA 4HYSA 4EJNA 2BFYA 5KMJA 2E9PA 3UIUA 3PZEA 4YTIA 4FSTA 4ZTMA 2OBJA 4QOXA 3QZHA 2IW8A 1VYZA 1OL5A 3IW6A 3WIGA 1OKWA 2B52A 3LQ8A 5CANA 1SZMA 3B2TA 5IPJA 2JKOA 4M66A 4Z3VA 1UA2A 4F99A 5HE0A 3MH1A 4QYHA 3TCPA 4B8MA 1F3MC 4TN6A 2OSCA 4QMMA 3F69A 2VZ6A 5HNIX 4FTUA 4ZLYA 5L6OA 5LOHA 4DT9A 4BDIA 2IZRA 5IEVA 4KIKB 5HNGA 4EWHA 1WBWA 2F4JA 2QOBA 3FPMA 4XG7A 3RPYA 3ALNA 5K5NA 1IR3A 1V1KA 1XHAA 3ZONA 5TE0A 3R2BA 4JG7A 4K8AA 4U41A 4APCA 3U87A 1OKVA 1OVEA 4IJPA 4IAKA 1J7IA 3QTSA 2GNIA 4BDDA 4B4LA 3EQIA 4DEIA 5I9YA 2RG5A 3EN5A 4IZYA 5H3QA 3G15A 5GIPE 2PMIA 1P2AA 5FBOA 2FSTX 3GEQA 3BHVA 4BCQA 2YITA 4G6OA 4F65A 4O0UA 5EKOA 2OH0E 4M7IA 4BF2A 2BRGA 2J9MA 3UNZA 5JZNA 3Q6WA 4B6LA 3FLWA 1VEBA 2PY3A 3DJ7A 4IVDA 1PXLA 2DWBA 2VX3A 5DH3A 4DLJA 3NYXA 1R3CA 5FD2A 4HPUE 3OT8A 4E93A 5B2MA 3ENMA 4HVHA 2R5TA 2UZOA 3R0TA 4X6QC 4R1YA 4FBXA 4I6BA 3EFJA 3DK7A 4YMJA 4ZMFA 4BZDA 5IA0A 2V0DA 5DHJA 4OTQA 4FNWA 3VS0A 4EUUA 1OB3A 1OPKA 4MNEB 3DKFA 3A2CA 5AMNA 4B0GA 4FV0A 5BNJA 3RNIA 4WBOA 2XCKA 1UU7A 2QOHA 1YRPA 3BCEA 3D2IA 2VD5A 3PY3A 3IQ7A 4AF3A 1AD5A 3R02A 4FKRA 4O21A 3LCSA 1NVRA 4Q5EA 4HVSA 3C1XA 4RC3A 3O96A 3UQGA 3QQJA 3ZRLA 2YAAA 4QP4A 4RWKA 3BPRA 4RA4A 4D0XA 5EG3A 2JKMA 3VQUA 3NUNA 4ANMA 1JKSA 3DJ6A 4J95A 2VTOA 3OWPA 4RG0A 3UE4A 1BI7A 3W2RA 4U40A 1WBNA 4OTGA 4N57A 2PE1A 2Y9QA 3V5QA 4HNFA 4DH8A 2ITOA 3ZLXA 3REPA 2WTIA 3JY9A 5L4QA 3FKLA 4MXOA 2W06A 4YLLA 1H4LA 1DM2A 2GCDA 4V05A 3SXFA 3KXMA 4NSTA 5KMNA 4HGTA 3E7VA 2YDKA 4C7TA 5DG5A 5EDQA 1XKKA 4KINA 2YM3A 2ZM1A 4D55A 5E8UA 4EOMA 4QYGA 3DXPA 4PNKA 4TWOA 4CV9A 4DEGA 3BU3A 4FIJA 5F1ZA 4J52A 4YU2A 5JSMA 5AUXA 5LCKA 4JDHA 3KFAA 5CZIA 5AAEA 2B0QA 2Y6MA 2PU8A 3QU0A 4R78A 4XYFA 2ITTA 2ITUA 2PVMA 3DQWA 3FXWA 4S31A 5D7VA 4Z55A 4IWOA 4FKLA 4RA5A 2J0IA 3I7CA 4BDBA 4IM0A 3Q4ZA 1H24A 3FLNC 4BCPA 3A7JA 4QP7A 4WNPA 4IW0A 5FM3A 4JI9A 3UC4A 5BYYA 3ZLWA 1HCKA 2LAVA 4H3BA 1R0PA 4RIXA 3U4WA 4JBVA 2F57A 3P7AA 3OCSA 4LGDA 3PPKA 4BDAA 5M55A 1NA7A 3F3UA 3CS9A 4FSNA 3MS9A 5CXZA 3KXXA 4BVUA 4C4IA 2X9EA 2VTTA 4FTTA 3KMUA 3DBDA 1PYXA 4YC8A 1L8TA 3OCTA 3BYVA 2P2IA 4RWLA 5AR7A 4Y85A 4F1TA 4ZZOA 1I44A 4G9CA 5CI7A 3U8WA 3DGKA 3RK9A 5HEZA 2F7EE 2WKMA 2P0CA 4GL9A 2ERZE 1GJOA 2QOIA 2HZIA 3R21A 4H05A 3GCVA 3BLQA 2YAKA 3MFUA 2H8HA 2GFCA 3BU6A 1OMWA 3ULIA 4ZSGA 3BELA 4L7FA 2CHLA 4WOVA 3R8ZA 4D0WA 4WSYA 1SYKA 4XOZA 4W8DA 4F1MA 3BWJA 3FY2A 3ZO1A 2IO6A 5EFQA 4O83A 2HZ0A 1NVSA 1PRYA 2XNBA 4ZIMA 3BV2A 5KO1A 2W1GA 3COMA 1Q4LA 4ASDA 4QMSA 4QT1A 3RVGA 1Q8WA 1VR2A 4A06A 2WELA 2BMCA 2O65A 3NSZA 5CF6A 4PX6A 4I5CA 4F7SA 3TIZA 1UKIA 3PUPA 2YFXA 2IPXA 5HO8A 2WIHA 2UW6A 2X39A 3AT2A 5EOBA 5GNKA 3VS3A 1G8SA 3ACKA 2VO0A 3ORMA 3E8DA 2QOQA 3ZUTA 3L9PA 3W2SA 4CD0A 2CGXA 3D9VA 4RVTA 3HLLA 3Q3BA 2W5HA 4G31A 2EXMA 1Z5MA 4DCAA 1H1PA 3EHAA 3EJ1A 3LCOA 3FLYA 4XS2A 4F9CA 3D83A 4DG3E 5HZNA 3TNWA 3R7UA 5ETFA 4DGGA 4GT4A 4LV5A 5AUWA 4X3FB 4KABA 3WF7A 3N4UA 4YZDA 3PJ3A 4ORKA 3BBWA 5T3QA 3G33A 3MA3A 2JIUA 2P33A 3OTUA 2PE0A 3PIYA 3EZRA 3VS1A 2JIVA 2OFVA 4H36A 4CQGA 4PTGA 1YDRE 2XMYA 4Q5HA 4EQMA 1AQ1A 3F7ZA 4ZY6A 4IMYA 2R3QA 3UQCA 4O7WA 5EOLA 4P90A 1YOLA 5EH0A 2DYLA 3BLHA 1JAMA 2UZNA 3EQBA 4O0VA 3R9OA 4DTBA 4FL2A 3I4BA 2JFLA 5LVNA 4NL0A 3OROA 4PPBA 3LFNA 2C6OA 3FUPA 3DKGA 5E8ZA 4EWQA 2RFSA 3ORLA 1JSVA 2JITA 4KAOA 3I7BA 5I9ZA 1M2RA 1XBCA 2QNJA 3II5A 1NY3A 5KHXA 1OKYA 3SVVA 3C50A 4E5AX 3R9RA 1E1VA 4YGAA 4JOAA 1W84A 4LL5A 2B7AA 2XBJA 4TRLA 2Q83A 2UZWE 4XBRA 2Y0AA 3BHUA 5ANIA 4FYOA 3G6HA 3K3JA 4R7IA 3QCSA 3WE8A 3ZFYA 4PY1A 3VC4A 1M17A 4PUZA 5AEPA 3QX4A 4YO4A 3QXOA 4UXLA 4NWMA 4NT4A 3ORXA 3FMNA 2PZYA 4EONA 4FL3A 5FP6A 1CM8A 1XH5A 2WO6A 1JBPE 4K1BA 4L3PA 1FVVA 3OXTA 2ZJWA 3LJ0A 2YLFA 5IZFA 3IO7A 5E91A 3HYHA 4RBLA 5DVRA 4MK0A 3DNEA 3R7IA 3CTJA 3EQGA 5GHVA 4ENYA 2BZHB 5I9VA 2J5FA 3D5XA 3R7GA 4JIAA 2R7BA 3Q96A 4MH7A 4X2KA 4BDFA 4FT3A 2RF9A 3ZXZA 3HP2A 2WTKC 3NVKI 4LRKA 4CFMA 4D1ZA 4YNOA 2WMQA 5AAFA 4O7YA 4PDYA 5BVEA 4HYHA 3ATTA 1PXJA 3LHJA 3QQGA 4TYGA 2OXDA 5HE3A 4O7VA 2QO2A 3OW3A 4LRMA 3OOGA 4EHEA 1BMKA 3ZCLA 2GQGA 4FKGA 4RPVA 3GXLA 3LVPA 3PXZA 3HZTA 3EH9A 1VZOA 4QMOA 3ZTXA 4ZTNA 5D10A 5I5ZA 3QRKA 2QD9A 2WQNA 4C37A 2QOKA 1FVRA 4FNZA 4IHPA 1PKDA 2W1IA 4FKOA 3RK7A 5IQGA 3AT3A 2GMXA 4F70A 3OUKA 3QWJA 1Q62A 1WZYA 3M11A 5L2SA 5FDXA 3R8VA 1GY3A 2XNPA 5ACBC 3GU4A 2B1PA 3BZ3A 1BI8A 3EQRA 3FKOA 3FZTA 4DCEA 4OTPA 2UW3A 3F3TA 5ANDA 4ALUA 2OF4A 5BX0A 3QA0A 4RQVA 5KCVA 5KNJA 4CT2A 3U55A 4GVAA 2DS1A 3KF4A 3Q2MA 3PVUA 2B9HA 4C4JA 5I4NA 2GHGA 4JR7A 4FOBA 3DKOA 4X2JA 4YJNA 5EM7A 5IA4A 3MPAA 4UXQA 5IQBA 4U44A 2OLCA 4GKIA 4EK5A 2E9OA 4Y72A 4JRNA 5A6OA 2ITWA 5DNRA 5DRDA 4Y8DA 3E8CA 2HYYA 3RGFA 3OZ6A 3R8MA 5C4LA 4JBOA 3TT0A 3ZFMA 3E93A 2WMBA 4MVFA 1UWJA 3FI3A 5D11A 1Q24A 4HOKA 4IH8A 4GMYA 5E8SA 4IQ6A 4HYUA 5J95A 3QYZA 3CE3A 2OFUA 2G1TA 3U6HA 3FC2A 3D14A 3OT3A 2GDOA 5CVHA 5DEYA 5HCXA 3FYKX 5HIDA 2C5XA 3AC2A 2HCKA 4U45A 4WG4A 3UBDA 1ND4A 2PUPA 3UYSA 4JNWA 3CR0A 4FK3A 4O27B 1KWPA 2O64A 3I6UA 3A8WA 3NWWA 2IZSA 3ULZA 3CQWA 4H1JA 5AX3A 4A9RA 4ZLOA 3W32A 3VF8A 1RJBA 3JY0A 3CD3A 2FGIA 4ZSJA 3BX5A 4CTBA 3LZBA 3OS3A 3LXPA 3OG7A 1W8CA 3THBA 3VIDA 4LL0A 3KVXA 3D5UA 4QQCA 3P23A 1OL2A 3MYGA 3R6XA 2J51A 4XLVA 3OBJA 4TL0A 5C26A 5IQEA 4MX9A 1KV2A 3ERKA 4L67A 4RLLA 3FLQA 4ZK5A 2OGVA 3A7HA 3G90X 4YPDA 3NYVA 4V04A 5GZ9A 4EOPA 2Z02A 4OR5A 4NM7A 1R39A 1YWNA 2QKRA 2GNLA 4FTCA 2PWLA 3NMUF 3ZDIA 4W4VA 4NCTC 4BHNA 4I4FA 4FTAA 2CMWA 2PZRA 2XK9A 3FZOA 3GNIB 3K3IA 3KULB 3U54A 3SG9A 5A4EA 1IG1A 4W9WA 3ZU7A 5HG8A 3D7TA 4BY9E 4WUAA 5AV1A 1FQ1B 4AS0A 2FUMA 2C3JA 3ROYA 5EHYA 5LWNA 2GS7A 1ATPE 4W8EA 3AG9A 5JGDA 2ZMCA 4QMNA 3QD2B 5BYZA 2YJRA 4FICA 3QQLA 5AV0A 3A7IA 2CNQA 3FZSA 4M67A 2QURA 4RC2A 2XNNA 3DS6A 2AUHA 3QGYA 3V04A 4IVBA 2OF2A 2QI8A 4EH2A 5DGZA 2C4GA 4W4YA 4BCOA 4EKLA 3PIXA 3QHRA 4KIOA 4L53A 4YSMA 3RK5A 2WEIA 2R2PA 4YNEA 2Y4IB 5KHWA 3O0GA 4JQ7A 3BE9A 2ZV2A 1PXOA 1XH4A 1KE9A 4FA2A 5JRQA 2VX0A 2QVSE 5HVYA 2O0UA 2CGWA 5FXQA 4KIQA 4FV2A 5EYKA 4HVGA 4GYGA 4QP1A 4FSWA 3L9NA 4DG2E 3Q9WA 2XK7A 4ERWA 3GC7A 3Q04A 4AW1A 1P5EA 2YACA 2ZVAA 3ENHA 4AXAA 5F9EA 3D94A 2F49A 3I6WA 4YJRA 4C35A 4CNHA 2XNGA 3BEAA 3C5UA 3E8NA 1U54A 4RQKA 5F94A 4V01A 4TWPA 4TYHB 4YPSA 5H9BA 3LMHA 5IQAA 1J3HA 1WVYA 3A61A 5I9WA 4CFFA 2GSFA 1LEWA 3GQLA 3R9DA 5IQCA 2XIXA 3BGPA 4WRGA 2GQRA 3SV0A 1KSWA 2I6LA 2FSMX 3N4VA 1XH9A 4YZCA 3JYAA 5K0KA 2F7XE 3KC3A 3FWQA 2JGZA 3RBWA 3WBLA 3PXKA 5LJJA 3RCDA 5KMOA 3CBLA 4WIHA 5IDNA 2X7FA 3EL7A 3LLTA 2UZLA 4F0IA 5L2IA 4G3FA 2IZTA 2WEVA 3MTFA 5CAVA 4IB3A 3LW0A 4ZXTA 5EQEA 5AUUA 4QP2A 4FTQA 3O2MA 1XH8A 1OM1A 2EXEA 3FMLA 4APPA 3HECA 3KRXA 3PE2A 2GHLA 2SRCA 3PP1A 3DCVA 2XVDA 4FIHA 2JDTA 4KSQA 4A7CA 3W1FA 3HGKA 5M4UA 5K4JA 4MBJA 3HMPA 4YJQA 3N4TA 5CSWA 2GU8A 3UNKA 4O0SA 1SMHA 3NUUA 3NCGA 3ORZA 4DH1A 2WMSA 4CLJA 5I0BA 4KD1A 4R7HA 2HAKA 4FC0A 3LMGA 2QO9A 5DR6A 1VJYA 3ZSHA 4NZWB 5CAOA 5L6PA 4F09A 3PDTA 2FB8A 4D2TA 1KE8A 4BN1A 5K9IA 3UZTA 2WMTA 5CEIA 3LFSA 3VS5A 3NS9A 2J0MB 3EQFA 2OIQA 4JX7A 4F6SA 2XKDA 3O8UA 3HV6A 4BBMA 3TDWA 3OY3A 3QFVA 3VWAA 4MF0A 5CU0A 3W10A 5JGAA 3L8SA 2OG8A 3TJCA 3TACA 5LXMA 4ZS4A 2W1DA 2QKWB 4FZ7A 4EC9A 5DIAA 3MPTA 4TY1A 4KS7A 1YHWA 2UZTA 3UOLA 3KKVA 3VULA 1CKJA 1U46A 4JXFA 4W4XA 4F1OA 2IVSA 3C9WA 3CJFA 3ZZWA 4LUDA 4I0TA 4A9YA 4BZOA 4F6WA 2CGVA 5HU9A 3UZPA 4C2WA 3W2PA 2XJ0A 1UU3A 3MH3A 3UODA 3OVVA 4K33A 4EZ5A 1PMUA 3QKLA 2BKKA 4CMUA 2NPQA 3RPSA 2R3RA 3BGZA 2VTAA 2PVJA 2IW6A 3QRTA 3O8TA 3HUBA 4FKJA 2XNEA 4BIBA 5LQFA 5JFWA 4JLCA 1WVXA 3QLFA 5A4QA 3NW5A 2XK8A 3Q52A 3IPHA 1PHKA 3I79A 3KREA 3OEZA 4FF8A 4O0XA 3A8XA 2R9SA 3DNDA 3Q53A 3Q4CA 3BHHA 3QTXA 3FKNA 4DFNA 4EOIA 2GQSA 4CRSA 2W1HA 3GCSA 1ZZLA 3MVMA 4KS8A 1PMEA 4DGMA 5HO6A 2VGPA 2ITYA 4N6ZA 2WMXA 3MVHA 2OK1A 2VV9A 4UMTA 5IMEA 4C58A 3VJOA 3R30A 4BICA 1KE5A 5D7AA 4LRJA 3VUDA 4XV9A 2HW7A 4UEUA
chains in the Genus database with same CATH superfamily
3UP2A 2XRWA 5EI2A 4CKRA 3KCKA 4IB5A 4EBVA 4O4FA 3HV7A 3NUXA 4L44A 4OW8A 2QOFA 4EH8A 4E7WA 2BILB 5KMMA 3VQHA 4Q9ZA 3OF0A 1G3NA 2UW5A 4S30A 4IC7A 2ZB0A 4C36A 4QQTA 3RHXA 3I5ZA 2OJFE 3NUYA 4NCTA 4XP3A 2FVDA 4E8AA 4ITIA 2W9ZB 3OP5A 2WU6A 4UWBA 3RM6A 4TYJA 5GJDA 4RIXB 5AUZA 5DWRA 4UV0A 4RX9A 1G8KA 4DT8A 2Y7JA 2WU7A 4RGJA 3FLSA 5HTIA 3S1HA 5J7HA 4O4CA 4E6CA 1IASA 2YIRA 4NKAA 4AT5A 4ERKA 2W5AA 5J1WA 4ZOGA 4ACCA 4GG5A 4N4SA 4XHKB 5E7RA 1JVPP 3DAKA 4QNYA 4NH1A 3QUPA 4JQEA 4L52A 4RJ3A 5L6WL 3R7OA 3C0GA 3ZRMA 4AZWA 4HJOA 5K3YA 4FKVA 4FSRA 2W1EA 5KUPA 3ZYAA 5JQ5A 4AXDA 1F0QA 1P4OA 4K77A 3LKMA 2CLXA 4I3ZA 3CQEA 4HZRA 1QMZA 4PDOA 5M56A 3GQIA 4I0RA 4E4NA 2ZB1A 1W83A 4Q9SA 2QU6A 2VTNA 3SQQA 5HCZA 3TV6A 4LG4A 4R5YA 5CZHA 1Q61A 4I5HA 2JD5A 5EHLA 3KA0A 1HOWA 4YLJA 4CSVA 4AXEA 2I40A 3W2CA 2HW6A 5FTOA 4DGNA 2YWVA 5IH4A 3SC1A 4ZY4A 4UMUA 4RJ5A 3VBYA 5CEOA 1Y8YA 2EWAA 4A07A 1ZARA 4G16A 4XG2A 4I6LA 3ZZEA 5CX9A 5AP4A 4DEEA 4FUYA 2ZV7A 4XG4A 3RM7A 3UJGA 3WYYA 2XYNA 5ETAA 2DUVA 5JZJA 4BWPA 4M3QA 2C0OA 2QOOA 2R3MA 2YA9A 4RX8A 5CTPA 3DBCA 3PSDA 5GZ8A 3UO4A 3UC3A 5AR5A 3Q9YA 2CKEA 4J98A 1EH4A 3AKLA 4BDCA 3P78A 5E8TA 3LCTA 4PP9A 5CSVA 4H58A 4UYNA 2CKPA 3EN9A 2JBOA 4L8MA 3MDYA 3F5UA 4NM5A 4DFLA 3NLBA 4L46A 2GFSA 2C5VA 4F9YA 2UZVA 4BIDA 4RVKA 4NFNA 4YJUA 2CCIA 1OKZA 4ASEA 2XM9A 2QONA 3KU2A 3VRYA 3FMDA 4AOTA 5KBQA 2QG7A 3V8SA 2JIIA 2BRNA 3UDTA 4O0WA 1JQHA 4NM3A 4C3PA 5I9XA 2JDVA 2YN8A 1ZWSA 5BV3A 3BI6A 3O71A 3B8RA 2CN5A 4JAIA 5CASA 4N0SA 4U6RA 4CV8A 3A4PA 4QP9A 2E9NA 3DT1A 4S34A 4TNBA 4U8ZA 2C6EA 5E8WA 1P4FA 2F7ZE 2QR7A 4ZSLA 4CGAA 4EH3A 2REIA 1XH7A 5B0XA 4IAAA 3EIDA 5IA3A 2PUIA 2UW8A 4JVGA 2GNJA 4YR8A 2HOGA 5EM8A 4KRCA 1TVOA 1H1WA 5FWKK 3SOAA 2XNMA 4QMWA 2CKQA 3H9RA 1ZMWA 3V5PA 2GHMA 4WBBB 3PJCA 2CKOA 2A0CX 1WBOA 3KK8A 3FV8A 3E87A 2W96B 3QTIA 4FGBA 4AX8A 3LJ1A 3HP5A 4MXCA 4QPSA 3QTQA 2ONLA 3UIXA 4DE4A 2PE2A 3MJ2A 3OBGA 1GAGA 4G9RA 3CD8A 4EOJA 3SX9A 1PKGA 3GC9A 2JAMA 4BBEA 3G0FA 5HCYA 3QALE 2NYAA 3AD4A 4BCNA 5LVPA 2R0IA 4F7NA 2A27A 4FZ6A 3PY1A 3M42A 4CYIA 4UWYA 2PTKA 2PZPA 3PLSA 2C68A 4BCFA 2P55A 5AR8A 4RX7A 2G9XA 2OH4A 5AV4A 3UOKA 4BWXA 3SOCA 5ANEA 4FG7A 3Q9XA 4U3ZA 4JL9A 4L6QA 1W2CA 3B8QA 4NFMA 3WF6A 5M06A 2Z7SA 4BGQA 2YM6A 3D5WA 1R0EA 3LM0A 2UZBA 2YDIA 3HDNA 4XP0A 3U6IA 3S00A 3TN8A 3RAKA 3DBFA 3HV3A 4MQ2A 4CZTA 5IEXA 5HGIA 2XK3A 3ROCA 3P7BA 1Q3DA 4DTKA 1JKLA 2C6KA 4DC2A 4IJ9A 3G9NA 3TV4A 5BVFA 1DAWA 3NUSA 4O7SA 1JPAA 2VTQA 3E92A 3KVWA 4YP8A 4LI5A 3IK3A 2W4KA 3TNQB 2X8EA 1HCLA 1XR1A 2VNYA 5ITAA 4HPTE 4YJSA 1ZYCA 3A7FA 4DH7A 4IWQA 5TF9A 1M7QA 3VHKA 3R7EA 4WNMA 4F9AA 4I0SA 4X2GA 2XK6A 2OJIA 4F4PA 5FBNC 3F2AA 1ZLTA 3LFAA 2E2BA 4IAFA 3ZHPC 1G5SA 3UGCA 2C6IA 4BDHA 1J7LA 5JH6A 4GKHA 4DFUA 2VWBA 3CGFA 3F5PA 3PRIA 4I23A 2V7AA 1J1CA 5A4TA 2B9JA 4YJPA 2OICA 4IX4A 3WYXA 5CT0A 5L2WA 3KEXA 4FNYA 1ZOGA 1YI3A 5CF8A 3EN4A 4O7ZA 4M14A 3PA3A 2X0GA 5LWMA 3FEGA 5HE1A 5ANKA 2C3LA 2XIZA 2XS0A 2I0YA 3GOPA 3ATSA 1ZYDA 2VTLA 3AKKA 4P5ZA 3TUCA 3OTVA 2WIPA 3F7WA 4MWHA 4ASZA 4FL1A 4DFXE 3H10A 3D5VA 4HW7A 1ZXEA 3VUGA 4O0YA 4QMQA 5IH5A 2R3FA 1YI4A 2ERKA 4DH5A 4ZEGA 4C62A 4CMOA 4D2VA 4D2SA 4EH5A 3UIMA 2XZSA 2XARA 2W0JA 3LFDA 4GFOA 2OJ9A 4AUAA 3L1SA 4BI2A 2PVLA 2J90A 4IDVA 3ZOSA 4AP7A 4ANNA 4B99A 5J8IA 4M69A 4O91A 4IFGA 4DTAA 2CNVA 5HU3A 3ZM4A 3L9MA 3WIKA 3UO5A 5KKRB 5IQHA 5BPYA 4GRBA 3RWQA 4UMQA 1OI9A 2R64A 4TNDA 5EI6A 4YBKA 2NNWB 2VO3A 4JR3A 3EFKA 3KY2A 1CSNA 3QCXA 4MHAA 5IKWA 4AZEA 4D5KA 5JKGA 1UNHA 4D4YA 3BE2A 4LMNA 2YERA 3FI4A 3EMGA 4ITJA 4XUFA 1Q8UA 4HYIA 5CNNA 5DA3A 3F3ZA 1Z9XA 3P08A 3RKBA 2X7OA 2QLQA 4BWKA 2BUJA 1LP4A 3KN5A 1Q97A 3MFRA 3NNVA 2QQ7A 4ENXA 4FTRA 3KL8A 4FEQA 2B53A 4RSSA 3E8EA 4BB4A 5DMZA 2XK4A 5HLWA 1M14A 3EN6A 2IF8A 4CXAA 1I09A 4HGSA 4NEUA 4M15A 4UZDA 4E20A 4PPAA 2GTMA 3DXQA 3F9NA 2CN8A 5CEMA 2RIOA 2WMUA 1W98A 1BUHA 4PF4A 3C4ZA 5J79A 5H8BA 5IG1A 3T9TA 3HAMA 4EHZA 3AC3A 5HD4A 4WO5A 4CMTA 2AC5A 5E90A 1H28A 3FI2A 3NIEA 4ZSAA 5HHWA 5L8LA 2VAGA 5F4NA 2B4SB 2BZIB 4QTDA 4R3CA 4EOSA 3ZS5A 3KCFA 4MD8E 4WNKA 4EORA 5KBRA 4O7LA 1TQIA 2PVRA 4ZJIA 4FVPA 1H00A 5AUVA 5A9UA 4RFZA 2JAVA 3D7TB 2R4BA 3BWFA 2IVUA 3IS5A 4BGHA 2QG5A 4LMUA 3HV4A 1AGWA 4XG6A 2BZKB 4QD6A 2VWVA 4RMZA 5CYIA 4M12A 4D4SA 4FODA 3DZQA 3RZFA 3FQSA 2EB2A 3SAYA 3ZDUA 4C33A 4FV7A 4ALVA 2UVYA 4CFWA 1PY5A 3R73A 4M97A 2X81A 3OWKA 1R1WA 1OGUA 2UV2A 4L42A 4RWJA 3K5VA 5CVFA 4I4EA 5HLPA 4BCKA 4CQEA 4AAYA 4FUXA 2XYUA 3CC6A 4QMLA 5B2KA 4EYJA 2X6EA 2BAQA 2CLQA 5JEBA 3VUHA 2GPHA 3GI3A 5LMKC 2OXXA 1H1QA 2V5QA 1YXXA 2WB8A 3NCZA 4WHZA 3TWJA 3W33A 4KNBA 4Y95A 3KRWA 1FMKA 2W05A 3F3VA 1GZKA 3ZUUA 3NUPA 2IVVA 3SXSA 2R3GA 3DY7A 3LLAA 4G5JA 1KOBA 2VWZA 4RIYA 1Y6BA 3QBNA 5CSPA 3H4JA 2X2KA 3QAME 3QTRA 2OW3A 3T3UA 4G3EA 3D2KA 5FQDC 5AP5A 3ZEPA 4ZMEA 3PVWA 2ESMA 4JRVA 4FV3A 1Q5KA 1JOWB 1ERKA 2VWIA 2XKCA 3PA4A 2C6TA 4X3JA 3UYTA 4XRLA 3UO6A 4B9DA 2FYSA 2UVXA 4FRFA 4BTKA 5AIKA 1U54B 3ET7A 4KWPA 4B8LA 5HG5A 4DDIA 3S4QA 2C3IB 4DHJA 5H8EA 4AA4A 3BYSA 4UZHA 2BHEA 4OTIA 1DI9A 3UOHA 4CEGA 5LVLA 5AM6A 3SW7A 4I41A 3C13A 3OWJA 2BRHA 2OZOA 3DK6A 3G0EA 4EKKA 4LFIA 5CEKA 2J0LA 4FKSA 4QYYA 4AOJA 4M68A 3A4OX 3VJNA 2YM8A 4DFYA 4IWPA 4FKIA 4GU9A 3NZ0A 4FIFA 3F5XA 4MF1A 3MTLA 3EL8A 1RDQE 5BUEA 2G2IA 4OTWA 1V0OA 4BC6A 4J99A 3ZO3A 2XA4A 3R9NA 4E4LA 4MAOA 3EFWA 4TPTA 2FH9A 4DAWA 5FTQA 5G1XA 4AACA 4EH6A 2Z8CA 4E3CA 4DDGA 2YCFA 3G5DA 4JIKA 3TUBA 4S32A 2UW9A 5AR2A 4MWIA 4CKIA 1YXTA 2EUFB 2F9GA 5DN3A 4DINA 4ZJVA 4NIFA 2WTKB 4FI1A 4AQCA 5KMLA 2PUNA 4YLKA 1PXIA 2PPQA 4TWCA 3I0QA 4FSUA 2VTSA 3COHA 4XG9A 4YTHA 5DR9A 3R9HA 3TIYA 1U4DA 3EOCA 4ZTSA 3B2WA 4AU8A 4O4DA 4HCUA 1Y8GA 3EYGA 3R22A 3PXFA 4ANSA 1M2PA 4BDGA 2BZJA 4R3RA 2X4ZA 4GCJA 2YIQA 4FT0A 2J0JA 3ZXTA 5M4IA 3G9LX 3Q6UA 3HRBA 1W82A 4IX5A 4K6ZA 3JPVA 5AIRA 2C5YA 2B55A 4L3LA 4ZJJA 4BFMA 1R78A 4EOLA 5BYLA 2YCRA 4QP6A 1PXMA 3MY5A 4UALA 3VUKA 4AFJA 1JSUA 4G6LA 2QHNA 4A4XA 3GFEA 3W0PA 3LCDA 4NKSA 3V6SA 4O6LA 3PRFA 4OGRA 2HK5A 2YLEA 3CTHA 2UZEA 1J7UA 3CY2A 3PVBA 3GUBA 4R8QA 4FTIA 1YHSA 4ZLZA 2XB7A 4PTCA 5KZIA 3SRVA 4BZNA 4PMSA 2YJSA 5EW9A 4BGGA 2A98A 5J9ZA 1H0WA 3FYJX 1QPJA 3NEWA 2QC6A 4A9TA 2AQXA 4TYIA 5CU4A 3FZ1A 3LCKA 1ZAOA 3EN7A 3TV7A 3C4EA 4FGRA 1ZZ2A 3MSSA 5E1EA 5LVMA 4ANLA 2R3IA 2P4IA 5JFXA 3RWPA 1WCCA 4K9YA 4KKGA 2OZAA 4PMMA 5AP3A 2RFNA 1T45A 4R3PA 3ID6C 2WZJA 1OITA 3QC9A 4GIHA 2HZNA 3FHIA 4YJVA 4BYJA 2I1MA 1GOLA 2WQBA 4QTCA 5EDRA 2JC6A 4USDA 5D12A 3MIYA 4FT9A 5CT7A 4CTCA 4J71A 4RFYA 5H8GA 3PXYA 4UX9A 3GCPA 3BLRA 5KMIA 4HZSA 5ANGA 2H9VA 4BDKA 4YUQA 3JR1A 3EQPA 3DA6A 2HWOA 2E9VA 4O38A 3UG2A 3ZFXA 3UOJA 3R8LA 2RFDA 2VX1A 2JDOA 4GG7A 3TNPC 4AE9A 4USEA 3FSKA 3N51A 3OCGA 3ALOA 5EW3A 3UVPA 5KMKA 2WOTA 5LCJA 2A1AB 1XH6A 1ZYLA 3DTCA 3ZC6A 2R3LA 3CEKA 1UV5A 2OI4X 1OBDA 3HRCA 3TTJA 2QOCA 4KB8A 3UVRA 2KTYA 1ST4A 4FKUA 4AOIA 5TKDA 3O7LB 4TXCA 1G8AA 3TL8A 1H26A 4YTFA 5IDPA 2X7GA 5IUGA 2PMLX 4L3JA 2B9IA 2WTWA 3VBXA 4ARKA 4IZ7A 5F95A 4G1WA 3KN6A 3O17A 2BAKA 5HTBA 3W16A 2XBAA 1YXUA 2O3PA 3E7OA 2YIYA 2C6LA 3DV3A 4RLKA 4FTLA 3MIAA 2QHMA 4F7LA 5HBJA 2PK9A 5LMBA 4FKPA 3S0OA 3AT4A 3JXWA 1MRVA 3PPJA 2I7QA 3FSFA 3PJ8A 4L9IA 5E1SA 4NTSA 2PVKA 5CENA 4FEWA 2C6MA 4AW5A 5HX6A 4KKEA 1KE7A 3O8PA 3AC1A 3Q5ZA 5DYJA 3FZPA 2Y4PA 4XP2A 2W1ZA 3QD4A 4LOOA 4JG6A 2BROA 1OPLA 2UW4A 2HXLA 4GH2A 3FLZA 4J8MA 5CNOA 3QZGA 5M51A 1JKKA 4TTHB 1MRYA 1Y91A 2P3GX 4GU6A 4HCVA 3JUHA 2EVAA 3QTUA 5EQPA 5LMKA 3QCQA 1YDTE 4UMPA 3AGLA 3H9FA 4P4CA 4EBWA 1E9HA 4TT7A 5I9UA 3HRFA 4XCUA 4BI1A 3IECA 4EZ3A 4OBPA 2Z7QA 4PL3A 2WNTA 3PA5A 5FM2A 2O5KA 4OTHA 3OD6X 3MH2A 4GUBA 1UVRA 1B6CB 4FEXA 3GU8A 4O0RA 5E4HA 3TDVA 5CU2A 5GINE 2WOUA 3POOA 4YC3A 2AC3A 2YM5A 3EKNA 3BKBA 1YDSE 4RVLA 3SXRA 3OFMA 2XAOA 2IG7A 3DLSA 4G5PA 3VF9A 1B38A 2JEDA 3GOKA 2Y6OA 4IAYA 4QP8A 5IQFA 4IX6A 2G15A 4QPAA 4S33A 3VNTA 4AGDA 2X2MA 5EKNA 3VAPA 3DPKA 3C4FA 2C6DA 3EQHA 2H96A 3QHWA 2WTVA 3PLAE 3LXKA 2QCSA 3U9NA 1OPJA 2YM4A 5CALA 3BEGA 5K4IA 3OWLA 4AGCA 5A6NA 4O7TA 4USFA 4PMTA 2VNWA 3C4CA 4QO9A 5C27A 1DI8A 5CEQA 3JS2A 2QR8A 3ZRKA 3HA6A 1JNKA 4DYMA 4ZY5A 3R8UA 3TTIA 1M52A 1QPCA 2JLDA 3F2NA 2KULA 4QMZA 4FIEA 5LMAA 5JQ8A 3LJ2A 2I0HA 5HG7A 3L9LA 4ASXA 4AZSA 4UMRA 2VWXA 3P5KA 3VS7A 2W4OA 5E8VA 4DN5A 2Z2WA 2XJ2A 3PYYA 3U6JA 5FUTA 4PDPA 4JQ8A 3HL7A 4CFXA 3HKOA 1FGKA 4W4WA 5C01A 1OBGA 3IDPA 4ANQA 5BMSA 5HE2A 5IA1A 3ODZX 3IOKA 3QYWA 5TOZA 3K54A 3RHKA 4ID7A 3V8TA 4BCJA 2HY81 1H27A 3KB7A 2GNHA 4HGEA 4PL4A 4WA9A 4IWDA 4AN9A 4NJ3A 4ACMA 2RFEA 1REKA 2JKQA 4FR4A 5J87A 3H3CA 2NO3A 3DKCA 3O51A 2HXQA 4RVMA 2BALA 4GK4A 3ANRA 4OTDA 4D9UA 4C34A 5K0XA 4P5QA 1F5QA 4KBKA 4DBNA 3LMIA 4L45A 1H08A 3PG1A 4HGLA 2BIKB 2Q0NA 4S2ZA 4WT6A 4YTCA 3NDMA 3LQ3A 3MESA 5GIOE 2PVYA 3ELJA 3OHTA 4P2KA 4FK6A 5D9HA 3OC1A 4KRDA 4O1PA 4EYMA 1J1BA 1WMKA 2HELA 4FT7A 4YHTA 1K9AA 1UU8A 3W0QA 4FV9A 5IEYA 2PZ5A 3BYOA 3OEFX 2CJMA 4JAJA 4QYEA 3TZ9A 3IGGA 2RKUA 3O7LD 4FV8A 3UTOA 5AR4A 1PYEA 3VBQA 3UQFA 3NIZA 3DBEA 3W18A 4D1XA 3MH0A 5IQDA 4G3GA 4X7QA 3K5UA 5AUYA 3V6RA 2JDSA 2ZMDA 3ZSGA 5IMXA 4AT3A 4UY9A 3GC8A 3VN9A 5JFVA 4OT6A 3OW4A 5LARA 4A4LA 4GUEA 1YXVA 4YZ9A 2VTIA 3LM5A 3SA0A 5M09A 2FA2A 4FSMA 1MRUA 4BKZA 3IOPA 4YJTA 3VUIA 3HNGA 2CNUA 3ZLYA 4DFZE 3MN3A 3IW8A 4PDSA 3EQDA 5FRIA 5A54A 2BCJA 2ETRA 3UIBA 3IW5A 4FYNA 1CDKA 2P2HA 2AYPA 3R71A 4O96A 3NUAA 4FEVA 2HY0A 5L8KA 4FT5A 4ONAA 2OU7A 1KE6A 3OMVA 2GS6A 4ITHA 2BKZA 4N70A 1XBBA 3LIJA 2X4FA 3O5AA 3CSVA 3FL5A 2XRUA 5CU6A 3C0IA 5JGBA 2RGPA 3E88A 2XP2A 3PXQA 5AP6A 3G6GA 5FG8A 5GJFA 5D41A 1WBTA 3TKUA 4EEVA 4KUJA 3COKA 2F2CB 3NYOA 3I60A 4R77A 3T8OA 1P14A 1PXKA 2IJMA 4ZP5A 3WZKA 1IAHA 2R3PA 4I24A 5HOAA 3LQ5A 4E26A 2R3OA 2UW7A 4AFEA 4DFBA 3AXWA 1K3AA 3GB2A 3VS2A 3G2FA 4FZDB 3RZBA 3ZBFA 4MBLA 4Q2AA 4AQKA 2YIWA 5EI8A 2Z7RA 5CY3A 3ZEWA 4E6QA 1OECA 4MEDA 2Q0BA 2ITZA 3E62A 2IEWA 2PVNA 3MVJA 4FTNA 3E3PA 2VTJA 4HVIA 1JSTA 4MXZA 4EUTA 4C8BA 4IIRA 5HKMA 4E4MA 3KMWA 3ODYX 4RIOA 3T9IA 2V55A 4UBAA 3RINA 5JN2A 2JBPA 4FV6A 4AW2A 3MGYA 4D4RA 3BRBA 5EM6A 4M69B 4XG8A 4F9WA 2PMNX 3WF9A 4BI0A 3ORKA 1U5RA 5EYCA 4DEHA 3GU7A 3QXPA 5L2TA 3DQXA 2GS2A 4K0YA 4BL1A 3RTPA 4A4OA 3AMAA 3M1SA 4LV7A 2ITNA 2YISA 2JKKA 3D7ZA 4WG3A 5ACKA 3UDBA 5BUIA 4XRJA 3NVMB 3W0OA 3LOKA 5CS6A 4D2WA 4LGGA 2R3JA 4BCMA 4F9BA 4XV2A 2UUEA 3R7YA 3Q60A 3QGWA 4IAZA 3VRZA 4CRLA 3NW7A 3ORIA 4V0GA 2BPMA 2C5NA 2ZFYA 1Q99A 3W8QA 5CAQA 1PMVA 1Q8TA 2WFYA 3BHTA 5D1JA 3TM0A 1URWA 5AP0A 3PE1A 4MXYA 3UG1A 4AAAA 2X8IA 1TQPA 3W55A 3FXXA 3Q5IA 3EB0A 4FE2A 3QQUA 4U42A 5CAUA 3HA8A 3QWKA 3WARA 4M0ZA 2VU3A 3A99A 2VTMA 1WVWA 5BVNA 5BVOA 3CPCA 3GFWA 5CSHA 1CKIA 3FMKA 4E73A 4IZAA 3Q4TA 4AGUA 4I6HA 4BCIA 1QL6A 2WMRA 5HI2A 4BCGA 2WXVA 2PULA 2GNFA 4C3FA 3ORPA 3W0RA 4QRCA 3P79A 3V3VA 4E5WA 3SG8A 4E6AA 1GNGA 3FY0A 4YZBA 2ITXA 3DAEA 3NPCA 3BYUA 2A2AA 3BGQA 4AA0A 4G17A 2WQOA 4AWIA 2ZDUA 3GBZA 4XJ0A 4GEOA 3FHRA 3QTZA 1U59A 2WMAA 5BUJA 1GIJA 4ZZNA 1NXKA 5CI6A 1Q8ZA 3DU8A 2BRMA 3ITZA 4AA5A 4II5A 4C0TA 4QNAA 1XWSA 4TW9A 3RAHA 4J8NA 5IUIA 4YZMA 4R7BA 2VUWA 3A62A 3IW7A 4GK3A 4DLIA 1M7NA 1MQ4A 4F6UA 3PZHA 3GENA 5IISA 1W2FA 2BIYA 4RIYB 1H07A 4BTMA 2R3HA 4RT7A 2WPAA 2VO6A 3NYNA 4H3PA 1OUKA 2PHKA 4LGHA 3CJGA 3I81A 3NNWA 2W99B 1FGIA 3EZVA 3QA8A 1BLXA 4PL5A 4U9AA 5M44A 1IA9A 4O2PA 3UVQA 4EZ7A 2BRBA 3W0NA 3R8PA 5CAPA 3WZUA 2XKFA 5IU2A 4OAUC 4TZRA 3FC1X 2PZIA 5E8YA 4ZZMA 3C5IA 4ALWA 4BR3A 3ORNA 3F66A 2PVFA 3BQRA 5A4LA 2W7XA 4JJRA 4U80A 2CDZA 3ZC5A 3I1AA 3TEIA 3U4UA 1O9UA 1OL1A 2VWUA 3TUDA 3W0MA 2I0VA 4FKQA 4MBIA 4FG8A 4O22A 4O1OA 3KIOC 4YSJA 2YZLA 2ITQA 4RIWA 1G8JA 1O6YA 4FSZA 4TWNA 4BKYA 5HIBA 3AOXA 2W9FB 5ICPA 5JFSA 3MI9A 4CG9A 4YO6A 5IF1A 4JMQA 4NYEA 3LFCA 1ZY5A 3GP0A 4CLIA 2WD1A 2C0IA 2ZV8A 4D5HA 3FZRA 3QCYA 4O4BB 4WD5A 4DG0E 3FAAA 4FJVA 2LGCA 1UU9A 2QU5A 3OXIA 4L43A 4NM0A 3QL8A 3F88A 3R1SA 4EHGA 2XAMA 3FL4A 4NIFB 2VGOA 4QQJA 2H6DA 4K18A 3DXNA 4A9UA 5M07A 2VTHA 3E3BX 1DAYA 2OIDA 2XEZA 2XUUA 4GSBA 2ETKA 2GNGA 2OJJA 2WQMA 5CQWA 3PFYA 1GIIA 3MW1A 3HMMA 3GCQA 1B39A 1IEPA 2QO7A 4FOCA 1YWRA 2JDRA 3QD3A 2J4ZA 4M13A 2PSQA 3AQVA 3L8PA 4U3YA 3GT8A 3TNIA 3FDNA 4IEBA 5EYMA 1BL6A 5A46A 3EYHA 5CF5A 3MY0A 4GJ2A 1WFCA 2VWYA 2BDJA 2G2FA 3V8WA 4EC8A 2VO7A 3FPQA 1APME 1V0BA 2PYWA 4BBFA 2VTRA 4UYAA 3R28A 4U79A 2O63A 4QTAA 4C38A 3KXZA 4AZFA 2W1FA 1FMOE 4ANOA 5EW8A 3IKAA 1A48A 2BR1A 4IACA 4NUSA 2FSLX 1O6LA 2VRXA 5DEWA 3BHYA 4EK3A 4FSYA 5DBXA 2C5OA 4J96A 4L00A 5CSXA 4F08A 4GT3A 5TO8A 3SRVB 3HMIA 3P86A 5KKRC 4RFMA 4ACHA 3PWDA 4L7SA 1H1RA 2QODA 3NX8A 4M84A 5M57A 2PVHA 5J1VA 3FI8A 3AMYA 4AN3A 4J7BA 3AC5A 3A60A 3H0YA 2IVTA 5EYDA 3UZRA 4RC4A 5C4KA 2WGJA 5T6KA 3QZFA 4I20A 4JDIA 2OZAB 3FQEA 2J6MA 4QTBA 5DT4A 4EH4A 2V62A 4I5MA 5C8NA 4O84A 5CF4A 1BL7A 3DFAA 4WUNA 4AG8A 4BTJA 4LUEA 5HTCA 3SLSA 4U7ZA 3MBLA 1BYGA 4NU1A 4NW5A 1UNLA 3R2YA 3R1YA 4CCBA 4I5PA 4D9TA 4DGLC 3PXRA 5G6VA 3PSBA 3V51A 4KIKA 4RX5A 2HWPA 4MXAA 4X3FC 3DDQA 3DB6A 3ZM9A 4MD7E 3FMEA 5TR6A 4YHJA 3HVCA 4K11A 3WZJA 2BHHA 4NW6A 3RAIA 4XV1A 4CCUA 1W7HA 2B9FA 4G34A 3NNXA 4LYNA 1U5QA 2YABA 4LOPA 3DOGA 3AD5A 3NAXA 2VN9A 4U43A 3C51A 3WI6A 3FQHA 2ACXA 4PWNA 1ZMVA 4I6QA 1TZDA 3FE3A 4GJ3A 4EOOA 3CLYA 2V22A 5AAGA 3IDBA 4OBOA 5CXHA 1ZOHA 2ZM4A 2BTSA 4YZNA 2XJ1A 4AW0A 1H0VA 2YIXA 3HMOA 3LPBA 4Y83A 3UMXA 2V7OA 3IG7A 3ZMMA 1RE8A 3DJ5A 3TKIA 3U51A 3NGAA 2PMOX 4E1ZA 3KXNA 3OXZA 4L68A 4MCVA 4BKJA 1S9IA 1OUYA 3ANQA 1CTPE 3E5AA 4U0IA 5DOSA 3RPOA 2RG6A 1OIUA 3QUDA 1PXPA 4PTEA 4IAIA 5AFVA 4GFMA 4IBMA 4WRSA 2QLUA 3PWYA 2R0UA 4E4XA 4D2PA 3H30A 3NRMA 3UPXA 4JS8A 1PJKA 2OWBA 4YHFA 2WTJA 4KKHA 4QMYA 2AEGA 5FEQA 5IA2A 3F82A 3WE4A 4UWCA 4O81A 3CKWA 1SVGA 2XH5A 3CY3A 2XANA 4RJ8A 3VBVA 3PPZA 4PMPA 4MNEA 3QRIA 4XOYA 3RALA 3LFQA 1ZYSA 4JDKA 4KBCA 3RI1A 3C7QA 4CZUA 3MA6A 3Q32A 1YW2A 3K2LA 3NR9A 5HESA 3OOMA 3P9JA 4RRVA 2X1NA 3SHEA 3CP9A 4JT3A 1O6KA 4IDTA 4D4VA 4ZAUA 2BDWA