4FV7A

Crystal structure of the erk2 complexed with e94
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
348
structure length
342
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
publication title Crystal Structure of the ERK2 complexed with E94
rcsb
source organism Homo sapiens
total genus 112
structure length 342
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fv7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fv7A01
2A0CX 3QD3A 4H58A 4AACA 5HQ0A 4CVAA 2UW3A 4GSBA 2J0MB 2O2UA 5GZ8A 4FGRA 4E4MA 3CY2A 3QTSA 2XIRA 5KUPA 3ZUTA 5LQFA 4DBXA 4I22A 4MTAA 4BDDA 3BEGA 1B39A 4EORA 2OO8X 2YDIA 3GI3A 4IMYA 3FJQE 4FR4A 1UNHA 2A4LA 1SVGA 4G6NA 3KRJA 4PMPA 5GZAA 3HGKA 4YJNA 4BDEA 1YHSA 2XEZA 3PVGA 2BALA 3LE6A 4MYGA 3V5JA 5IQFA 2YLEA 4F0IA 2J5FA 4QP9A 4K77A 5ANJA 1R0PA 1QL6A 2QURA 4QD6A 2OICA 3WE4A 4KABA 4CLIA 4A4XA 4A9UA 1KSWA 2OJGA 4TWOA 4CNHA 3HAVA 4KBKA 3QA8A 4ZJIA 5EM5A 3ORNA 4X3FB 4YURA 4H39A 1Y57A 1R3CA 2B52A 4UMUA 1URCA 3R73A 3VHEA 3WOWA 1PXNA 3BYMA 5EM6A 3C1XA 4IEBA 3FKLA 3WARA 4XP0A 3UGCA 3PP1A 3R2YA 3C0IA 4CMTA 3FXXA 4RWKA 5CY3A 1K9AA 3RNIA 3PRIA 1DS5A 4OAVB 1YDSE 3RCJA 3Q60A 4IB1A 3TJDA 4G31A 1YI3A 2Q0NA 1XH6A 3AT4A 4IXPA 3FAAA 1PF8A 4DGLC 4APCA 4X0MA 1WBOA 2JITA 5K5XA 5CEIA 1H0WA 2XS0A 4FUXA 4TYEA 5C8NA 3VNTA 4MNEB 3P08A 1OKWA 2C3KA 4ZSJA 4YPSA 3HRFA 4EK6A 2GNFA 4RZVA 4ANBA 2IO6A 3MFSA 2BAJA 2WIHA 4U6RA 5AMNA 3CLYA 3CTHA 3G0EA 3VW6A 3RPVA 4DEDA 2XMYA 4V05A 2GCDA 4I23A 4BCQA 4IQ6A 4WBBB 4F6UA 5AAGA 3QUEA 2XP2A 3LFNA 5E91A 2W4JA 5ETAA 3AQVA 3PP0A 4O6LA 5HNBA 4BB4A 4Q9ZA 3POOA 4C8BA 3BV2A 1YOJA 3R7GA 3ZDUA 1V1KA 1H26A 2A19B 1Y8GA 5DEWA 1IG1A 4PMMA 3VS1A 4IANA 3VW8A 5A54A 2C5YA 4BKZA 4DHFA 5BX0A 3OWPA 4I93A 2P0CA 3HP2A 3FL5A 3AC4A 3AD4A 2WU6A 3E62A 1DI8A 3KKVA 4CKIA 4ZS4A 1H1SA 2ETMA 3FDNA 5M07A 2VTLA 3L9MA 2GS2A 3BLHA 3V6SA 4I6FA 3JR1A 3QTZA 1XH7A 3BWFA 5KO1A 4C36A 3UOLA 3L8VA 2JLDA 5F4NA 3RK5A 2ETRA 1OUKA 3NCZA 4JRNA 4RJ8A 2HOGA 3OD6X 3TM0A 1AGWA 1Q61A 4OTFA 4E4NA 2WTIA 2C0IA 2YCQA 3AC3A 4BN1A 4MF0A 5JGBA 5I3OA 4O21A 1KOBA 1A48A 3LLAA 4WA9A 4AAAA 2BRHA 4MAOA 4P90A 3KF7A 3L9LA 4QMMA 5D10A 3SW7A 4FL3A 4QMLA 5E1SA 3E63A 4ZP5A 5ANGA 3PG3A 1H1WA 4J52A 4FKWA 1XH8A 2J50A 3DKFA 4XG8A 4Q5EA 3LCSA 3P9JA 3FYJX 3ZOSA 4G9RA 4DFYA 4ASDA 3ORIA 2WZJA 4QMTA 1V0BA 4N57A 3GC9A 4FNZA 4MHAA 4F9BA 3AMYA 5FBOA 4ZZOA 5I0BA 4YJVA 4MQ2A 3C5IA 4DFNA 2J90A 4EOLA 5AV3A 3Q9XA 5LMAA 3TZMA 4X2GA 5IA2A 3QAME 2YIXA 1UWHA 3EQBA 1Q99A 3M42A 2ZB1A 3Q96A 4IJPA 2RFDA 3ALNA 4O0RA 4O2PA 4QP7A 4WG5A 3A7FA 3ZEWA 1UU8A 2WQBA 3C4CA 4CT2A 5IPJA 2ITTA 4CG9A 3A7GA 3HMPA 3LFSA 3O0GA 5ANOA 1WBSA 4YZNA 3IPHA 4BR3A 3PE1A 2ZM4A 3S2PA 3DBQA 3I1AA 3ORZA 3TUCA 1XBCA 4I0SA 5EI8A 5M56A 5GIPE 4FT3A 3NMUF 1XBBA 1R78A 4YJSA 4YJUA 3QYZA 4WSQA 2OW3A 3EZVA 1ZZ2A 3I81A 4RJ7A 2BIKB 5M4IA 4D28A 2Z60A 1F0QA 4I24A 4WT6A 3NS9A 3CD8A 4JNWA 3VAPA 4DEBA 3VVHA 2W1FA 3VRZA 3FMDA 5FEEA 4CSVA 4I6QA 2W1HA 1YWVA 2R3FA 4FIJA 1H0VA 3FBVA 3LFBA 5CQUA 3VS0A 5A4LA 4KSPA 2PY3A 4IWDA 5EDPA 3O71A 4MD8E 4G6OA 3MIAA 5E8TA 3ZO2A 3AOXA 3HYHA 3SXSA 1QPDA 2QLUA 3RZBA 5AUXA 3DK7A 1UKIA 4W9XA 3W32A 5HNIX 5IUHA 3QQJA 4EK8A 2PZPA 1YI4A 3FKOA 5D7VA 3BQRA 3U8WA 3DK6A 2GNHA 5K5NA 3GCUA 2PUUA 4FA2A 4EL9A 3R63A 4PTCA 4RMZA 5HIBA 5DRBA 3CTJA 1IEPA 3S4QA 1BLXA 5J1WA 2VUWA 4V0GB 2BILB 2VX3A 5LWMA 3CP9A 3AD6A 2B9JA 3FXWA 4FYOA 2VWUA 3VIDA 1CM8A 4I5CA 3AD5A 3AT3A 5EOBA 1B38A 3AT2A 3P4KA 3H30A 5C9CA 4U79A 2CKQA 4WSYA 4IH8A 3L9PA 3RPOA 1JKTA 3V5TA 5IMEA 2CNUA 4NT4A 3JPVA 3NX8A 2HELA 3EFJA 3QU0A 3CD3A 4UXQA 3VO3A 4D2TA 5EI2A 4KUJA 2UVYA 2XIKA 4DGOA 4RVTA 3DKCA 3D2IA 3IKAA 3PJ1A 4M8TA 5EM8A 4GKHA 2UW0A 2YACA 5DWRA 5C01A 4D2WA 3UIMA 4D2PA 3MFTA 5IEVA 1H24A 3W10A 3A99A 2YDKA 2RSVA 3SD0A 3WF6A 2QD9A 4E4XA 1HCLA 2C3JA 3DCVA 2W05A 3IW8A 3KC3A 3KN6A 4NTSA 4YGAA 4BCHA 3G9NA 2XNPA 5GJDA 4W4YA 2WTKC 2O8YA 4FV0A 4FT7A 4NM7A 4XUFA 3W2OA 4J98A 4CMUA 4D2SA 5ACKA 5EKOA 3BHHA 4L00A 4HGSA 1W83A 2BZJA 4XRJA 4A06A 3TT0A 2OFUA 4M0YA 3C4FA 1DM2A 1ZYSA 4RIYA 3D83A 4NU1A 5HZNA 5M57A 4PL4A 1GIJA 2NRUA 3QHRA 2CLXA 2ITNA 4HZSA 4QRCA 4Y5HA 3DBEA 3WF7A 4ASZA 5IA3A 3DT1A 2DWBA 2UW8A 3IECA 1M2QA 3UP7A 4HOKA 1WZYA 4OTGA 4BKJA 1F3MC 1ERKA 4F0GA 4NZWB 2JIUA 3C7QA 3FLSA 3JUHA 3O7LD 4LQMA 4XCUA 3DOGA 1JOWB 2YIRA 4S33A 5EM7A 2WQNA 4JBPA 1ZYLA 4NIFB 3ZDIA 1XQZA 2HW7A 2ITVA 1U54B 2G01A 4LL0A 4M68A 4AWIA 4F7SA 2OIQA 4TYIA 1PXOA 2ERZE 5L8LA 3EFWA 4M69B 1GIIA 5E8UA 4C3PA 4EOJA 2PUPA 3L8XA 3NAYA 1H1PA 5JEBA 4AZTA 3MVMA 4EHGA 5FTQA 4PPBA 2C5OA 4LUDA 3MDYA 4MWHA 2I6LA 3FZRA 5F94A 3DLSA 2ZDUA 4BCIA 3A4PA 5E8ZA 5CXZA 3FZSA 2BDWA 3UO5A 3PA4A 4JVGA 3F2AA 1H1QA 3BYUA 3N4UA 4MH7A 4BWXA 2QOKA 2X2KA 2XKFA 3F3VA 3N4TA 5CNNA 5AUUA 4QMPA 1XWSA 4G5JA 4RBLA 1FPUA 2BDJA 3F5GA 4JXFA 3UJGA 2E9UA 2REIA 1QMZA 3ANRA 5M55A 4AW5A 4GT3A 3G9LX 3Q52A 5J79A 5EI6A 1WVXA 4EH9A 4LMNA 5ANDA 5GIOE 5CNOA 3ZRKA 3D0EA 1DI9A 5HLWA 5KZ0A 5CZHA 5KZIA 4MKCA 3A61A 2W5HA 3F7WA 3QD2B 1TKIA 2R3PA 4KIQA 1XKKA 2BKKA 3PVBA 2WOUA 2UZVA 2JKMA 5CTPA 3RHXA 2YIQA 2XIZA 4GEOA 1JNKA 3LXPA 2OJ9A 4FIIA 3F5UA 2I0VA 4PF4A 2F7XE 4EWQA 4HW7A 2PMIA 2GPHA 4JDKA 1JWHA 3BBTB 4RGJA 5LARA 4ITIA 3EQIA 2UW7A 3V01A 5AR4A 2GTNA 3OCBA 3E88A 4QMXA 3SOCA 5HE0A 1Q5KA 3ID6C 4MEDA 3DV3A 2YWPA 4WOVA 2PUNA 1BUHA 3F82A 4IAAA 4EZ5A 3WIGA 5HX6A 2RFNA 4IADA 5E92A 1Y8YA 3DQXA 3TWJA 4CTBA 1OECA 4FV1A 4DTAA 3L8SA 3OW3A 2Y6OA 3HV5A 3EN5A 2WTKB 3FY0A 4KKHA 4FTQA 4I21A 5CQWA 3F7ZA 3NNUA 1Q62A 4DBNA 2R3IA 2BHHA 4QP4A 3D7TB 3ZM9A 3LCTA 4ERWA 3R22A 1GJOA 5GHVA 5EK7A 1UVRA 1APME 2XUUA 4YBKA 2C6TA 2X6EA 3EH9A 3F5PA 3PSCA 3MH2A 1M52A 5TO8A 3L9NA 5HLNA 4YTCA 3R9DA 3F3ZA 1IA8A 3LCOA 4ZZMA 2CSNA 5T68A 3MS9A 5FEQA 5B2LA 3V3VA 4LG4A 2C47A 2GHGA 4IHPA 5FGKA 3KRWA 4NFNA 4N0SA 2H96A 4YC8A 4YZBA 4JAIA 3ZS5A 3LVPA 3OY3A 5T6KA 2C5VA 2IWIA 2ZVAA 5M4FA 1Y6AA 2CMWA 2PVYA 3CC6A 5JQ5A 3OWLA 1U5RA 2A1AB 1PMEA 2JDVA 4KWPA 4TWNA 4O22A 4M12A 2BRNA 3O51A 3HAMA 5H8GA 3GGFA 2HCKA 3I7BA 4GV1A 3MFUA 3UQCA 2X7GA 3BYSA 3EMGA 4FKGA 4Y95A 1PW2A 4RIWA 3ZZEA 5AA8A 3E87A 2WKMA 1JLUE 4FTIA 1XH5A 3D9VA 4R7IA 3KMWA 3SX9A 2G15A 5CVFA 3BE9A 1NXKA 3DDPA 2YM8A 3MY1A 1ZWSA 2Z7QA 3QUPA 4JR7A 4PV0A 5LCJA 4I0RA 5AP6A 5AM6A 1MQBA 1ZOEA 2X8DA 4KIKB 3NZ0A 3CQEA 4AUAA 5BYLA 3MPAA 2VGOA 1VJYA 5DI1A 3RMFA 2PE1A 3FI3A 3PZHA 3QTXA 4HNFA 3VBXA 3ZRLA 3S1HA 4BGQA 3LQ8A 4GG7A 2J2IB 2WEIA 4RJ4A 4WD5A 5B2KA 1HOWA 5IUGA 2HXLA 5EYKA 2EXEA 4JIAA 4F9AA 5AR2A 4XJ0A 5CS6A 4G9CA 3D4QA 2B7AA 3WIKA 3W8LA 5A9UA 2B53A 4EC8A 3U6IA 4FSTA 1OZ1A 4LOQA 2Y4PA 4GRBA 3AGLA 3RWPA 4PDSA 2R9SA 3PWDA 2WMRA 1RDQE 5AR8A 2C6EA 3E8EA 5ANEA 4PP7A 5KMLA 5BVOA 3MVLA 2YFXA 4C02A 4E93A 4YLKA 2CGWA 4LYNA 3LKMA 2VN9A 3EQCA 4FV8A 3NPCA 4BIDA 3SQQA 5DYJA 4G3FA 4L3PA 2I0HA 5K4IA 1FGIA 2XZSA 4BYIA 4NJ3A 1BKXA 5L6OA 2PK9A 1Q3DA 2QOHA 4WUNA 5H8BA 4ITHA 1SNUA 3D94A 4G3GA 3I6WA 3E92A 5JMSA 3QUDA 3W16A 4EOMA 3UOKA 3BV3A 2RL5A 4O7VA 5JN2A 5CVGA 1SNXA 5CASA 2V0DA 2W99B 3VUGA 2B0QA 3Q3BA 3ZRMA 3FEGA 4DH3A 5CU4A 3AC1A 4C34A 5A4TA 4KAOA 4CZTA 5BMSA 3HECA 4O0VA 4JX7A 4X3JA 2F2CB 3FLYA 2QODA 4ZXTA 5A3XA 1PHKA 3VBQA 5J7BA 5FTGA 1M7QA 4YJQA 5HIEA 5M51A 1W7HA 5IA4A 2UW9A 3MGYA 2DUVA 3CIKA 3LW0A 3QWKA 5HG5A 4LMUA 5BMMA 2XNBA 1EH4A 4MNEA 4D4VA 3EHAA 4F1OA 2X81A 3LFDA 2J51A 3D2KA 2JKQA 2UVZA 3F61A 2IW8A 4I5PA 2V7AA 2WD1A 4ALWA 4AZSA 4DH8A 4DCEA 2WTDA 2W1EA 3REPA 5A4QA 4M7IA 4OBOA 3LQ3A 3W18A 3WZKA 4XX9A 2QKRA 3CE3A 3NIEA 2UZOA 4OTHA 4DGMA 5BVEA 3WYYA 1T45A 3DZQA 1H25A 1O6KA 3JVRA 4GFOA 5CEQA 4FZFB 1OBGA 3ZYAA 5HO6A 2JBPA 4CCBA 1Q41A 4MF1A 5JRSA 4DYMA 1TQPA 4E5AX 4QQJA 4BI2A 3MI9A 5CANA 5E4HA 2J0LA 4D2RA 5JQ8A 3OC1A 4O82A 4QNAA 4AN2A 4XYFA 3DU8A 4PDYA 3PDTA 3V6RA 1Q8TA 5AP1A 1FINA 3II5A 4FV2A 4GJ3A 5J87A 5BUEA 4C7TA 3DBDA 3A8XA 1OITA 4ACHA 3OOGA 3PXQA 3MN3A 4H1MA 3V8SA 4C3RA 2NO3A 2BPMA 2PMOX 2VWIA 3QL8A 4X2NA 4MBLA 5HU3A 1PYEA 3QC4A 1ATPE 5CU2A 5D11A 5JZNA 1XJDA 5IMXA 4BFMA 2XBJA 1ND4A 3R30A 4NUSA 4X21A 4O7YA 2CGUA 1FVVA 3ZM4A 4F64A 2NNWB 2W1GA 5A46A 5M44A 4O7TA 5CF6A 2VX0A 1OIYA 4ACGA 4MXXA 4HNIA 5DHJA 4AF3A 3QQHA 4WNOA 1P14A 4IIRA 3KREA 2YN8A 1FOTA 3P23A 2EB3A 1Q8WA 4I6HA 4FTAA 3OMVA 1WCCA 3BGZA 4FSMA 3ALOA 1H1RA 4B0GA 2R3MA 1KE6A 4J95A 4WNPA 1JAMA 2BRGA 2VWBA 2R4BA 3BYVA 3FZ1A 4OTPA 3HV7A 4FV4A 4BDAA 4R8QA 1R39A 5J7HA 1U5QA 4ARKA 3RPRA 2VTPA 3UG1A 4L44A 4XOYA 4ANOA 3FC1X 3UPZA 3H0YA 2YISA 1SMHA 3ORKA 4G1WA 3POZA 4XS2A 5GNKA 4ZY5A 2YZLA 4N6YA 2VTAA 4O0UA 3R8VA 4JDJA 3E3BX 3W2RA 1ZZLA 4PQNA 1VEBA 4Q9SA 4UXLA 5AFVA 2W5BA 4P5ZA 4YO6A 3MJ1A 4GMYA 3SXFA 4C2VA 3HA8A 5CF4A 4MD7E 3OW4A 4W4XA 2UZNA 2OH0E 4QP3A 4MXZA 4E7WA 5L8KA 4QYGA 4CFVA 3LFEA 2PE2A 2FUMA 3PE2A 5CI7A 4YO4A 5BPYA 4IZ7A 3OP5A 2ITUA 2VZ6A 1JKSA 2FA2A 3QZIA 4M15A 3VS6A 3I79A 2UW5A 2YM3A 4FV6A 2CJMA 3EYGA 3V04A 3Q9WA 5AP0A 5HCZA 5GZ9A 4C33A 2VNYA 3NAXA 4RFYA 1JSTA 2PVNA 4QMVA 2E9NA 2RFEA 4O6EA 2WFYA 3H9RA 1FMOE 3N51A 3CJFA 3QF9A 2QO7A 5D1JA 4IB3A 1MP8A 2GFCA 2X2MA 3KRXA 4V0GA 4ZS0A 3ZBFA 4EOKA 3OTVA 3VQUA 3R2BA 4CTCA 3HRCA 4EH8A 4EKKA 4RFMA 4E6DA 4IM3A 2FGIA 4EZ3A 5DT3A 2X1NA 3BHYA 5DN3A 2HAKA 4CGAA 3TV4A 2OSCA 1R1WA 4UYAA 3CPBA 1KV1A 3KF4A 4DEGA 4F6SA 2XYNA 3P7BA 4FNYA 1ZMUA 2R3NA 2IVVA 2XJ0A 4ZY4A 4IFCA 3TKHA 5FDPA 2WIPA 3MY5A 2UV2A 4U41A 4DEAA 4EH6A 3HKOA 4X2KA 3T3VA 4C59A 1YW2A 3R1QA 2VTSA 3T8OA 2XF0A 3UDBA 3ANQA 3W2SA 5CEPA 4BCPA 3NUXA 4RQVA 2QOIA 3GOKA 2XA4A 4FL1A 3PG1A 5E1EA 5H2UA 4UMRA 3GP0A 3SXRA 3BWJA 3T3UA 3K5VA 5AR3A 1OUYA 4JBOA 4OT5A 4BBFA 3V8WA 3EKNA 4CFWA 4O2ZA 1H8FA 3DK3A 4C4FA 4HVDA 5EOLA 5JRQA 5HHWA 4FG8A 3HV6A 4J99A 5I9ZA 4BI0A 1IAJA 1I09A 3I60A 4DLIA 2IVTA 4QMZA 5BVWA 4XV3A 3AMBA 3SRVB 3Q2JA 3FSFA 3SVVA 4QPSA 4ASXA 1DAYA 2I40A 4ALVA 4ORKA 3VUMA 4BGGA 5FXRA 3OROA 4NIFA 2OF2A 4PWNA 4CEGA 5JFVA 4HVSA 1U54A 4D4YA 2CDZA 4CV9A 2GQGA 4J96A 4ZTLA 4XBUA 2GS6A 4I20A 4PUZA 3S95A 4GS6A 4M69A 3HMOA 2Y7JA 4W8DA 1DAWA 3ZSGA 4CLJA 3NUNA 4FKJA 5GJGA 3BQCA 4A07A 5JFWA 1UNLA 3NNXA 4K2RA 2BIYA 2W5AA 4Q5HA 2BAKA 4I3ZA 4Y46A 3GOPA 1H00A 2VWVA 1J7UA 1F5QA 2QR8A 4N6ZA 4NW5A 2I7QA 4U97A 3NYNA 4I5MA 4KIPA 2IJMA 5CALA 4NKSA 5E7RA 4D5KA 5ITAA 2XK7A 1PMUA 4E26A 2X9FA 5KCVA 4GU6A 3UVPA 2X8IA 3TKUA 2W96B 4EJ7A 3RAKA 2ZDTA 2DYLA 3WF9A 3ZCLA 5D7AA 1G8AA 2O63A 4XV2A 3DQWA 4A9RA 3LMHA 4YUQA 3VUIA 4P4CA 4CFMA 4OTRA 5CSVA 4YC3A 1BI8A 5BYYA 3NW5A 3F69A 3F3UA 5AA9A 3ZEPA 2AC3A 2W1IA 2R0UA 4C57A 3CSVA 3F3WA 3FE3A 5I4NA 1JBPE 3IG7A 3LJ0A 4XRLA 3TI1A 1WBVA 2RFSA 2BR1A 3FL4A 3MSSA 3DAKA 3U4WA 2IVUA 2VO3A 2HXQA 2ZMDA 2G2FA 1PMNA 3NR9A 3VF9A 4KIOA 4UB7A 3QWJA 3SKCA 4USDA 3K5UA 2XJ2A 2NPQA 3U54A 3O8TA 5LCKA 3SG9A 3KQ7A 4I6BA 2C69A 3RKBA 4XLVA 1OL6A 3CKWA 3TNIA 4O1PA 4A9TA 3WZEA 5CT0A 3R7OA 5IG1A 4QP2A 2EVAA 4BCJA 3ACKA 2VTNA 3BRBA 2BKZA 3KEXA 1O6LA 2WTJA 3EQDA 4BDFA 4CFUA 4BCKA 4FK6A 3U87A 3V5LA 4EKLA 4RIXA 3R8ZA 3D7TA 1AQ1A 2BZKB 3DJ7A 5D12A 1PXLA 2YERA 2X4ZA 2ZM3A 3F5XA 3OY1A 4LM5A 2FSOX 2WAJA 1M2PA 5ETFA 4U9AA 5I9YA 4RSSA 4IDVA 5AJQA 1PXMA 3UMWA 3QRKA 5G6VA 2JKOA 5FP5A 5C8KA 5IF1A 2P55A 4KA3A 4OTWA 3F3TA 5E90A 5CF8A 2P4IA 3PY0A 2QOOA 4O81A 2UZDA 4NCTC 5L2WA 2JBOA 2C1AA 2J4ZA 5AADA 5IQHA 4ANQA 3O8UA 4FV5A 4YPDA 2IW6A 3I5ZA 2R7IA 3U51A 5EW9A 3ZHPC 3DA6A 5M53A 4EBWA 3TNWA 4EUTA 2X0GA 5LXMA 4XHKB 4IX4A 5J9LA 3EYHA 4XEYA 3RCDA 4RWJA 1OKZA 4O1OA 4WRSA 4DH5A 4LGHA 2YWVA 5ETIA 3BLRA 3RHKA 3IGGA 3JYAA 3ULZA 4TYHB 3SW4A 3H3CA 5DPVA 3IONA 5CENA 3ZLYA 3ULIA 3O96A 3FQEA 1ZARA 3ENHA 2WQEA 3H4JA 4KIKA 1ZLTA 2V62A 3P7CA 4IVAA 2YCFA 2A2AA 4U81A 4EQMA 4DLJA 2XIXA 2F4JA 3GB2A 4XP3A 3ZUUA 4BCMA 3VULA 3RK7A 5L3AA 3U9NA 4GUBA 1PYXA 5CU0A 3ITZA 3BZ3A 3MA6A 4YZCA 3M1SA 3SGCA 4RQKA 2IPXA 5ANIA 1LP4A 2VTOA 4IAZA 1NY3A 2XNEA 4XG7A 1ZMVA 4RJ5A 3QHWA 4EH2A 4FTUA 2GDOA 4CYJA 3CEKA 2RF9A 4LRKA 2GQRA 2LAVA 4FI1A 4IC8A 2H34A 1FQ1B 3LMGA 4NKAA 5I9VA 3F9NA 4YSMA 3KMMA 2B55A 2P2IA 4D9TA 1ZAOA 4P5QA 5HTBA 4RLKA 2ITWA 5KE0A 1CMKE 3UODA 2ESMA 2ZV2A 2XIYA 3QTWA 1J3HA 4MVFA 3QKLA 1WVWA 3MYGA 2A27A 4L8MA 3MVJA 1P5EA 1H27A 2CGXA 3PJ2A 4DGGA 3I6UA 5CEKA 4PL3A 3ROCA 5B2MA 5AEPA 1GIHA 3CGFA 3ZO1A 4F7NA 3O2MA 3G33A 3E64A 3HNGA 3BGPA 3HP5A 5HCXA 1OB3A 2WMSA 5J5SA 3DLZA 3KB7A 5EKNA 5HKMA 3R21A 5CAOA 3FHIA 4OBQA 2W0JA 3MV5A 1OI9A 4PTGA 5BUJA 2IZTA 2CN5A 2XNOA 3BYOA 4EOIA 5EYCA 4A4OA 4D9UA 3NIZA 4AZEA 3VS5A 3FUPA 4AQCA 3A8WA 2VTQA 3LMIA 2ZJWA 2IW9A 3O17A 3MB7A 3TKIA 2YM6A 5KMIA 4GIHA 2P33A 2PVFA 3GNIB 4EOQA 3F88A 3PPJA 4CT1A 2GSFA 3WILA 3CJGA 4NM5A 4AA5A 5J9ZA 1BI7A 1OIQA 5IQEA 2IZSA 3ZLXA 3OZ6A 5HI2A 3UG2A 1BL6A 2QOLA 4WG3A 5ETCA 1XH4A 4AGCA 4APPA 1YVJA 1FVRA 3DAJA 4OTDA 1KE7A 4XBRA 3Q4ZA 3G0FA 4PNIA 3COHA 4QMYA 5TT7A 3KA0A 4FL2A 4TPTA 1NA7A 3G15A 2EWAA 2O5KA 2Z7SA 5EFQA 4BZNA 4RZWA 4M67A 3FPMA 2W06A 4MXYA 2BFXA 3QFVA 5CT7A 5HD7A 3W1FA 4Z7HA 1UKHA 4XNEA 4C38A 4O86A 2QOBA 4L6QA 4HGTA 3A7IA 3GVUA 3LXNA 2GNGA 2F57A 4AU8A 2B54A 3TEIA 4RA5A 2J0JA 3RZFA 2OK1A 3UZPA 2ITPA 2W4KA 3BU5A 1G3NA 1YXSA 4I4EA 1GY3A 4BIEA 2ZV7A 4MD9E 4QQ5A 4ZTNA 4S31A 5KX8A 2V55A 1BYGA 4FKRA 4E6AA 2C68A 5A14A 2OJFE 2ITOA 3QGWA 4FNWA 4NH1A 2QHNA 3NW6A 4ZTMA 4O7SA 4UEUA 2YM4A 4IM0A 2UZTA 3ORPA 2VAGA 2Z8CA 5A6OA 2E2BA 3IGOA 3FMEA 3NYXA 4G3DA 5IUIA 5DOSA 3U9CA 3QCSA 4I41A 3QRJA 5CF5A 2CCIA 2J5EA 3MW1A 4QYEA 4G3EA 5DR9A 4EJNA 2C1BA 3IW5A 2WMQA 4GT4A 4DCAA 3L1SA 5FM3A 2UZEA 2WQOA 2J7TA 3H9FA 4QMOA 5EYDA 4IW0A 1ZY4A 4E3CA 1E1XA 1PKDA 3RNYA 5AV4A 2HZIA 3ORXA 4W8EA 3KULB 3FZOA 3UIUA 4DH7A 3KL8A 2YM7A 5HIDA 4EH3A 3U6JA 1R0EA 2WTCA 3UPXA 3HL7A 4C3FA 3KK9A 4ANSA 3KXGA 1NT2A 2C6DA 1W0XC 4FVRA 4E1ZA 3R04A 2HWPA 4DT8A 3UOJA 2QQ7A 3DNDA 3P79A 4L42A 1PY5A 3BX5A 2Z7RA 4L45A 3E8NA 2XK6A 5L2SA 4L67A 3T9TA 4IC7A 3FMNA 3PY3A 4NEUA 4BTMA 2OXYA 2QG7A 5BVDA 4LGDA 4BWKA 5DH3A 3JS2A 5HGIA 4DINA 2BROA 3Q5IA 2VO0A 3FMMA 5AP3A 1Z57A 4MQ1A 4D0XA 4DITA 4WIHA 2CLQA 2WTWA 3UNJA 2WTVA 3R01A 4B8LA 2BMCA 4U40A 2F49A 3UZRA 2YABA 3UO4A 3GFEA 4FT9A 5GJFA 3EN6A 4F1MA 4GIIA 4N4SA 2XKEA 4G2FA 5F95A 3C4EA 2OBJA 2X39A 2GMXA 3NSZA 4JBQA 4UBAA 2QU5A 4K33A 2X6DA 3JY0A 4C4EA 4HGEA 4AGUA 3GC8A 4QP6A 4LV5A 3VS2A 4XH6A 2CHLA 4TN6A 3WF5A 4BBEA 3CBLA 4D55A 3ZXTA 4O0SA 1U4DA 5FRIA 4AW1A 4C37A 4UMTA 4HPUE 3OWKA 3DZOA 4R3CA 2C3LA 4DE4A 2XRWA 4XP2A 4H1JA 1I44A 5IA5A 4HCVA 4YP8A 4H3PA 4NW6A 1GOLA 3R71A 4FK3A 5IDPA 1IA9A 4S34A 3BI6A 4GW8A 2EU9A 2C5NA 3TUBA 1XHAA 1VR2A 4ZK5A 3TN8A 3LOKA 3UE4A 1YQJA 3VS4A 4P2KA 4OBPA 3QC9A 3NCGA 1PXJA 4K0YA 3OXIA 3MH3A 5L6WL 4DG0E 4WKQA 4ERKA 3PFQA 4ONAA 4IZAA 4M84A 4MBJA 1KE9A 1LPUA 4USFA 2X7OA 5TOZA 4BDCA 2PPQA 4H05A 4TNDA 3I0OA 2Q83A 4XG4A 4F99A 4IAKA 2VTIA 3WE8A 1OKVA 2X9EA 4ZLYA 3MH0A 1KV2A 2RKUA 3TZ9A 4KRCA 5HORA 2XCHA 2JIVA 4MBIA 4RWIA 3R28A 2VTJA 5AWMA 5AUWA 3QCYA 4M13A 1MRUA 1YWNA 1M2RA 2XRUA 4BY9E 4EH7A 3IS5A 5H9BA 2VNWA 5FXQA 4FTLA 2B9FA 3A2CA 3DJ6A 3TL8A 3NGAA 2VV9A 3QZHA 4D1SA 3NLBA 3U6HA 3L8PA 3HA6A 5DG5A 3KCFA 2X2LA 4FSUA 5HESA 4BTFA 1SVEA 1TQIA 1UV5A 3R8MA 2I0EA 3PIXA 1YHVA 1CTPE 3FLWA 4FTCA 2PZIA 1W82A 3LM5A 3FLZA 3NUYA 4KNBA 4FBXA 4YBJA 4ZMFA 4QYFA 4LI5A 1CSNA 5LWNA 3LFFA 1IAHA 4BVUA 4O84A 3E5AA 4IB5A 5HBHA 3FHRA 4CFXA 5DNRA 3K3IA 3OXTA 2XBAA 1M14A 5JZJA 2WOTA 5FQDC 3T9IA 1OVEA 1JSUA 3VRYA 5I9XA 4FVPA 5AV0A 4HGLA 4FSRA 4FIGA 3OTUA 3UTOA 4MXOA 4LOPA 3R7EA 3DDQA 4LOOA 3RALA 4G3CA 2QO2A 2H8HA 4ZMEA 2R3OA 3VBWA 4AG8A 3O7LB 3RAHA 3R1NA 4RX7A 4E5WA 3ZU7A 4R1YA 4NK9A 1MRVA 4X3FA 5F20A 3B8QA 3THBA 5KBQA 4M3QA 2EXCX 2YM5A 2ITYA 4C62A 5AUYA 3Q32A 5IH5A 2RIOA 5DA3A 1SVHA 3HDNA 2JAMA 4HPTE 5E8XA 4FSNA 2J0IA 4QQCA 4JT3A 1PXKA 3TJCA 2HWOA 2FSLX 3HUBA 4G6LA 4JJRA 4ZY6A 4FT0A 3E8DA 4EZ7A 2XK8A 3SV0A 4GYIA 5E8VA 4CYIA 1KE5A 3EFKA 4QYYA 5KMOA 4PX6A 2C30A 2JDTA 5AX9A 4JG7A 5K0XA 5EHYA 4AT3A 2PTKA 3HX4A 4FKSA 4GK4A 3QGYA 2E9VA 3G2FA 2UW6A 3E93A 3R9OA 5EW3A 2UZWE 5A6NA 1W8CA 3M11A 4FKIA 4UY9A 4L43A 3A7JA 4FV3A 3CR0A 3R00A 3C13A 2XB7A 4ZIMA 4AE9A 1LR4A 1UU9A 5A4EA 2FSMX 2VTHA 4RT7A 3SA0A 3W55A 4G17A 4W9WA 4RX9A 2VWYA 2Y8OA 3RPSA 3UC4A 5J5TA 1ZYJA 3UC3A 4OW8A 3RJCA 1GNGA 4IE9A 4MCVA 2R3QA 3UNZA 4L01A 3Q53A 3IDBA 4UMPA 5HE3A 1E1VA 3RBWA 1CKPA 3LCDA 1P4FA 4WNKA 4YLLA 3OEFX 3ZFMA 4AE6A 3VBTA 3QXOA 1PMVA 1CKJA 3JY9A 4QYHA 1JVPP 2YIWA 2QLQA 3DBFA 5HE1A 5CU6A 4W4VA 1JSVA 4YHTA 3MPTA 4K11A 5L4QA 3C5UA 3QQGA 3TNPC 2ONLC 4KSQA 4ZTRA 3PJCA 4O38A 3VJOA 1YWRA 4GFMA 4EUUA 4PPAA 2ETKA 4QTDA 4DAWA 3ZZWA 1YRPA 3C4ZA 3P7AA 3V5PA 4HVGA 3VN9A 5H3QA 1K3AA 4OR5A 3QYWA 2QVSE 3M2WA 5DT4A 4RC3A 1RQQA 4PTEA 1P2AA 3UNKA 5BQ0A 2C5XA 4TYHA 3TNQB 4S30A 3LAUA 2VTTA 1B6CB 1UA2A 3EN7A 4EONA 1PXIA 1JPAA 2IZRA 5LMKC 1TQMA 4AN9A 2JEDA 2ZMCA 3HDMA 2YHVA 4KKGA 4CRLA 3NYOA 2GHMA 2V7OA 5H8EA 1E9HA 1YXVA 4FEWA 4TY1A 1YOLA 1WBWA 3KRRA 1AD5A 3ATTA 5CAUA 3LFCA 3ZFXA 3FLNC 3HEGA 3GU5A 5AAFA 1FMKA 4BBMA 3ZFYA 3FY2A 4FKUA 3PSBA 5DT0A 3U4UA 3A7HA 3RAIA 4JAJA 4FZAB 2B1PA 4EHVA 3BLQA 3OUNB 3PA5A 3R0TA 3HRBA 3GBZA 1ZY5A 4U8ZA 2BZIB 4FTTA 3VS3A 3UVRA 4D1XA 3OFMA 4IX6A 4ZSGA 1CKIA 4AGWA 2Z7LA 3OEZA 1UU3A 2FYSA 1MQ4A 4XMOA 5AV1A 1KE8A 4L53A 3NYVA 2BFYA 2Y6MA 4CXAA 5DRDA 2QKWB 2R2PA 1J1CA 2QOQA 2F2UA 3ORTA 2CN8A 4X6RA 5AUTA 4CKRA 3A4OX 3JXWA 3IO7A 3R7UA 3EKKA 4XOZA 2YITA 4HYSA 5CYIA 3SHEA 4B9DA 2OIBA 3EFLA 2WELA 3UP2A 4G16A 3DXNA 4UWCA 4DFLA 5LVNA 3LFQA 5HVJA 3ODYX 2HYYA 1O6YA 2VD5A 3QKMA 4FSZA 4TYGA 2ITQA 5IQIA 5EHOA 1IASA 2WNTA 4C4IA 3HZTA 3OXZA 2PVLA 4FEVA 1Y6BA 3ZLSA 2W9FB 3DBCA 1W98A 2PVHA 4GK3A 4F6WA 3H0ZA 4FG7A 2IZUA 3D5VA 2X4FA 2KTYA 3ACJA 3GU6A 3I0QA 4FG9A 2PZRA 3BU3A 4PP9A 2QNJA 4YNEA 3R9HA 3P1AA 5DEYA 2P2HA 4H36A 4O0YA 4W4WA 2R3JA 5AR5A 3U55A 5HE2A 3PIZA 1FBNA 3O8PA 4UWYA 4Y85A 3QTQA 3EZRA 4FV9A 3WZUA 4TWPA 3RI1A 4I5HA 4FNXA 5FBNC 2RG5A 2R3LA 3QZFA 3QLGA 3R7IA 4EYMA 1MRYA 2R64A 4K18A 1OKYA 3FYKX 4J97A 4CFFA 3GU4A 3S00A 3DFCB 4PY1A 3TTJA 3OCSA 2J0KA 5T3QA 3Q04A 3TCPA 4QO9A 3VHKA 3LCKA 3RM7A 5CAQA 4XG3A 4XV1A 2PVMA 3QQKA 3Q4CA 5EYMA 4C4HA 4NWMA 3QX2A 5TKDA 4ANLA 2OXXA 4EOPA 1OPLA 3UYSA 4HCTA 4WBOA 3QBNA 5C8MA 4EK3A 2JDSA 3C51A 2R3HA 3ZMMA 2W1DA 1ZOHA 1J1BA 1OL5A 4AOTA 4ZSEA 4QQTA 1OL1A 2VTRA 3PSDA 1V0PA 3UOHA 3AC5A 3RINA 2FSTX 3PPZA 3ZSIA 4CZUA 4WO5A 3E8CA 3CS9A 1NW1A 3BBWA 2QONA 2YJSA 4ITJA 4RIWB 3MBLA 5CEMA 4PRJA 3UBDA 2XM8A 5HNGA 4KBCA 2PYWA 3Q6UA 3N9XA 3WI6A 2JFLA 2VRXA 3QXPA 1XH9A 4IX3A 4QMWA 3DKOA 4JL9A 5HD4A 5L2IA 4BDJA 5EH0A 4E4LA 3WF8A 3IOKA 4TNBA 2R3GA 4RRVA 2BUJA 1LEWA 2JC6A 2JKKA 4JLCA 4RG0A 5HBEA 3R7YA 3VBYA 5KNJA 4D2VA 4ZAUA 4PDPA 5JFSA 3MY0A 4D58A 3ET7A 3A60A 5CX9A 3OCTA 3Q4UA 4K6ZA 5EHLA 1RE8A 2C6LA 3C9WA 4QNYA 3ZC5A 3OOMA 4FZ7A 3UQFA 3O23A 3OBJA 4FKOA 4RVMA 2VWXA 4HZRA 2OG8A 3EOCA 3ORLA 3PJ3A 4BYJA 4QPAA 5BVFA 4QMNA 5DR6A 4FKTA 3FQSA 4FTRA 3KULA 1PXPA 2G1TA 2OZAB 4EK4A 4QMQA 2PZ5A 3PLSA 3R8PA 3EN9A 4BC6A 4JQ8A 2VGPA 1G5SA 3GCSA 5K3YA 4GU9A 4B6LA 4II5A 3LZBA 5DFPA 3OCGA 3NUUA 4USEA 4LFIA 3IW7A 5B0XA 2CKOA 1VYWA 4TZRA 3ZO3A 4IM2A 3FC2A 4E6CA 3RAWA 1WAKA 4FSQA 4BDBA 3D5WA 3ZBXA 4BHNA 4FODA 3ETAA 2GTMA 4YJOA 4RC2A 1JQHA 3LM0A 2BVAA 4HJOA 2W17A 4R1VA 2QOFA 4QTCA 4DTBA 3PXYA 4FTMA 2PMNX 5M4UA 4JG8A 2OI4X 3KXNA 3ZH8A 4ACMA 4WHZA 4FGBA 4ANNA 2OKRA 5AP7A 4AT5A 3R9NA 4X6QC 3VJNA 3PRFA 3D15A 3HV4A 4YNOA 4YZDA 2OU7A 2H6DA 1WMKA 3BELA 2WMVA 2YCRA 3IDPA 3PXFA 4K9YA 1FGKA 4RJ6A 2XM9A 5AUVA 5HLPA 1XO2B 1H08A 4E20A 4OGRA 3QZGA 2YZAA 4BGHA 2JGZA 4V04A 4Y72A 3PUPA 4L46A 4F1TA 3R7VA 4FIFA 3FZPA 2LGCA 2RG6A 1O9UA 4FOBA 4IX5A 4L68A 2YLFA 4QOXA 2C6KA 3NEWA 5FUTA 2OJIA 3HMMA 3RTPA 2DQ7X 2E9PA 4YJRA 4CD0A 3PXKA 1S9JA 3GUBA 4LV8A 5C4LA 3B2TA 4M0ZA 5LVOA 4ZEGA 2ITXA 5HBJA 3MFRA 2F7EE 3EQGA 4BHZA 2WMBA 5BVNA 3AC8A 2PU8A 3D5UA 1KWPA 5J1VA 5CSHA 3F2RA 2QC6A 3UQGA 1PJKA 4UWBA 3DS6A 4CQEA 2C4GA 3V5QA 4UN0C 3ZONA 2F9GA 2YAKA 1A9UA 4I92A 4RFZA 2QOCA 4B4LA 2G9XA 2R7BA 4B7TA 3ZC6A 4BDIA 5I3RA 5I9UA 1BX6A 3W33A 4ZTHA 4QMSA 2IG7A 2YIYA 2FH9A 4TTHB 2GNJA 5JSMA 2XK4A 1TVOA 2YA9A 3IQ7A 4IAFA 5J9YA 4QP1A 4KBAA 3RVGA 2BDFA 4H3QA 4NTTA 2XNGA 2VU3A 5TR6A 5CAPA 2QCSA 4RX8A 4WRGA 3ZO4A 2OLCA 1OIUA 4PL5A 1WBPA 5E9EA 3VUTA 4EC9A 5C4KA 3W2CA 4AFEA 1YXXA 5CXHA 5JFXA 4D4RA 5F1ZA 3BKBA 3NUAA 4FEUA 2XK3A 4XV9A 3RPYA 1L3RE 3AG9A 4AW2A 4Z3VA 5IQGA 3HUCA 1OMWA 2ZM1A 3IW6A 3NRMA 4JQ7A 3QKKA 4UALA 4F9YA 4F63A 3QQFA 4DC2A 4DG2E 5LJJA 1KUTA 4C35A 3R6XA 5FLFA 2O65A 5JGAA 4FOCA 2CNQA 4ALUA 2UW4A 4R5YA 4ZTSA 4JG6A 5C27A 3VS7A 3TUDA 3FQHA 3FMJA 3LJ2A 2BTSA 2Y0AA 4FTJA 4S2ZA 3VC4A 4O7LA 2BRBA 3GFWA 3OBGA 5L2QA 5JKGA 2PMLX 4R3RA 1VYZA 5CSXA 4AN3A 5D41A 4EQCA 3SOAA 3PZEA 4FICA 3COIA 5AIKA 1LUFA 1ZRZA 5DLSA 2OH4A 2HY81 4TT7A 3ZXZA 1H01A 2WGJA 4EQUA 1ZXEA 4NFMA 1QPCA 5IU2A 4ZSAA 3UO6A 4AZVA 3LJ1A 3FI2A 3NW7A 3P5KA 4O7NA 2XNNA 1GZKA 1LEZA 2W1CA 4O0XA 3EWHA 4F08A 2QI8A 3ENMA 1GZOA 3P86A 4FKVA 2GHLA 4AGDA 1Q97A 4Y73A 1URWA 4IJ9A 2WMXA 3UVQA 4CMOA 3D7ZA 3MB6A 4RIOA 3UZTA 3E7OA 3FZTA 3PVUA 4JRVA 4AOJA 4EK5A 2HK5A 5CI6A 3TZ8A 2WHBA 4U43A 5HG9A 3DFAA 1Q8UA 4F09A 4C61A 3GU7A 1YI6A 3R1SA 4FTNA 2DS1A 3VUKA 4O96A 3VBVA 4CRSA 3MA3A 4BZDA 4AW0A 4J53A 2QR7A 4BCOA 3VUDA 4DGNA 3RM6A 4OUCA 3FPQA 2VO6A 1FVTA 5LVLA 3ZUVA 5DMZA 3BGQA 2ERKA 3OVVA 1OPKA 3AXWA 2HIWA 1SYKA 2C6IA 3GXLA 4FIEA 4K1BA 5IH6A 4FYNA 3QCXA 3KK8A 2XEYA 4YU2A 3EQFA 4LRMA 5TE0A 3QTIA 4UMQA 4BL1A 4XG6A 2PSQA 5FXSA 3CPCA 1WBNA 4GVJA 4BWPA 4D1ZA 4DG3E 5IISA 3ZSHA 3ZTXA 3S3IA 4BDHA 4I94A 4U0IA 3KGAA 4L7FA 1V0OA 2GFSA 5ANKA 4ZZNA 2PULA 4JR3A 1SM2A 2G2HA 3VWAA 5BVKA 4GCJA 1K2PA 2CGVA 5AP5A 3R8LA 3TACA 2ACXA 5ACBC 3DXQA 4MXCA 2UUEA 4KRDA 4O27B 4ZSLA 5FDXA 2O64A 3WBLA 2J6MA 1QPEA 2C6MA 5IZFA 1U59A 3TV6A 1Y91A 2F7ZE 2PVJA 4BCNA 1G8SA 4QTBA 3ATSA 2QHMA 3NWWA 1REKA 5L8JA 2R3KA 1WBTA 2BTRA 3KXXA 4BTKA 3LIJA 4U45A 5CLPA 4BRXA 2JD5A 5LMBA 4TRLA 3RWQA 5KBRA 2Q0BA 3EQRA 4GVAA 4JX3A 4IACA 4RVKA 4E6QA 4YSJA 1NVRA 5CSWA 4EI4A 4FEXA 2XNMA 3LHJA 4ACCA 1IRKA 2QU6A 1XBAA 4FTOA 1CDKA 1OL7A 3C50A 4I4FA 4L7SA 3Q6WA 2WQMA 4O0WA 5AIRA 3V51A 4ZLOA 2XH5A 4GYGA 3QD4A 4L3JA 4R3PA 5HICA 2JDOA 3ORMA 1REJA 4DFXE 5EG3A 1P4OA 3NVKI 2WMTA 3MTFA 2AUHA 1H07A 3CGOA 2C0TA 4Z9LA 3G5DA 3QTUA 2VWZA 5DGZA 3GC0A 3QRUA 4NYEA 4OTIA 4PMSA 3BCEA 2Y9QA 3MH1A 5E8WA 4ENYA 2WMAA 5E8SA 3F2NA 3Q9ZA 3V8TA 5KMMA 4R5SA 2XJ1A 2HW6A 1WFCA 4NM3A 2G2IA 2YCSA 4CZYB 3HMIA 2B9IA 3F66A 3BIZA 4Z16A 3GENA 1NVSA 2WO6A 1GAGA 4UV0A 4D5HA 2BAQA 3GCVA 5C03A 1UNGA 3DNEA 3GCQA 4FKLA 2JAVA 3FWQA 4GH2A 5EQPA 5K4JA 3B2WA 3KY2A 4FIHA 4FTKA 3VF8A 4S32A 3G90X 2ZV9A 4FE2A 4DFZE 5EQYA 5IQDA 2PHKA 5HX8A 4BDGA 4CQGA 4KD1A 4F4PA 3OHTA 3NVMB 2FB8A 5KMKA 2PE0A 4F65A 3EN4A 3E7VA 3BHVA 1BL7A 4A9SA 5CSPA 4IVBA 2GU8A 2C6OA 5GINE 3MTLA 2O3PA 3HVCA 3IOPA 2GNIA 2QO9A 4YJTA 2Z2WA 3PY1A 3CTQA 3HV3A 4J8MA 3DB8A 4U80A 4UX9A 2UZLA 3CY3A 3COKA 4AA4A 1VZOA 3QQLA 2VWWA 3KXHA 1UU7A 4OT6A 4YHFA 4ZJVA 3EL8A 3GQLA 4CKJA 2Z02A 2ZV8A 4BDKA 5DE2A 5IKWA 5K0KA 1NVQA 3CCNA 3R83A 1J7LA 3TDWA 1J7IA 5D9HA 4HYHA 5IEYA 3SG8A 3Q5ZA 4ZTQA 4O91A 2FO0A 4LUEA 4IWOA 5HTIA 3DXPA 4ZOGA 3TNHA 1BMKA 3OT8A 2Y4IC 5KMNA 1RJBA 1QCFA 4YTIA 1JKLA 5FTOA 5JH6A 4L9IA 5HCYA 3KFAA 3LXKA 1YDTE 2ONLA 3C0GA 4RIXB 4DT9A 3AC2A 1GZNA 2YDJA 3KXMA 3I5NA 3K54A 3UMXA 3KVXA 4JDIA 4M66A 1U46A 2XCKA 3PIYA 4IWQA 2W7XA 2ZAZA 4R6VA 2OJJA 3GU8A 3QQUA 3NUPA 4PMTA 4TXCA 4DH1A 4DTKA 3FMKA 1Q24A 3HLLA 4I1ZA 1YXTA 2CNVA 1WVYA 3IDCA 4FF8A 3LQ5A 1H28A 3DKGA 5EDRA 4E73A 1A06A 3ERKA 4RPVA 4NL0A 3EQPA 2BRMA 4XG2A 3QX4A 4HVIA 5IH4A 2BZHB 4KB8A 3SRVA 3GT8A 1QPJA 4LRJA 1JKKA 2YJRA 4Q2AA 1M7NA 5HU9A 3K3JA 3W2QA 2CPKE 4M97A 5EW8A 4AZFA 3BHTA 5AX3A 3A62A 4AXAA 2W9ZB 3G51A 4RVLA 3QRTA 3WYXA 5FP6A 1H4LA 4ZLZA 4FZ6A 4GFGA 3CKXA 5HVKA 3MJ2A 4B8MA 4R78A 4V01A 5CVHA 5E8YA 5AUZA 3EL7A 4XLIA 3PPKA 5G1XA 1Z9XA 4FV7A 4F7LA 3Q2MA 4HCUA 2CKPA 4JBVA 3PTGA 4IZ5A 4NSTA 4MWIA 3QALE 4C4GA 4BCFA 5M09A 4YZMA 2ZOQA 3TZ7A 2UZBA 3S0OA 4YTFA 1PRYA 5HO7A 3BE2A 2EUFB 5KKRC 3KVWA 3W8QA 5C26A 5BUIA 3AGMA 4J7BA 2BCJA 2OZAA 3OT3A 2WMUA 4EWHA 4TKSA 2X8EA 5BYZA 4RA4A 4U44A 3GQIA 4RLLA 4N70A 4QMUA 4P7EA 3OG7A 5EDQA 3G6GA 5AR7A 3R8UA 4ENXA 3HMNA 1OPJA 4U3ZA 4IWPA 2XVDA 2R3RA 2SRCA 2CCHA 4O7RA 4U7ZA 4EBVA 3KU2A 3IK3A 4U42A 3FMHA 5AAEA 3R02A 4IFGA 2I0YA 2R5TA 5AV2A 3WZJA 3D14A 4A4LA 4AFJA 2OZOA 2HENA 3DTCA 2ZYBA 3QTRA 4IAIA 3RP9A 1OGUA 3I7CA 4FC0A 4U5JA 4WNMA 4GUEA 5J95A 3NDMA 4WUAA 2Y4IB 3DY7A 3H9OA 2VX1A 2V22A 2WB8A 3EQHA 3R1YA 3V5WA 2OXDA 2NP8A 4GL9A 3FXZA 4CCUA 4FKPA 3CQWA 5IA0A 4UZHA 5F9EA 3UIXA 5ICPA 3C4WA 5JT2A 4NM0A 5KHWA 3PXZA 3ROYA 2C3IB 2O0UA 4KS7A 3LFAA 1OBDA 3C4XA 3PXRA 2C0OA 2YAAA 3BU6A 4AP7A 1Q8ZA 5LVMA 3OUKA 2IVSA 4OLIA 1YHWA 3B8RA 4AT4A 3RK9A 4J71A 3FMLA 3PA3A 1W84A 4AS0A 2JFMA 2GQSA 3ODZX 2BHEA 5AP4A 3COMA 4DEIA 4FSWA 3WZDA 4CV8A 1YDRE 3FLQA 3OWJA 2WPAA 3KN5A 3TTIA 5M06A 4TWCA 4QTAA 5TF9A 2VTMA 2W4OA 5LOHA 5A4CA 2UVXA 3LLTA 3MIYA 4TYJA 5IA1A 3DPKA 2GS7A 4F0FA 4QP8A 5CU3A 1OIRA 5FEDA 5I9WA 4KKEA 4MXAA 4AA0A 2AC5A 3W2PA 4KINA 4G34A 3JVSA 1IR3A 4ZJJA 5AP2A 4EOOA 3DGKA 3EJ1A 2PZYA 2OGVA 4R7HA 3CQUA 3BHUA 3SDJA 2QG5A 3PVWA 4RIYB 4ASEA 5KHXA 5CEOA 3FSKA 3LXLA 2PUIA 5LMKA 5LVPA 3SAYA 4PPCA 2J9MA 4IAYA 4YTHA 4O83A 3KCKA 5EQEA 2XK9A 3OS3A 4Z55A 3DB6A 1YOMA 4DFBA 4XG9A 4M14A 1Z5MA 3KXZA 3R9RA 2I1MA 4BICA 2WEVA 3C0HA 4MK0A 5KKRB 4WG4A 5DBXA 5C1QB 4EEVA 2OWBA 2OFVA 3TV7A 4BZOA 2NRYA 3AMAA 4AX8A 2PWLA 3EIDA 3NNVA 2P3GX 4BF2A 5IQAA 5HOAA 2W1ZA 5JGDA 2GNLA 5BNJA 3FKNA 1STCE 3ELJA 4JI9A 5M4CA 5IQBA 4HYUA 4K8AA 4JIKA 2JDRA 4TL0A 3UIBA 1UWJA 4BKYA 4X2FA 4GT5A 5HG8A 1GZ8A 5HVYA 3QRIA 4FT5A 4J1RA 5CZIA 3FI4A 4ACDA 4DEEA 4E5BA 4C4JA 3E3PA 4A9YA 3O50A 4YMJA 3G6HA 2UZUE 1KOAA 4EH5A 4JQEA 2WXVA 5KMJA 1XR1A 3GEQA 4YR8A 4Z7GA 3PJ8A 4FX3A 1X8BA 2IN6A 3DTWA 3Q4TA 2HZ4A 3D5XA 5HTCA 2RGPA 4EHEA 2PVRA 4J8NA 4C2WA 2WU7A 3MESA 3F6XA 4R7BA 1MUOA 1OL2A 4C58A 1M17A 1Q3WA 5FWKK 3H10A 2HZNA 3OF0A 4IBMA 3LPBA 4DEHA 4FVQA 4QT1A 3MWUA 1ZYCA 2R0IA 3TIYA 4YJPA 3QCQA 5K9IA 1SZMA 2EXMA 4U3YA 3TG1A 4I0TA 4RJ3A 4ANMA 5FD2A 3MPMA 4IZYA 1ZMWA 4JOAA 4RWLA 3N4VA 2PL0A 4UZDA 3VQHA 3I4BA 4IB0A 4NJDA 1RW8A 5M08A 4HYIA 2XKDA 3TDVA 2YEXA 4LGGA 4YHJA 4MX9A 3NNWA 4CFNA 4CG8A 5FM2A 1YXUA 4YZ9A 2XKCA 3P78A 4F70A 3FV8A 4JS8A 4E8AA 4B99A 4F7JA 4X3FC 4DA5A 4IVDA 3KMUA 4FKQA 4GK2A 3QLFA 2WMWA 4FSYA 4PDOA 3P0MA 4A7CA 2VO7A 1L8TA 3BPRA 3ZLWA 3PYYA 4GG5A 4NCTA 3GC7A 3KRLA 2HZ0A 3NUSA 4DF3A 5AM7A 3GCPA 3QD0A 5HO8A 2CKEA 4OTQA 4RC4A 4FMQA 3K2LA 3EB0A 1J91A 2OF4A 4EOSA 5IQCA 4X2JA 3TIZA 4FUYA 4BCGA 5HEZA 2XYUA 4MNFA 4GJ2A 5I5ZA 2FVDA 2HY0A 1Q8YA 2PVKA 4LL5A 3VUHA 3SLSA 1OM1A 5CAVA 3TXOA 4DN5A 4BIBA 4BTJA 4D0WA 4Y83A 2V5QA 4FZDB 5IDNA 4L52A 5DR2A 2JIIA 4EHZA 1Q4LA 4L3LA 4JDHA 2B4SB 4YC6A 5L2TA 1PKGA 2ITZA 2X7FA 1ZOGA 4D4SA 4EYJA 3PWYA 4Y8DA 4QTEA 4BI1A 4YLJA 4O7ZA 3IW4A 2E9OA 4FEQA 4TW9A 4AZWA 4EH4A 4AOIA 5DVRA 3PLAE 2B9HA 3SC1A 4GKIA 4R77A 5L6PA 5FG8A 5CWZA 3RGFA 2H9VA 1S9IA 3BEAA 4ID7A 3FI8A 3MVHA 1ZYDA 3Q9YA 4PNKA 3CXWA 4DFUA 4O0TA 4G5PA 4OAUC 3DJ5A 2OIDA 1YKRA 2EB2A 4X7QA 5IEXA 5DIAA 2AYPA 4QPMA 2ZB0A 3DAEA 4RX5A 3QA0A 3UYTA 4HVHA 4Y5QA 4UYNA 5B7VA 1T46A 4KS8A 4H3BA 2KULA 5HG7A 4O7WA 4C0TA 5JK3A 4F9WA 1HCKA 4IVCA 4F9CA 4IDTA 5J8IA
chains in the Genus database with same CATH superfamily
2A0CX 3QD3A 4H58A 4AACA 5HQ0A 4CVAA 2UW3A 4GSBA 2J0MB 2O2UA 5GZ8A 4FGRA 4E4MA 3CY2A 3QTSA 2XIRA 5KUPA 3ZUTA 5LQFA 4DBXA 3KIOC 4I22A 4MTAA 4BDDA 3BEGA 1B39A 4EORA 2OO8X 2YDIA 3GI3A 4IMYA 3FJQE 4FR4A 1UNHA 2A4LA 1TFFA 1SVGA 4G6NA 3KRJA 4PMPA 5GZAA 3HGKA 4YJNA 4BDEA 1YHSA 2XEZA 3PVGA 2BALA 3LE6A 4MYGA 3V5JA 5IQFA 2YLEA 4F0IA 2J5FA 4QP9A 4K77A 5ANJA 1R0PA 1QL6A 2QURA 4QD6A 2OICA 3WE4A 4KABA 4CLIA 4A4XA 4A9UA 1KSWA 2OJGA 4TWOA 4CNHA 3HAVA 4KBKA 3QA8A 4ZJIA 5EM5A 3ORNA 4X3FB 4YURA 4H39A 1Y57A 1R3CA 2B52A 4UMUA 1URCA 3R73A 3VHEA 3WOWA 1PXNA 3BYMA 5EM6A 3C1XA 4IEBA 3FKLA 3WARA 4XP0A 3UGCA 3PP1A 3R2YA 3C0IA 4CMTA 3FXXA 4RWKA 5CY3A 1K9AA 3RNIA 3PRIA 1DS5A 4OAVB 1YDSE 3RCJA 3Q60A 4IB1A 3TJDA 4G31A 1YI3A 2Q0NA 1XH6A 3AT4A 4IXPA 3FAAA 1PF8A 4DGLC 4APCA 4X0MA 1WBOA 2JITA 5K5XA 5CEIA 1H0WA 2XS0A 4FUXA 4TYEA 5C8NA 3VNTA 4MNEB 3P08A 1OKWA 2C3KA 4ZSJA 4YPSA 3HRFA 4EK6A 2GNFA 4RZVA 4ANBA 2IO6A 3MFSA 2BAJA 2WIHA 4U6RA 5AMNA 3CLYA 3CTHA 3G0EA 3VW6A 3RPVA 4DEDA 2XMYA 4V05A 2GCDA 4I23A 4BCQA 4IQ6A 4WBBB 4F6UA 5AAGA 3QUEA 2XP2A 3LFNA 5E91A 2W4JA 5ETAA 3AQVA 3PP0A 4O6LA 5HNBA 4BB4A 4Q9ZA 3POOA 3UDTA 4C8BA 4AXEA 3BV2A 1YOJA 3R7GA 3ZDUA 1V1KA 1H26A 2A19B 1Y8GA 5DEWA 1IG1A 4PMMA 3VS1A 4IANA 3VW8A 5A54A 2C5YA 4BKZA 4DHFA 5BX0A 3OWPA 4I93A 2P0CA 3HP2A 3FL5A 3AC4A 3AD4A 2WU6A 3E62A 1DI8A 3KKVA 4CKIA 4ZS4A 1H1SA 2ETMA 3FDNA 5M07A 2VTLA 3L9MA 2GS2A 3BLHA 3V6SA 4I6FA 3JR1A 3QTZA 1XH7A 3BWFA 5KO1A 4C36A 3UOLA 3L8VA 2JLDA 5F4NA 3RK5A 2ETRA 1OUKA 3NCZA 4JRNA 4RJ8A 2HOGA 3OD6X 3TM0A 1AGWA 1Q61A 4OTFA 4E4NA 2WTIA 2C0IA 2YCQA 3AC3A 4BN1A 4MF0A 5JGBA 5I3OA 4O21A 1KOBA 1A48A 3LLAA 4WA9A 4AAAA 2BRHA 4MAOA 4P90A 3KF7A 3L9LA 4QMMA 5D10A 3SW7A 4FL3A 4QMLA 5E1SA 3E63A 4ZP5A 5ANGA 3PG3A 1H1WA 4J52A 4FKWA 1XH8A 2J50A 3DKFA 4XG8A 4Q5EA 3LCSA 3P9JA 3FYJX 3ZOSA 4G9RA 4DFYA 4ASDA 3ORIA 2WZJA 4QMTA 1V0BA 4N57A 3GC9A 4FNZA 4MHAA 4F9BA 3AMYA 5FBOA 4ZZOA 5I0BA 4YJVA 4MQ2A 3C5IA 4DFNA 2J90A 4EOLA 5AV3A 3Q9XA 5LMAA 3TZMA 4X2GA 5IA2A 3QAME 2YIXA 1UWHA 3EQBA 1Q99A 3M42A 2ZB1A 3Q96A 4IJPA 2RFDA 3ALNA 4O0RA 4O2PA 4QP7A 4WG5A 1VLRA 3A7FA 3ZEWA 1UU8A 2WQBA 3C4CA 4CT2A 5IPJA 2AQXA 2ITTA 4CG9A 3A7GA 3HMPA 3LFSA 3O0GA 5ANOA 1WBSA 4YZNA 3IPHA 4BR3A 3PE1A 2ZM4A 3S2PA 3DBQA 3I1AA 3ORZA 3TUCA 1XBCA 4I0SA 5EI8A 5M56A 5GIPE 4FT3A 3NMUF 1XBBA 1R78A 4YJSA 4YJUA 3QYZA 2IEWA 4WSQA 2OW3A 3EZVA 1ZZ2A 3I81A 4RJ7A 2BIKB 5M4IA 4D28A 2Z60A 1F0QA 4I24A 4WT6A 3NS9A 3CD8A 4JNWA 3VAPA 4DEBA 3VVHA 2W1FA 3VRZA 3FMDA 5FEEA 4CSVA 4I6QA 2W1HA 1YWVA 2R3FA 4FIJA 1H0VA 3FBVA 3LFBA 5CQUA 3VS0A 5A4LA 4KSPA 2PY3A 4IWDA 5EDPA 3O71A 4MD8E 4G6OA 3MIAA 5E8TA 3ZO2A 3AOXA 3HYHA 3SXSA 1QPDA 2QLUA 3RZBA 5AUXA 3DK7A 1UKIA 4W9XA 3W32A 5HNIX 5IUHA 3QQJA 4EK8A 2PZPA 1YI4A 3FKOA 5D7VA 3BQRA 3U8WA 3DK6A 2GNHA 5K5NA 3GCUA 2PUUA 4FA2A 4EL9A 3R63A 4PTCA 4RMZA 5HIBA 5DRBA 3CTJA 1IEPA 3S4QA 1BLXA 5J1WA 2VUWA 4V0GB 2BILB 2VX3A 5LWMA 3CP9A 3AD6A 2B9JA 3FXWA 4FYOA 2VWUA 3VIDA 1CM8A 4I5CA 3AD5A 3AT3A 5EOBA 1B38A 3AT2A 3BL7A 3P4KA 3H30A 5C9CA 4U79A 2CKQA 4WSYA 4IH8A 3L9PA 3RPOA 1JKTA 3V5TA 5IMEA 2CNUA 4NT4A 3JPVA 3NX8A 2HELA 3EFJA 3QU0A 3CD3A 4UXQA 3VO3A 4D2TA 5EI2A 4KUJA 2UVYA 2XIKA 4DGOA 4RVTA 3DKCA 3D2IA 3IKAA 3PJ1A 4M8TA 5EM8A 4GKHA 2UW0A 2YACA 5DWRA 5C01A 4D2WA 3UIMA 4D2PA 3MFTA 5IEVA 1H24A 3W10A 3A99A 2YDKA 2RSVA 3SD0A 3WF6A 2QD9A 4E4XA 1HCLA 2C3JA 3DCVA 2W05A 3IW8A 3KC3A 3KN6A 4NTSA 4YGAA 4BCHA 3G9NA 2XNPA 5GJDA 4W4YA 2WTKC 2O8YA 4FV0A 4FT7A 4NM7A 4XUFA 3W2OA 4J98A 4CMUA 4D2SA 5ACKA 5EKOA 3BHHA 4L00A 4HGSA 1W83A 2BZJA 4FJVA 4XRJA 4A06A 3TT0A 3BL9A 2OFUA 4M0YA 3C4FA 1DM2A 1ZYSA 4RIYA 3D83A 4NU1A 5HZNA 5M57A 4PL4A 1GIJA 2NRUA 4BJJB 3QHRA 2CLXA 2ITNA 4HZSA 4QRCA 4Y5HA 3DBEA 3WF7A 4ASZA 5IA3A 3DT1A 2DWBA 2UW8A 3IECA 1M2QA 3UP7A 4HOKA 1WZYA 4OTGA 4BKJA 1F3MC 1ERKA 4F0GA 4NZWB 2JIUA 3C7QA 3FLSA 3JUHA 3O7LD 4LQMA 4XCUA 3DOGA 1JOWB 2YIRA 4S33A 5EM7A 2WQNA 4JBPA 1ZYLA 4NIFB 3ZDIA 1XQZA 2HW7A 2ITVA 1U54B 2G01A 4LL0A 4M68A 4AWIA 4F7SA 2OIQA 4TYIA 1PXOA 2ERZE 5L8LA 3EFWA 4M69B 1GIIA 5E8UA 4C3PA 4EOJA 2PUPA 3L8XA 3NAYA 1H1PA 4O4DA 5JEBA 4AZTA 3MVMA 4EHGA 5FTQA 4PPBA 2C5OA 4LUDA 3MDYA 4MWHA 2I6LA 3FZRA 5F94A 3DLSA 2ZDUA 4BCIA 3A4PA 5E8ZA 5CXZA 3FZSA 2BDWA 3UO5A 3PA4A 4JVGA 3F2AA 1H1QA 3BYUA 3N4UA 4MH7A 4BWXA 2QOKA 2X2KA 2XKFA 3F3VA 3N4TA 5CNNA 5AUUA 4QMPA 1XWSA 4G5JA 4RBLA 1FPUA 2BDJA 3F5GA 4JXFA 3UJGA 2E9UA 2REIA 1QMZA 3ANRA 5M55A 4AW5A 4GT3A 3G9LX 3Q52A 5J79A 5EI6A 1WVXA 4EH9A 4LMNA 5ANDA 5GIOE 5CNOA 3ZRKA 3D0EA 1DI9A 5HLWA 5KZ0A 5CZHA 5KZIA 4MKCA 3A61A 2W5HA 3F7WA 3QD2B 1TKIA 2R3PA 4KIQA 1XKKA 2BKKA 3PVBA 2WOUA 2UZVA 2JKMA 5CTPA 3RHXA 2YIQA 2XIZA 4GEOA 1JNKA 3LXPA 2OJ9A 4FIIA 3F5UA 2I0VA 4PF4A 2F7XE 4EWQA 4HW7A 2PMIA 2GPHA 4F78A 4JDKA 1JWHA 3BBTB 4RGJA 5LARA 4ITIA 3EQIA 2UW7A 3V01A 5AR4A 2GTNA 3OCBA 3E88A 4QMXA 3SOCA 5HE0A 1Q5KA 3ID6C 4MEDA 3DV3A 4AXCA 2YWPA 4WOVA 2PUNA 1BUHA 3F82A 4IAAA 4EZ5A 3WIGA 5HX6A 2RFNA 4IADA 5E92A 1Y8YA 3DQXA 3TWJA 4CTBA 1OECA 4FV1A 4DTAA 3L8SA 3OW3A 2Y6OA 3HV5A 3EN5A 2WTKB 3FY0A 4KKHA 4FTQA 4I21A 5CQWA 4DHZA 3F7ZA 3NNUA 1Q62A 4DBNA 2R3IA 2BHHA 4QP4A 3D7TB 3ZM9A 3LCTA 4ERWA 3R22A 1GJOA 5GHVA 5EK7A 1UVRA 1APME 2XUUA 4YBKA 2C6TA 2X6EA 3EH9A 3F5PA 3PSCA 3MH2A 1M52A 5TO8A 3L9NA 5HLNA 4YTCA 3R9DA 3F3ZA 1IA8A 3LCOA 4ZZMA 2CSNA 5T68A 3MS9A 5FEQA 5B2LA 3V3VA 4LG4A 2C47A 3PUFC 2GHGA 4IHPA 5FGKA 3KRWA 4NFNA 4N0SA 2H96A 4YC8A 4YZBA 4JAIA 3ZS5A 3LVPA 3OY3A 5T6KA 2C5VA 2IWIA 2ZVAA 5M4FA 1Y6AA 2CMWA 2PVYA 3CC6A 5JQ5A 3OWLA 1U5RA 2A1AB 1PMEA 2JDVA 4KWPA 4TWNA 4O22A 4M12A 2BRNA 3O51A 3HAMA 5H8GA 3GGFA 2HCKA 3I7BA 4GV1A 3MFUA 3UQCA 2X7GA 3BYSA 3EMGA 4FKGA 4Y95A 1PW2A 4RIWA 3ZZEA 5AA8A 3E87A 2WKMA 1JLUE 4FTIA 1XH5A 3D9VA 4R7IA 3KMWA 3SX9A 2G15A 5CVFA 3BE9A 1NXKA 3DDPA 2YM8A 3MY1A 5BV3A 1ZWSA 2Z7QA 3QUPA 4JR7A 4PV0A 5LCJA 4I0RA 5AP6A 5AM6A 1MQBA 1ZOEA 2X8DA 4KIKB 3NZ0A 3CQEA 4AUAA 5BYLA 3MPAA 2VGOA 1VJYA 5DI1A 3RMFA 2PE1A 3FI3A 3PZHA 3QTXA 4HNFA 3VBXA 3ZRLA 3S1HA 4BGQA 3LQ8A 4GG7A 2J2IB 2WEIA 4RJ4A 4WD5A 5B2KA 1HOWA 5IUGA 2HXLA 5EYKA 2EXEA 4JIAA 4F9AA 5AR2A 4XJ0A 5CS6A 4G9CA 3D4QA 1G8KA 2B7AA 3WIKA 3W8LA 5A9UA 2B53A 4EC8A 3U6IA 4FSTA 1OZ1A 4LOQA 2Y4PA 4GRBA 3AGLA 3RWPA 4PDSA 2R9SA 3PWDA 2WMRA 1RDQE 5AR8A 2C6EA 3E8EA 5ANEA 4PP7A 5KMLA 5BVOA 3MVLA 2YFXA 4C02A 4E93A 4YLKA 2CGWA 4LYNA 3LKMA 2VN9A 3EQCA 4FV8A 3NPCA 4BIDA 3SQQA 5DYJA 4G3FA 4L3PA 2I0HA 5K4IA 1FGIA 2XZSA 4BYIA 4NJ3A 1BKXA 5L6OA 2PK9A 1Q3DA 2QOHA 4WUNA 5H8BA 4ITHA 1SNUA 3D94A 4G3GA 3I6WA 3E92A 5JMSA 3QUDA 3W16A 4EOMA 3UOKA 3BV3A 2RL5A 4O7VA 5JN2A 5CVGA 1SNXA 5CASA 2V0DA 2W99B 3VUGA 2B0QA 3Q3BA 1TZDA 3ZRMA 3FEGA 4DH3A 5CU4A 3AC1A 4C34A 5A4TA 4KAOA 4CZTA 5BMSA 3HECA 4O0VA 4JX7A 4X3JA 2F2CB 3FLYA 2QODA 4ZXTA 5A3XA 1PHKA 3VBQA 5J7BA 5FTGA 1M7QA 4YJQA 5HIEA 5M51A 1W7HA 5IA4A 1XMLA 2UW9A 3MGYA 2DUVA 3CIKA 3LW0A 3QWKA 5HG5A 4LMUA 5BMMA 2XNBA 1EH4A 4MNEA 4D4VA 3EHAA 4F1OA 2X81A 3LFDA 3NFFB 2J51A 3D2KA 2JKQA 2UVZA 3F61A 2IW8A 4I5PA 2V7AA 2WD1A 4ALWA 4AZSA 4DH8A 4DCEA 2WTDA 2W1EA 3REPA 5A4QA 4M7IA 4OBOA 3LQ3A 3W18A 3WZKA 4XX9A 2QKRA 3CE3A 3NIEA 2UZOA 4OTHA 4DGMA 5BVEA 3WYYA 1T45A 3DZQA 1H25A 1O6KA 3JVRA 4GFOA 5CEQA 4FZFB 1OBGA 3ZYAA 5HO6A 2JBPA 4CCBA 1Q41A 4MF1A 5JRSA 4DYMA 1TQPA 4E5AX 4QQJA 4BI2A 3MI9A 5CANA 5E4HA 4AQKA 2J0LA 4D2RA 5JQ8A 3OC1A 4O82A 4QNAA 4AN2A 4XYFA 3DU8A 4PDYA 3PDTA 3V6RA 1Q8TA 5AP1A 1FINA 3II5A 4FV2A 4GJ3A 5J87A 5BUEA 4C7TA 3DBDA 3A8XA 1OITA 4ACHA 3OOGA 3PXQA 3MN3A 4H1MA 3V8SA 4C3RA 2NO3A 2BPMA 2PMOX 2VWIA 3QL8A 4X2NA 4MBLA 5HU3A 1PYEA 3QC4A 1ATPE 5CU2A 5D11A 5JZNA 1XJDA 5IMXA 4BFMA 2XBJA 1ND4A 3R30A 4NUSA 4X21A 4O7YA 2CGUA 1FVVA 3ZM4A 4F64A 2NNWB 2W1GA 5A46A 5M44A 3VONA 4O7TA 5CF6A 2VX0A 1OIYA 4ACGA 4MXXA 4HNIA 5DHJA 4AF3A 3QQHA 4WNOA 1P14A 4IIRA 3KREA 2YN8A 1FOTA 3P23A 2EB3A 1Q8WA 4I6HA 4FTAA 3OMVA 1WCCA 3BGZA 4FSMA 3ALOA 1H1RA 4B0GA 2R3MA 1KE6A 4J95A 3W0OA 4WNPA 1JAMA 2BRGA 2VWBA 2R4BA 3BYVA 3FZ1A 4OTPA 3ML1A 3HV7A 4FV4A 4BDAA 4R8QA 1R39A 5J7HA 1U5QA 4ARKA 3RPRA 2VTPA 3UG1A 4L44A 4XOYA 4ANOA 3FC1X 3UPZA 3H0YA 2YISA 1SMHA 3ORKA 4G1WA 3POZA 4XS2A 5GNKA 4ZY5A 2YZLA 4N6YA 2VTAA 4O0UA 3R8VA 4JDJA 3E3BX 3W2RA 3AKLA 1ZZLA 4PQNA 1VEBA 4Q9SA 4UXLA 5AFVA 2W5BA 4P5ZA 4YO6A 3MJ1A 4GMYA 3SXFA 4C2VA 3HA8A 5CF4A 4MD7E 3OW4A 4W4XA 2UZNA 2OH0E 4QP3A 4MXZA 4E7WA 5L8KA 4QYGA 3UDZA 3W0PA 4CFVA 3LFEA 2PE2A 2FUMA 3PE2A 5CI7A 4YO4A 5BPYA 4IZ7A 3OP5A 2ITUA 2VZ6A 1JKSA 2FA2A 3QZIA 4M15A 3VS6A 3I79A 2UW5A 2YM3A 4FV6A 2CJMA 3EYGA 3V04A 3Q9WA 5AP0A 5HCZA 5GZ9A 4C33A 2VNYA 3NAXA 4RFYA 1JSTA 2PVNA 4QMVA 4O4FA 2E9NA 2RFEA 4O6EA 2WFYA 3H9RA 1FMOE 3N51A 3CJFA 3QF9A 2QO7A 5D1JA 4IB3A 1MP8A 2GFCA 2X2MA 3KRXA 4V0GA 4ZS0A 3ZBFA 4EOKA 3OTVA 3VQUA 3R2BA 4CTCA 3HRCA 4EH8A 4EKKA 4RFMA 4E6DA 4IM3A 2FGIA 4EZ3A 5DT3A 2X1NA 3BHYA 5DN3A 2HAKA 4CGAA 3TV4A 2OSCA 1R1WA 4UYAA 3CPBA 1KV1A 3KF4A 4DEGA 4F6SA 1W2FA 2XYNA 3P7BA 4FNYA 1ZMUA 2R3NA 2IVVA 2XJ0A 4ZY4A 4IFCA 4AAYA 3TKHA 5FDPA 2WIPA 3MY5A 2UV2A 4U41A 4DEAA 4EH6A 3HKOA 4X2KA 3T3VA 4C59A 3PFYA 1YW2A 3R1QA 2VTSA 3T8OA 2XF0A 3UDBA 3ANQA 3W2SA 5CEPA 4BCPA 3NUXA 4RQVA 2QOIA 3GOKA 2XA4A 4FL1A 3PG1A 5E1EA 5H2UA 4UMRA 3GP0A 3SXRA 3BWJA 3T3UA 3K5VA 5AR3A 1OUYA 4JBOA 4OT5A 4BBFA 3V8WA 3EKNA 4CFWA 4O2ZA 1H8FA 3DK3A 4C4FA 4HVDA 5EOLA 5JRQA 5HHWA 4FG8A 4JMQA 3HV6A 4J99A 5I9ZA 4BJJA 4BI0A 1IAJA 1I09A 3I60A 4DLIA 2IVTA 4QMZA 5BVWA 4XV3A 3AMBA 3SRVB 3Q2JA 3FSFA 3SVVA 4QPSA 4ASXA 1DAYA 2I40A 4ALVA 4ORKA 3VUMA 4BGGA 5FXRA 3OROA 4NIFA 2OF2A 4PWNA 4CEGA 5JFVA 4HVSA 1U54A 4D4YA 2CDZA 4CV9A 2GQGA 4J96A 4ZTLA 4XBUA 2GS6A 4I20A 4PUZA 3S95A 4GS6A 4M69A 3HMOA 2Y7JA 4W8DA 1DAWA 3ZSGA 4CLJA 3NUNA 4FKJA 5GJGA 3BQCA 4A07A 5JFWA 1UNLA 3NNXA 4K2RA 2BIYA 2W5AA 4Q5HA 2BAKA 4I3ZA 4Y46A 3GOPA 1H00A 2VWVA 1J7UA 1F5QA 2QR8A 4N6ZA 4NW5A 2I7QA 4U97A 3NYNA 4I5MA 4KIPA 4DDIA 2IJMA 5CALA 4NKSA 5E7RA 4D5KA 5ITAA 2XK7A 1PMUA 4E26A 2X9FA 5KCVA 4GU6A 3UVPA 2X8IA 3TKUA 2W96B 4EJ7A 3RAKA 2ZDTA 2DYLA 3WF9A 3ZCLA 5D7AA 1G8AA 2O63A 4XV2A 3DQWA 4A9RA 3LMHA 4YUQA 3VUIA 4P4CA 4CFMA 4OTRA 5CSVA 4YC3A 1BI8A 5BYYA 3NW5A 3F69A 3F3UA 5AA9A 3ZEPA 2AC3A 2W1IA 2R0UA 4C57A 3CSVA 3F3WA 3FE3A 5I4NA 1JBPE 3IG7A 3LJ0A 4XRLA 3TI1A 1WBVA 2RFSA 2BR1A 3FL4A 3MSSA 3DAKA 3U4WA 2IVUA 2VO3A 2HXQA 2ZMDA 2G2FA 1PMNA 3NR9A 3VF9A 4KIOA 4UB7A 3QWJA 3SKCA 4USDA 3K5UA 2XJ2A 2NPQA 3U54A 3O8TA 5LCKA 3SG9A 3KQ7A 4I6BA 2C69A 3RKBA 4XLVA 1OL6A 3CKWA 3TNIA 4O1PA 4A9TA 3WZEA 5CT0A 3R7OA 5IG1A 4QP2A 2EVAA 4BCJA 3ACKA 2VTNA 3BRBA 2BKZA 3KEXA 1O6LA 2WTJA 3EQDA 4BDFA 4CFUA 4BCKA 4FK6A 3U87A 3V5LA 4EKLA 4RIXA 3R8ZA 3D7TA 1AQ1A 2BZKB 3DJ7A 5D12A 1PXLA 2YERA 2X4ZA 2ZM3A 3F5XA 3OY1A 4LM5A 2FSOX 2WAJA 1M2PA 5ETFA 4U9AA 5I9YA 4RSSA 4AXFA 4IDVA 5AJQA 1PXMA 3UMWA 3QRKA 5G6VA 2JKOA 5FP5A 5C8KA 5IF1A 2P55A 4KA3A 4OTWA 3F3TA 5E90A 5CF8A 2P4IA 3PY0A 2QOOA 4O81A 2UZDA 4NCTC 5L2WA 2JBOA 2C1AA 2J4ZA 5AADA 5IQHA 4ANQA 3O8UA 4FV5A 4YPDA 2IW6A 3I5ZA 2R7IA 3U51A 5EW9A 3ZHPC 3DA6A 5M53A 4EBWA 3TNWA 4EUTA 2X0GA 5LXMA 4XHKB 4IX4A 5J9LA 3EYHA 4XEYA 3RCDA 4RWJA 1OKZA 4O1OA 4WRSA 4DH5A 4LGHA 2YWVA 5ETIA 3BLRA 3RHKA 3IGGA 3JYAA 3ULZA 4TYHB 3SW4A 3H3CA 5DPVA 3IONA 5CENA 3ZLYA 3ULIA 3O96A 3FQEA 1ZARA 3ENHA 2WQEA 3H4JA 4KIKA 1ZLTA 2V62A 3P7CA 4IVAA 2YCFA 2A2AA 4U81A 4EQMA 4DLJA 2XIXA 2F4JA 3GB2A 4XP3A 3ZUUA 4BCMA 3VULA 3RK7A 5L3AA 3U9NA 4GUBA 1PYXA 5CU0A 3ITZA 3BZ3A 3MA6A 4YZCA 3M1SA 3SGCA 4RQKA 2IPXA 5ANIA 1LP4A 2VTOA 4IAZA 1NY3A 2XNEA 4XG7A 1ZMVA 4RJ5A 3W0MA 3QHWA 4EH2A 4FTUA 2GDOA 4CYJA 4QDVA 3CEKA 2RF9A 4LRKA 2GQRA 2LAVA 4FI1A 4IC8A 2H34A 1FQ1B 3LMGA 4NKAA 5I9VA 3F9NA 4YSMA 3KMMA 2B55A 2P2IA 4D9TA 1ZAOA 4P5QA 5HTBA 4RLKA 2ITWA 5KE0A 1CMKE 3UODA 2ESMA 2ZV2A 2XIYA 3QTWA 1J3HA 4MVFA 3QKLA 1WVWA 3MYGA 2A27A 4L8MA 3MVJA 1P5EA 1H27A 2CGXA 3PJ2A 4DGGA 3I6UA 5CEKA 4O4BB 4PL3A 3BLAA 3ROCA 5B2MA 5AEPA 1GIHA 3CGFA 3ZO1A 4F7NA 3O2MA 3G33A 3E64A 3HNGA 3BGPA 3HP5A 5HCXA 1OB3A 2WMSA 5J5SA 3DLZA 3KB7A 5EKNA 5HKMA 3R21A 5CAOA 3FHIA 4OBQA 2W0JA 3MV5A 1OI9A 4PTGA 5BUJA 2IZTA 2CN5A 2XNOA 3BYOA 4EOIA 5EYCA 4A4OA 4D9UA 3NIZA 4AZEA 3VS5A 3FUPA 4AQCA 3A8WA 2VTQA 3LMIA 2ZJWA 2IW9A 3O17A 3MB7A 3TKIA 2YM6A 5KMIA 4GIHA 2P33A 2PVFA 3GNIB 4EOQA 3F88A 3PPJA 4CT1A 2GSFA 3WILA 3CJGA 4NM5A 4AA5A 5J9ZA 1BI7A 1OIQA 5IQEA 2IZSA 3ZLXA 3OZ6A 5HI2A 3UG2A 1BL6A 2QOLA 4WG3A 5ETCA 1XH4A 4AGCA 4APPA 1YVJA 1FVRA 3DAJA 4OTDA 1KE7A 4XBRA 3Q4ZA 3G0FA 4PNIA 3COHA 4QMYA 5TT7A 3KA0A 4FL2A 4TPTA 1NA7A 3G15A 2EWAA 2O5KA 2Z7SA 5EFQA 4BZNA 4RZWA 4M67A 3FPMA 2W06A 4MXYA 2BFXA 3QFVA 5CT7A 5HD7A 3W1FA 4Z7HA 1UKHA 4XNEA 4C38A 4O86A 2QOBA 4L6QA 4HGTA 3A7IA 3GVUA 3LXNA 2GNGA 2F57A 4AU8A 2B54A 3TEIA 4RA5A 2J0JA 3RZFA 2OK1A 3UZPA 2ITPA 2W4KA 3BU5A 1G3NA 1YXSA 4I4EA 1GY3A 4BIEA 2ZV7A 4MD9E 4QQ5A 4ZTNA 4S31A 5KX8A 2V55A 1BYGA 4FKRA 4E6AA 2C68A 5A14A 2OJFE 2ITOA 3QGWA 4FNWA 4NH1A 2QHNA 3NW6A 4ZTMA 4O7SA 2NYAA 4UEUA 2YM4A 2XAMA 4IM0A 2UZTA 3ORPA 2VAGA 2Z8CA 5A6OA 2E2BA 3IGOA 3FMEA 3NYXA 4G3DA 5IUIA 5DOSA 3U9CA 3QCSA 4I41A 3QRJA 4AXDA 5CF5A 2CCIA 2J5EA 3MW1A 4QYEA 4G3EA 5DR9A 4EJNA 2C1BA 3IW5A 2WMQA 4GT4A 4DCAA 3L1SA 5FM3A 2UZEA 2WQOA 2J7TA 3H9FA 4QMOA 5EYDA 4IW0A 1ZY4A 4E3CA 1E1XA 1PKDA 3RNYA 5AV4A 2HZIA 3ORXA 4W8EA 3KULB 3FZOA 3UIUA 4DH7A 3KL8A 2YM7A 5HIDA 4EH3A 3U6JA 1R0EA 2WTCA 3UPXA 3HL7A 4C3FA 3KK9A 4ANSA 3KXGA 1NT2A 2C6DA 1W0XC 4FVRA 4E1ZA 3R04A 2HWPA 4DT8A 3UOJA 2QQ7A 3DNDA 3P79A 4L42A 1PY5A 3BX5A 2Z7RA 4L45A 3E8NA 2XK6A 5L2SA 4L67A 3T9TA 4IC7A 3FMNA 3PY3A 4NEUA 4BTMA 2OXYA 2QG7A 5BVDA 4LGDA 4BWKA 5DH3A 3JS2A 2A98A 5HGIA 4DINA 2BROA 3Q5IA 2VO0A 3FMMA 5AP3A 1Z57A 4MQ1A 4D0XA 4DITA 4WIHA 2CLQA 2WTWA 3UNJA 2WTVA 3R01A 4B8LA 2BMCA 4U40A 2F49A 3UZRA 2YABA 3UO4A 1W2CA 3GFEA 2X0PA 4FT9A 5GJFA 3EN6A 4F1MA 4GIIA 4N4SA 2XKEA 4G2FA 5F95A 3C4EA 2OBJA