1WBTA

Identification of novel p38 alpha map kinase inhibitors using fragment-based lead generation.
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
351
structure length
351
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
publication title Identification of Novel P38Alpha Map Kinase Inhibitors Using Fragment-Based Lead Generation.
pubmed doi rcsb
source organism Homo sapiens
total genus 113
structure length 351
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1wbtA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1wbtA01
1OPLA 4NUSA 4IH8A 5IA5A 3ZSIA 5KO1A 5AV1A 4FTUA 2HOGA 4LV5A 5CANA 5E8UA 3IGOA 4IVBA 3FY0A 2C69A 3WF8A 3BELA 4FTMA 5A4EA 4W4XA 3FZSA 4QQTA 3OT8A 2OU7A 2W17A 2BHEA 3CTQA 2XK9A 3L8PA 5H3QA 5TOZA 3QCXA 4I5CA 3TZMA 2VZ6A 2BZHB 3HRCA 5CI6A 3R7UA 4BCNA 2YIXA 3S1HA 4BHNA 2YJRA 4QMOA 4J96A 4ALUA 5L3AA 1YWRA 4OR5A 1YI4A 2YLFA 1WCCA 3IPHA 4YC8A 2G9XA 5CU6A 5F94A 5C4KA 5M44A 3D5WA 1UKHA 3R28A 4L3JA 5EKOA 3BIZA 3VS4A 3GEQA 3JY9A 2YM5A 3RAKA 5GIPE 3LMIA 3NW6A 4QNYA 5HVKA 3QZIA 4A9UA 3PXFA 3BV2A 1DM2A 2OG8A 3DK7A 5CY3A 2W1CA 4A9SA 4FIHA 2X2MA 1URCA 2P2HA 5J1WA 4BR3A 4G31A 4WRGA 2YEXA 4RJ8A 4ANMA 5FDPA 2PK9A 3G5DA 4D2TA 4NM7A 2ZMCA 4Q5EA 3U6JA 1XH6A 4I6FA 1YHWA 3GB2A 3DBCA 3WZJA 4I0RA 1PYXA 3A8XA 5AADA 5BPYA 4OTGA 2RL5A 4BDIA 2C1BA 3G9LX 5HU9A 4J8NA 2ITZA 2IWIA 3QCYA 5LXMA 5B2KA 3DQWA 4B0GA 4APPA 2BILB 4XS2A 1E1XA 3OBGA 5FLFA 1CMKE 4JVGA 5E8WA 4BI2A 3L8SA 2B9IA 4JJRA 5AR3A 5CAOA 1TQPA 2XJ0A 4QTCA 3EWHA 4XV1A 3P78A 4E4XA 5K4JA 3DB8A 2WO6A 4BDDA 4E5BA 4FV5A 5M4UA 2H6DA 5E8XA 1MRVA 5HORA 1V0OA 4MX9A 3QFVA 3E7VA 3PWYA 2OF4A 3A7GA 4C4IA 3BPRA 4AT3A 5IA1A 4LQMA 3ZSGA 2Q0NA 2YIYA 3MFRA 1R39A 1SVEA 4GJ2A 4KBCA 4A9RA 4TY1A 3DAJA 2ONLC 3PXZA 3SXSA 2X7OA 4DEAA 5KMLA 2QOQA 4FV4A 4G5JA 3MPMA 3U9NA 4EEVA 5CVHA 5CALA 4RBLA 3FYKX 4IVCA 4IWQA 4XJ0A 4LGGA 4IM2A 4A4LA 3V5LA 2VTJA 3EZVA 4MKCA 2EB3A 4AGUA 4FV7A 4HYUA 2AC3A 5IH4A 5JEBA 2GCDA 2VWBA 4QD6A 3FMDA 5E90A 5IEYA 4ZS0A 1VR2A 3ELJA 2CCHA 1PW2A 2J7TA 3QTRA 5A46A 1YDTE 2QOIA 3RBWA 3RI1A 5LVPA 3VS0A 4G5PA 3DBQA 3LFEA 1OMWA 1UNLA 4IAAA 4Z55A 3LPBA 4D2VA 2VWZA 3I7CA 4RX7A 3RPOA 3TIZA 2G1TA 2YABA 4YJQA 2ITUA 2E9VA 3MY0A 3I0OA 3DZQA 1U5QA 3Q60A 4DGOA 3PG3A 5EYDA 4X3FA 3FC1X 4FSZA 1KE5A 4M67A 4FIFA 3I6UA 3RKBA 3UP2A 1H0VA 2OH0E 1I44A 4YO4A 4CMTA 4YZNA 2G2HA 4OBQA 3VUKA 2VWIA 4PV0A 4UN0C 2F9GA 3IECA 5CVFA 3P7BA 2Z60A 4C57A 2GU8A 3LFFA 4UXLA 4DT8A 1R78A 4UMUA 4O7SA 3COIA 4FYOA 4XG9A 3SVVA 3B8RA 2JLDA 4M3QA 4IB3A 4CV9A 4RMZA 4QMNA 3C5IA 4FG7A 2X4FA 3G0FA 4QP8A 5I9ZA 4KINA 4W4WA 4ARKA 5L8LA 2XKDA 4ZJIA 2WMSA 4IANA 5CSHA 5AP6A 4CKRA 4NTSA 1VYWA 2CKOA 5JSMA 4GJ3A 2R3KA 3KC3A 4R6VA 2IVUA 4XP3A 3VBYA 4BCIA 4RT7A 2V22A 3QRUA 4B99A 3ORMA 4BTFA 5IH5A 4HNIA 1RDQE 4IWDA 1JBPE 1YDRE 3BQCA 2R3IA 3ZONA 5DEYA 4HVDA 4F6SA 3KN5A 4ZEGA 5FTGA 3W8LA 2J9MA 2GNLA 4TKSA 5JFXA 4G2FA 3RTPA 3HP5A 3WZUA 1TQMA 4K11A 3ZHPC 4FTAA 3O7LD 2X7FA 3R9HA 3R9OA 3V5JA 4FR4A 1XHAA 3T9TA 5M53A 1OL2A 4HCUA 4EKKA 2QHMA 3UG1A 5M56A 4EH3A 3Q6UA 2W9ZB 1OECA 4G3EA 4K6ZA 5I0BA 2XBJA 2HCKA 5KHXA 4TNDA 3OT3A 3FXXA 3LXLA 2ZV7A 2W4OA 4BDKA 4DLIA 2J4ZA 3W33A 5KZIA 1U54B 5LCKA 2CN8A 3H30A 3ZO2A 5I5ZA 2WQEA 4M0ZA 4NSTA 3WYXA 2HW6A 3C0IA 2CCIA 3R22A 3E8EA 4XLVA 5EYKA 4WG4A 4YZCA 5JFVA 5IQBA 2OF2A 3GCPA 2CGVA 4II5A 4JBPA 3C1XA 5KZ0A 3LQ3A 2FH9A 3SGCA 3ZBXA 1G8AA 4GU9A 3PVGA 2ERZE 3RINA 4PQNA 4NL0A 3TXOA 2VO7A 3Q52A 3PG1A 2PUUA 4YJVA 2PWLA 5I9UA 3ZLYA 4AS0A 2WEIA 2XRUA 2VN9A 3F82A 3MS9A 5TO8A 2EVAA 3AOXA 3NNWA 3SOAA 4IFGA 5H8BA 2YM8A 4XG6A 1SNXA 4YZDA 5FM3A 3TWJA 4YTCA 3I7BA 5AAGA 4AW5A 3SW7A 2C0OA 2CLXA 3E5AA 5E8VA 5HBJA 2FB8A 2QO7A 4RWJA 2VWUA 3C51A 5AMNA 5BVKA 4Z7HA 5HD4A 5DG5A 5H8GA 5KMOA 3ZRLA 5HNBA 2F7XE 2I6LA 1YWNA 4DGNA 3JS2A 3EMGA 3VJOA 3OZ6A 4KRCA 4RIXB 3SW4A 3PE1A 3F61A 4ACHA 2J0IA 3MV5A 4TWNA 3IOPA 3FMKA 4H3PA 1PXKA 3FY2A 2W0JA 4BYJA 4G6LA 4O21A 3TN8A 1H01A 3AT4A 3IG7A 1H8FA 4IW0A 4F7JA 4FGRA 4DTBA 3HGKA 3UQFA 2NPQA 2IZTA 2YCQA 3NDMA 3TEIA 4EONA 5KKRC 5HX6A 3C50A 3L8XA 3Q5IA 4FNWA 4TYJA 2BIYA 2XYNA 2UVZA 3IONA 2PMOX 4J53A 2B9JA 5DRBA 4M8TA 4IX3A 4D58A 3AT2A 4EHEA 2R3FA 2XUUA 3COKA 4E7WA 4YBJA 1W7HA 2E9NA 4FZAB 2GHLA 4ENXA 5FXSA 3UTOA 4DCEA 1CKPA 4H3BA 1UA2A 4JR7A 1WBWA 3EL8A 3LFBA 3LFNA 3ORLA 3RPVA 4ZLYA 5BUIA 5DA3A 3LKMA 2QKWB 4MTAA 2R2PA 3VW6A 4IC7A 4FZ7A 4IAZA 2P0CA 3N4UA 1F0QA 5F1ZA 2WEVA 3C4EA 3EN6A 4ID7A 3ZUTA 4LOPA 2YCFA 3JPVA 2BDJA 3KKVA 3E8NA 1AQ1A 4BICA 2CNVA 5K4IA 4UBAA 3KFAA 1FGIA 5IA0A 4I92A 4DYMA 3ZUUA 4U43A 4IJ9A 4ZSAA 3F3UA 3FZOA 4XH6A 2BKKA 2H96A 4D2RA 4C35A 3HMPA 3Q4TA 4C4JA 2IVTA 1J1BA 1WBNA 4Q5HA 3GCSA 4GH2A 4ZTMA 2J0LA 3LCKA 5J5SA 3SA0A 4JRVA 3TUDA 4DBXA 2GNHA 3MI9A 3MFSA 4XRLA 4BHZA 1FMKA 3NYNA 1QPEA 4IX6A 2F2UA 3PTGA 4ASEA 4EH8A 5LJJA 3QA0A 5CAVA 5IQGA 3ZLWA 2W1DA 4MXAA 3UVPA 5M08A 4K9YA 4E93A 2PMNX 2QVSE 3P4KA 3V04A 3EZRA 3QC4A 4XEYA 2XNBA 2BMCA 2C0TA 3MH0A 4KABA 4RJ5A 5AM7A 3W10A 5AUZA 1H1WA 4RWKA 3LXKA 3OWPA 3GT8A 3LAUA 4NJDA 4O91A 3SRVA 4K18A 4BI1A 2Y9QA 4K1BA 2HZ0A 3PY3A 4FODA 4LG4A 4JQ8A 3RNIA 4W8EA 3SLSA 3G9NA 3GOPA 4O84A 4QPSA 4BDBA 4UWCA 3NNXA 4OTQA 3B2WA 4J98A 4ZY6A 2YWPA 2ITPA 4UX9A 4V04A 3VBQA 3E3PA 4NM0A 5IPJA 5IISA 5HG8A 4QMQA 5HNIX 2XA4A 2C5NA 1KV2A 4FZFB 5J79A 4RA5A 3LLTA 3O8TA 4QOXA 4YNEA 5C03A 2C6OA 3CR0A 4H1JA 2C3JA 2W1HA 3CEKA 3SKCA 5EOBA 5DN3A 5C8MA 4OTWA 5E8YA 3OY1A 4YJOA 5HO7A 4WD5A 4CTBA 3QQLA 3UNJA 4PUZA 2PVRA 4HYHA 3TUBA 3QQFA 4BRXA 1VZOA 5E8ZA 3QRTA 4X2KA 3HDNA 4GEOA 1W8CA 4KKGA 4MQ1A 3ATSA 3FQSA 5E8SA 2WTKC 1JPAA 4GT4A 1OITA 4AT4A 4HPTE 3F3TA 1FBNA 4YNOA 4C3FA 4ACGA 4M69A 2GHGA 2PZ5A 4YTHA 3OCGA 4IDVA 4NIFB 1ZZLA 3PVWA 2HWOA 4PMPA 1TVOA 2HZIA 4YR8A 4BIEA 3MFTA 3ZO1A 2B52A 3GP0A 1KE6A 2FVDA 1ERKA 3UP7A 3M1SA 3EN4A 3QCSA 4DH5A 4AF3A 4XHKB 4AN2A 4NCTA 2UW4A 3HUCA 2CNQA 1GZ8A 4WBBB 1B38A 4GFOA 4U6RA 1Q61A 4PNKA 2JAMA 5CI7A 5FGKA 4F7SA 2C0IA 3KXGA 5DT0A 4BDGA 3RCJA 3VS7A 4FL1A 4QMMA 5LWNA 3ZS5A 3QUDA 5HE2A 3VBXA 5K3YA 5CAQA 3RHXA 4F99A 3QX2A 2P3GX 3CS9A 3NWWA 4JX7A 4EL9A 2OJFE 4R5YA 3TDVA 1H1PA 4FZ6A 4GVAA 4RIXA 3EFKA 4FA2A 1UV5A 5DI1A 3IW5A 3OTUA 1UNGA 2W05A 2C3KA 2I0VA 1SMHA 2J6MA 4L53A 4OTFA 2PZYA 1H28A 2V55A 3NRMA 3UC3A 1OL7A 2A4LA 3TV6A 2OJ9A 5AEPA 1PXJA 4FTKA 4U3ZA 1QPDA 5J8IA 3LCSA 2Y4IC 4GYIA 5IG1A 4HZSA 1FINA 3HA6A 3KXHA 4O6EA 4BDAA 3QZFA 4PTEA 1JWHA 2DWBA 5ETCA 4BCPA 1PXIA 4FSRA 4XG2A 3DOGA 3UGCA 4BDFA 5ETIA 4CKIA 4E4LA 4F70A 5I9XA 4CQGA 3QF9A 4B7TA 1JQHA 4ZTSA 2VWXA 4X3FC 3ITZA 4D1ZA 4ZMFA 3CPBA 3QQJA 4NKSA 2YFXA 4I22A 2VTMA 3ODZX 1KOAA 4D5HA 3EB0A 3KU2A 3KL8A 1GZNA 1FPUA 3BLHA 1ZMUA 1Y6BA 1Q5KA 4HCVA 5ANEA 3W2QA 4CRLA 3L9NA 3W2CA 4TL0A 2BIKB 2ZOQA 2WQBA 5CNNA 3U8WA 3WBLA 2FYSA 4MYGA 4DEIA 3D9VA 3RK9A 5I9WA 4AN3A 3CJFA 3HNGA 4AGDA 1XR1A 3O2MA 2QG7A 3MJ1A 4LMNA 3ZO4A 5AAEA 4QMSA 5BUEA 3PSBA 3CQWA 3NEWA 2W1IA 1BI8A 3G2FA 4BC6A 1PRYA 3FKOA 5LCJA 1B39A 4BKZA 2R4BA 2PE0A 1Z9XA 3I1AA 3VUGA 2OZOA 2X6DA 3PY0A 4S31A 4X2NA 1GAGA 4I94A 4JAIA 4LI5A 4EK4A 2F2CB 1OIRA 2OJJA 3BYMA 4PX6A 4V05A 3H9OA 4YPDA 3GU4A 2QOLA 3UVQA 2OKRA 3ZTXA 4EK8A 4ZLZA 3TKUA 4K8AA 4FNZA 4RFMA 1M2PA 3KXMA 4RQKA 5B2LA 4F0FA 3BEGA 2PVKA 5CF5A 2EXMA 2IZRA 5A9UA 4BTMA 4EZ3A 2I1MA 1YXXA 2YCSA 3F9NA 4BN1A 3RAHA 2JKMA 2OLCA 3PJ3A 2C68A 4ASDA 1PMVA 3UVRA 3LFAA 5ETAA 4BGQA 2OJIA 2OK1A 4LYNA 2X2LA 4CT2A 2ZB0A 3CLYA 4X3JA 4YJPA 4EQMA 3VC4A 5KMKA 3MB7A 2A1AB 2XJ1A 2WOUA 1XH9A 4Y46A 4U80A 4OW8A 1VEBA 3ZCLA 3ZM4A 5KMIA 4Z9LA 4F08A 5DPVA 3W8QA 4NT4A 4O0TA 4PL4A 4MH7A 5EI2A 1OIUA 4CFWA 5L2IA 4RPVA 1V0PA 1SNUA 5CU0A 2QR7A 4ASXA 4O82A 1RQQA 1CTPE 4QP3A 3LXPA 1MRUA 3FLNC 3VBWA 5E4HA 3BYOA 2R0IA 4QYEA 4AP7A 4QP6A 4CXAA 4WUNA 4EWQA 4IACA 2XEZA 4OAUC 1FOTA 5CTPA 1OGUA 2G2IA 5FRIA 1F5QA 3DTCA 3UOLA 4FKVA 5I3RA 1M2QA 3ORPA 4U3YA 2J0MB 3R02A 4NIFA 2I40A 4O27B 2LGCA 1S9IA 2XBAA 4O0YA 3PUPA 4E6AA 2VWYA 4R78A 3R1YA 4BL1A 2KULA 3R8UA 4LL5A 2GNFA 3QA8A 4AE9A 3KMWA 3QUEA 4TN6A 4GIHA 1YOJA 3PJ1A 2XIXA 4UB7A 5AP5A 3DNEA 2XK8A 4C4HA 4E5AX 2GTNA 3PPJA 3MBLA 2OIQA 2E9OA 2QU6A 1XWSA 4U79A 4X7QA 3U4WA 4I5HA 3I81A 4G17A 3U51A 1GIHA 4M84A 2CKPA 3NGAA 3QYZA 1FVVA 2QOOA 3UMXA 2GFCA 1IA8A 4FV0A 5AAFA 2F7EE 5AUTA 5AV4A 3LLAA 5D12A 4DT9A 5FDXA 3DB6A 1DI9A 3U4UA 4O2PA 4YUQA 2WTJA 5BVFA 1UVRA 1OIQA 3GU8A 4J97A 3AC3A 2YN8A 4XG7A 4S33A 1YXUA 2FUMA 2WMVA 5AR5A 4WOVA 4V0GB 3B8QA 4JLCA 3PVBA 4FVRA 1STCE 2WGJA 3GCVA 3DKCA 1WBTA 4RC4A 4U41A 2XYUA 5CASA 4NWMA 4X2JA 4EZ5A 1PF8A 3FMMA 5ACKA 3V6RA 4FEXA 3ZM9A 2XK3A 4E6QA 3BE2A 4BDEA 2WTWA 1XBCA 3OWJA 2PVNA 2YM6A 2RFDA 3NUUA 4FF8A 4AA0A 4RX5A 3BU6A 3QLGA 4FTOA 2VTLA 2YA9A 1ZXEA 3GFWA 3HYHA 4J99A 2C6EA 2REIA 4LUEA 4UMQA 1Q3DA 2PZIA 2XB7A 5CEPA 5CNOA 4I5MA 3BGQA 1KOBA 1VYZA 2I0EA 2PY3A 2QURA 3Q4CA 2G2FA 2ZV8A 3U54A 2OWBA 4JL9A 2H9VA 2AUHA 4DFYA 5B2MA 3QTZA 2ACXA 2C5XA 2J0KA 3VS5A 4I4EA 3W2RA 2DQ7X 5A4QA 1Q8WA 2JC6A 3DFCB 2FSMX 3EKNA 4X3FB 2QG5A 4OTPA 3KGAA 2WTIA 5ANIA 3WZEA 1HOWA 2BRMA 2GTMA 2J2IB 4I93A 2XNPA 3BKBA 2UZBA 5HHWA 2E9UA 4BKJA 4L00A 3DKGA 4XV9A 4LL0A 2Y8OA 3BCEA 2RG6A 4BCGA 3SC1A 4O96A 4BGGA 4JBVA 5DWRA 4BCMA 3F3WA 3V8SA 5IEVA 3TACA 5BYYA 4CEGA 5KE0A 3ZO3A 4TRLA 1TKIA 2VGPA 2ZDUA 3S0OA 3OXIA 4H3QA 3BEAA 3F3ZA 4QTAA 4HCTA 5JRQA 2X4ZA 3DBDA 2JBOA 3FI2A 3MGYA 3MVJA 3ORXA 1YOLA 2O0UA 3R83A 4ALVA 3PLSA 3IW6A 4FIEA 2HYYA 2VX1A 3RGFA 4EJNA 4FT5A 3D5VA 3HUBA 3Q04A 4QYFA 2C4GA 2XIYA 3N4TA 2PZRA 2YIWA 4YO6A 4FSNA 2RSVA 2WTDA 3P7CA 1FGKA 4IDTA 3ZXZA 3QQGA 4DFZE 2R3RA 1AD5A 5CU4A 3O0GA 2VWWA 3PP0A 5HVJA 1ZRZA 2I0HA 3C4WA 3GC7A 3IO7A 4XOYA 4AG8A 1TQIA 2OFUA 4G3DA 3C4CA 4WG3A 2ITYA 4WG5A 4QMUA 4FKOA 3ENMA 5HX8A 3DPKA 1KE7A 3KA0A 4KIPA 4R7HA 5DR6A 3TCPA 3UPXA 5GZ9A 4D4VA 2ETKA 4OBPA 5EQEA 1PXLA 4ERKA 2P2IA 1HCKA 4GK4A 4GS6A 5L6PA 3MY1A 3D14A 3PA3A 4UEUA 5FEEA 5J1VA 5IQDA 2J5FA 3ZU7A 3QUPA 3A7IA 3OG7A 4PPAA 3TKIA 3I5ZA 3AQVA 3EKKA 4G6OA 4N70A 5FBNC 3UBDA 4HVHA 3CD3A 1JKKA 2F4JA 3Q5ZA 1YW2A 3MA6A 1WVYA 3PIZA 3SDJA 4C33A 4ZY5A 4A9YA 3HECA 2C6MA 2PULA 3VS6A 3OF0A 4MNEA 5EM7A 4EOQA 3KMUA 3H0ZA 4JG6A 5JZNA 3S4QA 4O7TA 4BY9E 3DJ5A 4J52A 4AAAA 5T6KA 5C9CA 3ZC6A 2AYPA 3ORKA 1OKZA 1KSWA 3EHAA 3I79A 3R8VA 3FMJA 5JQ8A 1U5RA 3N4VA 4I4FA 5M55A 4NCTC 4QMPA 3JYAA 3R6XA 3NNUA 4C7TA 3CD8A 3CKWA 4PP7A 2HENA 3DGKA 3TIYA 4FSTA 5L8JA 5HU3A 2GS6A 3MB6A 3R7YA 3TI1A 1L3RE 3A62A 4QMYA 4FG8A 3H3CA 2CNUA 2R3PA 3AC4A 4F1TA 3P7AA 4G34A 5CAUA 2NP8A 3GBZA 4KIOA 2G15A 3HV4A 4WHZA 5E91A 3RPRA 3PA5A 4IZYA 1YHVA 3AXWA 4O7NA 4JBOA 4V0GA 3NVKI 3U6HA 1ZYCA 2JGZA 3U9CA 2QOKA 4BFMA 3LCOA 3DLZA 3NUNA 2XKFA 2WFYA 4FBXA 4P5QA 3SD0A 4K77A 3ANRA 5EM8A 4FZDB 1J3HA 2C5VA 2YLEA 3FLZA 2OW3A 2W7XA 4TYEA 5D7AA 5AUUA 1SVGA 4IB5A 2A27A 1MQBA 1OPJA 3EJ1A 3DLSA 1APME 4O6LA 3FDNA 3EFWA 3KREA 4BF2A 1H27A 3OFMA 4LOQA 2CKQA 2WKMA 3LFCA 3FMEA 4PRJA 2XNEA 3OC1A 4O38A 4D1XA 2YIQA 4CQEA 4DBNA 4DEEA 3IQ7A 3ZSHA 1H08A 3Q3BA 4C4EA 3BBTB 2OIDA 4RX8A 4FEUA 3BU5A 3FC2A 4DEHA 4BTJA 4HNFA 2RG5A 4S34A 4BIDA 3COMA 2B0QA 4I0SA 5D1JA 4UYAA 1M7QA 2X1NA 2IN6A 4AOIA 3F7ZA 3EQPA 2OJGA 3FMLA 3UIXA 3EFJA 4F6WA 2NO3A 2O64A 3BHTA 4PPBA 2YM7A 4G1WA 3EFLA 5AV3A 4EWHA 4PL5A 4DINA 4Q9ZA 2NRUA 4DEDA 5JFWA 3DT1A 4IHPA 3F6XA 1O6KA 2YIRA 4LGDA 2WMAA 3A7HA 4IFCA 3ALNA 2W06A 4YC3A 3UOHA 4YSJA 3FMNA 5EYCA 3UZTA 2VTIA 4C36A 4IIRA 4KKHA 2OZAA 3GU6A 4C3RA 4AW1A 3V5PA 4KA3A 3IGGA 5TF9A 4C8BA 4USFA 4MD8E 4AFEA 4BWKA 2VUWA 3OVVA 3ZC5A 2XNGA 5AA8A 5KHWA 3SV0A 2CLQA 4RIWB 5DH3A 2YWVA 3VAPA 2YZLA 4AZFA 4D5KA 4RA4A 2JDOA 3C4FA 4I41A 4AZSA 2HZ4A 2CGUA 2J5EA 3C5UA 3KF7A 3LJ1A 2PU8A 3BV3A 3S00A 4A4XA 3D0EA 4IWOA 4QTBA 2VAGA 4CTCA 5J7BA 1JOWB 3QYWA 3NUAA 2C5YA 4EH4A 1H25A 4R7IA 3SRVB 3UE4A 2ZM1A 3QTIA 1YRPA 4QYYA 4BKYA 3VRYA 3RWPA 3Q2JA 4P2KA 2VX0A 1XBBA 1M14A 2BROA 4PTGA 4WSYA 3UIBA 4RSSA 4EOJA 2GSFA 3MY5A 3VW8A 2VX3A 5EI6A 4M14A 3UNKA 3TM0A 4IB1A 3PWDA 1PMUA 4XP2A 4A7CA 2BR1A 2XCHA 3GU7A 4RQVA 3MIYA 4BWPA 2BPMA 3JY0A 4ZY4A 2HXQA 3QKMA 5ICPA 1F3MC 1OM1A 5IA4A 2C6KA 4C0TA 3CJGA 4L7FA 4AE6A 1NY3A 1P4FA 1GZKA 3UNZA 3NUSA 1LUFA 3UZPA 5BX0A 3IDCA 4O7LA 3EL7A 4MBIA 4YHJA 3JVSA 2UZVA 5AX3A 2PVJA 2GS7A 4W9XA 5HE0A 2C6TA 3KXNA 4IX5A 2C5OA 4PDOA 3VN9A 3IW4A 4EK6A 3Q96A 4X0MA 4WKQA 2P33A 5EG3A 1NVRA 2JITA 1T46A 4J7BA 4M69B 5CEKA 2JKQA 3D7TB 3OW3A 2VO3A 3ZRKA 5M4IA 2PZPA 5C8KA 1GIIA 5AR4A 3TKHA 4YHFA 3BHYA 2WNTA 4EJ7A 2XK6A 4BZOA 2WQOA 4DGLC 1RJBA 3CBLA 4EHVA 4ZS4A 4DFXE 2ZVAA 4USDA 4CZTA 3TDWA 1E9HA 3JUHA 4F63A 5EDQA 3QZGA 2WMTA 3LXNA 2XZSA 5G1XA 4C37A 4WBOA 2VV9A 3GVUA 4YHTA 4OTRA 4GK2A 4AZEA 2W1ZA 2UW3A 4R8QA 2PUNA 2WD1A 5F4NA 4MWHA 4BDCA 3FSFA 4LRKA 3FXZA 4PWNA 3IW7A 4L8MA 3UO5A 4CG8A 4GSBA 1Z57A 3O8UA 3QTUA 4FL2A 3LCTA 4FTRA 4HPUE 2PL0A 2JFLA 3UYTA 4ITJA 4N57A 4FTTA 5KMNA 2WMXA 2GMXA 1Q8ZA 3CY3A 3QRIA 2C6IA 5FTQA 4E73A 3FZPA 4EBVA 3BE9A 3EN9A 5CLPA 3AG9A 4D2SA 1H07A 4FUYA 2X2KA 3HL7A 2CDZA 5HKMA 3VWAA 5I3OA 3QHWA 2Y7JA 4USEA 3BWFA 3DBEA 2XNMA 4IVDA 1OBDA 5E9EA 5I9YA 4YGAA 4FL3A 3DXNA 1OL1A 4C02A 4CFMA 4GU6A 2HY0A 2VO0A 2XKEA 4AW2A 4ZTHA 3TZ9A 3BRBA 2QO9A 3OCTA 4JG8A 4ZZMA 4BTKA 5EW8A 3DCVA 4O1PA 3R7IA 5KX8A 3G6HA 4UZDA 3QALE 3FYJX 3WF6A 5GJGA 4CFUA 4DCAA 3NCZA 3L9PA 2W1GA 2BTSA 3R7OA 4G3CA 3NYXA 2O3PA 3K3IA 2HIWA 4O7YA 5A6OA 4GG7A 4J95A 2Z7SA 1IA9A 1KE8A 4Y5QA 3DJ7A 4AUAA 2B7AA 3BU3A 3RVGA 4U0IA 3RPSA 4C61A 3H9RA 3OROA 4AXAA 4FKPA 4O22A 4CCUA 3F5UA 2Z7RA 3F69A 4IX4A 5CEQA 4H05A 4RIWA 3N51A 3Q2MA 3AC2A 4Q2AA 3EQCA 4I3ZA 4FKJA 4PDPA 5A14A 2OSCA 3GC0A 5IH6A 1ND4A 3QRKA 1YOMA 1JLUE 3TNPC 1WVWA 3ALOA 4NKAA 3TZ8A 4ITIA 3P5KA 1XKKA 5CXZA 3GQLA 4XBRA 4D1SA 3AGMA 4ASZA 1P2AA 5ANDA 4FKRA 3OHTA 2YDJA 2XKCA 3MW1A 4UXQA 4ZSJA 4FYNA 4YTIA 4HYIA 4K33A 4FIJA 5HBEA 4B4LA 5F20A 2WMQA 2QCSA 3KRXA 2QQ7A 3QC9A 3ZRMA 4BI0A 5JGDA 2JIVA 4D9UA 4D2WA 3HP2A 3QGWA 3BBWA 1OPKA 4Y95A 1Q8UA 1U59A 3OEFX 2R3NA 2V62A 2ITWA 2O65A 2WQNA 2XP2A 5FD2A 2XIZA 1URWA 2QR8A 3D7ZA 4FV9A 5EFQA 3QWKA 4R7BA 4DG3E 1BKXA 4A4OA 3FWQA 3QD2B 4YP8A 4F6UA 4ORKA 5EH0A 5HI2A 4DN5A 3TNHA 3DV3A 4X2FA 4GT5A 4MBLA 5HLNA 4NK9A 5AV2A 3UDBA 1V0BA 3FI4A 3ZEPA 4XOZA 3EQBA 2X8DA 4YLKA 2I7QA 3UOJA 3ORNA 2Z7LA 4EBWA 4MAOA 3ZDUA 3ZFMA 3NMUF 5GNKA 2JD5A 3M42A 4U42A 3DKOA 3O50A 2EXCX 5BMSA 3KXZA 5JGAA 4J1RA 2JIUA 2UZEA 5LVOA 3UO6A 4L9IA 5HIEA 4EHGA 2CGWA 3QZHA 5IQEA 3CQEA 3W16A 5EHLA 1IRKA 3NCGA 3NUYA 3D7TA 4JQ7A 1H26A 3TT0A 1H4LA 1FVRA 2UZNA 2XNNA 1UKIA 2UZWE 4DHFA 1BI7A 4F9AA 2PMIA 4J71A 5CEIA 5K0KA 4ANQA 4G9RA 5E92A 2OXDA 2JDVA 2WMBA 2ZMDA 2VGOA 4NFMA 3GC9A 1M17A 5HTBA 4OAVB 3RK7A 2EXEA 3POOA 4IM0A 5L2TA 1R0PA 1ZOGA 1Q8YA 3K54A 3QL8A 3KMMA 4YPSA 4GKHA 2A0CX 3CCNA 4BYIA 2ZAZA 2A2AA 2GQRA 3RAIA 2YACA 2XK4A 3RCDA 4C58A 5KBQA 2FSLX 3D94A 5JRSA 4FSQA 4MF0A 3DNDA 3ATTA 5CF4A 3WZDA 5A4CA 5EHOA 4ZXTA 3NNVA 4D2PA 2ITXA 1KE9A 3R01A 4FKIA 5DT3A 1AGWA 2GPHA 4S32A 4RGJA 3WIKA 4APCA 5AP4A 4H1MA 5LMBA 3DXPA 3MTFA 4LM5A 3V5TA 5BVOA 3F88A 4H36A 1WVXA 1MUOA 4BGHA 5D41A 1DS5A 3EOCA 4DEBA 4QP4A 4LFIA 3QX4A 3NZ0A 4L3LA 3HMOA 3DS6A 2C6DA 5LMKA 4DFUA 3REPA 1BUHA 4KWPA 4UMRA 4MK0A 3OTVA 2WELA 4YJRA 2BRGA 4EOOA 4DTKA 4HVSA 4EI4A 1UNHA 3W2PA 3II5A 2IZUA 4IWPA 3WE4A 3G33A 3PRIA 2KTYA 2GQSA 4GT3A 3TL8A 3ZOSA 3QTQA 5E8TA 3F3VA 1ZARA 3KEXA 3CP9A 5M09A 4EH5A 3CC6A 4O0SA 4R3RA 1A48A 3MJ2A 4PDYA 5BMMA 1BL7A 4RJ4A 2GNJA 4DH7A 3KVXA 4FE2A 4U45A 5HTCA 2PPQA 4CV8A 2PVFA 3OY3A 3D5XA 3HV3A 2R7IA 1K2PA 2YZAA 3KY2A 4TT7A 5TKDA 3QGYA 3R1QA 5ANKA 1GIJA 3C13A 4JNWA 1YVJA 2UVYA 2XJ2A 3DA6A 4RC2A 5DHJA 3UMWA 3TTIA 1OKVA 1XH8A 4MEDA 5FXQA 2UZUE 2EUFB 5D9HA 4KS8A 2X9FA 4FKUA 4FTLA 3DK6A 5EQYA 5GZAA 2XEYA 4IAYA 5DOSA 4H39A 2QODA 3JR1A 4PF4A 5BVNA 2UW9A 3RM6A 3BYSA 3KRJA 4JAJA 3NX8A 1OB3A 1QPCA 2PSQA 3O96A 3R7VA 3EN5A 4NM3A 4AZWA 3ZFXA 3A4OX 1WMKA 3DBFA 2BVAA 4GKIA 5AR7A 4HOKA 5DLSA 1DI8A 2R3JA 4OTHA 4MBJA 5CQUA 3E92A 5HLWA 5DE2A 1H24A 1R3CA 1RW8A 4N4SA 4DGGA 1Y8YA 1QMZA 4HZRA 2QKRA 4E26A 5GINE 3FLQA 4PL3A 3KK8A 3WF9A 4U9AA 5HLPA 3K5VA 4W9WA 4X6RA 5EOLA 5A6NA 3AMAA 3AD6A 3CPCA 2PHKA 2FO0A 3F2RA 2W5BA 2R3MA 2PVYA 2VTRA 2W4JA 2XCKA 3ZZWA 2IG7A 5DGZA 4C34A 3C4XA 3QLFA 4PMSA 4ZZOA 4WA9A 5AM6A 1ZOEA 4MD9E 3VS3A 2UW8A 1G3NA 4P4CA 3RZBA 5IUGA 4N6ZA 4UMTA 3BLRA 2XK7A 2VRXA 3Q9XA 5AUXA 4YLJA 3UPZA 4RWIA 1ZMVA 2XIKA 4QO9A 5J5TA 3ULIA 4BCFA 3LW0A 2W4KA 4FK6A 5C1QB 2GNGA 4AGCA 2AC5A 1YHSA 4YU2A 3G90X 3AMBA 4AWIA 4ACMA 2WMWA 4U81A 3LHJA 3ZBFA 3IDPA 3OCBA 3E88A 2B9FA 2X9EA 4YMJA 1LPUA 3UC4A 4MNEB 5KNJA 4ZSLA 2UW6A 3FLSA 3MPAA 2O5KA 5IKWA 5CAPA 1OBGA 3AMYA 5HICA 3R8LA 4CLJA 2BKZA 5BNJA 4XNEA 3IDBA 1XH5A 4AQCA 1IASA 4KB8A 4QP1A 2R5TA 4R77A 3FZTA 3NW7A 3ACKA 2WTVA 2V7OA 4ACDA 5BVDA 5J9ZA 3VULA 4RJ6A 4YZMA 5FM2A 4EYJA 3NIEA 4EOMA 3DXQA 3NR9A 2YAAA 3KULA 4I5PA 3NAYA 1YXTA 1CKJA 2WIPA 3S95A 3TJDA 2FSOX 3VQUA 4ZK5A 4WT6A 5LWMA 3K5UA 4J8MA 3HEGA 3LM5A 4O7WA 5TR6A 4UWYA 1ZOHA 4W4VA 3VIDA 3UO4A 5IU2A 4ZMEA 4YJNA 2XS0A 3Q4UA 5AIKA 3MPTA 4QP9A 4EK5A 4ZSGA 5EM6A 4RFZA 1YKRA 3KRWA 4Y5HA 4RFYA 4UV0A 4XG4A 3V5WA 5IMEA 1KV1A 3ZUVA 4C2WA 1Q3WA 2RGPA 1ZYJA 2OBJA 4EH9A 4AW0A 4HGSA 1W0XC 3ROCA 2ZV9A 4GIIA 4QMXA 4CT1A 4EORA 5AUVA 2QC6A 4EOKA 4FUXA 5I4NA 2C3IB 5J87A 2F49A 3NUXA 2PE1A 3WF7A 4QRCA 4ANOA 3CTJA 2GDOA 4IAKA 5KCVA 3MVLA 4TWPA 5CS6A 4L43A 3TTJA 3VVHA 2B4SB 2BRHA 2WU6A 4QMWA 4QNAA 4F64A 3I60A 3DQXA 3R2YA 4MXOA 5H8EA 3W2OA 5H9BA 5DMZA 3OS3A 4NZWB 4D0XA 4NW5A 5D11A 3A61A 1GZOA 2YISA 4ZZNA 1NT2A 5KBRA 5CT0A 3TV7A 4FKGA 1XO2B 3IS5A 3Q9WA 5CYIA 3VHKA 5AP0A 2XNOA 1PHKA 2HK5A 1CDKA 4JT3A 4ZTNA 4FV8A 2IPXA 1BLXA 4JR3A 5AX9A 4FK3A 4M97A 3SG8A 4NM5A 3UIUA 3PIXA 4JIAA 2UZTA 3QQUA 4M68A 4R5SA 5CU2A 3O7LB 3D2IA 2HELA 1YQJA 4PDSA 4TWOA 3VUTA 5L2QA 3NSZA 1R1WA 3TNWA 4KAOA 3TG1A 2E9PA 3QQKA 1PXOA 4AN9A 3OEZA 3BYVA 1KUTA 3NW5A 3HV6A 3PXRA 4HGLA 3QKKA 5IDNA 5HIDA 5CEMA 3NUPA 4JXFA 3W32A 2BZJA 1X8BA 4JS8A 3GCQA 4XYFA 5FTOA 1P4OA 3AC5A 4L01A 1G8SA 2OZAB 3KRLA 3KQ7A 3MYGA 2R3QA 5JN2A 1J7IA 4EZ7A 1L8TA 2Z8CA 4NU1A 3FEGA 2NNWB 3R04A 2GQGA 2ITOA 3PJ8A 3C4ZA 2QLUA 4YJUA 5FWKK 4QQJA 5EK7A 3T3UA 2CJMA 3WYYA 2OICA 4I23A 1Y8GA 3L9MA 3RJCA 3Q53A 3BX5A 3LJ0A 4QYGA 4AT5A 4MXXA 3AT3A 4LUDA 4OBOA 3E8DA 4MNFA 1OL5A 4DEGA 5DR9A 5CT7A 3R63A 2W99B 1DAYA 4V01A 5FXRA 3AD4A 3HRBA 4TYHA 2ETMA 1OIYA 4PPCA 2PUPA 3KRRA 3FZRA 4IJPA 3AC1A 3GQIA 5IZFA 4PY1A 2GNIA 2VTPA 4GV1A 2Y6MA 4ZSEA 4AFJA 1XH4A 4RRVA 4F65A 4GMYA 3L1SA 5EW3A 5DYJA 4D0WA 2X8IA 1Q24A 3WIGA 4F09A 4O83A 3ZH8A 4IAIA 4FSYA 5L6WL 3SG9A 5IDPA 3F66A 2O63A 3H0YA 3L9LA 4MF1A 3O51A 5AR2A 3R1NA 5ANJA 4FC0A 4ANBA 5C27A 3FPQA 2WOTA 3R8ZA 4LRJA 2ESMA 3DKFA 3KB7A 4M7IA 1ZY5A 4XG3A 4FEQA 4WNPA 3V6SA 4IZAA 2W5AA 1ATPE 1PY5A 4GW8A 5AJQA 3UOKA 5DEWA 2UW0A 3IOKA 4L52A 4WIHA 4CMUA 3AGLA 2EU9A 3POZA 5FEDA 5JQ5A 3HDMA 4MD7E 3PXQA 2ZB1A 4CZUA 4EOIA 3ORZA 2XVDA 1WZYA 5HE1A 3S3IA 3BWJA 2QOBA 4FIIA 4O0UA 4RG0A 1Q62A 5CVGA 5AP7A 5BYZA 4CSVA 1E1VA 3U6IA 3A4PA 4DG2E 1DAWA 4HW7A 4IVAA 1W83A 2B55A 3EH9A 1Q97A 2WMUA 4IQ6A 2VTSA 5A3XA 3MA3A 5CQWA 1YWVA 4HGTA 1S9JA 3QTSA 3HA8A 2XM8A 3JXWA 3SHEA 4P7EA 4XLIA 5IA2A 4GK3A 5E1EA 3BQRA 4LV8A 3A99A 4I20A 2WMRA 4DH8A 4U7ZA 3IKAA 1PYEA 5DVRA 2Z02A 5HZNA 4OTIA 5HTIA 4UYNA 5ANGA 3MWUA 4BCOA 3FQEA 1OKYA 4ANSA 1ZYDA 1JNKA 2UV2A 5C8NA 1ZWSA 2B1PA 2RKUA 4O1OA 4ENYA 4FVQA 2Z2WA 4FT0A 4CRSA 2OIBA 2WPAA 3CE3A 3NYVA 4FTIA 4RIYA 5AV0A 3V8TA 1M7NA 5IEXA 4UZHA 4I21A 2IW9A 2W9FB 4FEWA 3HMNA 3PFQA 2YCRA 3MDYA 3QBNA 1JKSA 2GHMA 3R9NA 3HKOA 5K5NA 5LMKC 4CNHA 3CQUA 4KBAA 4OGRA 4FVPA 4MVFA 3VUHA 3QRJA 2BAKA 4XV2A 3FZ1A 5C01A 3V3VA 4D28A 4JQEA 2QOFA 4FICA 4I6QA 4IXPA 2PTKA 5HOAA 4DFLA 4U8ZA 2XRWA 4O86A 4R3CA 2OH4A 3ETAA 3LJ2A 4KIKB 3HZTA 4MCVA 4D55A 3KCFA 4P5ZA 2RFSA 3RWQA 2BUJA 2VTTA 5AR8A 4GYGA 5ACBC 1OUKA 2X81A 4RJ7A 2X39A 4DF3A 5M4CA 3QKLA 3FXWA 2QNJA 4QMLA 1OVEA 3PXYA 5LOHA 4I6HA 2OFVA 2BRBA 3L8VA 2CN5A 3OWLA 4QMZA 5AIRA 1PXNA 5FQDC 4C59A 4KD1A 4RC3A 1O9UA 2JKOA 2R3GA 5JKGA 3UODA 1JAMA 2VNWA 2W1FA 4O0VA 2VWVA 3T9IA 4BCHA 3PVUA 4QPAA 2JIIA 1M52A 4KKEA 3LMGA 4Z16A 5AP3A 3SAYA 1NVSA 3BHHA 4EOPA 4YURA 3I0QA 4FGBA 5GIOE 3T3VA 3V51A 3ZYAA 3D4QA 4C62A 4DE4A 3HRFA 2VTQA 3BHUA 4O7VA 4E20A 5CF8A 1FMOE 1ZYSA 2QOHA 2ZM4A 3TV4A 3MH2A 4A07A 4D4SA 4XCUA 5CSVA 2C6LA 1R0EA 3OOGA 3PA4A 4MWIA 4XV3A 2Y6OA 4BZDA 3UZRA 3FQHA 3PY1A 4BBFA 4JDIA 3WI6A 2RFNA 4L42A 4QT1A 5HG5A 4M12A 5LVNA 4QMVA 3D2KA 5JZJA 1I09A 2WB8A 3RK5A 5HCXA 2OXYA 1W82A 3WARA 5KMJA 4XP0A 5HIBA 4CFXA 3O71A 4IADA 1SM2A 2WU7A 4QYHA 2BRNA 3NPCA 2ERKA 5HO8A 3OXTA 5EI8A 4QPMA 5KMMA 5IUHA 3G15A 4WNKA 5CEOA 4DA5A 1G5SA 5A4LA 1Z5MA 4YC6A 3VO3A 2G01A 3SXRA 4F9CA 5ETFA 3FLWA 3TJCA 4RVLA 2VNYA 2UW5A 3EQHA 4R3PA 2QD9A 2IW6A 2WHBA 4HYSA 3HMMA 1PJKA 3GGFA 3OUNB 5AUWA 2ITNA 1IAJA 2SRCA 5J95A 3VS1A 3K2LA 2ZJWA 1ZY4A 4YSMA 3C0HA 4YZBA 3VF8A 3DK3A 1A9UA 1K3AA 4FTJA 4RZWA 1OL6A 4X21A 2NRYA 1GY3A 1K9AA 3MSSA 5M4FA 2R0UA 4E5WA 3A2CA 3CIKA 1H1QA 1U4DA 2RIOA 3E87A 2J50A 3M2WA 3Q6WA 3RMFA 4CCBA 1PKGA 4JG7A 4L46A 3TZ7A 1IR3A 4MXZA 1JKTA 1KWPA 3F2NA 4FX3A 1QPJA 1SYKA 2P4IA 3PJCA 1REJA 3PPKA 2ETRA 4K0YA 4WRSA 5HD7A 5IMXA 5A54A 4JDHA 3OOMA 3VQHA 5L6OA 3BYUA 4KBKA 2FSTX 4L3PA 3LVPA 3ZLSA 5CSWA 4L44A 3LE6A 3R7GA 4Q9SA 3FI8A 3FI3A 4NTTA 3P0MA 2C47A 4WO5A 5HG7A 5DT4A 2V5QA 4XRJA 2VO6A 3I5NA 3A7JA 5TE0A 2W5HA 1WBOA 4LMUA 4L68A 3QTXA 2VTOA 2HWPA 4IE9A 3CSVA 2VD5A 2ITVA 1XQZA 4NFNA 2UVXA 1ZYLA 1OZ1A 2QONA 4IZ5A 1JSTA 1W84A 2YDKA 3D83A 4RWLA 3VNTA 1SVHA 3OUKA 3EYGA 4UY9A 2V7AA 5CXHA 4MXYA 3TNIA 5JFSA 3R9DA 3PDTA 4AOJA 4L7SA 4WNOA 3GXLA 5BVEA 3CY2A 5IQIA 4O7ZA 3VF9A 5CSXA 1LR4A 1LEWA 1Q4LA 1IAHA 4BDJA 1ZZ2A 4QTDA 5LVMA 2B54A 5EM5A 3ODYX 4HVGA 3ULZA 3ID6C 3N9XA 4M15A 2C30A 1H00A 3R73A 3FUPA 3NS9A 5L2SA 4F0IA 2B9HA 4FOBA 4L67A 1NA7A 2WQMA 4AOTA 1CSNA 2RFEA 3CGFA 3R9RA 3GOKA 4CZYB 1W98A 4DC2A 5EKNA 2IJMA 1IEPA 3MVHA 1LEZA 3BLQA 4KIKA 5CU3A 3NLBA 4CKJA 1OUYA 3NVMB 1CM8A 2Y4PA 4ZJJA 3ZFYA 4E1ZA 1XJDA 1JSVA 4EH2A 4Y85A 5CENA 1QCFA 2ITTA 3HAVA 3B2TA 4FKWA 3O23A 3BHVA 4IZ7A 5HBHA 3VRZA 4IM3A 2QU5A 4G3FA 5E1SA 3E3BX 3CTHA 2UW7A 4RIOA 3ZEWA 4W4YA 3F5GA 4IEBA 4CFNA 2WZJA 3QD3A 1M2RA 5HQ0A 4KUJA 1RE8A 3HAMA 3QD0A 2BZIB 2HY81 2PVLA 4YLLA 5AUYA 4RVKA 4B8LA 4FTCA 4I0TA 4CFFA 1O6LA 5IF1A 4CYIA 1UWJA 3THBA 2YDIA 3EQFA 4ZLOA 4ZIMA 3VHEA 3VBTA 4U44A 5J9YA 2B53A 3PZEA 1BX6A 2BHHA 3F7WA 5BVWA 3WOWA 4NEUA 4EUTA 3GUBA 4LGHA 5K9IA 2W96B 1BMKA 4RZVA 4D4RA 2BAQA 2UZOA 4EOLA 1WBPA 4ALWA 4KIQA 2XH5A 5M06A 2YAKA 3W1FA 5JGBA 3ZXTA 4E3CA 3W2SA 3LCDA 3DAKA 4TNBA 3D5UA 4F9YA 3BGPA 4QTEA 5EDRA 2WAJA 3ANQA 3RALA 1UWHA 4IAFA 2HZNA 1H1SA 1P5EA 4H58A 5DR2A 4BWXA 1OKWA 4S30A 3MN3A 1FQ1B 2ZM3A 2J0JA 5JMSA 4EOSA 3DTWA 3P08A 3H9FA 3P79A 5HEZA 4B9DA 3RAWA 4GVJA 2EWAA 3C9WA 4IB0A 4JBQA 4TYGA 4DAWA 4ZP5A 4FOCA 2Q0BA 4N0SA 2PVHA 3RM7A 4A06A 2CHLA 5CZHA 3C7QA 1T45A 3Q9YA 5IQAA 3TUCA 2O2UA 2WXVA 4CLIA 4TPTA 4ITHA 3JVRA 4DGMA 4X2GA 1J7UA 3MH1A 3ET7A 3D15A 2C1AA 4DITA 1UU3A 3GI3A 3LZBA 1J91A 1WFCA 1CKIA 4F0GA 3FKNA 4ZTLA 1UU8A 3FHIA 2BDWA 5FG8A 1LP4A 3FJQE 3NYOA 4GG5A 3LIJA 3LM0A 1H0WA 3CGOA 3H10A 3R21A 4OUCA 3E62A 3U87A 4RLKA 5D7VA 4ANNA 4LRMA 3V5QA 3R8PA 5F9EA 5FUTA 4HJOA 3T8OA 2C3LA 4FT7A 3KVWA 4TYIA 4YBKA 3V01A 4XMOA 3H4JA 4LOOA 5FP5A 3LFQA 1ZMWA 5GJFA 4DTAA 1YXSA 2IO6A 2ZYBA 3IW8A 5ANOA 4FNYA 3EIDA 2ZDTA 4M13A 2HAKA 2HW7A 3HV7A 5E7RA 1JVPP 3VBVA 1NVQA 4ACCA 1WAKA 4O0WA 3OCSA 3P86A 1QL6A 2DUVA 5EW9A 5HG9A 4L45A 4O7RA 4OLIA 4G6NA 1U54A 3I4BA 2QI8A 3FL4A 3FSKA 2UZDA 3OWKA 4B6LA 5IQFA 4F4PA 4O0RA 5M57A 2J51A 2BCJA 2I0YA 3COHA 3UG2A 3FMHA 5AFVA 5CX9A 1IG1A 2X8EA 4PMMA 3KULB 4Y72A 3QAME 1U46A 5IQHA 3F5PA 4PTCA 2IZSA 2PE2A 5HE3A 2V0DA 4NH1A 1J7LA 4RJ3A 3GC8A 4G16A 4RX9A 4XUFA 5EHYA 4ZOGA 3OD6X 4CD0A 3QCQA 5GHVA 4JX3A 5GJDA 3ENHA 3EQRA 4IBMA 2QHNA 4WSQA 4FG9A 4TW9A 5IA3A 4MHAA 2Z7QA 4RVMA 4D4YA 1XH7A 3HMIA 3E93A 3MIAA 4D9TA 4BIBA 5I9VA 2BTRA 4TTHB 1H1RA 3A60A 2W1EA 5DRDA 1NW1A 4EH6A 5K0XA 4XBUA 2WTCA 4FT9A 2OXXA 3PRFA 4TWCA 1JSUA 5HCYA 3OXZA 3LFDA 4WUAA 3DFAA 3UJGA 5M07A 3GFEA 5L2WA 4BB4A 4G9CA 3OP5A 2H8HA 4FSWA 3VS2A 3BI6A 4AA5A 4FTNA 2LAVA 4HVIA 5L8KA 2ONLA 4BCKA 3LMHA 1V1KA 3HX4A 1ZAOA 4FKLA 1A06A 3S2PA 5JK3A 1FVTA 1YDSE 3O17A 1WBSA 4GFGA 3ZMMA 3G6GA 5LMAA 3P9JA 2Q83A 3QXPA 3FAAA 4BDHA 4NW6A 1BL6A 1J1CA 3ROYA 2YITA 4EC8A 2IVSA 2QO2A 3R7EA 3VUMA 4I24A 3SXFA 3GENA 4BBEA 1PXMA 4Y73A 4O0XA 4FSUA 1MP8A 5AP1A 4CG9A 3U55A 3QD4A 3BZ3A 4FV6A 3GU5A 4EQCA 2JDSA 4I6BA 3G51A 3ZDIA 4E6CA 4ANLA 5AA9A 3MESA 1Y57A 5AWMA 3DY7A 4JDJA 5KKRB 3QXOA 2WIHA 3Q4ZA 5CWZA 2OI4X 1MRYA 3Q32A 4EH7A 1O6YA 2CKEA 3NIZA 4MQ2A 3CXWA 1HCLA 3P1AA 4S2ZA 3WILA 3CKXA 2YHVA 5BUJA 1GJOA 4JOAA 2GS2A 1EH4A 3W18A 4TXCA 4F1MA 4FV3A 4HGEA 4R1YA 5HESA 3GCUA 4CGAA 5BQ0A 3TNQB 2H34A 4ERWA 4YJTA 5D10A 2RF9A 3O8PA 3KK9A 4F7LA 3RPYA 2EB2A 4GFMA 5LQFA 5HNGA 3E8CA 5IQCA 4XG8A 3RZFA 4R1VA 2YM4A 4JRNA 2X0GA 4RVTA 4CMOA 2PUIA 3E64A 2YERA 3LFSA 1WBVA 1VJYA 3RNYA 2BFYA 1Y6AA 3SOCA 5EDPA 4IMYA 5B0XA 2OGVA 2HXLA 2FGIA 3EQDA 4TYHB 4ZTQA 5FBOA 5T68A 4RLLA 2BALA 3UQGA 3MTLA 2R9SA 3ACJA 4QQ5A 1PMEA 1UU7A 5IUIA 4AZTA 4YTFA 4FEVA 2VTHA 2XM9A 4C4GA 3HLLA 3PZHA 4E4NA 5DIAA 5EQPA 5HCZA 2X7GA 3FKLA 3AC8A 5KUPA 1PMNA 3UIMA 2Y0AA 4PMTA 1JKLA 3FE3A 3R1SA 4A9TA 5A4TA 2VTNA 4QP7A 2R3LA 4CVAA 3QQHA 3OW4A 3DDQA 5HO6A 4JI9A 1YXVA 5C26A 4QQCA 2IW8A 2CPKE 2E2BA 5EYMA 3VJNA 4M0YA 4GUBA 4QMTA 5LARA 3RP9A 4EUUA 2ZV2A 2XMYA 4KSPA 4FKSA 3R71A 4FV2A 3FHRA 1OI9A 2UZLA 4ZAUA 5B7VA 4L6QA 3FL5A 4AU8A 3BGZA 4TZRA 4F7NA 4CFVA 3FBVA 4OTDA 4NYEA 3WF5A 3DJ6A 4F1OA 4FI1A 3IK3A 4G3GA 3W55A 3HV5A 5DFPA 4JIKA 4E4MA 2OO8X 4BCJA 4DH3A 4WNMA 2F7ZE 3OBJA 5GZ8A 3F2AA 2JEDA 1SZMA 4FKTA 4EHZA 3LQ8A 3R0TA 5TT7A 1MQ4A 5JH6A 5M51A 2BAJA 4AACA 4FTQA 2DYLA 4UALA 5J7HA 1YI3A 2VU3A 1YI6A 2WTKB 3DDPA 4DFNA 4N6YA 2R64A 3ORIA 4U97A 2A19B 1GOLA 5DNRA 3R8MA 4Z3VA 3PLAE 1BYGA 5CZIA 3E63A 1P14A 3EYHA 4GCJA 4FKQA 4ONAA 4EQUA 3A8WA 2R3HA 2PVMA 3EN7A 4XX9A 3WE8A 3SQQA 4DG0E 3QU0A 4EKLA 3ORTA 4OT5A 4RIYB 4AGWA 4X6QC 4ZTRA 3ERKA 3ZZEA 4EK3A 4NJ3A 3MVMA 2XIRA 3QWJA 5FP6A 4O2ZA 4YZ9A 4C4FA 4UWBA 5JT2A 4E6DA 3P23A 3KN6A 4BVUA 3EQIA 4QP2A 4CYJA 3RHKA 2X6EA 4FNXA 4W8DA 4MXCA 3VUIA 4BZNA 3PXKA 3FLYA 4GL9A 5C4LA 4U5JA 3MH3A 4YJSA 2CMWA 4C38A 5LVLA 2JBPA 2VTAA 2YJSA 2DS1A 3PP1A 1PKDA 5FEQA 3MFUA 1Q99A 4KRDA 4M66A 5AP2A 4AX8A 5CSPA 3PJ2A 3F5XA 4FSMA 2F57A 1Y91A 3QHRA 4K2RA 3VUDA 5ITAA 2XF0A 3PSCA 5BYLA 4U40A 2YM3A 3OMVA 2QOCA 2P55A 5DBXA 4AZVA 4BBMA 4KNBA 4FV1A 3LOKA 1XBAA 4KS7A 4Z7GA 4FIGA 4FT3A 4C2VA 2Y4IB 3KCKA 3PE2A 4F9WA 2BFXA 5J9LA 2JKKA 1Q41A 2FA2A 3KF4A 4DH1A 5F95A 4BCQA 4PNIA 4Y8DA 4C3PA 3HVCA 4GUEA 5G6VA 4I1ZA 4EC9A 3DZOA 3QTWA 1REKA 3R2BA 4JDKA 5H2UA 5HGIA 3KXXA 5T3QA 3V8WA 3G0EA 4O81A 3NAXA 3PSDA 4B8MA 2JAVA 2CGXA 2JFMA 5CF6A 4P90A 2UUEA 3E7OA 4ZJVA 2R3OA 1GNGA 3PPZA 3DAEA 2CSNA 3C0GA 4E8AA 1UU9A 2JDTA 3DU8A 3R00A 4Y83A 4EYMA 3K3JA 4PP9A 2PMLX 2JDRA 4AA4A 2IVVA 3SX9A 2PYWA 4GRBA 5HVYA 3GNIB 3R30A 3Q9ZA 3ZLXA 1PXPA 3WZKA 1B6CB 2R7BA 3FPMA 4KSQA 4UMPA 2QLQA 3PYYA 3A7FA 2O8YA 2ITQA 3LQ5A 2BDFA 1Q8TA 2J90A 3I6WA 5K5XA 1ZLTA 3PIYA 4FMQA 2GFSA 4OT6A 4IC8A 4F9BA 2BZKB 3UYSA 4DLJA 5L4QA 1NXKA 3FV8A 3AD5A 3M11A 3UQCA 4DFBA 3EQGA
chains in the Genus database with same CATH superfamily
1OPLA 4NUSA 4IH8A 5IA5A 3ZSIA 5KO1A 5AV1A 4FTUA 2HOGA 4LV5A 5CANA 5E8UA 3IGOA 4IVBA 3FY0A 2C69A 3WF8A 3BELA 4FTMA 5A4EA 4W4XA 3FZSA 4QQTA 3OT8A 2OU7A 2W17A 2BHEA 3CTQA 2XK9A 3L8PA 5H3QA 5TOZA 3QCXA 4I5CA 3TZMA 2VZ6A 2BZHB 3HRCA 5CI6A 3R7UA 4BCNA 2YIXA 3S1HA 4BHNA 2YJRA 4QMOA 4J96A 4ALUA 5L3AA 1YWRA 4OR5A 1YI4A 2YLFA 1WCCA 3IPHA 4YC8A 2G9XA 5CU6A 5F94A 5C4KA 5M44A 3D5WA 1UKHA 3R28A 4L3JA 5EKOA 3BIZA 3VS4A 3GEQA 3JY9A 2YM5A 3RAKA 5GIPE 3LMIA 3NW6A 4QNYA 5HVKA 3QZIA 4A9UA 3PXFA 3BV2A 1DM2A 2OG8A 3DK7A 5CY3A 2W1CA 4A9SA 2XANA 4FIHA 2X2MA 1URCA 2P2HA 5J1WA 4BR3A 4G31A 4WRGA 2YEXA 4RJ8A 4ANMA 5FDPA 2PK9A 3G5DA 4D2TA 4NM7A 2ZMCA 4Q5EA 3U6JA 1XH6A 4I6FA 1YHWA 3GB2A 3DBCA 3WZJA 4I0RA 1PYXA 3A8XA 5AADA 5BPYA 4OTGA 2RL5A 4BDIA 2C1BA 3G9LX 5HU9A 4J8NA 2ITZA 2IWIA 3QCYA 5LXMA 5B2KA 3DQWA 4B0GA 5BV3A 4APPA 2BILB 4XS2A 1E1XA 3OBGA 5FLFA 3PUFC 1CMKE 4JVGA 5E8WA 4BI2A 3L8SA 2B9IA 4JJRA 5AR3A 5CAOA 1TQPA 2XJ0A 4QTCA 3EWHA 4XV1A 3P78A 4E4XA 5K4JA 3DB8A 2WO6A 4BDDA 4E5BA 4FV5A 5M4UA 2H6DA 5E8XA 1MRVA 5HORA 1V0OA 4MX9A 3QFVA 3E7VA 3PWYA 2OF4A 3A7GA 4C4IA 3BPRA 4AT3A 5IA1A 4LQMA 3ZSGA 2Q0NA 2YIYA 3MFRA 1R39A 1SVEA 4GJ2A 4KBCA 4A9RA 4TY1A 3DAJA 2ONLC 3PXZA 3SXSA 2X7OA 4DEAA 5KMLA 2QOQA 4FV4A 4G5JA 3MPMA 3U9NA 4EEVA 5CVHA 5CALA 4RBLA 3FYKX 4IVCA 4IWQA 4XJ0A 4LGGA 4IM2A 4A4LA 3V5LA 2VTJA 3EZVA 4MKCA 2EB3A 4AGUA 4FV7A 4HYUA 2AC3A 5IH4A 5JEBA 2GCDA 2VWBA 4QD6A 3FMDA 5E90A 5IEYA 4ZS0A 1VR2A 3ELJA 2CCHA 4O4FA 1PW2A 2J7TA 3QTRA 5A46A 1YDTE 2QOIA 3RBWA 3RI1A 5LVPA 3VS0A 4G5PA 3DBQA 3LFEA 1OMWA 1UNLA 4IAAA 4Z55A 3LPBA 4D2VA 2VWZA 3I7CA 4RX7A 3RPOA 3TIZA 2G1TA 2YABA 4YJQA 2ITUA 2E9VA 3MY0A 3I0OA 3DZQA 1U5QA 3Q60A 4DGOA 3PG3A 5EYDA 4X3FA 3FC1X 4FSZA 1KE5A 4M67A 4FIFA 3I6UA 3RKBA 3UP2A 1H0VA 2OH0E 1I44A 4YO4A 4CMTA 4YZNA 2G2HA 4OBQA 3VUKA 2VWIA 4PV0A 4UN0C 2F9GA 3IECA 5CVFA 3P7BA 2Z60A 4C57A 2GU8A 3LFFA 4UXLA 4DT8A 1R78A 4UMUA 4O7SA 3COIA 4FYOA 4XG9A 3SVVA 3B8RA 2JLDA 4M3QA 4IB3A 4CV9A 4RMZA 4QMNA 3C5IA 4FG7A 2X4FA 3G0FA 4QP8A 5I9ZA 4KINA 4W4WA 4ARKA 5L8LA 2XKDA 4ZJIA 2WMSA 4IANA 5CSHA 5AP6A 4CKRA 4NTSA 1VYWA 2CKOA 5JSMA 4GJ3A 2R3KA 3KC3A 4R6VA 2IVUA 4XP3A 3VBYA 4BCIA 4RT7A 2V22A 3QRUA 4B99A 3ORMA 4BTFA 5IH5A 4HNIA 1RDQE 4IWDA 1JBPE 1YDRE 3BQCA 2R3IA 3ZONA 5DEYA 4HVDA 4F6SA 3KN5A 4ZEGA 5FTGA 3W8LA 2XAMA 2J9MA 2GNLA 4TKSA 5JFXA 4G2FA 3RTPA 3HP5A 3WZUA 1TQMA 4K11A 3ZHPC 4FTAA 3O7LD 2X7FA 3R9HA 3R9OA 3V5JA 4FR4A 1XHAA 3T9TA 5M53A 1OL2A 4HCUA 4EKKA 2QHMA 3UG1A 5M56A 4EH3A 3Q6UA 3W0QA 2W9ZB 1OECA 4G3EA 4K6ZA 5I0BA 2XBJA 2HCKA 5KHXA 4TNDA 3OT3A 3FXXA 3LXLA 2ZV7A 2W4OA 4BDKA 4DLIA 2J4ZA 3W33A 5KZIA 1U54B 5LCKA 2CN8A 3H30A 3ZO2A 5I5ZA 2WQEA 4M0ZA 4NSTA 3WYXA 2HW6A 3C0IA 2CCIA 3R22A 3E8EA 4XLVA 5EYKA 4WG4A 4YZCA 5JFVA 5IQBA 2OF2A 3GCPA 2CGVA 4II5A 4JBPA 3C1XA 5KZ0A 3LQ3A 2FH9A 3SGCA 3ZBXA 1G8AA 4GU9A 4DHIB 3PVGA 2ERZE 3RINA 4PQNA 4NL0A 3TXOA 2VO7A 3Q52A 3PG1A 2PUUA 4YJVA 2PWLA 5I9UA 3ZLYA 4AS0A 2WEIA 2XRUA 2VN9A 3F82A 3MS9A 5TO8A 2EVAA 3AOXA 3NNWA 3SOAA 4IFGA 5H8BA 2YM8A 4XG6A 1SNXA 4YZDA 5FM3A 3TWJA 4YTCA 3I7BA 5AAGA 4AW5A 3SW7A 2C0OA 2CLXA 3E5AA 5E8VA 5HBJA 2FB8A 2QO7A 4RWJA 2VWUA 3C51A 5AMNA 5BVKA 4Z7HA 5HD4A 5DG5A 5H8GA 5KMOA 3ZRLA 5HNBA 2F7XE 2I6LA 1YWNA 4DGNA 3JS2A 3EMGA 3VJOA 3OZ6A 4KRCA 4RIXB 3SW4A 3PE1A 3F61A 4ACHA 2J0IA 3MV5A 4TWNA 3IOPA 3FMKA 4H3PA 1PXKA 3FY2A 2W0JA 4BYJA 4G6LA 4O21A 3TN8A 1H01A 3AT4A 3IG7A 1H8FA 4IW0A 4F7JA 4FGRA 4DTBA 3HGKA 3UQFA 2NPQA 2IZTA 2YCQA 3NDMA 3TEIA 4EONA 5KKRC 5HX6A 3C50A 3L8XA 3Q5IA 4FNWA 4TYJA 2BIYA 2XYNA 2UVZA 3IONA 2PMOX 4J53A 2B9JA 5DRBA 4M8TA 4IX3A 4D58A 3AT2A 4EHEA 2R3FA 2XUUA 3COKA 4E7WA 4YBJA 1W7HA 2E9NA 4FZAB 2GHLA 4ENXA 5FXSA 3UTOA 4DCEA 1CKPA 4H3BA 1UA2A 4JR7A 1WBWA 3EL8A 3LFBA 3LFNA 3ORLA 3RPVA 4ZLYA 5BUIA 5DA3A 3LKMA 1W2FA 2QKWB 4MTAA 2R2PA 3VW6A 4IC7A 4FZ7A 4IAZA 2P0CA 3N4UA 1F0QA 5F1ZA 2WEVA 3C4EA 3EN6A 4ID7A 3ZUTA 4LOPA 2YCFA 3JPVA 2BDJA 3KKVA 3E8NA 1AQ1A 4BICA 2CNVA 5K4IA 4UBAA 3KFAA 1FGIA 5IA0A 4I92A 4DYMA 3ZUUA 4U43A 4IJ9A 4ZSAA 3F3UA 3FZOA 4XH6A 2BKKA 2H96A 4D2RA 4C35A 3HMPA 3Q4TA 4C4JA 2IVTA 1J1BA 1WBNA 4Q5HA 3GCSA 4GH2A 4ZTMA 2J0LA 3LCKA 5J5SA 3SA0A 4JRVA 3TUDA 4DBXA 2GNHA 3MI9A 3MFSA 4XRLA 4BHZA 1FMKA 3NYNA 1QPEA 4DDGA 4IX6A 2F2UA 3PTGA 4ASEA 4EH8A 5LJJA 3QA0A 5CAVA 5IQGA 3ZLWA 2W1DA 4MXAA 3UVPA 5M08A 4K9YA 4E93A 2PMNX 2QVSE 3P4KA 3V04A 3EZRA 3QC4A 4XEYA 2XNBA 2BMCA 2C0TA 3MH0A 4KABA 4RJ5A 5AM7A 3W10A 5AUZA 1H1WA 4RWKA 3LXKA 3OWPA 3GT8A 3LAUA 4NJDA 4O91A 3SRVA 4K18A 4BI1A 2Y9QA 4K1BA 2HZ0A 3PY3A 4FODA 4LG4A 4JQ8A 3RNIA 4W8EA 3SLSA 3G9NA 3GOPA 4O84A 4QPSA 4BDBA 4UWCA 3NNXA 4OTQA 3B2WA 4J98A 4ZY6A 2YWPA 2ITPA 4UX9A 4V04A 3VBQA 3E3PA 3W0OA 4NM0A 3UDZA 5IPJA 5IISA 5HG8A 4QMQA 5HNIX 2XA4A 2C5NA 1KV2A 4FZFB 5J79A 4RA5A 3LLTA 3O8TA 4QOXA 4YNEA 5C03A 2C6OA 3CR0A 4H1JA 2C3JA 2W1HA 3CEKA 3SKCA 5EOBA 5DN3A 5C8MA 4OTWA 5E8YA 3OY1A 4YJOA 5HO7A 4WD5A 4CTBA 3QQLA 3UNJA 4PUZA 2PVRA 4HYHA 3TUBA 3QQFA 4BRXA 1VZOA 5E8ZA 3QRTA 4X2KA 3HDNA 4GEOA 1W8CA 4KKGA 4MQ1A 3ATSA 3FQSA 5E8SA 2WTKC 1JPAA 4GT4A 1OITA 4AT4A 4HPTE 3F3TA 1FBNA 4YNOA 4C3FA 3AKKA 4ACGA 4M69A 2GHGA 2PZ5A 4YTHA 3OCGA 4IDVA 4NIFB 1ZZLA 3PVWA 2HWOA 4PMPA 1TVOA 2HZIA 4YR8A 4BIEA 3MFTA 3ZO1A 2B52A 3GP0A 1KE6A 2FVDA 1ERKA 3UP7A 3M1SA 3EN4A 3QCSA 4DH5A 4AF3A 4XHKB 4AN2A 4NCTA 2UW4A 3HUCA 2CNQA 1GZ8A 4WBBB 1B38A 4GFOA 4U6RA 1Q61A 4PNKA 2JAMA 5CI7A 5FGKA 4F7SA 2C0IA 3KXGA 5DT0A 4BDGA 3RCJA 3VS7A 4FL1A 4QMMA 5LWNA 3ZS5A 3QUDA 5HE2A 3VBXA 5K3YA 5CAQA 3RHXA 4F99A 3QX2A 2P3GX 3CS9A 3NWWA 4JX7A 4EL9A 4BJJA 2OJFE 4R5YA 3TDVA 1H1PA 4FZ6A 4GVAA 4RIXA 3EFKA 4FA2A 1UV5A 5DI1A 3IW5A 3OTUA 1UNGA 2W05A 2C3KA 2I0VA 1SMHA 2J6MA 4L53A 4OTFA 2PZYA 1H28A 2V55A 3VONA 3NRMA 3UC3A 1OL7A 2A4LA 3TV6A 2OJ9A 5AEPA 1PXJA 4FTKA 4U3ZA 1QPDA 5J8IA 3LCSA 2Y4IC 4GYIA 5IG1A 4HZSA 1FINA 3HA6A 3KXHA 4O6EA 4BDAA 3QZFA 4PTEA 1JWHA 2DWBA 5ETCA 4BCPA 1PXIA 4FSRA 4XG2A 3DOGA 3UGCA 4BDFA 5ETIA 4CKIA 4E4LA 4F70A 5I9XA 4CQGA 3QF9A 4B7TA 3UDSA 1JQHA 4ZTSA 2VWXA 4X3FC 3ITZA 4D1ZA 4ZMFA 3CPBA 3QQJA 4NKSA 2YFXA 4I22A 2VTMA 3ODZX 1KOAA 4O4CA 3EB0A 3KU2A 4D5HA 3PFYA 3KL8A 1GZNA 1FPUA 3BLHA 1ZMUA 1Y6BA 1Q5KA 4HCVA 5ANEA 3W2QA 4CRLA 3L9NA 3W2CA 4TL0A 2BIKB 2ZOQA 2WQBA 5CNNA 3U8WA 3WBLA 2FYSA 4MYGA 4DEIA 3D9VA 3RK9A 5I9WA 4AN3A 3CJFA 3HNGA 4AGDA 1XR1A 3O2MA 2QG7A 3MJ1A 4LMNA 4AQKA 3ZO4A 5AAEA 4QMSA 5BUEA 1G8JA 3PSBA 3CQWA 3NEWA 2W1IA 1BI8A 3G2FA 4BC6A 1PRYA 3FKOA 5LCJA 1B39A 4BKZA 2R4BA 2PE0A 1Z9XA 3I1AA 3VUGA 2OZOA 2X6DA 3PY0A 4S31A 4X2NA 4AXDA 1GAGA 4I94A 4JAIA 4LI5A 4EK4A 2F2CB 1OIRA 2OJJA 3BYMA 4PX6A 4V05A 3H9OA 4YPDA 3GU4A 2QOLA 3UVQA 2OKRA 3ZTXA 4EK8A 4ZLZA 3TKUA 4K8AA 4FNZA 4RFMA 1M2PA 3KXMA 4RQKA 5B2LA 4F0FA 3BEGA 2PVKA 5CF5A 2EXMA 2IZRA 5A9UA 4BTMA 4EZ3A 2I1MA 1YXXA 2YCSA 3F9NA 4BN1A 3RAHA 2JKMA 2OLCA 3PJ3A 2C68A 4ASDA 1PMVA 3UVRA 3LFAA 5ETAA 4BGQA 2OJIA 2OK1A 4LYNA 2X2LA 4CT2A 2ZB0A 3CLYA 4X3JA 4YJPA 4EQMA 3VC4A 5KMKA 3MB7A 2A1AB 2XJ1A 2WOUA 1XH9A 4Y46A 4U80A 4OW8A 1VEBA 3ZCLA 3ZM4A 5KMIA 4Z9LA 4F08A 5DPVA 3W8QA 4NT4A 4O0TA 4PL4A 4MH7A 5EI2A 1OIUA 4CFWA 5L2IA 4RPVA 1V0PA 1SNUA 5CU0A 2QR7A 4ASXA 4O82A 1RQQA 1CTPE 4QP3A 3LXPA 1MRUA 3FLNC 3VBWA 1OGYA 5E4HA 3BYOA 2R0IA 4QYEA 4AP7A 4QP6A 4CXAA 4WUNA 4EWQA 4IACA 2XEZA 4OAUC 1FOTA 5CTPA 1OGUA 2G2IA 5FRIA 1F5QA 3DTCA 3UOLA 4FKVA 5I3RA 1M2QA 3ORPA 4U3YA 2J0MB 3R02A 4NIFA 2I40A 4O27B 2LGCA 1S9IA 2XBAA 4O0YA 3PUPA 4E6AA 2VWYA 4R78A 3R1YA 4BL1A 2KULA 3R8UA 4LL5A 2GNFA 3QA8A 4AE9A 3KMWA 3QUEA 4TN6A 4GIHA 1YOJA 3PJ1A 2XIXA 4UB7A 5AP5A 3DNEA 2XK8A 4C4HA 4E5AX 2GTNA 3PPJA 3MBLA 2OIQA 2E9OA 2QU6A 1XWSA 4U79A 4X7QA 3U4WA 4I5HA 3I81A 4G17A 3U51A 1GIHA 4M84A 2CKPA 3NGAA 3QYZA 1FVVA 2QOOA 3UMXA 2GFCA 1IA8A 4FV0A 5AAFA 2F7EE 5AUTA 5AV4A 3LLAA 5D12A 4AAYA 4DT9A 5FDXA 3DB6A 1DI9A 3U4UA 4O2PA 4YUQA 2WTJA 5BVFA 1UVRA 4MUQA 1OIQA 3GU8A 4J97A 3AC3A 2YN8A 4XG7A 4S33A 1YXUA 2FUMA 2WMVA 5AR5A 4WOVA 4V0GB 3B8QA 4JLCA 3PVBA 4FVRA 1STCE 2WGJA 3GCVA 3DKCA 1WBTA 4RC4A 4U41A 2XYUA 5CASA 4NWMA 4X2JA 4EZ5A 1PF8A 3FMMA 5ACKA 3V6RA 4FEXA 3ZM9A 2XK3A 4E6QA 3BE2A 4BDEA 2WTWA 1XBCA 3OWJA 2AEGA 2PVNA 2YM6A 2RFDA 3NUUA 4FF8A 4AA0A 4RX5A 3BU6A 3QLGA 4FTOA 2VTLA 2YA9A 1ZXEA 3GFWA 3HYHA 4J99A 2C6EA 2REIA 4LUEA 4UMQA 1Q3DA 2PZIA 2XB7A 5CEPA 5CNOA 4I5MA 3BGQA 1KOBA 1VYZA 2I0EA 2PY3A 2QURA 3Q4CA 2G2FA 2ZV8A 3U54A 2OWBA 4JL9A 2H9VA 2AUHA 4DFYA 5B2MA 3QTZA 2ACXA 2C5XA 2J0KA 3VS5A 4I4EA 3W2RA 2DQ7X 5A4QA 1Q8WA 2JC6A 3DFCB 2FSMX 3EKNA 4X3FB 2QG5A 4OTPA 3KGAA 2WTIA 5ANIA 3WZEA 1HOWA 2BRMA 2GTMA 2J2IB 4I93A 2XNPA 3BKBA 2UZBA 5HHWA 2E9UA 4BKJA 4L00A 3DKGA 4XV9A 4LL0A 2Y8OA 3BCEA 2RG6A 4BCGA 3SC1A 4O96A 4BGGA 4JBVA 5DWRA 4BCMA 3F3WA 3V8SA 5IEVA 3TACA 5BYYA 4CEGA 5KE0A 2AQXA 3ZO3A 4TRLA 1XMMA 1TKIA 2VGPA 2ZDUA 3S0OA 3OXIA 4H3QA 3BEAA 3F3ZA 4QTAA 4HCTA 5JRQA 2X4ZA 3DBDA 2JBOA 3FI2A 3MGYA 3MVJA 3ORXA 1YOLA 2O0UA 3R83A 4ALVA 3BLAA 3PLSA 3IW6A 4FIEA 2HYYA 2VX1A 3RGFA 4EJNA 4FT5A 2XARA 3D5VA 3HUBA 3Q04A 4QYFA 2C4GA 2XIYA 3N4TA 2PZRA 2YIWA 4YO6A 4FSNA 2RSVA 2WTDA 3P7CA 1FGKA 4IDTA 3ZXZA 3QQGA 4DFZE 2R3RA 1AD5A 5CU4A 3O0GA 2VWWA 3PP0A 5HVJA 1ZRZA 2I0HA 3C4WA 3GC7A 3IO7A 4XOYA 4AG8A 1TQIA 2OFUA 4G3DA 3C4CA 4WG3A 2ITYA 4WG5A 4QMUA 4FKOA 3ENMA 5HX8A 3DPKA 1KE7A 3KA0A 4KIPA 4R7HA 5DR6A 3TCPA 3UPXA 5GZ9A 4D4VA 2ETKA 4OBPA 4LV7A 5EQEA 1PXLA 4ERKA 2P2IA 1HCKA 4GK4A 4GS6A 5L6PA 3MY1A 3D14A 3PA3A 4UEUA 5FEEA 5J1VA 5IQDA 2J5FA 3ZU7A 3QUPA 3A7IA 3OG7A 4PPAA 3TKIA 3I5ZA 3AQVA 3EKKA 4G6OA 4N70A 5FBNC 3UBDA 4HVHA 3CD3A 1JKKA 2F4JA 3Q5ZA 1YW2A 3MA6A 1WVYA 3PIZA 3SDJA 4C33A 4ZY5A 4A9YA 3HECA 2C6MA 2PULA 3VS6A 3OF0A 4MNEA 5EM7A 4EOQA 3KMUA 3H0ZA 4JG6A 5JZNA 3S4QA 4O7TA 4BY9E 3DJ5A 4J52A 4AAAA 5T6KA 5C9CA 3ZC6A 2AYPA 3ORKA 3BL7A 1OKZA 1KSWA 3EHAA 3I79A 3R8VA 3FMJA 5JQ8A 1U5RA 3N4VA 4I4FA 5M55A 4NCTC 4QMPA 3JYAA 3R6XA 3NNUA 4C7TA 3CD8A 3CKWA 4PP7A 2HENA 3DGKA 3TIYA 4FSTA 5L8JA 5HU3A 2GS6A 3MB6A 3R7YA 3TI1A 4QDEA 1L3RE 3A62A 4QMYA 4FG8A 3H3CA 2CNUA 2R3PA 3AC4A 4F1TA 3P7AA 4G34A 5CAUA 2NP8A 3GBZA 4KIOA 2G15A 3HV4A 4WHZA 5E91A 3RPRA 3PA5A 4IZYA 1YHVA 3AXWA 4O7NA 4JBOA 4V0GA 3NVKI 3U6HA 1ZYCA 2JGZA 3U9CA 2QOKA 4BFMA 3LCOA 3DLZA 3NUNA 2XKFA 2WFYA 4FBXA 4P5QA 3SD0A 4K77A 3ANRA 5EM8A 4FZDB 1J3HA 2C5VA 2YLEA 3FLZA 2OW3A 2W7XA 4TYEA 5D7AA 5AUUA 1SVGA 4IB5A 2A27A 1MQBA 1OPJA 3EJ1A 3DLSA 1APME 4O6LA 3FDNA 3EFWA 3KREA 4BF2A 1H27A 3OFMA 4LOQA 2CKQA 2WKMA 3LFCA 3FMEA 4PRJA 2XNEA 3OC1A 4O38A 4D1XA 2YIQA 4CQEA 4DBNA 4DEEA 3IQ7A 3ZSHA 1H08A 3Q3BA 4C4EA 3BBTB 2OIDA 4RX8A 4FEUA 3BU5A 3FC2A 4DEHA 4BTJA 4HNFA 2RG5A 2IF8A 4S34A 4BIDA 3COMA 2B0QA 4I0SA 5D1JA 4UYAA 1M7QA 4FEWA 2X1NA 2IN6A 4AOIA 3F7ZA 3EQPA 2OJGA 3FMLA 3UIXA 3EFJA 4F6WA 2NO3A 2O64A 3BHTA 4PPBA 2X0OA 2YM7A 4G1WA 3EFLA 5AV3A 4EWHA 4PL5A 4DINA 4Q9ZA 4QEBA 2NRUA 4DEDA 5JFWA 3DT1A 4IHPA 3F6XA 1O6KA 2YIRA 4LGDA 2WMAA 3A7HA 4IFCA 3ALNA 2W06A 4YC3A 3UOHA 4YSJA 3FMNA 5EYCA 3UZTA 2VTIA 4C36A 4IIRA 4KKHA 2OZAA 3GU6A 4C3RA 4AW1A 3V5PA 4KA3A 3IGGA 5TF9A 4C8BA 4USFA 4MD8E 4AFEA 4BWKA 2VUWA 3OVVA 3ZC5A 2XNGA 5AA8A 5KHWA 3SV0A 2CLQA 4RIWB 5DH3A 2YWVA 3VAPA 2YZLA 4AZFA 4D5KA 4RA4A 2JDOA 3C4FA 4I41A 4AZSA 2HZ4A 2CGUA 2J5EA 3C5UA 3KF7A 3LJ1A 2PU8A 3BV3A 3S00A 4JMQA 4A4XA 3D0EA 4IWOA 4QTBA 2VAGA 4CTCA 5J7BA 1JOWB 3QYWA 3NUAA 2C5YA 4EH4A 1H25A 4R7IA 3SRVB 3UE4A 2ZM1A 3QTIA 1YRPA 4QYYA 4BKYA 3VRYA 3RWPA 3Q2JA 4P2KA 2VX0A 1XBBA 1M14A 2BROA 4PTGA 4WSYA 3UIBA 4RSSA 4EOJA 2GSFA 3MY5A 3VW8A 2VX3A 5EI6A 4M14A 3UNKA 3TM0A 4IB1A 3PWDA 1PMUA 4XP2A 4A7CA 2BR1A 2XCHA 3GU7A 4RQVA 3MIYA 4BWPA 2BPMA 3JY0A 4ZY4A 2HXQA 3QKMA 5ICPA 1F3MC 1OM1A 5IA4A 2C6KA 4C0TA 3CJGA 4L7FA 4AE6A 1NY3A 1P4FA 3O5AA 1GZKA 3UNZA 3NUSA 1LUFA 3UZPA 5BX0A 3IDCA 4O7LA 3EL7A 4MBIA 4YHJA 3JVSA 2UZVA 5AX3A 2PVJA 2GS7A 4W9XA 5HE0A 2C6TA 3KXNA 4IX5A 2C5OA 4PDOA 3VN9A 3IW4A 4EK6A 3Q96A 4O4DA 4X0MA 4WKQA 2P33A 5EG3A 1NVRA 2JITA 1T46A 4J7BA 4M69B 5CEKA 2JKQA 3D7TB 3OW3A 2VO3A 3ZRKA 5M4IA 2PZPA 5C8KA 1GIIA 5AR4A 3TKHA 4YHFA 3BHYA 2WNTA 4EJ7A 2XK6A 4BZOA 2WQOA 4DGLC 1RJBA 3CBLA 4EHVA 4ZS4A 4DFXE 2ZVAA 4USDA 4CZTA 3TDWA 1E9HA 3JUHA 4F63A 5EDQA 3QZGA 2WMTA 3LXNA 2XZSA 5G1XA 4C37A 4WBOA 2VV9A 3GVUA 4YHTA 4OTRA 4GK2A 4AZEA 2W1ZA 2UW3A 4R8QA 2PUNA 3TMOA 2WD1A 5F4NA 4BJJB 4MWHA 4BDCA 3FSFA 4LRKA 3FXZA 4PWNA 3IW7A 4L8MA 3UO5A 4CG8A 4GSBA 1Z57A 3O8UA 3QTUA 4FL2A 3LCTA 4FTRA 4HPUE 4O4EA 2PL0A 2JFLA 3UYTA 4ITJA 4N57A 4FTTA 5KMNA 2WMXA 2GMXA 1Q8ZA 3CY3A 3QRIA 2C6IA 5FTQA 4E73A 3FZPA 4EBVA 3BE9A 3EN9A 5CLPA 3AG9A 4D2SA 1H07A 4FUYA 2X2KA 3HL7A 2CDZA 5HKMA 3VWAA 5I3OA 3QHWA 2Y7JA 4USEA 3BWFA 3DBEA 2XNMA 4IVDA 1OBDA 5E9EA 5I9YA 4YGAA 4FL3A 3DXNA 1OL1A 4C02A 4CFMA 4GU6A 2HY0A 2VO0A 2XKEA 4AW2A 4ZTHA 3TZ9A 3BRBA 2QO9A 3OCTA 4JG8A 4ZZMA 4BTKA 5EW8A 3DCVA 4O1PA 3R7IA 5KX8A 3G6HA 4UZDA 3QALE 3FYJX 3WF6A 5GJGA 4CFUA 4DCAA 3NCZA 3L9PA 2W1GA 2BTSA 3R7OA 4G3CA 3NYXA 2O3PA 3K3IA 2HIWA 4O7YA 5A6OA 4GG7A 4J95A 2Z7SA 1IA9A 1KE8A 4Y5QA 3DJ7A 4AUAA 2B7AA 3BU3A 3RVGA 4U0IA 3RPSA 4C61A 3H9RA 3OROA 4AXAA 4FKPA 4O22A 4CCUA 3F5UA 2Z7RA 3F69A 4IX4A 5CEQA 4H05A 4RIWA 3N51A 3Q2MA 3AC2A 4Q2AA 3EQCA 4I3ZA 4FKJA 4PDPA 5A14A 2OSCA 3GC0A 5IH6A 1ND4A 3QRKA 1YOMA 1JLUE 3TNPC 4I6LA 1WVWA 3ALOA 4NKAA 3TZ8A 4ITIA 3P5KA 1XKKA 5CXZA 3GQLA 4XBRA 4D1SA 3AGMA 4ASZA 1P2AA 5ANDA 4FKRA 3OHTA 2YDJA 2XKCA 3MW1A 4UXQA 4ZSJA 4FYNA 4YTIA 4HYIA 4K33A 4FIJA 5HBEA 4B4LA 5F20A 2WMQA 2QCSA 3KRXA 2QQ7A 3QC9A 3ZRMA 4BI0A 5JGDA 2JIVA 4D9UA 4D2WA 3HP2A 3QGWA 3BBWA 1OPKA 4Y95A 1Q8UA 1U59A 3OEFX 3NFGB 2R3NA 2V62A 2ITWA 2O65A 2WQNA 2XP2A 5FD2A 2XIZA 1URWA 2QR8A 3D7ZA 4FV9A 5EFQA 3QWKA 4R7BA 4DG3E 1BKXA 4A4OA 3FWQA 3QD2B 4YP8A 4F6UA 4ORKA 5EH0A 5HI2A 4DN5A 3TNHA 3DV3A 4X2FA 4GT5A 4MBLA 5HLNA 4NK9A 5AV2A 3UDBA 1V0BA 3FI4A 3ZEPA