1WBTA

Identification of novel p38 alpha map kinase inhibitors using fragment-based lead generation.
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
351
structure length
351
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
publication title Identification of Novel P38Alpha Map Kinase Inhibitors Using Fragment-Based Lead Generation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 113
structure length 351
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1wbtA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1wbtA01
5KHXA 5KE0A 3ORZA 3A61A 2XMYA 3LCSA 3E5AA 4LGDA 3RKBA 3KKVA 2WMSA 4WSYA 5FWKK 5ANJA 4CV9A 3E8NA 4H3BA 2IO6A 1XWSA 4MQ2A 1Q97A 3CGOA 4D4VA 3WOWA 2VTTA 4C3RA 5AM6A 2YJSA 1YOJA 5EM6A 3C4EA 3QD4A 2RFEA 3QKKA 3FHRA 4DLIA 2GNHA 1RQQA 5BVEA 4E5BA 2HOGA 2YLFA 1ZYDA 4NU1A 5TKDA 2C5XA 4HYIA 3R8PA 4RJ4A 3OF0A 2JBOA 4R1YA 4W8EA 4FUXA 3FKNA 1YWNA 3SG9A 3RAHA 3NIEA 1WVXA 3NW7A 4U44A 3IDPA 3V5JA 2WKMA 2Y4IB 1OKYA 5IA2A 3A7HA 4O2ZA 2VTIA 5HLWA 5AFVA 2XKCA 3PXYA 4A4OA 4E4XA 4ANQA 4APCA 3UVQA 2BTRA 2F4JA 2I0HA 3R0TA 3CGFA 5TE0A 3GC0A 4HYHA 2W1GA 4EBWA 3SW7A 5ANKA 4FT3A 4ONAA 4WT6A 3COKA 3KREA 2W5HA 3D5VA 3MW1A 3FPMA 4EQUA 3RPOA 4HGEA 4OBPA 2YITA 1HCKA 4PL5A 3LMHA 3NUUA 2XK4A 4S31A 4IWQA 2RKUA 3HMIA 3QQJA 4ZP5A 5I9XA 4QMNA 3R1SA 3VJNA 2BTSA 3LXKA 3FLNC 3RWPA 2WEIA 2UW7A 2VWZA 3C1XA 4F63A 4FEVA 4KKHA 4GYGA 3A62A 1VJYA 3LPBA 3QRIA 1H26A 2EB2A 2Y8OA 5IH6A 1Q3DA 4P5ZA 4AZFA 4K0YA 4RX8A 3SRVB 5L4QA 1H27A 4AT5A 2PVYA 4QMWA 5HGIA 1YKRA 3P4KA 4DFLA 4A9TA 3NYOA 3CQUA 5E1EA 4DBNA 2VNYA 5IU2A 2WTVA 3BEGA 2ZDTA 5K5XA 4F64A 2X0GA 4AF3A 4A9YA 3BYUA 2SRCA 4RFYA 3GFEA 3RCJA 4FKGA 5CSXA 1PXNA 1WBWA 3E3PA 1TQIA 3QTZA 3R00A 4FKTA 1OBDA 2UZTA 2WNTA 3QCXA 5HHWA 3PLAE 5EI2A 4WHZA 5M44A 2WEVA 3SG8A 4QPSA 5CU2A 3Q9YA 3BHTA 4IZ5A 4RWJA 3ZCLA 2R7BA 1GNGA 4BHZA 3LCTA 4YZDA 3OTUA 3BE9A 3H0YA 4FODA 5HX8A 3MVLA 4RIXB 4IE9A 5KO1A 4MK0A 3A8WA 3OT8A 3QWKA 1A48A 4I6QA 3KQ7A 1FGKA 3KVWA 3ITZA 3ELJA 5CZIA 3DK7A 4JDIA 4EH3A 3JPVA 3DAEA 2HY0A 4DLJA 2IPXA 5GZ8A 1T45A 2PSQA 2Z02A 4PDPA 3SV0A 4DEAA 3VBWA 4FKPA 4RX7A 4ZTLA 4ZTNA 2B53A 2VTNA 4WG3A 5E9EA 3G6GA 4XS2A 3LAUA 2HY81 5G6VA 4E5AX 2ZOQA 3Q5ZA 2OZAB 4O0UA 2B54A 3EQRA 3ACJA 3KL8A 5C9CA 4CKRA 3FXXA 5DG5A 3G9NA 3IECA 4PMSA 4OTDA 4DTKA 4BCGA 1XKKA 3F3ZA 5E92A 4CMTA 4CZYB 4ORKA 2X8IA 3FQEA 4G5JA 5HBJA 4U43A 4AXAA 4PDYA 2PUPA 3L8XA 5I4NA 3N4UA 3OROA 3KGAA 3NUNA 4N57A 4IMYA 5BVOA 2O8YA 4FG7A 2C30A 3PXZA 5AJQA 5FGKA 1BYGA 3EQGA 2O64A 3HUBA 2NO3A 3GU7A 2QLQA 4RA4A 5BVNA 3LIJA 4I1ZA 4BF2A 3EH9A 3BYSA 4R6VA 5IPJA 2B9JA 5DR6A 3F3TA 4L68A 1GIJA 1ZMWA 3IW7A 2W9FB 2WTKB 4I6HA 4K1BA 3UO4A 3NPCA 3NCZA 4FVPA 3B8RA 5E91A 5TR6A 3CLYA 5AWMA 3NYNA 4FKJA 5LMKC 2G2HA 3QWJA 3R22A 3HNGA 3UJGA 4FEQA 4C62A 2UW5A 3E7OA 4EQCA 4XBUA 4X2GA 3ZBXA 5I9WA 3EMGA 3GCUA 4C35A 3ZLWA 4DFUA 4CCUA 3L1SA 3NNWA 3VBTA 5CF4A 2PE2A 2QQ7A 2H8HA 3CD3A 3NNXA 3QCSA 5J5SA 3RM6A 2JBPA 5EYDA 5DN3A 4EOIA 4UWYA 1V0OA 4WNMA 3EQHA 3R28A 4G3EA 1M52A 3MY0A 4UWCA 1O6LA 2HK5A 4F0GA 3A4PA 4OTWA 3QHRA 5CWZA 4CRSA 3TDVA 4FTIA 2JFLA 3PVUA 3QD2B 3KRRA 5B2MA 4JXFA 4L3LA 4ERKA 3FQHA 4X6QC 1GIIA 1F5QA 5DR2A 4FSWA 3LXNA 3BHYA 3DAKA 4O7VA 1OIRA 3FC1X 4D2PA 1Q5KA 5JGAA 3OC1A 2AUHA 3EZRA 4HPTE 3G90X 5KMKA 4NIFA 4O82A 1GZOA 1YHVA 4YHTA 1NXKA 3R2BA 4NM7A 5HG9A 4FKWA 2C3JA 1PMNA 2C6EA 3HV5A 5G1XA 1PMUA 3DNDA 4U97A 3LQ3A 2YM7A 4IXPA 4QOXA 3R7UA 2GQRA 4IQ6A 4RQVA 3BU5A 2F9GA 4A9UA 3QRJA 3V51A 2QOKA 1LR4A 3UOHA 2J90A 3ORLA 4GT4A 4DG0E 4CG8A 5I9UA 3ZFXA 3GENA 4ZSEA 4R3CA 4X2FA 3S4QA 5DGZA 4A7CA 3I7CA 4M69A 1XO2B 4MXCA 2FSLX 4S32A 2Z7RA 4CYJA 3EN5A 4FZ6A 5GNKA 3UOLA 3RWQA 1JOWB 3P79A 3RAWA 5DT4A 4CG9A 3KVXA 5EHOA 3HZTA 5IEVA 4K6ZA 4AW1A 2UZNA 2F2UA 1UNHA 3UNJA 5GINE 1ZOGA 3AC8A 2W4OA 4I22A 4Z7GA 2V22A 4NM0A 3PZEA 5EHYA 2R5TA 3ZEPA 4F6WA 1CKIA 1ZRZA 2B1PA 2QOLA 5I3RA 5IA4A 4DE4A 4BDDA 4O0YA 1G8SA 4Y46A 2YCQA 3GXLA 4WNPA 2H96A 4FIHA 1OKWA 4D4RA 4FSUA 4E6AA 4ITJA 3GU5A 5E90A 5CEIA 3TIYA 5IQEA 2R7IA 2ZJWA 3U55A 2Y4IC 1XBAA 3F6XA 4AA5A 4F7SA 4JVGA 2BDJA 4PY1A 4UBAA 2IVUA 4YJSA 3BU3A 2I0YA 2J0MB 3HYHA 3RPVA 5AIKA 1FOTA 3DXPA 1YW2A 5CT7A 2WAJA 5DIAA 5LVOA 3DNEA 4JDHA 4MNFA 3H9FA 3WF7A 3LE6A 2XCHA 3QKLA 2CLXA 4RWKA 2R3HA 1OL6A 3OW3A 3MI9A 2XKFA 1Q8UA 3ORNA 2UZVA 3ENHA 4FV8A 2UV2A 2W9ZB 3LJ2A 4QP9A 5CQUA 3V04A 3ZO2A 2VTQA 4C4HA 1OUKA 1BL6A 4V04A 4BCNA 3D5WA 4QP4A 3QRTA 3WZUA 1OL2A 4GEOA 1ZOHA 2R3IA 2W4JA 2ONLA 4YJRA 2ITTA 3R8UA 5LMAA 3MB7A 2IVTA 4AW2A 1HOWA 1KE7A 4USEA 3FMNA 3LFBA 4GU6A 4IX5A 4EH2A 2VGOA 4IAFA 4MVFA 4FKIA 4D2WA 4EK3A 3C5UA 1J7LA 1BX6A 4CMOA 1B6CB 1FVRA 4BHNA 2CMWA 3ALNA 4QYEA 3VS0A 4U41A 3V01A 5KZIA 2XJ2A 1MRYA 4JOAA 4LUDA 4Q9SA 3CJGA 3DKCA 3EZVA 1UWJA 3PP0A 1QL6A 4W9WA 4AUAA 1FQ1B 2FSMX 3QZGA 4JBOA 1Z5MA 2FSOX 3WE8A 4D9UA 4E5WA 4F7LA 2NRYA 1SYKA 2BRBA 5B2LA 2YCRA 4AS0A 4C8BA 4D5KA 3AC1A 3GU8A 4IWPA 4AN9A 2XM8A 4IDVA 4G2FA 4O1OA 3AC5A 5AP1A 3FMEA 1QPCA 4NJDA 4YJPA 4BCHA 4U79A 5EOLA 4BCMA 4GV1A 3FEGA 4PRJA 5HEZA 2WZJA 4QTBA 5DT3A 3RVGA 5CF5A 5K0KA 5JFXA 4UMQA 1IAHA 2YZAA 1YRPA 3AGMA 3NYVA 5FP6A 3PSCA 4L44A 3WIGA 1U46A 1JPAA 4KBKA 5LOHA 3O8TA 3PXRA 1ZY5A 1MRVA 3CTQA 2C47A 3F66A 3W18A 5IEYA 1KWPA 4D5HA 4E73A 5CAOA 2XF0A 4J7BA 3TV7A 2GNIA 2J50A 5HICA 3KC3A 2W17A 5HO7A 5HTBA 2LAVA 5IH4A 5BPYA 3LW0A 2VWYA 3H4JA 2WMRA 2F7ZE 1UVRA 3CR0A 4CYIA 4F9WA 2PHKA 2C4GA 2OO8X 4UXLA 5L8KA 5BUEA 4XUFA 3GT8A 3QRUA 2YCFA 2QO7A 3M1SA 4CNHA 3QCYA 3DLSA 4TZRA 3R6XA 2BKZA 3CKWA 4FIIA 4FV1A 5HG5A 3W2RA 3TUBA 3KXNA 5C4KA 3Q53A 3H10A 4FT0A 2W5BA 5DNRA 4MF1A 4JDKA 5K9IA 3GU6A 3BBWA 4WSQA 2YDIA 1JBPE 5EQYA 2JKOA 1IAJA 4RFZA 4GFGA 4FIFA 2ZB0A 4FTCA 4G3CA 4H1JA 4P4CA 3D2IA 5J7HA 4NM3A 4Q9ZA 3AG9A 3LFAA 5AR5A 3KXMA 4MWHA 4ZY5A 5EQPA 2Z7QA 2J5EA 3HGKA 3NRMA 3FXZA 2Y9QA 1LEWA 2VTMA 2VZ6A 3KXZA 4ZTSA 4CLJA 3PJCA 5DVRA 4HVIA 4C57A 2I40A 2Z7LA 3BQCA 2UZWE 4CFFA 3OFMA 2R3GA 4IADA 3HMOA 4O7WA 2HZ4A 3QTRA 5EYKA 3UBDA 1ZMVA 4DFYA 4ZLZA 1CTPE 3OCSA 2JIVA 2WTKC 4RC4A 3LFSA 5CVFA 4DFXE 2FO0A 2VTAA 5E1SA 3RK5A 1LP4A 4KIKA 4L7FA 3TG1A 4EYMA 2ZV8A 4F6UA 2YWVA 2HZ0A 4C59A 5HLPA 4WG4A 3R02A 5M06A 3MDYA 5JRSA 1XH4A 3UIXA 4ZZOA 5IZFA 2J4ZA 3M42A 4I5HA 1WMKA 1ZYSA 4R78A 4EJ7A 4CFWA 2WTCA 1R1WA 3D0EA 2ACXA 3G5DA 4F7JA 2OJIA 4C4JA 3QZIA 2EVAA 3HDMA 4AN2A 4Z7HA 5HD4A 3V5WA 3F7ZA 4QYGA 2H6DA 2WOTA 5L2SA 5FUTA 3AOXA 3CKXA 3QQUA 2OF2A 4NUSA 1HCLA 3QD3A 5AV2A 3SXFA 2BPMA 4K77A 2HXLA 3N9XA 1Q4LA 1YXXA 4EOMA 2WU7A 4I6FA 3WZEA 1ZXEA 4RWIA 4ACMA 5KMOA 1DAYA 4O0TA 2V7AA 5BQ0A 1H0VA 4FTQA 4LRMA 1VEBA 4O38A 4R5YA 5JFWA 4IACA 3GU4A 3CPBA 3AD5A 3C50A 3EQPA 4MXYA 4UX9A 3H9RA 3D9VA 4JS8A 3FQSA 4UV0A 3BYOA 2XJ1A 5AUXA 3I5NA 2OIBA 3PE1A 2G2IA 3ZFMA 1FVVA 1Z9XA 1APME 4NYEA 2WMXA 3QX4A 4TXCA 3U4WA 3FL5A 4TL0A 3IK3A 1OGUA 3UP2A 5FLFA 4EH5A 2CJMA 2FSTX 5CI7A 3ZSGA 3HV6A 4FYOA 4X6RA 3GEQA 2YJRA 3EOCA 5HOAA 2CLQA 3BU6A 5LVNA 4U5JA 5M4UA 3WYXA 3R30A 5FD2A 5IUIA 4ENYA 4FL3A 4M8TA 3BGZA 2VU3A 3ZM4A 5DPVA 4G6NA 4EHEA 2G15A 4A9RA 1H24A 2WQMA 3OY3A 4ZS4A 2PVHA 3ZLYA 3OWPA 4MTAA 2QKWB 3EFKA 3ETAA 3PVGA 1PXLA 1Q61A 4QMVA 3PA4A 2ITQA 3GCPA 2E9OA 2ZYBA 3A4OX 4QTEA 1KUTA 4O2PA 2DS1A 1UV5A 4HNIA 4FTAA 4NIFB 1PYEA 4F9YA 1YI4A 4M67A 4PQNA 2ETKA 5KBQA 1FGIA 4M7IA 4JIAA 4ID7A 5AV3A 4FK6A 3TNIA 4D4SA 2OH0E 3DBQA 3AT4A 3BWFA 2NP8A 2UW3A 2ITYA 2JGZA 3VIDA 5CENA 4CT2A 4QYFA 2GCDA 4ALUA 4LOOA 3SOAA 3PWYA 5LQFA 2PZ5A 3R63A 4PF4A 4DN5A 2RIOA 5HG8A 4ZK5A 3TI1A 1UKIA 4ANLA 4F7NA 1YXUA 5ETFA 3QRKA 4FKRA 5CX9A 4M69B 2B52A 1PKDA 2O63A 1W82A 3TTJA 4TWCA 5E8ZA 3TKUA 4O1PA 2B55A 2KULA 2Z2WA 4HPUE 3R9OA 4MBLA 4M84A 3TJDA 2C69A 4RQKA 4C58A 2VWWA 2ITUA 4UMRA 4DCAA 5I9VA 2OJFE 4KD1A 2DYLA 4OBQA 3MSSA 2C6KA 3UVPA 3AT2A 1WBSA 2UVYA 3L8SA 4LMUA 3K3IA 2HWPA 2XKDA 3VS5A 3ZZWA 5M4CA 3OW4A 5A4EA 4FNYA 1PXJA 4XCUA 2ITOA 1PF8A 3WI6A 1VZOA 3KULB 4OTIA 3VBQA 4JJRA 1ZYLA 2F7EE 5BUIA 3FC2A 4OTPA 4KIOA 3G9LX 4YURA 1O6KA 3EYHA 4L3PA 3F7WA 4LGGA 4GKIA 3TIZA 4RBLA 4BWKA 3LCDA 3PXFA 3DTWA 4RFMA 5HBHA 4D1ZA 3I81A 4DGNA 3IW5A 3LXPA 5AMNA 5EM8A 4G3FA 3QU0A 4FSTA 5HE2A 1MUOA 4G3DA 3FZOA 4FTUA 4XG9A 2B9FA 1Q8WA 4MEDA 4TNBA 5J9LA 3EIDA 2W96B 2P2HA 3GB2A 4FTLA 1P2AA 2X4FA 3Q4UA 1GZKA 3C4ZA 4MHAA 5JSMA 4Y73A 4FL1A 2YM8A 4QP1A 3V8SA 1REJA 4EK4A 3GCQA 3G51A 1G8AA 3DXQA 3RHKA 3R1NA 2PUIA 2JDTA 2HWOA 2BAJA 2VTOA 4JNWA 3MPTA 5CAVA 4I21A 4CMUA 5LVLA 5JT2A 4OTHA 2O5KA 3GQLA 5AM7A 5J87A 2WQBA 4UWBA 4HW7A 3QA0A 3NGAA 4FNXA 3W10A 2XEYA 4QMQA 2X2MA 2ZAZA 4YBJA 5M55A 4BL1A 5M56A 2PUNA 3ZXTA 2P4IA 2YAAA 3DJ5A 3PPJA 3PUPA 3MIYA 3QTSA 4S34A 3GGFA 3R9DA 4ZAUA 3DT1A 1J91A 3QQFA 5BX0A 4MH7A 2E2BA 2OIDA 5CT0A 4UZDA 1IRKA 3ZLXA 3AC2A 4C4GA 3TJCA 2WPAA 3IDBA 4LYNA 4IBMA 5BVWA 3O8UA 2W05A 3QL8A 4ZSJA 2VO6A 3A7GA 3HLLA 4JL9A 5L8JA 3TZ7A 2QOHA 2BRMA 4TYHA 4XV1A 3EL7A 2F2CB 1YOLA 3BLHA 2WTDA 4X2JA 4EOOA 4IFGA 3R2YA 4FA2A 2HW7A 4BI0A 1M2PA 4FF8A 4FSMA 1WFCA 4AT4A 3Q04A 4XX9A 3I6UA 4YJOA 1Y91A 4O7TA 3R9RA 3U9NA 3BI6A 1ZMUA 4ZSGA 5FM2A 2ZV7A 4EKKA 5A4TA 3KB7A 3BKBA 3RINA 4WOVA 4NCTC 2GNLA 3BWJA 1CM8A 3LLTA 4CQGA 4F6SA 1K2PA 4ITIA 5EQEA 2QR7A 4FV6A 2GHGA 3DLZA 4BI1A 3TL8A 2BZIB 4ZJIA 3IW4A 2O2UA 2IWIA 2C0OA 2XIRA 4I93A 4BDKA 3SLSA 3MFUA 2YEXA 4LL5A 4CT1A 4QQ5A 3FZ1A 2OSCA 3TUCA 1KV2A 5L8LA 2ZV9A 3R8ZA 4QYYA 3TNPC 1GZ8A 1WZYA 3E63A 2GU8A 3VAPA 1ERKA 3AXWA 2WGJA 2QOQA 4RIOA 3BBTB 4CVAA 4E3CA 4F99A 3LMGA 4AU8A 2XK8A 3R7OA 1OM1A 2WTIA 3LFCA 2OICA 5A14A 3NEWA 4BWXA 4C2WA 3FYJX 1L8TA 4FG8A 5F9EA 5CS6A 4F0IA 1XBCA 3A7FA 3QTWA 1NVQA 3U51A 1M7QA 4EEVA 2RGPA 3QQLA 2VTLA 4UY9A 4K33A 5HU9A 4LRJA 3SVVA 1F3MC 4BDJA 4FEUA 4APPA 3QX2A 3QUPA 3D5XA 1YDRE 2HW6A 4DG2E 4OTQA 4JR7A 4NH1A 3PTGA 3U9CA 1WBOA 3RK7A 2HYYA 3RTPA 5I9ZA 2QKRA 3RZFA 1IASA 4N6ZA 4HCUA 5LJJA 4IWOA 5DLSA 3UE4A 2I1MA 3SXRA 1EH4A 3KMMA 4QNYA 4NM5A 3AMYA 5T68A 4FIEA 5E7RA 2C68A 4FIGA 4WUNA 1A9UA 2BALA 2OZOA 4KIKB 3KA0A 5A9UA 4PPCA 4FTOA 4JQ8A 5IEXA 4Q5HA 5C03A 5HNBA 4GG7A 2QOFA 3QC9A 5A4CA 2X9FA 4PNIA 4IX6A 3O17A 2ZMDA 3FY2A 3IOPA 3ZHPC 3ZO1A 1Y8YA 4DHFA 2X2LA 1OMWA 4EZ3A 4RZWA 4JBPA 5ANIA 4UMPA 2G01A 3CY2A 4MYGA 3FY0A 3C0IA 5E8VA 3ROCA 4PV0A 3NAYA 5CQWA 5E8TA 4I0RA 3RZBA 1XH6A 3PIYA 4MWIA 4X3FA 2C0IA 3OVVA 2BVAA 1UU8A 2XZSA 4ANNA 5KCVA 3KEXA 5EDRA 4B9DA 4BZDA 2C5OA 2NPQA 3R71A 1A06A 4FEWA 3QD0A 2UZBA 2V55A 4I0SA 1P14A 2PMLX 1SVEA 1WVYA 3CBLA 4OR5A 5HLNA 3OCGA 2P33A 2QO2A 5ETCA 4LRKA 5HIDA 3WZJA 4EOLA 2OIQA 2PWLA 2VO3A 4NWMA 3UMWA 4ZZNA 5LVMA 2JFMA 4KBAA 4L01A 5EFQA 3HRBA 3MVMA 4XG4A 4PMPA 3F82A 3BQRA 2WTWA 4G31A 3PZHA 5HIBA 5AUUA 4YNEA 2BFXA 1BI7A 4FTNA 2PL0A 5HVJA 3VNTA 1RJBA 3CTHA 3F5PA 3G2FA 4FVRA 5AIRA 4RX9A 5FM3A 5CSVA 4EC8A 5AUTA 3UO5A 1QCFA 2BRHA 3PIXA 3U8WA 3CP9A 3P78A 3WF9A 3FZSA 4AGUA 4B0GA 4HZSA 5JK3A 3OUNB 2XH5A 2W5AA 3A8XA 4O0WA 4I41A 4IM3A 1W7HA 5IH5A 5L2IA 2OK1A 3VBYA 4JG7A 3VUHA 1YXTA 4TW9A 1AQ1A 2WMAA 3GC9A 3O7LB 3CXWA 1PMVA 2YIXA 2BFYA 3Q4TA 3VUTA 3VBXA 1ZLTA 3W2SA 4EUUA 3W16A 3D7TA 4YLLA 1XQZA 3EQIA 3E3BX 4JBQA 2RFSA 2OGVA 4W8DA 2GTMA 5EW8A 3ZTXA 3QZHA 5HD7A 5IQGA 4R5SA 4C34A 3V5QA 2UW4A 4Y83A 4YSJA 1BKXA 3GFWA 4HVGA 3OEZA 1V0BA 1Z57A 5DEYA 5GJDA 1ZOEA 4WNOA 3OBGA 4J8MA 5EW9A 4CFXA 2VWXA 3DKGA 2QCSA 3BPRA 3PRFA 3HDNA 4FKQA 5AAFA 3SDJA 3COMA 3S3IA 2R3FA 3DKFA 2C6DA 3QUDA 3HEGA 3L8VA 5IA1A 4FKOA 3O71A 1OZ1A 5CU0A 4D2RA 3TDWA 4I6BA 2AC5A 2IJMA 3KMUA 1TQMA 5EDPA 4E20A 3F3VA 4KIQA 4XOYA 1KE6A 1ZARA 2YA9A 2DQ7X 3ZDUA 4EZ5A 4NL0A 4BCIA 2XNBA 3MS9A 3P7AA 5HE1A 4ZZMA 5HCZA 2BHHA 5FEQA 1AGWA 3C7QA 1PJKA 4FTJA 4HOKA 5DH3A 5EM5A 4ZTMA 3FI4A 3PJ3A 3T3UA 4AE9A 4IHPA 4TN6A 1XR1A 2VNWA 4NKAA 3PVBA 4LQMA 4Q2AA 2DWBA 3DS6A 4O7LA 4E6QA 4O84A 3F5XA 1OIYA 3QHWA 4UEUA 4L8MA 3NW5A 3C4CA 5IQCA 4YHJA 4I24A 3TXOA 4IB1A 4V01A 3JXWA 3FLWA 2WMTA 5M57A 3OOGA 1Q8TA 3U87A 3P1AA 1UU9A 4OLIA 3ZUTA 1UWHA 3B2WA 3THBA 4EZ7A 3NUYA 2P3GX 4FSYA 4KS8A 4FNZA 5HIEA 3A7IA 4EOPA 3G0EA 3V5TA 2OI4X 2QO9A 3H0ZA 4RG0A 3Q9XA 4KINA 4JAJA 4OW8A 1B39A 2G9XA 3UODA 4WO5A 4BBFA 5BMSA 4TYGA 5I5ZA 3RGFA 3OXIA 5HO8A 4E6CA 4FSRA 5TT7A 4BDHA 3TV4A 4DEDA 3ATTA 1FPUA 3UG1A 4AX8A 4KNBA 2GTNA 3FLSA 3UC4A 3UG2A 2Y7JA 4H58A 5J1VA 3V5PA 4E4LA 4EJNA 4MKCA 4U6RA 4WA9A 4NJ3A 4XYFA 3LOKA 1MQBA 5FDXA 4YTFA 3MN3A 3R21A 4FI1A 5IKWA 3CIKA 3ORIA 5K0XA 1T46A 3QA8A 4RGJA 4FGRA 1SNXA 2H34A 2XBAA 3Q9ZA 1U5QA 4QTCA 4ANBA 3HMPA 4IB5A 1V1KA 4EL9A 3MIAA 2UVXA 2OU7A 3NUAA 3IG7A 4EI4A 2OFVA 4CGAA 1KE9A 4AA0A 4EH8A 2YLEA 5C8KA 3UNZA 3C0GA 1B38A 1U54A 3JVSA 1M2RA 3OS3A 4LFIA 3KK9A 3F69A 3HVCA 4BDEA 1P5EA 3IPHA 4IW0A 4MXXA 3ZU7A 5I9YA 3HUCA 4IAZA 5ANEA 3REPA 2WMUA 2CGVA 4Y8DA 2HENA 2JLDA 3SX9A 4TYHB 3FZTA 4LI5A 2IVVA 4FUYA 5DOSA 3RALA 3SW4A 4GH2A 4RJ8A 4EQMA 3LJ1A 4F70A 1W84A 4KA3A 4C36A 4PL3A 5JRQA 5CU6A 2QONA 3SKCA 4G9CA 4D58A 4ERWA 1FMKA 4NSTA 1OPLA 5FEEA 3OXZA 3QQKA 1YWRA 4V05A 5BMMA 2GNJA 2QOCA 2IVSA 4WUAA 1S9JA 4YBKA 3DK6A 4XRJA 1ZY4A 3PG3A 2WOUA 3R04A 2X1NA 3HAMA 2XIKA 2VX0A 2A0CX 2VRXA 2Y6MA 2PZPA 1QPDA 3Q96A 4YR8A 4FKUA 2ZM3A 4GFMA 1IR3A 4BTJA 4ZTHA 4E7WA 1OKVA 2X4ZA 3S2PA 4EHGA 4PUZA 2ITVA 3QTIA 4AOJA 3HP2A 4MX9A 4F65A 3QTUA 4AZTA 4IAKA 3CE3A 4R1VA 4IX3A 4TY1A 4ENXA 4EYJA 3UYTA 2PMNX 1KE5A 4X21A 4FSNA 5B0XA 4A9SA 3FLYA 5EDQA 3BE2A 4U40A 4YPSA 4LM5A 5J1WA 2WHBA 3WF6A 2I6LA 1GY3A 3BX5A 4G1WA 4IWDA 2WQEA 4L42A 4XG7A 4YGAA 3BYVA 5HCYA 3CC6A 3VS6A 3N51A 4E6DA 4F1OA 3MY1A 1GOLA 3POZA 3EQBA 4ZY6A 3FE3A 5A4LA 5EI6A 3D83A 3I79A 3ORMA 4I5MA 1YHSA 1CKPA 2VTPA 3OCBA 4O21A 1Y8GA 4TT7A 4XLVA 3SOCA 2BROA 3G0FA 4BIDA 2ZB1A 4WIHA 5CF8A 2C3KA 4I92A 4BCPA 4TWOA 2O0UA 3VF8A 4JRVA 4XP3A 4FV2A 4ASZA 3BHUA 1ZWSA 4DT9A 2OKRA 3OG7A 1DAWA 4XLIA 2BKKA 4OT5A 2HCKA 4DEIA 5LMKA 4FE2A 5D9HA 3VF9A 4R3PA 1L3RE 4ZLOA 3IDCA 4A4LA 4EOSA 3O7LD 2WMVA 4AOTA 4DGOA 3KF7A 3OWKA 3PVWA 3OUKA 1Q8ZA 3DCVA 2RF9A 4KAOA 2C6MA 3ZRMA 5JQ5A 3ENMA 3KRWA 4WRGA 3NZ0A 4GFOA 3EKNA 4RVTA 1RE8A 2QR8A 1WCCA 3PA3A 4F1TA 3DGKA 4DTBA 4DGGA 2CHLA 1GJOA 2XRUA 3LZBA 4FV0A 5AUWA 3R8LA 3ZC6A 5JQ8A 2B0QA 2Y4PA 5F1ZA 2W0JA 1LUFA 5LVPA 3G33A 1FMOE 4C7TA 4AA4A 3PXKA 4QTAA 3BLQA 3MBLA 5DMZA 4M13A 4ACCA 4ACHA 4YJUA 3FMHA 3OHTA 4HVDA 4WRSA 4XJ0A 3N4TA 4HVHA 2JKQA 2J0KA 2YN8A 3DFCB 3R1YA 3COIA 4X3FB 1WAKA 2OG8A 3S0OA 4QQCA 2X7OA 4IAYA 3DDQA 3RMFA 2WO6A 5DYJA 3UQCA 2OXDA 3ZUVA 3QLGA 5H8BA 5C4LA 4WKQA 2X81A 2XB7A 3M2WA 3MH3A 4G6OA 3UO6A 4CD0A 3ROYA 5KKRB 2J0JA 1W83A 4EK5A 1Q99A 3VBVA 2BIYA 2YISA 4XG8A 1WBPA 4IZYA 2JAMA 2VWBA 2J9MA 2XKEA 3KF4A 4ZS0A 1Q62A 4B99A 4CQEA 4YC6A 2PULA 1OL1A 4WD5A 4J98A 1SVGA 3WE4A 5CVHA 1PW2A 3EL8A 3VS4A 2HZIA 3VW6A 4BYJA 3KRLA 3ATSA 3JR1A 3D5UA 4LGHA 3ZEWA 4FTTA 2Y0AA 2R3RA 4GJ3A 4UYNA 1PHKA 3NYXA 2JKMA 3E64A 3I6WA 1OPJA 3RI1A 5M09A 2JAVA 3UNKA 5CSHA 3UP7A 4PDSA 4FNWA 2XK6A 2X9EA 4XRLA 4E4NA 4FZ7A 4JX3A 5A6OA 1SMHA 2C5VA 3HL7A 4IM2A 5HE3A 2LGCA 3FV8A 2PU8A 2VWUA 3W2QA 4X3JA 4RMZA 3RPRA 1JLUE 2VTJA 4IVBA 5M07A 4MD8E 3D7TB 3F2NA 4O6EA 3NVMB 1W8CA 4ACDA 2W06A 4AW5A 4C0TA 4AAAA 4RC3A 3VUIA 4MD9E 2XVDA 4FK3A 4FT7A 5AUVA 3VVHA 4P90A 4IH8A 2Y6OA 5E8YA 2WIHA 2UVZA 1WBNA 2C3IB 4IVAA 3SAYA 5BVDA 3CCNA 2YFXA 4QTDA 3NS9A 1DI9A 5H3QA 3IONA 3O96A 5C1QB 5FXRA 2XIXA 3AT3A 2OW3A 3BLRA 4YP8A 4CKJA 3MVJA 4GKHA 3OOMA 2YACA 3U54A 4R7HA 5A4QA 2PZYA 2YCSA 3OBJA 2OH4A 1JVPP 1H28A 1O9UA 5LCKA 1IA9A 3OEFX 3Q5IA 1J3HA 2XM9A 4HNFA 4A07A 3QUEA 4OUCA 1ZYJA 2C6IA 3E8DA 3PPZA 2CKOA 4QP3A 3VHEA 2CGXA 3F61A 5CEMA 1X8BA 4BKJA 4MQ1A 2B9IA 4PTEA 5AR8A 4AT3A 1YDTE 2BDWA 4P5QA 4A06A 2W4KA 3D94A 4EH9A 4K2RA 5GHVA 3QTQA 3SC1A 3ORKA 5IQHA 4M68A 1H1WA 2PVMA 2X39A 4HZRA 2C6LA 2GSFA 4BDFA 1LPUA 2JIUA 4IANA 5D12A 4RIYA 3NNUA 3GP0A 2JD5A 4U3ZA 4KKEA 4MF0A 1XJDA 1JSTA 1UA2A 3ULZA 3K2LA 4DA5A 3PSDA 4U9AA 3ZM9A 2FUMA 3ULIA 4ZTRA 1G5SA 2R4BA 5ACBC 4BKZA 3EKKA 2OF4A 3CSVA 4C61A 3OWLA 4U42A 4XOZA 1MQ4A 4Z16A 1CKJA 3BZ3A 5K5NA 4EOQA 1PRYA 2IW8A 5ITAA 3LFFA 3PWDA 5AX3A 4DINA 4BTKA 2GDOA 3FI3A 3FDNA 3IKAA 4YO6A 3FMLA 5CEOA 5DRBA 2RFNA 2YABA 3GOKA 4ASEA 5GIOE 4QMLA 1NA7A 2XIYA 2BCJA 4IZAA 4S2ZA 3CQEA 2XUUA 3V6RA 3FYKX 3W8LA 2IZUA 2XCKA 4FV9A 2QG7A 2OXXA 5HX6A 3ZOSA 4XEYA 3WYYA 4QP2A 3DKOA 2GQGA 2O65A 3DZOA 4IJPA 4NT4A 4P2KA 5CU4A 4BIBA 3TWJA 4FSZA 3JVRA 4KB8A 1YHWA 4YJNA 4RC2A 4EK8A 4KABA 4XHKB 3TCPA 5IDPA 5JFSA 3SHEA 4G34A 3DV3A 4DCEA 3LCKA 3D4QA 3HV3A 4I3ZA 4FMQA 4AGWA 4K18A 4Z9LA 2PVNA 2XIZA 4CEGA 1U54B 3CTJA 3ERKA 5LCJA 2PPQA 3F9NA 3MPAA 3P5KA 3HAVA 1OECA 4ZJJA 1WBVA 1YQJA 3HMNA 5CYIA 3TZ9A 2QURA 2YWPA 3P0MA 4XP2A 4EORA 4NTTA 4ANMA 3VWAA 3ZXZA 3Q6WA 4M66A 3SD0A 1JQHA 2BHEA 3MH0A 4J95A 4D0XA 4F09A 3K5UA 3Q4ZA 4UXQA 3FPQA 2XYNA 3L9PA 4RIWA 5CI6A 5AA8A 1KOAA 4TYJA 4B8LA 2WU6A 2PVLA 5JFVA 4MNEA 4F4PA 1Q8YA 2QVSE 2XNGA 5HVKA 3W2OA 3P08A 1Q3WA 3TN8A 3MPMA 4PL4A 4B7TA 3PXQA 3LJ0A 3O8PA 4Z55A 3FMMA 1FVTA 5HQ0A 4J53A 2P2IA 2R3QA 1QPEA 4C38A 5LMBA 4NW6A 2X8DA 2CGWA 4L9IA 4M97A 2B4SB 3GVUA 1O6YA 4YTIA 5L3AA 3ZSIA 4ALWA 5A3XA 4J52A 2XJ0A 5H2UA 5JZNA 4UALA 2RG5A 3K5VA 4ZMEA 4X7QA 2BILB 2PTKA 3WF8A 5BNJA 1RDQE 4GT3A 2IZSA 3BIZA 4DH3A 1URCA 1NY3A 3CY3A 4MCVA 4DYMA 1W0XC 4EOKA 4O7RA 4GVJA 5BYLA 4YC3A 3A60A 3EN4A 4E4MA 4QP7A 1H07A 3BHVA 3F2AA 5IDNA 4JG8A 5AP4A 3BCEA 2G1TA 3Q60A 4M3QA 3UZPA 3OWJA 2XNNA 3F3WA 5CU3A 5H8GA 4FYNA 2V7OA 1WBTA 4IC8A 3R7IA 3MY5A 3ZRKA 2JIIA 3EHAA 4ZY4A 5IMXA 3SA0A 5IQIA 1DM2A 2OJJA 3LXLA 1OVEA 2WQOA 4I20A 4M12A 4O7NA 1TVOA 3UTOA 3ORTA 2OJ9A 4L53A 5CALA 5I3OA 4XBRA 3FI2A 3TM0A 3QF9A 4OT6A 3ODYX 3NLBA 1UU7A 4QMXA 5GZAA 1SM2A 5ETAA 4CFNA 4OGRA 3I7BA 1XH5A 2EXCX 1E1VA 3PG1A 4YJVA 4D1SA 1J7UA 2V0DA 4TPTA 5JH6A 3NWWA 3ZC5A 4RZVA 4DBXA 4YTHA 3JY9A 3JS2A 3NMUF 4Y72A 2UZEA 5D41A 5IQFA 3EWHA 4MXOA 3AC3A 2UUEA 4JDJA 4BGQA 5J79A 5BVFA 5LWMA 1BI8A 2VTRA 3MV5A 3OP5A 3L9LA 3HV4A 4JQ7A 5HNIX 2CKQA 4NK9A 3MJ1A 3GCSA 4PMMA 4GIIA 4YSMA 5FBOA 3U6HA 4LL0A 3UDBA 3GI3A 3R8MA 3BELA 5EYMA 5KMMA 2E9UA 1YI6A 2XA4A 3PP1A 5M08A 2ZM4A 4FV4A 1YXSA 1VR2A 4AFJA 4BGGA 3O2MA 3I60A 3DA6A 4XMOA 1U5RA 4C3PA 3QC4A 3EQCA 1JKTA 2EU9A 5JGDA 3D7ZA 3MGYA 5L2WA 1CDKA 2XP2A 5JMSA 5ANDA 3LCOA 3O23A 4C2VA 2VWVA 4C02A 3WIKA 4BTFA 2ZVAA 1JKSA 3FI8A 2W99B 4Y5QA 5DRDA 2WTJA 4EH6A 5EKNA 3P86A 5IUGA 5D11A 2CSNA 2R64A 4EH7A 3UC3A 2QHMA 2R3MA 2UZLA 3R8VA 1J7IA 5LXMA 1H0WA 2PVJA 1CMKE 4USDA 2QU5A 1H00A 5D7AA 5DWRA 3R9HA 4BDIA 5HO6A 1URWA 3PY1A 2XBJA 3MB6A 4IZ7A 5HBEA 4CSVA 1REKA 3DXNA 4QP8A 5J95A 2E9VA 1QMZA 3AD4A 4WBBB 5AR7A 4TTHB 2P55A 5J9YA 5KBRA 1YOMA 4YJTA 3UYSA 1H1QA 4JIKA 4TYIA 3ORPA 4K9YA 4I0TA 2V62A 4PNKA 1OI9A 4JG6A 4DH5A 3R1QA 3E93A 2QNJA 1KSWA 2PZRA 3PJ1A 5BVKA 3W1FA 4XH6A 3BHHA 3FHIA 3VW8A 3QKMA 1CSNA 4FSQA 4DEBA 4YLKA 5ICPA 4C33A 2OJGA 3AQVA 1PKGA 4JT3A 1U59A 4U3YA 3ZYAA 4FVQA 2E9PA 1F0QA 1BMKA 4H1MA 3V8WA 5E4HA 3DQWA 3IQ7A 4RRVA 4XV9A 4DEGA 3OZ6A 3DJ6A 3VS2A 4R7IA 2WIPA 5EI8A 2CNVA 1VYWA 2ESMA 4AZWA 2J51A 3MWUA 5HESA 3HRFA 2X2KA 3AC4A 3DJ7A 3WBLA 4BVUA 2RFDA 2HELA 4U81A 3QFVA 1OKZA 5HKMA 5ANOA 4CFUA 1PMEA 5FTQA 1AD5A 4CFVA 2YM4A 5C8MA 4EBVA 2IZRA 3ZRLA 2Z7SA 2CPKE 2GS2A 3GOPA 4IDTA 1SNUA 2YERA 3QALE 3KXHA 4GL9A 4H3QA 2R3OA 5EG3A 4CFMA 4ANOA 2WXVA 2X6DA 4BDGA 4DGLC 4M0YA 2QD9A 4UN0C 3UOJA 3DAJA 1UNGA 5GJGA 2ZMCA 3FWQA 1XHAA 2CGUA 3D15A 4RT7A 3ZO4A 5L2TA 2IN6A 3DY7A 5AR2A 1Y6BA 2B9HA 1TKIA 2BDFA 4NEUA 5F95A 2WB8A 4JBVA 3AD6A 5TF9A 4UB7A 3OD6X 3T8OA 1NT2A 2J0IA 3E92A 4FT9A 2UZOA 5CLPA 3MH1A 5KZ0A 2VN9A 4IEBA 4ITHA 4OBOA 1K9AA 2WD1A 4YHFA 1M2QA 3EQFA 4JRNA 4D55A 4QMPA 3TKIA 5CXHA 4BRXA 5AAEA 3KRJA 5BYZA 1IEPA 3DBCA 3DOGA 3R73A 4B4LA 2BZHB 3E8CA 3C0HA 4XV2A 4BTMA 3HA6A 2ITPA 4RA5A 5DBXA 2R9SA 5HI2A 3MTFA 4RIYB 4RLKA 4BDAA 4BDCA 1R39A 5DA3A 4FV5A 3DZQA 2C0TA 3W2PA 5EK7A 5D10A 2I7QA 4RVLA 4V0GA 4H39A 2ERKA 2Q0NA 4O22A 4O0VA 5K4IA 1SZMA 2EXEA 3VO3A 3JY0A 3ZFYA 1H1SA 4F0FA 4BCOA 3EB0A 4W9XA 3OMVA 2WQNA 5AV1A 4GS6A 4FZAB 2PE0A 4W4YA 3CQWA 4GIHA 4YC8A 4ZJVA 3KCKA 2ITWA 4D0WA 4D1XA 3LMIA 4N4SA 5EH0A 2C3LA 4H3PA 3VULA 3NUSA 4NCTA 4FV7A 2BUJA 2JDOA 2QODA 3HX4A 3GQIA 3QGYA 4N70A 4CLIA 3C9WA 4QO9A 2XK9A 2ETRA 2R0UA 4ANSA 4USFA 3EN6A 1MRUA 2J6MA 3VQUA 2FVDA 5AUZA 4NTSA 2WMQA 4FKSA 3QZFA 2J5FA 4AFEA 4S30A 4RX5A 4OAUC 4LV5A 5EOBA 5FTOA 3UPZA 3MJ2A 1BLXA 2F57A 5AP2A 4XG6A 4BBEA 3PIZA 4NZWB 1H08A 4F9BA 3QQGA 2VWIA 3GC8A 4KRDA 3E88A 5J7BA 5JN2A 2ETMA 2R3KA 5JGBA 3LLAA 3DB8A 2CN8A 3R83A 4AACA 4PDOA 4R7BA 3BYMA 2IW6A 4EWHA 3L9MA 4YZBA 2VTHA 2A19B 1TQPA 2UW0A 3I0QA 4GJ2A 4IC7A 5E8XA 3C51A 3S00A 3U6JA 5AP3A 4AE6A 4YU2A 3QXPA 5DFPA 5AAGA 3PE2A 3FSFA 3P7BA 4FX3A 4WG5A 3FXWA 5IQAA 4RIWB 4PTGA 3PDTA 2I0VA 2YAKA 3FMDA 3FL4A 4GT5A 2PK9A 2EB3A 4MNEB 4X2KA 2A4LA 5F94A 5I0BA 5M4IA 3ACKA 3FKOA 2BMCA 4EH4A 5T3QA 4BY9E 3HV7A 4TWPA 3E7VA 3RPSA 4W4XA 4O91A 5DE2A 4JR3A 2NRUA 4PP9A 4C37A 4HVSA 2OBJA 5IQDA 2VGPA 4CV8A 2ONLC 3ZO3A 4CZTA 4FGBA 4I4FA 3RAIA 4GCJA 4EKLA 4ZSLA 3TUDA 5ETIA 3VRYA 4J97A 4P7EA 3PPKA 3SXSA 1P4FA 3EFWA 4DITA 5HZNA 4N0SA 3QQHA 5C26A 5AX9A 5DR9A 4WNKA 5FXSA 2X6EA 1XH9A 4RJ7A 2VV9A 5KUPA 1PYXA 3PJ8A 4TWNA 1YI3A 1KE8A 5CXZA 1WVWA 1QPJA 3PFQA 5CEPA 4UZHA 2PY3A 4U45A 4TKSA 5JEBA 3C5IA 4FKLA 2BRNA 3NNVA 5HORA 4ACGA 3IW8A 4J71A 4L45A 5AUYA 2XYUA 1R78A 2VX3A 5AA9A 4IVDA 5KNJA 1RW8A 2PVFA 1H4LA 1R0EA 4O27B 3HKOA 4AGDA 1H1PA 3A2CA 4QMZA 3SQQA 2XEZA 3I1AA 3ET7A 3VN9A 4AN3A 4F1MA 4H05A 4FT5A 4GG5A 5CAQA 3L8PA 4IAAA 4AOIA 4AGCA 3LFQA 3POOA 5K4JA 4L67A 1OPKA 1YWVA 3CS9A 5FDPA 5LWNA 4YLJA 5J5TA 3C13A 3UZRA 3FSKA 4O96A 4M0ZA 3KFAA 3RNYA 2QI8A 3KK8A 4JLCA 4XV3A 4LV8A 4AZVA 3FKLA 5AP0A 4AZEA 4FOCA 2R3PA 4YZNA 4BGHA 5FP5A 3LQ5A 5DT0A 5CAPA 4X0MA 2C6TA 3RP9A 3QLFA 5L2QA 3CD8A 1S9IA 3PY0A 2YDKA 3TNHA 3VHKA 2WMWA 3DPKA 5ANGA 3MFTA 5FXQA 3TTIA 4MXAA 5H8EA 4GK4A 2VTSA 2UZUE 4PPBA 4BBMA 2GHLA 2A27A 4BCQA 4KRCA 4DG3E 3KMWA 4O7SA 3NDMA 4LOPA 4FC0A 4QNAA 2GQSA 2BAKA 5HG7A 2GMXA 4CCBA 5BYYA 5CASA 5CEKA 2V5QA 3Q32A 5HU3A 1OIQA 5M4FA 3FAAA 3Q6UA 5F20A 2YZLA 4QMSA 3ZH8A 4HJOA 4DTAA 3MTLA 3EN9A 3NW6A 5IQBA 3SGCA 2C6OA 3KULA 5B7VA 2KTYA 4IX4A 2UZDA 2J0LA 2R3LA 4R3RA 5KX8A 2AYPA 4KSQA 4LOQA 1V0PA 2I0EA 5C01A 4MXZA 3GC7A 5GJFA 3UIUA 1JNKA 2BZKB 2YHVA 2PMOX 2ITNA 4YUQA 4G9RA 2HIWA 2GHMA 3EQDA 4NFNA 1JSUA 4OTRA 5AR3A 3WF5A 3N4VA 3ZONA 4BB4A 3BEAA 1JKKA 4QMUA 2HAKA 3Q52A 4TRLA 3LHJA 3PRIA 4QMYA 3DBFA 3TEIA 2VAGA 2IZTA 3W32A 3EFJA 1KV1A 2GPHA 2RG6A 1E9HA 3CPCA 5H9BA 3RPYA 3HP5A 4DFZE 3H9OA 3Q3BA 4IAIA 5D7VA 2ITXA 4J96A 3ANRA 3DDPA 3NUPA 4FZFB 4GSBA 5CY3A 4MBIA 4FEXA 1BUHA 2XNMA 3DK3A 2PYWA 4BN1A 5HNGA 2F49A 1JAMA 5IISA 4JQEA 2X7FA 2A1AB 4I5CA 4Y95A 2X7GA 2QOBA 4W4VA 2G2FA 4YZCA 5IMEA 1FINA 2BAQA 1G3NA 3KU2A 3KN5A 4YNOA 4GYIA 4C3FA 1DS5A 3LM5A 1NW1A 3BRBA 4RWLA 3OTVA 2Q83A 4O86A 4IB0A 5CEQA 2CNQA 1P4OA 4I5PA 2JEDA 4RSSA 4HCTA 3MESA 3RNIA 4BI2A 2ITZA 4YMJA 3T9IA 3MH2A 4UMUA 4FG9A 3E87A 3TNQB 5M51A 5DI1A 4AZSA 4K11A 2PZIA 2FB8A 2JC6A 3GUBA 3QXOA 3K3JA 3IS5A 3FBVA 3T9TA 4NFMA 1M17A 4KS7A 1H01A 1Q41A 1SVHA 3FLQA 3R01A 4O0RA 3ZUUA 3W33A 3HRCA 2UW6A 3TKHA 4KKGA 3ZZEA 4F9AA 3GBZA 5HTCA 1OL5A 2YM6A 4HGLA 5KMIA 4RPVA 4QP6A 3NCGA 1OUYA 4RJ5A 2VO7A 3C4XA 4WBOA 3S95A 3FUPA 4DFBA 3NSZA 4S33A 3Q4CA 4QYHA 3I5ZA 4FTRA 4G5PA 2HXQA 3QCQA 2RSVA 3OCTA 4LUEA 2XNPA 2Z8CA 4IFCA 4M14A 4Y5HA 5AEPA 4BWPA 4U8ZA 4CTCA 3E8EA 1YDSE 1GIHA 4PWNA 2VUWA 1PXOA 4UMTA 3BGQA 5KHWA 4FV3A 5AP7A 5BUJA 4AP7A 4I94A 3HA8A 2XNOA 4BCKA 5CSPA 3QYWA 2XK3A 3DQXA 2NNWB 2ZV2A 4XG3A 4FR4A 2A2AA 3CEKA 5EHLA 3RAKA 1I44A 3DBDA 3PSBA 4XNEA 2PVKA 2W1HA 2GNGA 4JI9A 4V0GB 4L3JA 5FRIA 5JKGA 5CF6A 2GNFA 1KOBA 4DT8A 4QQTA 2EUFB 3EN7A 2HZNA 3F5UA 4Y85A 3TV6A 1PXMA 1STCE 4QMMA 5IA5A 4RVKA 3GCVA 3UIMA 5A54A 1R0PA 1ZZLA 2W1EA 2UW9A 2YIQA 4GU9A 1LEZA 5CTPA 5AV4A 3P7CA 3VUMA 4LMNA 4BCJA 4JAIA 3JYAA 1M7NA 5FG8A 1M14A 1YVJA 3UGCA 3HECA 3EJ1A 3IO7A 3PA5A 2JDVA 4O0XA 3W55A 5AR4A 2R0IA 2RL5A 3QBNA 4RJ3A 3VS3A 3NVKI 3IGOA 3AMBA 3B8QA 4DC2A 3W2CA 4G17A 5IA3A 2W1ZA 3DBEA 3Q2JA 3DB6A 5FEDA 1H25A 2VX1A 2CN5A 4PP7A 5HE0A 3A99A 4BFMA 3VC4A 3S1HA 5AV0A 5IA0A 2OFUA 3Q2MA 3WARA 1U4DA 3F88A 3FJQE 4L6QA 4LG4A 5KMJA 4IVCA 4EK6A 2CKPA 5C8NA 1YXVA 5EM7A 3R7EA 4EHVA 5ACKA 3R9NA 3MA3A 5AADA 2W1FA 4R8QA 4MAOA 2J7TA 4Z3VA 3U6IA 4QMOA 5CVGA 3TZMA 4TNDA 3ODZX 2W7XA 4PMTA 4AQCA 1PXPA 2R3JA 3ZBFA 4TYEA 3P23A 4RVMA 1PXKA 3G6HA 3F3UA 3UIBA 4B6LA 2YIRA 4CTBA 2XS0A 2EWAA 5L6PA 2PVRA 3FMJA 4ASXA 2ZM1A 4J1RA 1BL7A 3RCDA 1OBGA 4BR3A 3OT3A 4E8AA 1VYZA 2EXMA 4FICA 4YJQA 2PE1A 4YZMA 4L7SA 3I0OA 5JZJA 3SRVA 1H8FA 2Q0BA 3ZLSA 3LQ8A 3TZ8A 4BIEA 3D14A 3R7VA 3QTXA 3UQGA 3ZDIA 2P0CA 4G16A 5EW3A 2CKEA 3WZKA 3FZPA 4EUTA 1Q24A 3VUDA 4QD6A 3O0GA 3VUKA 2FA2A 2B7AA 2CCHA 4C4IA 5CZHA 4J99A 3MVHA 2YIYA 3PYYA 2QC6A 4GW8A 4L52A 5L6OA 1Y57A 3AMAA 3KXGA 4QPMA 2GFCA 3O50A 3BGPA 3W8QA 3NR9A 5E8UA 1JWHA 4ZOGA 4EC9A 5DHJA 1OL7A 3LM0A 5IF1A 3U4UA 3WZDA 4DFNA 4BKYA 4DAWA 2BIKB 3UQFA 4F08A 4I4EA 5E8WA 3B2TA 1W98A 2WELA 1E1XA 2R2PA 4HYSA 4D2SA 4RIXA 5FBNC 3ZS5A 4K8AA 2BR1A 3OXTA 4ZMFA 1ZZ2A 5F4NA 2JDSA 3ORXA 4PTCA 4OTFA 4GRBA 1DI8A 4E93A 4BZNA 3ALOA 1OB3A 4IM0A 2PMIA 4J8NA 4MD7E 1GAGA 1PXIA 2QOIA 2YDJA 3R7GA 4NW5A 5DEWA 5FQDC 5K3YA 3KCFA 4C4FA 4KBCA 2X8EA 3II5A 3UMXA 4O7YA 4BICA 4RLLA 4D28A 3LFEA 2BRGA 2FGIA 4X2NA 1ZYCA 2QHNA 5C27A 2W1IA 4QPAA 2Z60A 4BYIA 2E9NA 2VD5A 2JITA 3V6SA 1JSVA 2JDRA 2WFYA 3EYGA 4O0SA 2OZAA 3M11A 4DF3A 3C4FA 1I09A 1OIUA 2OXYA 4O7ZA 3NUXA 3MFSA 4FKVA 2IW9A 3BV2A 5AP5A 2YIWA 4EHZA 4R77A 1XH7A 4PPAA 2H9VA 4ZLYA 4GUEA 4FL2A 4L00A 5KMLA 2GFSA 3NIZA 3KY2A 3Q9WA 2XRWA 3L9NA 4ZIMA 5HVYA 4B8MA 4F9CA 1NVRA 1R3CA 4FZDB 4KWPA 2WMBA 3BV3A 4KUJA 4CRLA 2YM3A 2BZJA 1J1BA 5T6KA 3TACA 4M15A 1Y6AA 4N6YA 4ZSAA 4DH7A 3RM7A 5GZ9A 3NX8A 2GS6A 3D2KA 3PY3A 4AWIA 4EONA 3COHA 3NAXA 3TNWA 2GS7A 3ANQA 3KN6A 4O6LA 5CSWA 3UZTA 4GUBA 3VQHA 4D2VA 4HGSA 5HCXA 4BDBA 4H36A 1IA8A 3CJFA 2AC3A 3A7JA 2UW8A 3IW6A 5CNOA 3V3VA 3V5LA 2OWBA 4XG2A 5E8SA 1ND4A 3HMMA 3P9JA 4BZOA 4XP0A 3O51A 1JKLA 2JKKA 4AG8A 2C1BA 5J8IA 2VO0A 1FBNA 4DGMA 3GNIB 3IOKA 3V8TA 4D9TA 3LFDA 3DFAA 4YPDA 3T3VA 3DU8A 2QOOA 4G3GA 4O81A 2FH9A 3RK9A 5J9ZA 2F7XE 3K54A 2C5YA 2CDZA 3RBWA 4O83A 3VJOA 4QRCA 5B2KA 3E62A 3MYGA 5AP6A 5L6WL 4NKSA 3EFLA 3KXXA 4KSPA 3UOKA 2YM5A 2O3PA 4HYUA 4UYAA 3C4WA 4QMTA 3VRZA 3VS1A 5A46A 3I4BA 3UVRA 4IB3A 4ALVA 4QT1A 2REIA 1H1RA 2CCIA 4KIPA 4L43A 2W1CA 4QQJA 3F2RA 4HGTA 4X3FC 2FYSA 1J1CA 3MA6A 4IIRA 4ZXTA 3LFNA 4AW0A 4ZEGA 2J2IB 1GZNA 3OY1A 2PUUA 4EOJA 5CANA 4RJ6A 2QU6A 4E26A 3FMKA 3MFRA 3QYZA 4YTCA 4BCFA 5LARA 4JX7A 4YZ9A 4W4WA 3LKMA 4PX6A 1PY5A 4FTKA 4L46A 3TT0A 4E1ZA 5KKRC 2CNUA 1UU3A 4ARKA 4G6LA 3QAME 3VUGA 3RJCA 4A4XA 5EYCA 3ZMMA 4I23A 2W1DA 3F5GA 2OLCA 4GVAA 4IJ9A 1IG1A 4EWQA 4U80A 5TOZA 3WILA 5HTIA 5IG1A 3PJ2A 3VS7A 3AGLA 2DUVA 2IG7A 1NVSA 5A6NA 3LVPA 2C5NA 4U0IA 1UNLA 4C4EA 2QLUA 4HCVA 4CKIA 4CXAA 5CNNA 4DH8A 1K3AA 4DH1A 4D2TA 1XBBA 4II5A 2XK7A 3QGWA 5GIPE 4D4YA 4YO4A 5EKOA 4FBXA 5M53A 1ZAOA 3G15A 4OAVB 3JUHA 1UKHA 2XNEA 3KRXA 4DEEA 2ZDUA 4U7ZA 4CZUA 3R7YA 2R3NA 4BC6A 3FZRA 4FTMA 4FOBA 1OITA 4OTGA 5D1JA 2C1AA 4ASDA 5IUHA 3IGGA 4DEHA 3PLSA 4MBJA 3DTCA 3FLZA 3H3CA 3ZSHA 5TO8A 2ERZE 4Q5EA 5CAUA 1XH8A 3H30A 1MP8A 4GK2A 4GMYA 4ZTQA 3ID6C 2QG5A 4GK3A 3RHXA 3UPXA 5FTGA 1ATPE 5KMNA 4FIJA
chains in the Genus database with same CATH superfamily
5KHXA 5KE0A 3ORZA 3A61A 2XMYA 3LCSA 3E5AA 4LGDA 3RKBA 3KKVA 2WMSA 4WSYA 5FWKK 5ANJA 4CV9A 3E8NA 4H3BA 2IO6A 1XWSA 4MQ2A 1Q97A 3CGOA 4D4VA 3WOWA 2VTTA 4C3RA 5AM6A 2YJSA 1YOJA 5EM6A 2X0OA 3C4EA 3QD4A 2RFEA 3QKKA 3FHRA 4DLIA 2GNHA 1RQQA 5BVEA 4E5BA 2HOGA 2YLFA 1ZYDA 4NU1A 5TKDA 2C5XA 4HYIA 3R8PA 4RJ4A 3OF0A 2JBOA 4R1YA 4W8EA 4FUXA 3FKNA 1YWNA 3SG9A 3RAHA 2X0PA 3NIEA 1WVXA 3NW7A 4U44A 3IDPA 3V5JA 2WKMA 2Y4IB 1OKYA 5IA2A 3A7HA 4O2ZA 2VTIA 5HLWA 5AFVA 2XKCA 3PXYA 4A4OA 4E4XA 4ANQA 4APCA 3UVQA 2BTRA 2F4JA 2I0HA 3R0TA 3CGFA 5TE0A 3GC0A 4HYHA 2W1GA 4EBWA 3SW7A 5ANKA 4FT3A 4ONAA 4WT6A 3COKA 3KREA 2W5HA 3D5VA 3MW1A 3FPMA 4EQUA 3RPOA 4HGEA 4OBPA 2YITA 1HCKA 4PL5A 3LMHA 3NUUA 2XK4A 4S31A 4IWQA 2RKUA 3HMIA 3QQJA 4ZP5A 5I9XA 4QMNA 3R1SA 3VJNA 2BTSA 3LXKA 3FLNC 3RWPA 2WEIA 2UW7A 2VWZA 3C1XA 4F63A 4FEVA 4KKHA 4GYGA 3A62A 1VJYA 3LPBA 3QRIA 1H26A 2EB2A 2Y8OA 5IH6A 1Q3DA 4P5ZA 4AZFA 4K0YA 4RX8A 3SRVB 5L4QA 1H27A 4AT5A 2PVYA 4QMWA 5HGIA 1YKRA 3P4KA 4DFLA 4A9TA 3NYOA 3CQUA 5E1EA 4DBNA 2VNYA 5IU2A 2WTVA 3BEGA 2ZDTA 5K5XA 4F64A 2X0GA 4AF3A 4A9YA 3BYUA 2SRCA 4RFYA 3GFEA 3RCJA 4FKGA 5CSXA 1PXNA 1WBWA 3E3PA 1TQIA 3QTZA 3R00A 4FKTA 1OBDA 2UZTA 2WNTA 3QCXA 5HHWA 3PLAE 5EI2A 4WHZA 5M44A 2WEVA 3SG8A 4QPSA 5CU2A 3Q9YA 3BHTA 4IZ5A 4RWJA 3ZCLA 2R7BA 1GNGA 4BHZA 3LCTA 4YZDA 3OTUA 3BE9A 3H0YA 4FODA 5HX8A 3MVLA 4RIXB 4BJJA 4IE9A 5KO1A 4MK0A 3A8WA 3OT8A 3QWKA 1A48A 4I6QA 3KQ7A 1FGKA 3KVWA 3ITZA 3ELJA 5CZIA 3DK7A 4JDIA 4EH3A 2ZFYA 3JPVA 3DAEA 2HY0A 4DLJA 2IPXA 5GZ8A 1T45A 2PSQA 2Z02A 4PDPA 3SV0A 4DEAA 3VBWA 4FKPA 4RX7A 4ZTLA 4ZTNA 2B53A 2VTNA 4WG3A 5E9EA 4O4FA 3G6GA 4XS2A 3LAUA 2HY81 4DDIA 5G6VA 4E5AX 2ZOQA 3Q5ZA 2OZAB 4O0UA 2B54A 3EQRA 3ACJA 3KL8A 5C9CA 4CKRA 3FXXA 5DG5A 3G9NA 3IECA 4PMSA 4OTDA 4DTKA 4BCGA 1XKKA 3F3ZA 5E92A 4CMTA 4CZYB 4ORKA 2X8IA 3FQEA 4G5JA 5HBJA 4U43A 4AXAA 4PDYA 2PUPA 3L8XA 5I4NA 3N4UA 3OROA 3KGAA 3NUNA 4N57A 4IMYA 5BVOA 1ST4A 2O8YA 4FG7A 2C30A 3PXZA 5AJQA 5FGKA 1BYGA 3EQGA 2O64A 3HUBA 2NO3A 3GU7A 2QLQA 4RA4A 5BVNA 3LIJA 4I1ZA 4BF2A 3EH9A 3BYSA 4R6VA 5IPJA 2B9JA 5DR6A 3F3TA 4L68A 1GIJA 1ZMWA 3IW7A 2W9FB 2WTKB 4I6HA 4K1BA 3UO4A 3NPCA 3NCZA 4FVPA 3B8RA 5E91A 5TR6A 3CLYA 5AWMA 3NYNA 4FKJA 5LMKC 2G2HA 3QWJA 3R22A 3HNGA 3UJGA 3UDSA 4FEQA 4C62A 2UW5A 3E7OA 4EQCA 4XBUA 4X2GA 3ZBXA 5I9WA 3EMGA 3GCUA 4C35A 3ZLWA 4DFUA 4CCUA 3L1SA 3NNWA 3VBTA 5CF4A 2PE2A 2QQ7A 2H8HA 3CD3A 3NNXA 3QCSA 5J5SA 3RM6A 2JBPA 5EYDA 5DN3A 4EOIA 4UWYA 1V0OA 4WNMA 3EQHA 3R28A 4G3EA 1M52A 3MY0A 4UWCA 1O6LA 2HK5A 4F0GA 3KIOC 3A4PA 4OTWA 3QHRA 5CWZA 4CRSA 4QDEA 3TDVA 4FTIA 2JFLA 3PVUA 2AEGA 3QD2B 3KRRA 5B2MA 4JXFA 4L3LA 4ERKA 3FQHA 4X6QC 1GIIA 1F5QA 5DR2A 4FSWA 3LXNA 3BHYA 3DAKA 4O7VA 1OIRA 3FC1X 4D2PA 1Q5KA 5JGAA 3OC1A 2AUHA 3EZRA 4HPTE 3G90X 5KMKA 4NIFA 4O82A 1GZOA 1YHVA 4YHTA 1NXKA 3R2BA 4NM7A 5HG9A 4FKWA 2C3JA 1PMNA 2C6EA 3HV5A 5G1XA 1PMUA 3DNDA 4U97A 3LQ3A 2YM7A 4IXPA 4QOXA 3R7UA 2GQRA 4IQ6A 4RQVA 3BU5A 2F9GA 4A9UA 3QRJA 3V51A 2QOKA 1LR4A 3UOHA 2J90A 3ORLA 4GT4A 4DG0E 4CG8A 5I9UA 3ZFXA 3GENA 4ZSEA 4R3CA 4X2FA 3S4QA 5DGZA 4A7CA 3I7CA 4M69A 1XO2B 4MXCA 2FSLX 4S32A 2Z7RA 4CYJA 3EN5A 4FZ6A 5GNKA 3UOLA 3RWQA 1JOWB 3P79A 3W0MA 3RAWA 5DT4A 4CG9A 3KVXA 5EHOA 3HZTA 5IEVA 4K6ZA 4AW1A 1G8KA 2UZNA 2F2UA 1UNHA 3UNJA 4AXDA 5GINE 1ZOGA 3AC8A 2W4OA 4I22A 4Z7GA 2V22A 4NM0A 3PZEA 5EHYA 2R5TA 3ZEPA 3W0NA 4F6WA 1CKIA 1ZRZA 2B1PA 2QOLA 5I3RA 5IA4A 4DE4A 4BDDA 4O0YA 1G8SA 4Y46A 2YCQA 3GXLA 4WNPA 2H96A 4FIHA 1OKWA 4D4RA 4FSUA 4E6AA 4ITJA 3GU5A 5E90A 5CEIA 3TIYA 5M56A 5IQEA 2R7IA 2ZJWA 3U55A 2Y4IC 1XBAA 3F6XA 4AA5A 4F7SA 4JVGA 2BDJA 4PY1A 4UBAA 2IVUA 4YJSA 3BU3A 2I0YA 2J0MB 3HYHA 3RPVA 5AIKA 1FOTA 3DXPA 1YW2A 5CT7A 2WAJA 5DIAA 5LVOA 3DNEA 4JDHA 4MNFA 3H9FA 3WF7A 3LE6A 2XCHA 3QKLA 2CLXA 4RWKA 2R3HA 3W0QA 1OL6A 3OW3A 3MI9A 2XKFA 1Q8UA 3ORNA 2UZVA 3ENHA 4FV8A 2UV2A 2W9ZB 3LJ2A 4QP9A 5CQUA 3V04A 3ZO2A 2VTQA 4C4HA 1OUKA 1BL6A 4V04A 4BCNA 3D5WA 4QP4A 3QRTA 3WZUA 1OL2A 4GEOA 1ZOHA 2R3IA 2W4JA 2ONLA 4YJRA 2ITTA 3R8UA 5LMAA 3MB7A 2IVTA 4AW2A 1HOWA 1KE7A 4USEA 3FMNA 3LFBA 4GU6A 4IX5A 4EH2A 2VGOA 4IAFA 4MVFA 4FKIA 4D2WA 4EK3A 3C5UA 1J7LA 1BX6A 4CMOA 1B6CB 1FVRA 4BHNA 2CMWA 3ALNA 4QYEA 3VS0A 4U41A 3V01A 5KZIA 2XJ2A 1MRYA 4JOAA 4LUDA 4Q9SA 3CJGA 3DKCA 3EZVA 1UWJA 3PP0A 1QL6A 4W9WA 4AUAA 1FQ1B 2FSMX 3QZGA 4JBOA 1Z5MA 2FSOX 3WE8A 4D9UA 4E5WA 4F7LA 2NRYA 1SYKA 2BRBA 5B2LA 2YCRA 4AS0A 4C8BA 4D5KA 3AC1A 3GU8A 4IWPA 4AN9A 2XM8A 4IDVA 3BL9A 4G2FA 4O1OA 3AC5A 5AP1A 3FMEA 1QPCA 4NJDA 4YJPA 4BCHA 4U79A 5EOLA 4BCMA 4GV1A 3FEGA 4PRJA 5HEZA 2WZJA 4QTBA 5DT3A 3RVGA 5CF5A 5K0KA 5JFXA 4UMQA 1IAHA 2YZAA 1YRPA 3AGMA 3NYVA 5FP6A 3PSCA 4L44A 3WIGA 1U46A 1JPAA 4KBKA 5LOHA 3O8TA 3PXRA 1ZY5A 1MRVA 2C47A 3CTQA 3F66A 3W18A 5IEYA 1KWPA 4D5HA 4E73A 5CAOA 2XF0A 4J7BA 3TV7A 2GNIA 2J50A 5HICA 3KC3A 2W17A 5HO7A 5HTBA 2LAVA 5IH4A 5BPYA 3LW0A 2VWYA 3H4JA 2WMRA 2F7ZE 1UVRA 3CR0A 4CYIA 4F9WA 2PHKA 2C4GA 2OO8X 4UXLA 5L8KA 5BUEA 4XUFA 3GT8A 3QRUA 2YCFA 2QO7A 3M1SA 4CNHA 3QCYA 3DLSA 4TZRA 3R6XA 2BKZA 3CKWA 4FIIA 4FV1A 5HG5A 3W2RA 3TUBA 3KXNA 5C4KA 3Q53A 3H10A 4FT0A 2W5BA 5DNRA 4MF1A 4JDKA 5K9IA 4BJJB 3GU6A 3BBWA 4WSQA 2YDIA 1JBPE 3BL7A 5EQYA 2JKOA 1IAJA 4RFZA 4GFGA 4FIFA 2ZB0A 4FTCA 4G3CA 4H1JA 4P4CA 3D2IA 5J7HA 4NM3A 4Q9ZA 3AG9A 3LFAA 5AR5A 3KXMA 4MWHA 4ZY5A 5EQPA 2Z7QA 2J5EA 3HGKA 3NRMA 3FXZA 2Y9QA 1LEWA 2VTMA 2VZ6A 3KXZA 4ZTSA 4CLJA 3PJCA 5DVRA 4HVIA 4C57A 2I40A 2Z7LA 3BQCA 2UZWE 4CFFA 3OFMA 2R3GA 4IADA 3HMOA 4O7WA 2HZ4A 3QTRA 5EYKA 3UBDA 1ZMVA 4DFYA 4ZLZA 1CTPE 3OCSA 2JIVA 2WTKC 4RC4A 3LFSA 5CVFA 4DFXE 2FO0A 2VTAA 5E1SA 3RK5A 1LP4A 4KIKA 4L7FA 3TG1A 4EYMA 2ZV8A 4F6UA 2YWVA 2HZ0A 4C59A 5HLPA 4WG4A 3R02A 5M06A 3MDYA 5JRSA 1XH4A 3UIXA 4ZZOA 5IZFA 2J4ZA 3M42A 4I5HA 1WMKA 1ZYSA 4R78A 4EJ7A 4CFWA 2WTCA 1R1WA 3D0EA 2ACXA 3G5DA 4F7JA 2OJIA 4C4JA 3QZIA 2EVAA 3HDMA 4AN2A 4Z7HA 5HD4A 3V5WA 3F7ZA 4QYGA 2H6DA 2WOTA 5L2SA 5FUTA 3AOXA 3CKXA 3QQUA 2OF2A 4NUSA 1HCLA 3QD3A 5AV2A 3SXFA 2BPMA 4K77A 2HXLA 3N9XA 1Q4LA 1YXXA 4EOMA 3PUFC 2WU7A 4I6FA 3WZEA 1ZXEA 4RWIA 4ACMA 5KMOA 1DAYA 4O0TA 2V7AA 5BQ0A 1H0VA 4FTQA 4LRMA 1VEBA 4O38A 4R5YA 5JFWA 4IACA 3GU4A 3CPBA 3AD5A 3C50A 3EQPA 4MXYA 4UX9A 3H9RA 1W2DA 3D9VA 3FQSA 4JS8A 4UV0A 3BYOA 2XJ1A 5AUXA 3I5NA 2OIBA 3PE1A 2G2IA 3ZFMA 1FVVA 1Z9XA 1APME 4NYEA 2WMXA 3QX4A 4TXCA 3U4WA 3FL5A 4TL0A 3IK3A 1OGUA 3UP2A 5FLFA 4EH5A 2CJMA 2FSTX 5CI7A 3ZSGA 4AXCA 3HV6A 4FYOA 4X6RA 3GEQA 2YJRA 3EOCA 5HOAA 2CLQA 3BU6A 5LVNA 4U5JA 5M4UA 3WYXA 3R30A 5FD2A 5IUIA 4ENYA 4FL3A 4M8TA 3BGZA 2VU3A 3ZM4A 5DPVA 4G6NA 4EHEA 2G15A 4A9RA 1H24A 2WQMA 3OY3A 4ZS4A 2PVHA 3ZLYA 3OWPA 4MTAA 2QKWB 3EFKA 3ETAA 3PVGA 1PXLA 1Q61A 4QMVA 3PA4A 2ITQA 3GCPA 2E9OA 2ZYBA 3A4OX 4QTEA 1KUTA 4O2PA 2DS1A 1UV5A 4HNIA 4FTAA 4NIFB 1PYEA 4F9YA 1YI4A 4M67A 4PQNA 2ETKA 5KBQA 1FGIA 4M7IA 4JIAA 4ID7A 5AV3A 4MUQA 4FK6A 3TNIA 4D4SA 2OH0E 3DBQA 3AT4A 3BWFA 2NP8A 2UW3A 2ITYA 2JGZA 3VIDA 5CENA 4CT2A 4QYFA 2GCDA 4ALUA 4I6LA 4LOOA 3SOAA 3PWYA 5LQFA 2PZ5A 3R63A 4PF4A 4DN5A 2RIOA 5HG8A 4ZK5A 3TI1A 1UKIA 4ANLA 4F7NA 1YXUA 5ETFA 3QRKA 4FKRA 5CX9A 4M69B 2B52A 1PKDA 2O63A 1W82A 3TTJA 4TWCA 5E8ZA 3TKUA 4O1PA 2B55A 2KULA 2Z2WA 4HPUE 3R9OA 4MBLA 4M84A 3TJDA 2C69A 4RQKA 4C58A 2VWWA 2ITUA 4UMRA 4DCAA 5I9VA 2OJFE 4KD1A 2DYLA 4OBQA 3MSSA 2C6KA 3UVPA 3AT2A 1WBSA 2UVYA 3L8SA 4LMUA 3K3IA 2HWPA 2XKDA 3VS5A 3ZZWA 5M4CA 3OW4A 5A4EA 4FNYA 1PXJA 4XCUA 2ITOA 1PF8A 3WI6A 1VZOA 3KULB 4OTIA 3VBQA 4JJRA 1ZYLA 2F7EE 5BUIA 3FC2A 4OTPA 4KIOA 3G9LX 4YURA 1O6KA 3EYHA 4L3PA 3F7WA 4LGGA 4GKIA 3TIZA 4RBLA 4BWKA 3LCDA 3PXFA 3DTWA 4RFMA 5HBHA 4D1ZA 3I81A 4DGNA 3IW5A 3LXPA 5AMNA 5EM8A 4G3FA 3QU0A 4FSTA 5HE2A 1MUOA 4G3DA 3FZOA 4O4BB 4FTUA 4XG9A 2B9FA 1Q8WA 4MEDA 4TNBA 5J9LA 3EIDA 2W96B 2P2HA 3GB2A 4FTLA 1P2AA 2X4FA 3Q4UA 1GZKA 3C4ZA 4MHAA 5JSMA 4Y73A 4FL1A 2YM8A 4QP1A 3V8SA 1REJA 4EK4A 3GCQA 3G51A 1G8AA 3DXQA 3RHKA 3R1NA 2PUIA 2JDTA 2HWOA 2BAJA 2VTOA 4JNWA 3MPTA 5CAVA 4I21A 4CMUA 3TYKA 5LVLA 5JT2A 4OTHA 2O5KA 3GQLA 5AM7A 5J87A 2WQBA 4UWBA 4HW7A 3QA0A 3NGAA 4FNXA 3W10A 2XEYA 4QMQA 2X2MA 1W2CA 2ZAZA 4YBJA 5M55A 4BL1A 2PUNA 3ZXTA 2P4IA 2YAAA 3DJ5A 3PPJA 3PUPA 3MIYA 3QTSA 4S34A 3GGFA 3R9DA 4ZAUA 3DT1A 1J91A 3QQFA 5BX0A 4MH7A 2E2BA 2OIDA 5CT0A 4UZDA 1IRKA 3ZLXA 3AC2A 4C4GA 3TJCA 2WPAA 3IDBA 4LYNA 4IBMA 5BVWA 3O8UA 2W05A 3QL8A 4ZSJA 2VO6A 3A7GA 3HLLA 4JL9A 5L8JA 3TZ7A 2QOHA 2BRMA 2X0QA 4TYHA 4XV1A 3EL7A 2F2CB 1YOLA 3BLHA 2WTDA 4X2JA 4EOOA 4IFGA 3R2YA 4FA2A 2HW7A 4BI0A 1M2PA 4FF8A 4FSMA 1WFCA 4AT4A 3Q04A 4XX9A 3I6UA 4YJOA 1Y91A 4O7TA 3R9RA 3U9NA 3BI6A 1ZMUA 4ZSGA 5FM2A 2ZV7A 4EKKA 5A4TA 3KB7A 3BKBA 3RINA 4WOVA 4FRFA 4NCTC 2GNLA 3BWJA 1CM8A 3LLTA 4CQGA 4F6SA 1K2PA 4ITIA 5EQEA 2QR7A 4FV6A 2GHGA 3DLZA 4BI1A 3TL8A 2BZIB 4ZJIA 3IW4A 2O2UA 2IWIA 2C0OA 2XIRA 4I93A 4BDKA 3SLSA 3MFUA 2YEXA 4LL5A 4CT1A 4QQ5A 3FZ1A 2OSCA 3TUCA 1KV2A 5L8LA 2ZV9A 3R8ZA 4QYYA 3TNPC 1GZ8A 1WZYA 3E63A 2GU8A 3VAPA 1ERKA 3AXWA 2WGJA 2QOQA 4RIOA 3BBTB 4CVAA 4E3CA 4F99A 3LMGA 4AU8A 2XK8A 3R7OA 1OM1A 2WTIA 3LFCA 2OICA 5A14A 3NEWA 4BWXA 4C2WA 3FYJX 1L8TA 4FG8A 5F9EA 5CS6A 4F0IA 1XBCA 3A7FA 3QTWA 1NVQA 3U51A 1M7QA 4EEVA 2RGPA 3QQLA 2VTLA 4UY9A 4K33A 5HU9A 4LRJA 3SVVA 1F3MC 4BDJA 4FEUA 4APPA 3QX2A 3QUPA 3D5XA 1YDRE 2HW6A 4DG2E 4OTQA 4JR7A 4NH1A 3PTGA 3U9CA 1WBOA 3RK7A 2HYYA 3RTPA 5I9ZA 4QDVA 2QKRA 3RZFA 1IASA 4N6ZA 4HCUA 5LJJA 4IWOA 5DLSA 3UE4A 2I1MA 3SXRA 1EH4A 3KMMA 4QNYA 4NM5A 3AMYA 5T68A 4FIEA 5E7RA 2C68A 4FIGA 4WUNA 1A9UA 2BALA 2OZOA 4KIKB 3KA0A 5A9UA 4PPCA 4FTOA 4JQ8A 5IEXA 4Q5HA 5C03A 5HNBA 4GG7A 2QOFA 3QC9A 5A4CA 2X9FA 4AXFA 4PNIA 4IX6A 3O17A 2ZMDA 3FY2A 3IOPA 3ZHPC 3ZO1A 1Y8YA 4DHFA 2X2LA 1OMWA 4EZ3A 4RZWA 4JBPA 5ANIA 4UMPA 2G01A 3CY2A 4MYGA 3FY0A 3C0IA 5E8VA 3ROCA 4PV0A 3NAYA 5CQWA 5E8TA 4I0RA 3RZBA 1XH6A 3PIYA 4MWIA 4X3FA 2C0IA 3OVVA 2BVAA 1UU8A 2XZSA 4ANNA 5KCVA 3KEXA 5EDRA 4B9DA 4BZDA 2C5OA 2NPQA 3R71A 1A06A 4FEWA 3QD0A 2UZBA 2V55A 4I0SA 1P14A 2PMLX 1SVEA 1WVYA 3CBLA 4OR5A 5HLNA 3OCGA 2P33A 2QO2A 5ETCA 4LRKA 5HIDA 3WZJA 4EOLA 2OIQA 2PWLA 2VO3A 4NWMA 3UMWA 4ZZNA 5LVMA 2JFMA 4KBAA 4L01A 5EFQA 3HRBA 3MVMA 4XG4A 4PMPA 3F82A 3BQRA 2WTWA 4G31A 3PZHA 5HIBA 5AUUA 4YNEA 2BFXA 1BI7A 4FTNA 2PL0A 5HVJA 3VNTA 1RJBA 3CTHA 3F5PA 3G2FA 4FVRA 5AIRA 4RX9A 5FM3A 5CSVA 4EC8A 5AUTA 3UO5A 1QCFA 2BRHA 3PIXA 3U8WA 3CP9A 3P78A 3WF9A 3FZSA 4AGUA 4B0GA 4HZSA 5JK3A 3OUNB 2XH5A 2W5AA 3A8XA 4O0WA 4I41A 4IM3A 2NYAA 1W7HA 5IH5A 5L2IA 2OK1A 3VBYA 4JG7A 3VUHA 1G8JA 1YXTA 4TW9A 1AQ1A 2WMAA 3GC9A 3O7LB 3CXWA 1PMVA 2YIXA 2BFYA 3Q4TA 3VUTA 3VBXA 1ZLTA 3W2SA 4EUUA 3W16A 3D7TA 4YLLA 1XQZA 3EQIA 3E3BX 4JBQA 2RFSA 2OGVA 4W8DA 2GTMA 5EW8A 3ZTXA 3QZHA 5HD7A 5IQGA 4R5SA 4C34A 3V5QA 2UW4A 4Y83A 4YSJA 1BKXA 3GFWA 4HVGA 3OEZA 1V0BA 1Z57A 5DEYA 5GJDA 1ZOEA 4WNOA 3OBGA 4J8MA 5EW9A 4CFXA 2VWXA 3DKGA 2QCSA 3BPRA 3PRFA 3HDNA 4FKQA 5AAFA 3SDJA 3W0SA 3COMA 3S3IA 2R3FA 3DKFA 2C6DA 3QUDA 3HEGA 3L8VA 5IA1A 4FKOA 3O71A 3AKJA 1OZ1A 5CU0A 4D2RA 3TDWA 4I6BA 2AC5A 2IJMA 3KMUA 1TQMA 5EDPA 4E20A 3F3VA 4KIQA 4XOYA 3W0PA 1KE6A 1ZARA 2YA9A 2DQ7X 3ZDUA 4EZ5A 4FJVA 4NL0A 4BCIA 2XNBA 3MS9A 3P7AA 5HE1A 4ZZMA 5HCZA 2BHHA 5FEQA 1AGWA 3C7QA 1PJKA 4FTJA 4HOKA 5DH3A 5EM5A 4ZTMA 3FI4A 3PJ3A 3T3UA 4AE9A 4IHPA 4TN6A 1XR1A 2VNWA 4NKAA 4QEBA 3PVBA 4LQMA 4Q2AA 2DWBA 3DS6A 4O7LA 4E6QA 4O84A 3F5XA 1OIYA 3QHWA 4UEUA 4L8MA 3NW5A 3C4CA 5IQCA 4YHJA 4I24A 3TXOA 4IB1A 4V01A 3JXWA 3FLWA 2WMTA 5M57A 3OOGA 1Q8TA 3U87A 3P1AA 1UU9A 4OLIA 3ZUTA 1UWHA 3B2WA 3THBA 4EZ7A 3NUYA 2P3GX 4FSYA 4KS8A 4FNZA 5HIEA 3A7IA 4EOPA 3G0EA 3V5TA 2OI4X 2QO9A 3H0ZA 4RG0A 3Q9XA 4KINA 4JAJA 4OW8A 1B39A 2G9XA 3UODA 4WO5A 4BBFA 5BMSA 4TYGA 5I5ZA 3RGFA 3OXIA 5HO8A 4E6CA 4FSRA 5TT7A 4BDHA 3TV4A 4DEDA 3ATTA 1FPUA 3UG1A 4AX8A 4KNBA 2GTNA 3FLSA 3UC4A 3UG2A 2Y7JA 4H58A 5J1VA 3V5PA 4E4LA 4EJNA 4MKCA 4U6RA 4WA9A 4NJ3A 4XYFA 3LOKA 1MQBA 5FDXA 4YTFA 3MN3A 3R21A 4FI1A 5IKWA 3CIKA 3ORIA 5K0XA 1T46A 3QA8A 4RGJA 3BLAA 4FGRA 1SNXA 2H34A 2XBAA 3Q9ZA 1U5QA 4QTCA 4ANBA 3HMPA 4IB5A 1V1KA 4EL9A 3MIAA 2UVXA 2OU7A 3NUAA 3IG7A 4EI4A 2OFVA 4CGAA 1KE9A 4AA0A 4EH8A 2YLEA 5C8KA 3ML1A 3UNZA 3C0GA 1B38A 1U54A 3JVSA 1M2RA 3OS3A 4LFIA 3KK9A 3F69A 3HVCA 4BDEA 1P5EA 3IPHA 4IW0A 4MXXA 3ZU7A 5I9YA 3HUCA 4IAZA 5ANEA 3REPA 2WMUA 2CGVA 4Y8DA 2HENA 2JLDA 3SX9A 4TYHB 3FZTA 4LI5A 2IVVA 4FUYA 5DOSA 3RALA 3SW4A 4GH2A 4RJ8A 4EQMA 3LJ1A 4F70A 1W84A 4KA3A 4C36A 4PL3A 5JRQA 5CU6A 2QONA 3SKCA 4G9CA 4D58A 4ERWA 1FMKA 4NSTA 1OPLA 5FEEA 4O4EA 3OXZA 3QQKA 1YWRA 4V05A 5BMMA 2GNJA 2QOCA 2IVSA 4WUAA 1S9JA 4YBKA 3DK6A 4XRJA 1ZY4A 3PG3A 2WOUA 3R04A 2X1NA 3HAMA 2XIKA 2VX0A 2A0CX 2VRXA 2Y6MA 2PZPA 1QPDA 3Q96A 4YR8A 4FKUA 2ZM3A 4GFMA 1IR3A 4BTJA 4ZTHA 4E7WA 1OKVA 2X4ZA 3S2PA 4EHGA 4PUZA 2ITVA 3QTIA 4AOJA 3HP2A 4MX9A 4F65A 3QTUA 4AZTA 4IAKA 3CE3A 4R1VA 4IX3A 4TY1A 4ENXA 4EYJA 3UYTA 2PMNX 1KE5A 4X21A 4FSNA 5B0XA 4A9SA 3FLYA 5EDQA 3BE2A 4U40A 4YPSA 4LM5A 5J1WA 2WHBA 3WF6A 2I6LA 1GY3A 3BX5A 4G1WA 4IWDA 2WQEA 4L42A 4XG7A 4YGAA 3BYVA 5HCYA 3CC6A 3VS6A 3N51A 4E6DA 4F1OA 3MY1A 1GOLA 3POZA 3EQBA 4ZY6A 3FE3A 5A4LA 5EI6A 3D83A 3I79A 3ORMA 4I5MA 1YHSA 1CKPA 2VTPA 3OCBA 4O21A 1Y8GA 4TT7A 4XLVA 3SOCA 2BROA 1VLRA 3G0FA 4BIDA 2ZB1A 4WIHA 5CF8A 2C3KA 4I92A 4BCPA 4TWOA 2O0UA 3VF8A 4JRVA 4XP3A 4FV2A 4ASZA 3BHUA 1ZWSA 4DT9A 2OKRA 3OG7A 1DAWA 4XLIA 2BKKA 4OT5A 2HCKA 4DEIA 5LMKA 2XAOA 4FE2A 5D9HA 3VF9A 4R3PA 1L3RE 4ZLOA 3IDCA 4A4LA 4EOSA 3O7LD 2WMVA 4AOTA 4DGOA 3KF7A 3OWKA 3PVWA 3OUKA 1Q8ZA 3DCVA 2RF9A 4KAOA 2C6MA 3ZRMA 5JQ5A 3ENMA 3KRWA 4WRGA 3NZ0A 4GFOA 3EKNA 4RVTA 1RE8A 2QR8A 1WCCA 3PA3A 4F1TA 3DGKA 4DTBA 4DGGA 2CHLA 1GJOA 2XRUA 3LZBA 4FV0A 5AUWA 3R8LA 3ZC6A 5JQ8A 2B0QA 3W0OA 2Y4PA 5F1ZA 2W0JA 1LUFA 5LVPA 3G33A 1FMOE 4C7TA 4AA4A 3PXKA 4QTAA