1WBTA

Identification of novel p38 alpha map kinase inhibitors using fragment-based lead generation.
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
351
structure length
351
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
publication title Identification of Novel P38Alpha Map Kinase Inhibitors Using Fragment-Based Lead Generation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 113
structure length 351
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1wbtA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1wbtA01
4BB4A 1XQZA 5AP5A 2O3PA 3TXOA 3GU5A 2YIQA 3KXZA 5M4IA 4L67A 4KIPA 3TV6A 1OB3A 2PSQA 3W33A 5AADA 4BI2A 4BYJA 4C58A 3I0QA 4EHGA 3V5QA 3CKWA 4W9WA 5B2LA 3I60A 4QO9A 3AD6A 3QGYA 4D2VA 1KWPA 3FY0A 3IECA 2BTSA 2XNEA 5A4QA 5L2SA 2WEVA 3EFKA 2Z2WA 3PPZA 4QQCA 3COMA 1M2RA 4OLIA 2J0MB 1NY3A 5AR5A 3WYXA 4OUCA 3QZHA 3HZTA 5A4EA 2OICA 4BZNA 1Y6AA 4FKSA 5G1XA 1GIJA 2CDZA 5DT0A 5AP3A 3TJCA 3TACA 4ANOA 4RZWA 2Q83A 3PP0A 4RIWB 3O51A 2BDWA 2OZAB 3OEZA 3EIDA 4BBEA 4LFIA 3HV4A 2ITTA 4MCVA 5CT7A 1T46A 4MHAA 3T3UA 4FMQA 4NU1A 4LG4A 4Z9LA 3DZOA 4U8ZA 4EK8A 4FV2A 2X2LA 3GCPA 4MD9E 4YTHA 1VR2A 4A7CA 5M53A 3D2KA 2WOUA 5IUGA 3Q9YA 5HEZA 4CTCA 3F3ZA 5EYCA 1XH6A 1F3MC 1IAHA 5JRQA 1G8AA 3F3VA 4ZMEA 4W8DA 2QURA 5F20A 4BDCA 2VWXA 4UMQA 3VJOA 3SRVA 4XG7A 3FMKA 2OBJA 2JLDA 4QNYA 4BHZA 3RZBA 4DH5A 3S0OA 4FTMA 3ZS5A 3DKGA 2VO3A 5TKDA 4ANSA 2VRXA 3QL8A 4F70A 4KIQA 3LFNA 4BKZA 1K3AA 5HIDA 4FZFB 3RM7A 1Q3WA 4U81A 3ZLYA 4N6YA 4WO5A 2VTSA 1JKKA 4I93A 3WYYA 5CNNA 4AN9A 4QQTA 4WG3A 3R1NA 4Q9SA 2A19B 1B38A 2XVDA 5EQPA 3R9RA 4BN1A 4EQUA 3EN5A 4R6VA 2WHBA 2RKUA 4BL1A 4FSNA 5JN2A 4UWCA 3R21A 3A8XA 4FG8A 4P4CA 2VV9A 1G8SA 1I09A 5ANDA 4C4JA 1Z57A 2C0IA 4I3ZA 3CQWA 2XM9A 4RX9A 3ZO1A 3FLSA 5CF4A 2YFXA 4L7FA 2WFYA 4MD7E 4QMWA 5AV4A 3DXNA 1UNGA 3CTHA 3FXZA 1FMKA 5M4CA 5EDQA 2VWVA 2IWIA 5CU2A 5A9UA 5F94A 3NRMA 2ITOA 4DEAA 3CEKA 4GK3A 3R8LA 2W5BA 3U51A 5EYMA 1OL1A 3EN7A 4MXXA 5AP7A 5I9XA 4FZDB 1Y6BA 4QTBA 3H10A 4Q5EA 1YOMA 3IOKA 4OTWA 3W2RA 3RP9A 3O7LD 4OTFA 4LOPA 3AOXA 5DR2A 2PUNA 1YW2A 4YNOA 3BCEA 4ACDA 4FKQA 3JR1A 3BQCA 4RIYB 4PF4A 4FIFA 4ANNA 2BALA 4K18A 4GL9A 3UOHA 5BVNA 2ITYA 3PE1A 4GSBA 5KNJA 4O82A 1UWJA 4YO4A 2R3KA 3CP9A 2FH9A 5AV1A 2GQRA 3HP2A 3PJ2A 3PLAE 3BLHA 3W8LA 3A8WA 2PZIA 3W8QA 2VO0A 3NS9A 2UZWE 3LXLA 4JT3A 4IWDA 5LCJA 3MY1A 1P4FA 3PWDA 4R7BA 3Q4UA 3QD0A 2BCJA 5A6NA 5M57A 2R3OA 5DPVA 4PDPA 1H00A 3GT8A 5BYYA 3OT3A 3HLLA 5I9WA 5ETIA 4CFFA 2ITUA 2BPMA 4GVJA 3R9NA 2WMBA 3TM0A 5JGAA 5CNOA 1PYXA 2FA2A 4WNOA 2XJ1A 3IDBA 1JKLA 2PVYA 4BCQA 2RIOA 2W1CA 2WQBA 4UX9A 4F0FA 4G5JA 5CZHA 2WQMA 2WQOA 3V51A 3AQVA 4JOAA 4C2WA 4UN0C 4W4VA 3VUTA 5CF8A 3R63A 3A7JA 3TZ7A 3G0FA 3QUPA 4PNKA 3NZ0A 3R6XA 2C3IB 2EXCX 3Q6UA 4WUNA 5K5NA 3U8WA 2CN8A 1SVHA 4Y5QA 5FP5A 3G33A 3FLYA 4D0XA 4IH8A 4W8EA 4R1YA 5AIRA 3QU0A 5K5XA 2OFUA 3AC1A 4YPDA 4L68A 3F5PA 3D5WA 3L9MA 4G2FA 4EOLA 3MV5A 4NSTA 4RC4A 3MY5A 4Y72A 4HYIA 3V6RA 4QOXA 4CT2A 1UU3A 3T9IA 4QMPA 3QRUA 1XH4A 1XJDA 3OBGA 3ZFMA 3PVGA 3DKCA 3HA8A 4QP6A 4EWQA 4BWKA 4R78A 3FSFA 2V55A 5CSXA 3KXGA 2WQNA 2Z7SA 4LRMA 4IZYA 2IG7A 3MH3A 3QTRA 3FI3A 4NWMA 1U4DA 5FWKK 3KULB 4DC2A 4OGRA 1Q61A 1A06A 5DHJA 5I9ZA 4C7TA 2WTDA 2ITQA 3IW6A 2R3QA 3PXFA 4MXOA 2UV2A 1YKRA 3DGKA 4ZLZA 5HICA 3NUYA 5LMBA 3DDPA 2GMXA 3C0IA 3G90X 3AMYA 3GC8A 4JG7A 4KBCA 4LQMA 4FG9A 3EKNA 4BICA 4PMTA 2UW9A 4QQ5A 1S9IA 2FSOX 4BTJA 3NIZA 5HGIA 4C4EA 4AS0A 2VNYA 4G9CA 1HCKA 1B39A 3PVBA 1Z5MA 3Q3BA 4FIJA 3VUIA 4JAIA 3ATSA 2YACA 3UC3A 3VO3A 4YU2A 3Q4ZA 1Q8YA 3Q2MA 4IAFA 4R3RA 3EFWA 5EYKA 3R9DA 4B4LA 4UMRA 1JPAA 4AGDA 2X6EA 3TL8A 2W1DA 3Q9XA 3FLZA 3HMOA 3D5VA 4MF0A 3FWQA 1FPUA 3O17A 2XEZA 4S31A 4WA9A 4FTAA 4ANBA 3UO5A 3O8UA 4PP9A 4TZRA 4F1MA 3DXPA 2F7ZE 1ZOGA 3ENHA 2QO2A 3R04A 3ZLWA 5CALA 2I0HA 3MSSA 3ZLSA 4AZEA 5ANIA 3KU2A 4E93A 2JFLA 2JBOA 4ACHA 5EFQA 1WVXA 2BR1A 2C0TA 5J95A 2XK6A 1UNLA 1X8BA 3NYXA 3ZC6A 4EC8A 1PXLA 3PSDA 1NW1A 1H24A 1H27A 4CZUA 4S2ZA 4ZY5A 3UPZA 3O71A 3ZFYA 3BHUA 4KNBA 5AA8A 4FICA 1MRVA 4J71A 1ND4A 4O7SA 2JKKA 4UV0A 3HRCA 1OKWA 5L6WL 3AD5A 5AJQA 4FSTA 2XNMA 3GP0A 4WSYA 5HIEA 3EH9A 5HO7A 3IK3A 4FC0A 5D1JA 1MQ4A 4DITA 4BZOA 4XV2A 4RG0A 4E73A 2J51A 3OZ6A 1WVYA 4L00A 2OK1A 3VHEA 2H96A 1TQPA 4ZZNA 5A46A 5LQFA 1OVEA 4O7WA 5I3OA 3QC4A 5DVRA 4O86A 4TYJA 3I7CA 3OWJA 3VS5A 2E9VA 4CD0A 5BVDA 4BDIA 3V5JA 1BI7A 4I94A 4QTAA 5CI6A 2BVAA 2VTOA 4DCAA 2RSVA 2HK5A 1Q8ZA 4RWJA 5KKRB 2WB8A 3RMFA 3HECA 1IA8A 5AEPA 5B2MA 3ACKA 5EW8A 2RFSA 4O7NA 3VUHA 3CGFA 4FIEA 3IS5A 1FGIA 3NR9A 3ORLA 4ZTLA 5AA9A 5AAEA 4G6LA 2QD9A 2XK4A 3MA6A 2YEXA 2YM4A 2XF0A 2C47A 4O6EA 3TTIA 4LGGA 4QPMA 3DQWA 3R7OA 4BCPA 2C6EA 4RMZA 4DGGA 2UW4A 3QKKA 2JD5A 5EI8A 5L8LA 3V01A 5FLFA 3RCDA 2XYUA 3QRKA 4NJDA 2LAVA 3H9RA 4AXAA 4I5MA 5BUIA 4L43A 2VO7A 3UVQA 4YMJA 2C30A 5KMNA 2OIQA 3COHA 4QPAA 4F9BA 4FTUA 3TEIA 3HGKA 4DG0E 2ZV2A 5CI7A 3DB8A 4I41A 3LFAA 4G3DA 3MIYA 3O96A 2YCSA 2B9FA 2CCIA 2Z60A 4H39A 4A9UA 3WOWA 4EKLA 5HQ0A 2XKEA 4ERWA 4DF3A 3BU5A 5CEOA 2UZEA 3I4BA 3UYTA 3F2AA 4YC6A 4HCTA 4E8AA 3TN8A 3U6HA 4N57A 3PVUA 3G2FA 3HX4A 4PDSA 3BPRA 4JLCA 3E8DA 4RQKA 4ASEA 3KB7A 5HCXA 4OBPA 3D7ZA 2ETRA 1GZNA 4R3PA 4RJ5A 3COKA 5CVGA 1CMKE 1OMWA 3K3JA 4QMQA 3BHTA 5JSMA 1PY5A 4AGUA 4USDA 2W1EA 4DINA 2IW9A 3FYKX 5FTGA 5AMNA 1WMKA 4B7TA 1O6KA 4G1WA 4HYHA 1XHAA 5EQEA 5HORA 4NFMA 1WBTA 4JQ7A 1M17A 3BHVA 4LMUA 4U7ZA 4WT6A 3QUDA 4MQ2A 3FDNA 2QOQA 4LOQA 2Y7JA 4CLJA 3C4ZA 3R71A 5HVJA 3GU6A 2F57A 2J90A 3NCGA 1YI4A 2R3MA 3P7BA 3R1SA 1H25A 2G15A 3V8SA 4YURA 4EH4A 2UW3A 1ZYDA 2B53A 1H1WA 2RL5A 2WZJA 3F2RA 2C1AA 4UEUA 4XP0A 3R7IA 4YSJA 4M7IA 4FNWA 4KRCA 1KE7A 5A3XA 4EK4A 5AUWA 1ZLTA 4ANQA 1OL6A 1GIIA 1TKIA 2Y4IB 3KKVA 3E63A 3RZFA 3FMNA 4YR8A 4Z55A 2F9GA 2W9FB 4PUZA 4RJ8A 2HXQA 3EQIA 4UB7A 4BCGA 3FEGA 3FKLA 4Y85A 3S1HA 4R8QA 4FSWA 4JBVA 2IZSA 3FZRA 4EJNA 5CU6A 3ORXA 5CVFA 3VF8A 3WIKA 1PXNA 5HE2A 4C2VA 5ETFA 3OFMA 4M97A 3GC7A 2BMCA 5HG5A 3UZTA 1U5RA 1E9HA 3BE9A 3FZSA 3I0OA 1DS5A 2WNTA 4D28A 3DK3A 3IW5A 4F7LA 4MKCA 5FQDC 4QMXA 4JG6A 2HYYA 3FZTA 1IA9A 1UU9A 4RT7A 3LKMA 3C13A 3LFBA 3WBLA 5D9HA 4IB1A 3QWJA 1SMHA 1VYWA 2WELA 3FLWA 2O63A 3NSZA 3ODZX 2PVKA 4J96A 4K11A 5CEPA 5JGDA 3BYMA 3U55A 4YJVA 1XBBA 5DRDA 5A4CA 3P23A 4IZAA 3RPSA 2IO6A 4XV9A 4XOYA 2EXEA 5IMXA 4RIXA 1SM2A 1V0PA 1OPKA 2HZ0A 5L3AA 1J7LA 2ZV8A 3GU4A 4I6FA 3DA6A 1JBPE 5CAVA 2OH0E 4XG2A 3QQLA 3OG7A 2CSNA 3BBWA 4TPTA 3H0YA 3VBWA 1BL6A 4GV1A 4IVAA 4ASZA 1R0EA 1PW2A 1H0WA 2YM5A 1ZMUA 2WMAA 3OOMA 2B55A 5M56A 4C4IA 2W1GA 3OP5A 1IEPA 2YLFA 4JR7A 2RGPA 2W4JA 3RJCA 4KB8A 1YHVA 3C7QA 4XYFA 5EI6A 4A9SA 4DGLC 2OXXA 4GUEA 1FVRA 1OUKA 2C4GA 3F7ZA 4NEUA 4NTSA 4BWPA 2X4ZA 2YCFA 4LM5A 5D11A 5T3QA 2REIA 2HY81 2XIRA 1H28A 1QPDA 1YXSA 4O27B 1U54B 2XZSA 5CU3A 2VTMA 5FRIA 4ASDA 5HTCA 4BDHA 1WBSA 5AM7A 4BR3A 2BRGA 3R1YA 4MF1A 2PVFA 4FTNA 4YHTA 3RGFA 3NDMA 5A14A 3I7BA 1PXOA 3UQCA 3CY2A 3E3BX 3AMBA 1BYGA 1PXIA 1CSNA 3F3WA 3PY1A 3SX9A 3UOKA 3V3VA 4YJUA 3LFDA 3KXMA 4GKHA 4EZ7A 2YWVA 3NUUA 3BU6A 3B2WA 4RGJA 2C6TA 4IX5A 3WZJA 4A9TA 1Y57A 2OGVA 5L4QA 2BUJA 4DH1A 5KMJA 2E9NA 5ACKA 2PL0A 4KD1A 3G0EA 4D9UA 4L8MA 5EM5A 4BVUA 1MP8A 1P14A 4FT3A 2VTHA 1JQHA 3G15A 3IO7A 4RZVA 1VJYA 4BDJA 4ZSLA 4XV1A 2XIZA 4L3JA 3QTQA 3UMXA 4IADA 2FSTX 5CEQA 5JT2A 5FEQA 3BE2A 2AUHA 3OXIA 4O0UA 4QT1A 4WOVA 3HVCA 2OKRA 4TXCA 5C27A 4CXAA 4FTQA 2XS0A 3QKMA 4AACA 1OL7A 2X9FA 1U5QA 4FZ6A 2BRHA 2FSLX 3KMUA 1PHKA 1PXMA 2W17A 3SG8A 4NH1A 4BCOA 4AOJA 3H4JA 3D7TB 2GCDA 3PP1A 5IPJA 4EYMA 5L6PA 4FV1A 2X2MA 3VW8A 3LCSA 2ZAZA 3VNTA 1LUFA 5HBHA 3UNZA 2JIVA 2FSMX 3DBDA 2YIYA 1URWA 3NPCA 1YXUA 4DFXE 4AW0A 4C4HA 4FVRA 3IW7A 3KK9A 3UC4A 4NM5A 5LCKA 3BI6A 2ZB0A 4CVAA 4E7WA 4XG9A 2PE1A 4L6QA 3JPVA 4U97A 1IR3A 5DE2A 4BDKA 1H1PA 4KS7A 2EVAA 3ZZEA 3CQEA 4D4VA 3NYVA 5DH3A 2J2IB 3V6SA 4BCNA 1WBOA 2X6DA 4J99A 3HMMA 3DKOA 4WSQA 4YPSA 4IVCA 4PTCA 4HGEA 1NVQA 4DG3E 3EQCA 4RIWA 3CD3A 3DJ7A 4J8NA 2OZAA 4K0YA 5KHXA 4KIOA 3KRWA 2YAKA 4DA5A 4E6AA 5IDNA 1J7UA 4OTPA 3SQQA 3A2CA 3TZMA 3UG1A 4RJ7A 3FJQE 4FVPA 2B7AA 4KWPA 4GW8A 2ZMCA 4H58A 4RJ3A 4TTHB 2RG6A 4NYEA 1S9JA 2C6KA 3DU8A 4WNKA 2HZIA 4IBMA 3R8PA 4BRXA 1BLXA 5IQDA 4IAIA 5H9BA 1YWVA 4I0SA 4FSZA 3ZXTA 4AT4A 4F7NA 5IQIA 4O96A 3BYVA 4PTEA 2YZAA 3FC1X 3U9CA 4PRJA 4YHJA 5AUXA 5DMZA 3G9NA 5ICPA 4XUFA 2AYPA 3DT1A 3VQUA 5I9UA 3TI1A 4C4GA 1AGWA 4HVDA 5LVMA 5JMSA 3N9XA 2QONA 4BCJA 3ZEPA 2AC5A 3ZHPC 1E1XA 5DBXA 4RC2A 2VUWA 3ZBXA 2HY0A 2XCKA 3U6IA 2YZLA 2QG5A 4FODA 3AXWA 5KBRA 2YDJA 3F9NA 4WUAA 2HENA 2VTAA 2UW6A 4OT5A 5KX8A 5HOAA 4XMOA 4AT3A 1BI8A 2PZPA 2PVMA 4FL2A 5GIOE 4IM0A 2YABA 3QCXA 4Z16A 3D94A 1GZKA 4UXQA 3QCSA 4IXPA 5AP0A 2DUVA 5GZ9A 4IE9A 3ANRA 2CPKE 5CYIA 3FLNC 5FDPA 3TZ9A 2QU6A 4I1ZA 2B54A 4IAAA 2WIHA 3DS6A 3HMPA 4H3PA 5TOZA 4BCIA 5C4LA 5DIAA 3MN3A 1OIQA 3P1AA 3QZIA 3P4KA 4C61A 3ORNA 4O38A 5ANKA 2XRWA 2WMTA 1DI8A 1B6CB 2P2IA 3MW1A 3EJ1A 4EOJA 1OIRA 4YZNA 3F5UA 3HRFA 3UTOA 4F7SA 2CNUA 4BGHA 3ZSIA 5C9CA 4EH3A 1YHWA 1REJA 5AR7A 5CF5A 4ZTSA 4O91A 4V01A 1SVEA 3LQ5A 3TNQB 3UO4A 4OTHA 2C3JA 3OF0A 4E5BA 5IF1A 3EOCA 1YWNA 3QQJA 3E88A 3BGQA 5J87A 1YDTE 3Q53A 4ZLYA 4DEEA 4X2FA 4LL0A 4RIYA 4EI4A 4DTAA 2XMYA 3FMMA 3MIAA 3QQUA 3ZRKA 4AA4A 4AZVA 5BVOA 4LYNA 5EI2A 5AR8A 4NKSA 3IDPA 3PZEA 2GSFA 3AT3A 3CD8A 2X9EA 3F7WA 3GCQA 5DG5A 2PUPA 3ZDUA 2BTRA 2ZOQA 3WZUA 5BPYA 2BZIB 3DTWA 1H1QA 4HGSA 5HKMA 2VNWA 3EQBA 4JRNA 3OEFX 5ANEA 3L8VA 3P7AA 2WO6A 5AR2A 3CCNA 5HG9A 2UZBA 3CS9A 4X3FC 4AQCA 3PJ3A 4O7LA 4FSRA 3VUKA 4FV5A 3H30A 3PY0A 5EHLA 4BDFA 2QG7A 5CAUA 1DAWA 4HVGA 2C6LA 4GKIA 4DBXA 1ZYCA 2J5EA 3P9JA 4H1JA 5HNIX 4GCJA 3ID6C 4FX3A 1CKPA 3MTLA 4G5PA 4ZMFA 2XJ2A 3KXHA 3SVVA 3ET7A 1VYZA 4O0TA 4PY1A 3TT0A 2FVDA 3BEGA 2XA4A 3DAJA 3O2MA 3OS3A 4YLKA 1UKIA 4O7ZA 3CGOA 4JQEA 4YJSA 4IW0A 2GNFA 4LUEA 4Y95A 4APCA 4BZDA 2B4SB 2C3KA 4V04A 3UIMA 4D55A 4PP7A 4W4WA 2B9IA 2R7BA 3R2YA 4JDIA 4ZK5A 1H1RA 4M0ZA 5AUZA 3F3UA 3MJ2A 3JXWA 4RVKA 4J1RA 4IHPA 2H6DA 3GU8A 4UWBA 5HNBA 3U54A 3THBA 4R1VA 5CWZA 3BRBA 1P2AA 3PIXA 3CTQA 4ALWA 5CAOA 4C37A 3MFTA 3Q60A 3UYSA 2BDJA 2CGWA 2EWAA 1TQMA 3ODYX 4FTKA 4NW6A 5EH0A 4ZTQA 2ERKA 5KHWA 4X2GA 3CC6A 3OD6X 2VWZA 4ANLA 2YIRA 1NVRA 3TCPA 3W32A 2XK9A 1ZWSA 2YJRA 3D0EA 4KUJA 2OSCA 3KULA 3RNYA 3OUNB 4FGRA 3UO6A 4XV3A 3RPRA 5IQFA 3OVVA 1L3RE 3R9OA 2RF9A 4MVFA 1YI6A 3LFEA 4BI0A 2JKQA 5E8UA 3AT2A 2GFSA 3OBJA 4FBXA 5AP2A 2UW5A 1Q5KA 4BKJA 5CQUA 4ID7A 2HELA 3PDTA 4KAOA 3QTXA 2ITPA 1KE9A 1YHSA 4ITHA 2ZVAA 4TNBA 4GT4A 4FKPA 5EM8A 2BHHA 5I9YA 3GQLA 2C6MA 3HUCA 5IQEA 4GK4A 5FBNC 4CFVA 3HDNA 1Q97A 3FLQA 1ZYJA 2V0DA 4U9AA 2JGZA 3UZRA 5E1SA 5EDPA 2JDOA 1FVVA 2VZ6A 3EFLA 3ZFXA 4OTQA 1QL6A 3QD2B 3BEAA 4I6HA 4K9YA 4M15A 5FG8A 4AGCA 1QMZA 2QCSA 1J7IA 2OH4A 5AR3A 4ZIMA 4CRLA 5J1VA 3JS2A 3EQDA 2ONLC 3R00A 4A07A 3D4QA 3DNDA 3QHRA 4FTRA 5DFPA 3LE6A 2QR8A 4BCMA 3ZO3A 5IDPA 3L9PA 4AZWA 4EUTA 4C3PA 4J95A 4EH6A 3QRJA 3EWHA 3TUBA 4FV6A 3QTSA 4OTDA 4TWPA 4PWNA 3IPHA 4O6LA 3SHEA 4Q5HA 3DK6A 3NNWA 5F95A 5B7VA 4O7TA 3P0MA 3OT8A 5CASA 5CSVA 3R8VA 4QMZA 3F6XA 2V62A 1SZMA 4C3FA 3QTIA 4FEQA 4QYYA 4FOBA 5AM6A 4XG4A 4HGTA 3WF6A 1J1CA 3GFEA 4QMOA 4AE9A 4F9CA 3AC5A 3DLSA 3ORTA 3OMVA 2F49A 4D2PA 2PHKA 4FNXA 2JIUA 4HYSA 3RI1A 2E2BA 4IC8A 3CLYA 4L44A 3QUEA 3KMWA 4FV9A 4RVLA 3JY0A 1XBAA 1KV1A 5FBOA 2YA9A 2QKRA 2ZMDA 3HRBA 4U43A 3BKBA 4FKWA 4AZFA 4CQEA 4EOMA 2X7GA 3Q9ZA 3PIZA 5HNGA 4L52A 2PUUA 2R0UA 3W18A 1WAKA 3DDQA 5M4FA 3ENMA 4RIOA 2VX3A 3LXNA 2QOIA 4XOZA 1ZRZA 3LJ2A 4GK2A 4D4SA 4HCVA 3DBQA 1ZOHA 4GYGA 3W1FA 3V5WA 4CMTA 3PJ8A 5HX6A 4M0YA 3LCKA 3ROCA 4FNZA 2CNQA 2R3PA 2IZUA 3K5UA 3OTVA 1F0QA 3WF9A 4F4PA 3PXYA 4Z3VA 3ORMA 3OW3A 4FVQA 2X4FA 3T9TA 3L9LA 3FZOA 3QTZA 4S32A 2WMUA 3EQRA 3WF8A 2OJ9A 4NK9A 3MVLA 3KEXA 1GZ8A 1KV2A 5HVYA 3BHYA 2GNLA 2XIXA 2BIYA 2OU7A 5GJGA 2Z7LA 5DOSA 4FIGA 4DFBA 5H8BA 2UUEA 3K5VA 4HZSA 3KRJA 4WG4A 3WE4A 5C03A 3AC3A 3UQFA 3PFQA 3PXZA 1LR4A 4BIDA 1IRKA 3LMGA 2QVSE 2JIIA 1XH9A 3HYHA 3LOKA 5KE0A 4CCUA 4DH8A 3ORKA 5K4IA 3OWKA 4PL3A 5TR6A 2WGJA 1J91A 3IONA 4BGQA 3FQSA 3NUAA 2R3RA 2EB2A 4ALUA 3FAAA 3BU3A 2HAKA 4C34A 4RWIA 2UW8A 2PZYA 3NAXA 2HZNA 4HOKA 2JAVA 2C6DA 2G2FA 2VTRA 4IM3A 4YC8A 4FTTA 5FP6A 4YUQA 1OECA 4KKGA 1NVSA 2VGOA 4UWYA 4U80A 4L9IA 3SW4A 3VULA 2ZM4A 4C0TA 1OUYA 3GQIA 4M69B 4IZ7A 3UVRA 4FEVA 3FI2A 4X21A 3IDCA 4IANA 5H8EA 4BCFA 2CCHA 3FMEA 4DN5A 3E5AA 3VS7A 3Q04A 4IWQA 3DOGA 4RX8A 5LMKC 3SA0A 3ELJA 4ZJVA 4FSQA 3S2PA 4J53A 3MPAA 4FE2A 1FINA 4A4LA 2FO0A 4MD8E 3QC9A 1PMUA 4ZJIA 2DYLA 4ITJA 3W2OA 3SG9A 3N4TA 1L8TA 3PXRA 3BX5A 4DH3A 3UMWA 4I6QA 5AP1A 4CEGA 2WU7A 4BGGA 3Q9WA 3KRXA 3OTUA 5AUUA 2IVTA 2UZOA 3T8OA 3NYNA 3CSVA 1WFCA 4I0RA 4ZS4A 1Z9XA 3O50A 3ZYAA 2YERA 3IKAA 2R0IA 3QQHA 3VN9A 4YTIA 2UVXA 3FYJX 2QHMA 3L9NA 2QR7A 4EL9A 2V22A 4HYUA 2W7XA 2W5AA 4EC9A 3E8EA 2GPHA 4CZYB 2XCHA 5KMLA 3PUPA 3EZRA 4YZ9A 3I81A 3LAUA 4H3QA 5HG8A 1ZZLA 4EH5A 5HE1A 2A0CX 3W16A 5CSHA 4I20A 3DFAA 3K3IA 2QOBA 3FQHA 1JSVA 3DBEA 4GFGA 5CXHA 5J79A 2CLXA 2UZDA 5JQ8A 1XH5A 3QZFA 3B8QA 2IW8A 3KXNA 5LWNA 3CKXA 4AN2A 3W10A 4MXZA 3SV0A 4EK6A 4HVSA 2YJSA 1PMEA 5F9EA 3CIKA 4F9YA 4PPCA 3R2BA 3RAHA 4PMSA 1PRYA 4EUUA 3L8SA 5IQCA 1WBVA 2KTYA 4LUDA 3VWAA 3C50A 4FKJA 3ZMMA 5KCVA 4TL0A 4EKKA 5FGKA 5HO8A 5LXMA 3H9FA 2C69A 3DAEA 1PYEA 3RALA 2XK7A 4G3CA 2XRUA 2BKKA 2ESMA 3QWKA 5AUYA 3LPBA 4IFCA 4YJNA 3A4OX 3RVGA 4A9YA 3R28A 4IFGA 3WZDA 3ACJA 2YISA 3MB7A 4WNMA 5M4UA 4QYHA 4CT1A 1Q4LA 1KE5A 2GU8A 2V7OA 5HVKA 4ALVA 3UP7A 4FZ7A 5IKWA 4U3ZA 3ETAA 5GZ8A 1OL2A 3P79A 4P5QA 4PNIA 5ANJA 4YJRA 5KO1A 1PXKA 5FUTA 1NA7A 3EQPA 4FKVA 1Y91A 4CTBA 4DAWA 2XK3A 5CU0A 3GCSA 5ETCA 2Y6MA 5AAFA 3CJFA 3GB2A 3RAKA 3C5UA 2JC6A 5HLWA 3D5UA 4HGLA 4QMMA 4QPSA 5HU9A 2B0QA 1U54A 4RFMA 4N4SA 2PMNX 4M14A 4H3BA 1ZOEA 1LPUA 3GOPA 3Q5ZA 2P3GX 4D5KA 4RLKA 4QNAA 5IEXA 3R83A 4DT8A 5LJJA 5TT7A 5CAQA 2IZRA 4F99A 4FIIA 4YNEA 4MXAA 2JDSA 4RVTA 4HPTE 2VTTA 3QQGA 4BI1A 3MVMA 3NUSA 4YBJA 2E9OA 4B0GA 1CM8A 5LVNA 1LEZA 5K0KA 2CMWA 4K6ZA 1UV5A 4AW2A 2IZTA 2VTNA 3EZVA 1ZY4A 3FL4A 4I24A 4EZ5A 3SW7A 1XH7A 2P0CA 5B0XA 4BCKA 4C35A 4F9WA 3HMNA 4FT7A 4IM2A 3R7GA 5GIPE 1PF8A 4JS8A 2J7TA 5G6VA 5GINE 4XP3A 2OXYA 4EOSA 2GQSA 1GZOA 4QP3A 2YLEA 1P4OA 4D1XA 3QFVA 4RA4A 2CKEA 4FOCA 4GJ2A 4IWOA 2ITVA 3EYGA 4MTAA 2PY3A 2WQEA 4IC7A 2R7IA 3LMIA 4A4XA 2JKMA 4UZDA 1W7HA 4RLLA 2XYNA 4LGDA 5J5TA 3NLBA 2I0EA 4QP9A 2P33A 2XIKA 2ZDTA 4CZTA 3SOCA 3KC3A 4YZMA 2YM3A 4M66A 2UZTA 4F08A 3JY9A 3V5PA 4QTDA 3TNWA 3QALE 3FHRA 3D7TA 3UODA 4IMYA 4PV0A 3ERKA 4FTOA 4C02A 1H0VA 4NT4A 1ZYLA 3QHWA 2GS6A 3GUBA 4IJPA 3VBXA 2PVRA 3UPXA 3PG3A 3KF4A 4QMYA 1Q8TA 3W55A 4C38A 4IB5A 2VAGA 5KZIA 1ZYSA 3ZSHA 4XEYA 5HCZA 2C5YA 4W4XA 4BC6A 3H3CA 3EN4A 4I0TA 5EDRA 3MY0A 4DEIA 4HVIA 4FEUA 4M8TA 2VWYA 5HLNA 1PXJA 3HAVA 4AN3A 3B2TA 3FZ1A 4PDOA 4GYIA 4E20A 2ERZE 5CF6A 4BTKA 3R02A 2PVJA 4QMSA 5M06A 5EW3A 3ULZA 4M67A 4ERKA 2G2HA 3G6HA 4N70A 4FYNA 4JDJA 3A99A 3AC2A 5KBQA 3QTUA 2OXDA 4N0SA 5DI1A 3KL8A 1M2QA 4FKLA 4RX7A 4K1BA 3K54A 4RFZA 5JK3A 3CPBA 2YITA 2BAJA 2IVVA 3I6WA 3UBDA 2G1TA 3C4FA 2DS1A 4N6ZA 3E7VA 4U45A 2WAJA 4GU6A 4JAJA 1H08A 3QXOA 3T3VA 4BDBA 3TNIA 3MTFA 4O7VA 3VW6A 3VS6A 2J9MA 5EYDA 3RK7A 5A6OA 4PDYA 4QQJA 2ZV9A 4YBKA 1VZOA 2V7AA 4KKHA 5E92A 5JEBA 4AGWA 3L1SA 1JSTA 4E6DA 2BRBA 2ZM3A 5H2UA 2UZVA 3GGFA 3VIDA 3POZA 2ITNA 1U59A 4J52A 3RNIA 4QD6A 5JFXA 3NX8A 1OPLA 4YO6A 3WZKA 4CFMA 4CMUA 2X39A 4KS8A 2R5TA 4Q2AA 4EHVA 4NTTA 1OM1A 4YJQA 1IG1A 4EBWA 3POOA 4DLJA 4ZZOA 2NPQA 2QOOA 4CGAA 2VTQA 1SVGA 3GCVA 4X3FB 3DTCA 3PPKA 2C6IA 5AUVA 3W2SA 3KREA 2Q0NA 4U44A 3A62A 5T68A 2R3HA 2YM6A 3EB0A 3QX2A 3GC0A 4GMYA 2Y0AA 5FM2A 4TN6A 2P2HA 4UY9A 1I44A 4J98A 3BYUA 2ETKA 4IZ5A 5HIBA 3SOAA 5DN3A 3D2IA 2CNVA 5HBEA 5C4KA 3QRIA 3RPYA 1ZMVA 2C6OA 4IDTA 4R77A 5KMIA 3LJ1A 2X0GA 4ZTNA 2PMOX 3MPTA 3ZZWA 2R3IA 5GHVA 3S95A 1JSUA 3E64A 3LVPA 4BBFA 5HBJA 3ULIA 1YVJA 3F2NA 5CSWA 3A7IA 2P4IA 3H0ZA 4D4RA 4EORA 5CU4A 3LMHA 1PXPA 1Q41A 1Y8GA 2GFCA 4TKSA 2ITWA 4FKIA 4GS6A 3M1SA 1O9UA 4FV7A 1OPJA 5CS6A 4DCEA 2XNNA 1YXXA 1R1WA 4QP4A 3UIXA 2QQ7A 4OR5A 5CANA 3VUDA 3II5A 5J1WA 2BIKB 4FV8A 4XJ0A 4YHFA 3GOKA 1Q99A 3BYSA 4LL5A 2I0VA 3NVKI 2NO3A 3GCUA 4FTLA 3OROA 3CBLA 3PTGA 5H3QA 3LCDA 4IB0A 5D12A 4I6BA 5LWMA 3BWJA 3FL5A 2WTCA 4O22A 4K8AA 3PVWA 1OKZA 5E9EA 2XIYA 4IAZA 3KRLA 3QYZA 4CQGA 4NZWB 2YIXA 3ZC5A 2VWIA 3Q4TA 4B8LA 5HCYA 3KCFA 3IG7A 4HVHA 2YDKA 2ZM1A 5C8KA 3TTJA 4YGAA 4I4EA 3RCJA 5IEVA 1PMVA 4NKAA 2O65A 4P7EA 4TYHA 2XNGA 4V0GA 4MYGA 2R2PA 3U87A 2WMQA 4D5HA 3FMLA 4F7JA 4RJ4A 4S30A 5HG7A 2PULA 4U42A 2BZHB 1W83A 3HA6A 4JX7A 2IN6A 3GNIB 5M09A 5AV0A 2PZ5A 1BX6A 2WMRA 2HZ4A 5AP4A 5IQAA 5EHYA 5JQ5A 3OUKA 4H05A 4DFZE 4Y73A 1GNGA 2XB7A 3PPJA 4JBOA 4EH9A 3HDMA 5LMKA 3SXSA 3PLSA 5DR6A 4D1ZA 5EK7A 1YDRE 4PMMA 3UGCA 5L2QA 4ORKA 4G6OA 1H8FA 3LXKA 3A7FA 4EZ3A 1UNHA 5FXSA 4F0IA 2SRCA 3AT4A 2HW6A 4XH6A 3O7LB 2C68A 3E8NA 1QCFA 4FTJA 5EG3A 3DFCB 2PK9A 3A7HA 4KBAA 5KUPA 4XG8A 3C9WA 3CPCA 4TRLA 1OKVA 3NEWA 5FEEA 5L2IA 3I79A 2V5QA 3ANQA 3VVHA 4TYGA 3QLGA 4KKEA 3JVSA 4ZEGA 2I6LA 1QPCA 2B9HA 3HV6A 4CYIA 4NIFA 3R8UA 4EOQA 4XS2A 3BBTB 2RFNA 3HV3A 4E4MA 3KY2A 5CZIA 2X8IA 3RWPA 4PL4A 2O8YA 3BV2A 4F6SA 3ZBFA 4NUSA 3ZUVA 5E1EA 3PRFA 4II5A 3R1QA 1YXVA 3MJ1A 4MQ1A 3ZDIA 4ZTMA 3F66A 4EQMA 4PPAA 3E62A 5J7BA 3KN6A 5E8SA 2OLCA 2X81A 2BROA 3IOPA 3QQFA 4GFOA 2WPAA 2W9ZB 5FD2A 3ZO2A 1WBWA 2BAQA 2VGPA 2WMWA 1UU7A 2WU6A 2WTKC 1AQ1A 5LVOA 4F1TA 4XCUA 4YC3A 4GIIA 3RK9A 5K9IA 2C5XA 2UW0A 2PTKA 2QC6A 3ORZA 4HJOA 3CXWA 1JKTA 4O0WA 2Z02A 2YM8A 3KK8A 2F2CB 3R0TA 2PYWA 4YTCA 3O23A 4LMNA 4QTEA 4WKQA 4NM7A 2OWBA 1ATPE 3Q32A 5L8KA 4G9RA 2WMXA 4PPBA 4RA5A 1V1KA 4PQNA 2QOLA 3E8CA 1FQ1B 5C8MA 4MBIA 4MH7A 4CNHA 2XP2A 1R78A 3RBWA 1GY3A 5B2KA 1TQIA 3Q2JA 4FSYA 4B99A 3QA8A 2VWBA 2O64A 2J0JA 2XUUA 4J8MA 3MESA 4LV8A 3ZTXA 4AF3A 4KSPA 2ITXA 1M7QA 5M55A 1VEBA 4HCUA 4OAVB 2CHLA 4XBUA 4CFXA 4A06A 4ACCA 3FE3A 4KINA 3SAYA 2XNOA 4HW7A 3LM0A 3PXKA 4ZP5A 4NM0A 4PX6A 2HIWA 3CR0A 5DGZA 5LOHA 1EH4A 4JQ8A 5EM6A 1ZMWA 3JVRA 4YJOA 2CKOA 1YRPA 2YWPA 5BMMA 3MFUA 1OZ1A 3RTPA 4F0GA 3A7GA 3FXXA 1BMKA 3UZPA 4DEBA 4AA0A 1KUTA 4AW5A 3ZUTA 3N4UA 2UZLA 1RQQA 2HOGA 4IVDA 1J3HA 4TYHB 4V0GB 5IA1A 4CG8A 4BKYA 3NAYA 3PY3A 3Q5IA 4UMTA 3OCGA 3VUGA 5FXRA 5KMOA 1YQJA 4GRBA 1HOWA 3F3TA 3PA4A 4NL0A 2OJIA 4FV4A 2Z8CA 3OWPA 4O1PA 4ZJJA 5HX8A 5IU2A 2YCRA 3FXWA 4BTFA 2PMLX 3EN6A 3KVWA 2VTJA 3TV7A 4X0MA 3OCTA 2XK8A 4WIHA 1WVWA 2R3GA 1DM2A 2CGVA 3HUBA 4Y8DA 5J7HA 2P55A 4QP1A 3P5KA 2GTNA 1M52A 4EH7A 5AX3A 5C26A 5HTIA 3VF9A 3PYYA 4RWKA 4YSMA 5JH6A 5L8JA 2X8DA 2NP8A 2UVYA 2QKWB 4ZY4A 5D7VA 1ZXEA 2XKCA 1JKSA 3VRZA 4HZRA 3FI4A 3LCTA 5E90A 4GT3A 5JFWA 2C5VA 3FUPA 4MK0A 5E91A 3EHAA 5GZAA 3MDYA 1RJBA 3S00A 2F4JA 2OFVA 2PUIA 3A60A 2PVHA 5GJFA 4FUYA 5DWRA 4DHFA 2BRMA 3L8PA 4NIFB 1MUOA 2IJMA 4DEDA 2B1PA 3D15A 1IASA 1E1VA 3VC4A 3OW4A 3TIYA 3UIBA 2JFMA 2VO6A 2R3FA 3R01A 4QP7A 4AG8A 4U41A 4I5CA 4KA3A 2OJGA 4BCHA 2YAAA 2R9SA 5CEKA 3D83A 5AIKA 1OKYA 5EKNA 4IACA 5IQGA 2W4OA 3MS9A 4M12A 2I1MA 3UJGA 3PSCA 3NUNA 2A1AB 2JAMA 5E8YA 4ITIA 2W4KA 3KXXA 2X7OA 3QTWA 5ETAA 4ZZMA 4M69A 3IW8A 3RM6A 3UG2A 2IPXA 2OZOA 3KCKA 5HD7A 4CKIA 4GU9A 5HTBA 2WTWA 2XKDA 4CFWA 5DA3A 2O5KA 3NIEA 3PA3A 5AWMA 4EK5A 4B9DA 1ZY5A 5IH5A 4QP8A 3G6GA 4G31A 5LVPA 2I40A 4AA5A 1UWHA 5CEIA 5EOBA 2A4LA 4D2RA 5D10A 4FV3A 1DAYA 2VTPA 2W1HA 4FTIA 4M84A 1MRUA 4R7HA 2ZYBA 3AD4A 4TWNA 4AW1A 1GAGA 3NYOA 3PJCA 4DEHA 3VBTA 1UU8A 2XNBA 5K0XA 4GVAA 4TYIA 3AC8A 2OG8A 3DJ6A 4JVGA 3UIUA 4ANMA 1P5EA 3LXPA 2JBPA 4FL1A 4Y46A 4IAKA 3DKFA 5CSPA 1WCCA 4X2NA 2BAKA 4FG7A 5DEYA 4A4OA 4BYIA 2WKMA 3TG1A 4O21A 5JZJA 2J0KA 4L53A 5J5SA 3TNPC 2YN8A 3TKUA 3NVMB 4R7IA 2HWPA 4KSQA 4C4FA 4D2TA 2XH5A 3MYGA 4AZSA 3R8MA 2F7EE 3MGYA 3BIZA 4FTCA 3F69A 2UVZA 4E4XA 5EKOA 4ASXA 2I7QA 3PG1A 3U6JA 4IEBA 3DJ5A 3R7YA 3ZRLA 3FY2A 4EH8A 4F09A 2FUMA 2EB3A 2R4BA 2GNHA 4X6RA 5IA3A 3R7EA 3NNVA 4X3JA 3KN5A 5FXQA 4RC3A 3V8TA 5FEDA 1G5SA 2IW6A 3EMGA 2EXMA 2WD1A 3LQ8A 4DEGA 3SD0A 4NCTC 2CJMA 3VBVA 3ZRMA 3QRTA 4BWXA 1JNKA 2YHVA 2C5OA 5HLPA 4E6CA 4OAUC 2BFXA 4O7RA 1REKA 2X2KA 3OOGA 4UYNA 5D7AA 3N51A 4Z7GA 4FK6A 2GNGA 2BHEA 2H9VA 3GFWA 1XWSA 4L46A 5AV2A 3LW0A 4I4FA 4AX8A 4IDVA 5IUIA 2XKFA 4AU8A 5EQYA 1OGUA 3HNGA 4YJPA 4XLIA 5BYZA 1CKIA 5K3YA 2ITZA 3LFFA 1M7NA 5HU3A 4U0IA 4D58A 2XJ0A 4M13A 1TVOA 5E7RA 5EM7A 3V04A 3VJNA 3LCOA 1R39A 4QMLA 2A27A 3PJ1A 1KOAA 3LJ0A 2J6MA 4L3LA 2X7FA 2O0UA 1Y8YA 3OCBA 1XH8A 3MFRA 3G9LX 2QOFA 3HV7A 2EUFB 1ERKA 5IH6A 3FV8A 1WBNA 5HO6A 3NCZA 4OTRA 2VN9A 3FPQA 5IA0A 4F1OA 5EHOA 4EK3A 4EYJA 4P5ZA 2W1IA 1JAMA 1WBPA 1T45A 2EU9A 3KFAA 4OT6A 3KQ7A 3BZ3A 4DYMA 4EWHA 5HZNA 5L6OA 3SRVB 4HNIA 2WOTA 3ZM9A 3OHTA 5HI2A 2GNJA 5DR9A 4TNDA 4FZAB 4JXFA 4XHKB 5LMAA 4O2PA 5J9LA 2HCKA 3SDJA 4O7YA 3A61A 3NNUA 1XR1A 3UOLA 3UOJA 4TYEA 5JRSA 4WNPA 2WTVA 1XBCA 2VWWA 5JZNA 1W84A 4E4LA 5ANOA 4JNWA 2NNWB 1Q3DA 4MXCA 3TUCA 4AOTA 4NFNA 3PIYA 4JDKA 1Q24A 3TKHA 5CEMA 2GS7A 3WIGA 5BVFA 4C8BA 3KRRA 1SNUA 4PTGA 4EHEA 5I4NA 3ZO4A 2R3NA 4CRSA 4CYJA 3TNHA 2WMSA 2HWOA 2ZB1A 2VD5A 3MB6A 3MI9A 4G3EA 4A9RA 5M07A 3OWLA 1DI9A 1BL7A 3MWUA 4G16A 4NM3A 2OF2A 4CV9A 1OIYA 1HCLA 1PKGA 3R30A 3IW4A 3E93A 5LARA 4JI9A 4YTFA 5C1QB 1K9AA 4RVMA 5AP6A 4MXYA 3CQUA 2GNIA 3TUDA 4DE4A 4W9XA 2BDFA 1V0OA 2J0IA 4FV0A 4CFUA 4IJ9A 3DAKA 4E5WA 1H1SA 4IVBA 3UDBA 3SC1A 4DFNA 3FHIA 4TY1A 4IX4A 3R73A 2CGXA 4K77A 2CN5A 3DLZA 5J9YA 1G3NA 4O0RA 4G34A 3AC4A 4AWIA 2OJJA 3B8RA 3G5DA 3ZSGA 4I92A 4K33A 4LV5A 5BUEA 3C0GA 3C5IA 4X2KA 4JRVA 1W8CA 2ETMA 4GEOA 4P2KA 4LRJA 4MNFA 4U3YA 1CDKA 1XKKA 3HV5A 5KZ0A 3COIA 3P7CA 5H8GA 3C1XA 3NW7A 3WF7A 1O6LA 3ZU7A 3RKBA 4MWHA 3FKOA 4WRGA 2FYSA 4CV8A 4X2JA 4MWIA 3QYWA 5ACBC 4O0SA 4PL5A 3A4PA 5BYLA 1FGKA 2QHNA 2H8HA 2UZNA 4DBNA 3QAME 3TZ8A 5I9VA 4G17A 4ENYA 2W99B 3GI3A 2NRUA 4GJ3A 2PMIA 4CFNA 3LZBA 4FKUA 4U5JA 4E3CA 3O8TA 3M11A 3MA3A 1H07A 3I6UA 4G3FA 4O1OA 4X6QC 4BDGA 4EHZA 4JG8A 3DBCA 3IGGA 4WBOA 4MBLA 2C0OA 5E4HA 1JOWB 3FKNA 1ZZ2A 3E7OA 5IH4A 5HE3A 5K4JA 5IUHA 3KMMA 3PSBA 4TW9A 2QLQA 4UMUA 4JX3A 2A2AA 3LLTA 3FPMA 3OXTA 4XBRA 1FBNA 5BX0A 2QLUA 1OBGA 4V05A 4ONAA 1XO2B 4YZDA 2VX1A 4UZHA 4C57A 4K2RA 3U9NA 3WE8A 5HHWA 1H4LA 4U40A 2WMVA 3SXRA 5L2WA 4DTBA 3VS4A 3OY3A 3Q6WA 4CKRA 2FGIA 3NWWA 4YJTA 4D2SA 4GUBA 3HL7A 4CCBA 4FF8A 4ZOGA 2H34A 3U4UA 3K2LA 4C3RA 3UP2A 2FB8A 4KIKA 4EONA 1QPEA 5CVHA 4ZTHA 2J0LA 2QOHA 3DK7A 4FUXA 4LRKA 4RQVA 3UNKA 2XBJA 4MBJA 1OIUA 4EBVA 4FA2A 3CJGA 1YI3A 1W82A 3EKKA 2BKZA 2QOKA 4XG6A 3S3IA 4LI5A 4XRLA 3Q52A 3OC1A 4BY9E 5DLSA 3V5LA 3WI6A 4X3FA 2XNPA 5M51A 5DYJA 4XP2A 3C4WA 4BDDA 2ACXA 2DQ7X 1O6YA 3C4EA 4AE6A 5ITAA 1LP4A 3F82A 4HNFA 4MNEA 5EW9A 3RPOA 5I0BA 5IA2A 2JEDA 4L3PA 2Y8OA 4H1MA 4I23A 4TWCA 4O83A 1KOBA 4DGMA 4IQ6A 2OJFE 5CY3A 1JWHA 3GENA 2GS2A 4QMVA 2JKOA 3ITZA 1YWRA 3E92A 4O0XA 5TO8A 4EQCA 3DB6A 1UKHA 4NJ3A 4UYAA 1OITA 4E5AX 2C5NA 2J5FA 4EOOA 2Y4PA 1MQBA 3PE2A 4QYFA 3EL7A 5T6KA 5BNJA 2G9XA 4PMPA 3FSKA 1M2PA 3MPMA 3TKIA 5IMEA 4IX6A 1PMNA 4RSSA 3DQXA 3GEQA 4FSMA 4QMUA 3DV3A 3M2WA 2HW7A 4FNYA 5HE0A 3NGAA 5LVLA 3RK5A 3ZLXA 4D0WA 4E4NA 2VTLA 3R7VA 3DXQA 5AV3A 3IQ7A 3SKCA 4D2WA 4KRDA 4FEWA 4DH7A 3EQFA 4F65A 4KABA 5IQHA 2F2UA 1URCA 4I21A 3C4CA 2OW3A 3NW6A 5D41A 1JLUE 5BVKA 3G51A 4MEDA 3C0HA 4BHNA 2YCQA 3I1AA 2R3LA 2ZDUA 1Q62A 3MH2A 4GIHA 2G01A 2Y6OA 2OIBA 4G6NA 4UXLA 4ENXA 2E9UA 3WILA 4M68A 2ZV7A 3MH0A 4D9TA 3PRIA 4R5YA 3VUMA 5HD4A 1V0BA 3DY7A 3SXFA 2QOCA 5C01A 4BTMA 3VBQA 2GHGA 3QD3A 1W98A 3FQEA 1Q8UA 5E8XA 2OF4A 4DFUA 2C3LA 3AGMA 3NW5A 4JIKA 4RJ6A 5CENA 3EFJA 2PVLA 3RINA 4ZTRA 3BV3A 3HMIA 2DWBA 1STCE 2W1ZA 3MVHA 4ZS0A 2NRYA 2OO8X 3VBYA 4ARKA 4USFA 4RRVA 5L2TA 5HESA 4IIRA 4FYOA 2JDVA 4EOIA 3EQHA 3DNEA 4LGHA 4QYGA 1BKXA 2XBAA 2HXLA 3UVPA 3DCVA 4FEXA 5KMMA 3DPKA 3PXQA 4HPUE 4LOOA 5DT3A 3VRYA 4R5SA 4EOPA 2C1BA 1OBDA 1H01A 1SNXA 4YZBA 4FKGA 4QRCA 5FTQA 3R8ZA 3ALNA 3MH1A 2AC3A 2VTIA 5F1ZA 5I5ZA 4WBBB 3QQKA 5CT0A 2WTKB 2RFEA 2VX0A 3BWFA 4DLIA 5IG1A 3F88A 4XLVA 4UMPA 1RDQE 3BGZA 4F6UA 4FI1A 1U46A 4L01A 3LM5A 4FL3A 3E87A 4Y83A 3ORPA 4DTKA 4JBPA 5I3RA 3LQ3A 3L8XA 4D1SA 4JIAA 3HP5A 1KE8A 3WF5A 5M44A 3F5XA 4EH2A 4D4YA 3GXLA 3D14A 3QGWA 3TJDA 2CKPA 2X1NA 4TT7A 2QI8A 1K2PA 2Z7QA 2QODA 2ONLA 3BHHA 5J8IA 3ZH8A 5IISA 3HEGA 2GHLA 5DNRA 5FTOA 3GU7A 4FT9A 4ZLOA 5AFVA 2J4ZA 3P08A 3VHKA 3Q96A 2CLQA 4KIKB 4B8MA 4BFMA 4OBOA 1ZAOA 1KSWA 5FM3A 4TWOA 3F61A 4XG3A 2X8EA 4GT5A 4DFYA 4YP8A 4F63A 5CQWA 3QZGA 3W2QA 3QX4A 4RPVA 3SLSA 3UNJA 3NNXA 2Z7RA 5TF9A 4MX9A 3CE3A 2RFDA 2R64A 4IAYA 3TWJA 1M14A 2PZRA 3BGPA 2Q0BA 2RG5A 3NMUF 4MNEB 4KBKA 4ZSAA 5BQ0A 4ZSGA 4XNEA 2W0JA 1PJKA 4O0VA 4FK3A 2PWLA 5E8VA 5A4TA 5AUTA 1R3CA 2J50A 4FT0A 3WZEA 1RE8A 2BILB 2UW7A 3LIJA 1W0XC 1YXTA 3D5XA 3FZPA 4AT5A 3I5NA 2JITA 2YDIA 1Q8WA 2GTMA 1BUHA 2W96B 4FT5A 4FIHA 4AFEA 2VU3A 4IB3A 4QP2A 4NCTA 4QMNA 3ORIA 4AZTA 5M08A 5DEWA 1PKDA 4G3GA 2O2UA 3QCQA 4F6WA 2JDTA 3ZCLA 5AAGA 4WHZA 4OTIA 2W05A 5BVWA 3V8WA 5E8WA 5JGBA 5KKRC 1QPJA 3KVXA 3OCSA 3VS0A 5IA4A 1AD5A 3LFCA 3H9OA 3O8PA 5A4LA 2W1FA 3BLRA 3F5GA 4JJRA 1JVPP 1YDSE 2PE2A 4JR3A 1F5QA 3REPA 4UBAA 5CLPA 3RHXA 3RPVA 1UA2A 4AOIA 5J9ZA 4L7SA 3R7UA 2YIWA 3M42A 3NUXA 3RWQA 4O0YA 3KF7A 4QMTA 3ALOA 1A9UA 4JL9A 3QA0A 3BQRA 2Y9QA 3FC2A 4FKRA 2QNJA 4DT9A 4GFMA 3LFQA 4I5PA 4IWPA 1SYKA 3EN9A 3EYHA 4APPA 3VS2A 2WTJA 1IAJA 3PA5A 3JYAA 3S4QA 1NXKA 1J1BA 3RAWA 4WD5A 4AP7A 4QTCA 3KGAA 5IZFA 4IX3A 3RHKA 5DT4A 5JFSA 4BDAA 3GC9A 4BDEA 5A54A 2GDOA 4OTGA 2VWUA 2OIDA 3QCYA 3LHJA 3ZOSA 4B6LA 4C33A 2ZJWA 4WG5A 2WXVA 3FMJA 2KULA 5ANGA 4I22A 5IA5A 2BZKB 3OXZA 3OY1A 2QO9A 2R3JA 1KE6A 3Q4CA 2LGCA 5GJDA 4O81A 1OL5A 3VAPA 3TDVA 3ZEWA 3MVJA 2QU5A 1FOTA 2WEIA 3I5ZA 1YOJA 1R0PA 5CXZA 3QBNA 2GHMA 3VS1A 5E8TA 4QYEA 5DRBA 4H36A 3AMAA 4USEA 1CTPE 3AG9A 4W4YA 2IVSA 4RFYA 4FKTA 5JFVA 4MAOA 2BRNA 3LLAA 4JDHA 3CTJA 3VS3A 3ZONA 4X7QA 3SGCA 3ROYA 4RIXB 4L42A 1WZYA 3ATTA 4GH2A 3QF9A 3BYOA 3IGOA 4FR4A 4UALA 3TIZA 4BBMA 3P78A 2XM8A 2OI4X 4RBLA 3NUPA 2PPQA 4ZY6A 3AGLA 4XX9A 1GOLA 4ACGA 4E26A 3P86A 4P90A 4BF2A 4CKJA 2GQGA 2IVUA 1GIHA 2Y4IC 3KA0A 3FBVA 5IEYA 2QO7A 4E1ZA 2I0YA 3DBFA 3MBLA 4YLLA 3HAMA 4BIEA 3FI8A 2PVNA 2B9JA 4GG5A 5AR4A 4DFLA 3BELA 3TV4A 5CTPA 5C8NA 3C51A 1RW8A 4AAAA 3CY3A 1ZARA 3R22A 5CAPA 4XRJA 5TE0A 4ZSJA 3QLFA 1A48A 4ZXTA 3O0GA 1UVRA 3U4WA 2YM7A 3RAIA 4FGBA 4CLIA 3N4VA 3QD4A 3R9HA 4U6RA 3QKLA 2W06A 4ZAUA 3UQGA 3ZM4A 3LFSA 3QXPA 2PE0A 5IQBA 5BVEA 5CX9A 5GNKA 4F64A 1OI9A 3DZQA 3ZXZA 4Y5HA 5FDXA 4C59A 3W2CA 2JDRA 4Z7HA 1GJOA 4F9AA 3GVUA 4AFJA 4CSVA 4L45A 4CG9A 4OBQA 2CKQA 4EJ7A 4J7BA 3WARA 3EQGA 4GG7A 5E8ZA 4ZSEA 5JKGA 2XEYA 5BMSA 4O84A 3GBZA 3ZUUA 5KMKA 1NT2A 4ACMA 4EOKA 3JUHA 4JBQA 4E6QA 1YOLA 4FSUA 4J97A 1CKJA 4M3QA 3D9VA 3UE4A 3BLQA 2F7XE 4BIBA 4RWLA 4I5HA 4EEVA 2WIPA 1LEWA 5BUJA 1FMOE 1H26A 1MRYA 4DGNA 3VQHA 4DGOA 5AX9A 4R3CA 3MFSA 2CGUA 4FKOA 4YZCA 4YLJA 5EOLA 2PU8A 3E3PA 3FMHA 4WRSA 3W2PA 4C62A 3FMDA 4O2ZA 4OW8A 2B52A 3TDWA 1FVTA 3HKOA 5F4NA 2BFYA 3C4XA 2WTIA 3EL8A 3PWYA 2UZUE 3PZHA 2BZJA 2G2IA 2W5HA 4U79A 4C36A 4DG2E 4Q9ZA 4S33A 1APME 4S34A 3V5TA 4AUAA 4CMOA 4NW5A 4RX5A 2E9PA
chains in the Genus database with same CATH superfamily
4BB4A 1XQZA 5AP5A 2O3PA 3TXOA 3GU5A 2YIQA 3KXZA 5M4IA 4L67A 4KIPA 3TV6A 1OB3A 2PSQA 3W33A 5AADA 4BI2A 4BYJA 4C58A 3I0QA 4EHGA 3V5QA 3CKWA 4W9WA 5B2LA 3I60A 4QO9A 3AD6A 3QGYA 4D2VA 1KWPA 3FY0A 3IECA 2BTSA 2XNEA 5A4QA 5L2SA 2WEVA 3EFKA 2Z2WA 3PPZA 4QQCA 3COMA 1M2RA 4OLIA 2J0MB 1NY3A 5AR5A 3WYXA 4OUCA 3QZHA 3HZTA 5A4EA 2OICA 4BZNA 1Y6AA 4FKSA 5G1XA 1GIJA 2CDZA 5DT0A 5AP3A 3TJCA 3TACA 4ANOA 4RZWA 2Q83A 3PP0A 4RIWB 3O51A 2BDWA 2OZAB 3OEZA 3EIDA 4BBEA 4LFIA 3HV4A 2ITTA 4MCVA 5CT7A 1T46A 4MHAA 3T3UA 4FMQA 4NU1A 4LG4A 4Z9LA 3DZOA 4U8ZA 4EK8A 4FV2A 2X2LA 3GCPA 4MD9E 4YTHA 1VR2A 4A7CA 5M53A 3D2KA 2WOUA 5IUGA 3Q9YA 4DHIB 5HEZA 4CTCA 3F3ZA 5EYCA 1XH6A 1F3MC 1IAHA 5JRQA 1G8AA 3F3VA 4ZMEA 4W8DA 2QURA 4QEBA 5F20A 4BDCA 2VWXA 4UMQA 3VJOA 3SRVA 4XG7A 3FMKA 2OBJA 2JLDA 4QNYA 4BHZA 3RZBA 4DH5A 3S0OA 4FTMA 3ZS5A 3DKGA 2VO3A 5TKDA 4ANSA 2VRXA 3QL8A 4F70A 4KIQA 3LFNA 4BKZA 1K3AA 5HIDA 4FZFB 3RM7A 1Q3WA 4U81A 3ZLYA 4N6YA 4WO5A 2VTSA 1JKKA 4I93A 3WYYA 5CNNA 4AN9A 4QQTA 4DDIA 4WG3A 3R1NA 4Q9SA 2A19B 1B38A 2XVDA 5EQPA 3R9RA 4BN1A 4EQUA 3EN5A 4R6VA 2WHBA 2RKUA 4BL1A 4FSNA 5JN2A 4UWCA 3R21A 3A8XA 4FG8A 4P4CA 2VV9A 1G8SA 1I09A 5ANDA 4C4JA 1Z57A 2C0IA 4I3ZA 3CQWA 2XM9A 4RX9A 3ZO1A 3FLSA 5CF4A 2YFXA 4L7FA 2WFYA 4MD7E 4QMWA 5AV4A 3DXNA 1UNGA 4DHZA 3CTHA 3FXZA 1FMKA 5M4CA 5EDQA 2VWVA 2IWIA 5CU2A 5A9UA 5F94A 3NRMA 2ITOA 4DEAA 3CEKA 4GK3A 3R8LA 2W5BA 3U51A 5EYMA 1OL1A 3EN7A 4MXXA 5AP7A 5I9XA 4FZDB 1Y6BA 4QTBA 3H10A 4Q5EA 1YOMA 3IOKA 4OTWA 3W2RA 3RP9A 3O7LD 4OTFA 4LOPA 3AOXA 5DR2A 2PUNA 1YW2A 4YNOA 3BCEA 4ACDA 4FKQA 3JR1A 3BQCA 4RIYB 4PF4A 4FIFA 4ANNA 2BALA 4K18A 4GL9A 3UOHA 5BVNA 2ITYA 3PE1A 4GSBA 5KNJA 4O82A 1UWJA 4YO4A 2R3KA 3CP9A 2FH9A 5AV1A 2GQRA 2XARA 3HP2A 3PJ2A 3PLAE 3BLHA 3W8LA 3A8WA 2PZIA 3W8QA 2VO0A 3NS9A 2UZWE 3LXLA 4JT3A 4IWDA 5LCJA 3MY1A 1P4FA 3PWDA 4R7BA 3Q4UA 3QD0A 2BCJA 5A6NA 5M57A 3UDSA 2R3OA 5DPVA 4QDEA 4PDPA 1H00A 3GT8A 5BYYA 3OT3A 3HLLA 5I9WA 5ETIA 4CFFA 2ITUA 2BPMA 4GVJA 3R9NA 2WMBA 3TM0A 5JGAA 5CNOA 1PYXA 2FA2A 4WNOA 3TMOA 2XJ1A 3IDBA 1JKLA 2PVYA 4BCQA 2RIOA 2W1CA 2WQBA 3VONA 4UX9A 4F0FA 4G5JA 5CZHA 2WQMA 2WQOA 3V51A 3AQVA 4AXFA 4JOAA 4C2WA 4AXCA 4UN0C 4W4VA 3VUTA 5CF8A 3R63A 3A7JA 3KIOC 3TZ7A 3G0FA 3QUPA 4PNKA 3NZ0A 3R6XA 2C3IB 2EXCX 3Q6UA 4WUNA 5K5NA 3U8WA 2CN8A 1SVHA 4Y5QA 5FP5A 3G33A 3FLYA 4D0XA 4IH8A 4W8EA 4R1YA 5AIRA 3QU0A 5K5XA 2OFUA 3AC1A 4YPDA 4L68A 3F5PA 3D5WA 3L9MA 4G2FA 4EOLA 3MV5A 4NSTA 4RC4A 3MY5A 4Y72A 4HYIA 3V6RA 4QOXA 4CT2A 1UU3A 3T9IA 4QMPA 3QRUA 1XH4A 1XJDA 3OBGA 3ZFMA 3PVGA 3DKCA 3HA8A 4QP6A 4EWQA 4BWKA 4R78A 3FSFA 2V55A 5CSXA 3KXGA 2WQNA 2Z7SA 4LRMA 4IZYA 2IG7A 3MH3A 3QTRA 3FI3A 4NWMA 1U4DA 5FWKK 3KULB 4DC2A 4OGRA 1Q61A 1A06A 5DHJA 5I9ZA 4C7TA 2WTDA 2ITQA 3IW6A 2R3QA 3PXFA 4MXOA 2UV2A 1YKRA 3DGKA 4ZLZA 5HICA 3NUYA 5LMBA 3DDPA 2GMXA 3C0IA 3G90X 3AMYA 3GC8A 4JG7A 4KBCA 4LQMA 4FG9A 3EKNA 4BICA 4PMTA 2UW9A 4QQ5A 1S9IA 2FSOX 4BTJA 3NIZA 5HGIA 4C4EA 4AS0A 2VNYA 4G9CA 1HCKA 1B39A 3PVBA 1Z5MA 3UDZA 3Q3BA 4FIJA 3VUIA 4JAIA 3ATSA 2YACA 3UC3A 3VO3A 4YU2A 3Q4ZA 1Q8YA 3Q2MA 4IAFA 4R3RA 3EFWA 5EYKA 3R9DA 4B4LA 4UMRA 1JPAA 4AGDA 2X6EA 3TL8A 2W1DA 3Q9XA 3FLZA 3HMOA 3D5VA 4MF0A 4LDTA 3FWQA 1FPUA 3O17A 2XEZA 4S31A 4WA9A 4FTAA 4ANBA 3UO5A 3O8UA 4PP9A 4TZRA 4F1MA 3DXPA 2F7ZE 1ZOGA 3ENHA 2QO2A 3R04A 3ZLWA 5CALA 2I0HA 3MSSA 3ZLSA 4AZEA 5ANIA 3KU2A 4E93A 2JFLA 2JBOA 4ACHA 5EFQA 1WVXA 2BR1A 2C0TA 5J95A 2XK6A 1UNLA 1X8BA 3NYXA 3ZC6A 4EC8A 1PXLA 3PSDA 1NW1A 1H24A 1H27A 4CZUA 4S2ZA 4ZY5A 3UPZA 3O71A 5BV3A 3ZFYA 3BHUA 4KNBA 5AA8A 4FICA 1MRVA 4J71A 1ND4A 4O7SA 2JKKA 4UV0A 3HRCA 1OKWA 5L6WL 3AD5A 5AJQA 4FSTA 2XNMA 3GP0A 4WSYA 5HIEA 3EH9A 5HO7A 3IK3A 4FC0A 5D1JA 1MQ4A 4DITA 4BZOA 4XV2A 4RG0A 4E73A 2J51A 3OZ6A 1WVYA 4L00A 2OK1A 3VHEA 2H96A 1TQPA 4ZZNA 5A46A 5LQFA 1OVEA 4O7WA 5I3OA 1TFFA 3QC4A 5DVRA 4O86A 4TYJA 3I7CA 3OWJA 3VS5A 2E9VA 4CD0A 5BVDA 4BDIA 3V5JA 1BI7A 4I94A 4QTAA 5CI6A 2BVAA 2VTOA 4DCAA 2RSVA 2HK5A 1Q8ZA 4RWJA 5KKRB 1TZDA 2WB8A 3RMFA 3HECA 1IA8A 5AEPA 5B2MA 3ACKA 5EW8A 2RFSA 4O7NA 3VUHA 3CGFA 4FIEA 3IS5A 1FGIA 3NR9A 3ORLA 4ZTLA 5AA9A 5AAEA 4G6LA 2QD9A 2XK4A 3MA6A 2YEXA 2YM4A 2XF0A 2C47A 4O6EA 3TTIA 4LGGA 4QPMA 3DQWA 3R7OA 4BCPA 2C6EA 4RMZA 4DGGA 2UW4A 3QKKA 2JD5A 5EI8A 5L8LA 3V01A 5FLFA 3RCDA 2XYUA 3QRKA 4NJDA 2LAVA 3H9RA 4AXAA 4I5MA 5BUIA 4L43A 2VO7A 3UVQA 4YMJA 2C30A 5KMNA 2OIQA 3COHA 4QPAA 4F9BA 4FTUA 3TEIA 3HGKA 4DG0E 2ZV2A 5CI7A 3DB8A 4I41A 3LFAA 4G3DA 3MIYA 3O96A 2YCSA 2B9FA 2CCIA 2Z60A 4H39A 4A9UA 3WOWA 4EKLA 5HQ0A 2XKEA 4ERWA 4DF3A 3BU5A 5CEOA 2UZEA 3I4BA 3UYTA 3F2AA 2X0PA 4YC6A 4HCTA 4E8AA 3TN8A 3U6HA 4N57A 3PVUA 3G2FA 3HX4A 4PDSA 3BPRA 4JLCA 3E8DA 4RQKA 4ASEA 3KB7A 5HCXA 4OBPA 1ST0A 3D7ZA 2ETRA 1GZNA 4R3PA 4RJ5A 3COKA 5CVGA 1CMKE 1OMWA 3K3JA 4QMQA 3BHTA 5JSMA 1PY5A 4AGUA 4USDA 2W1EA 4DINA 2IW9A 3FYKX 5FTGA 5AMNA 1WMKA 4B7TA 1O6KA 4G1WA 4HYHA 1XHAA 5EQEA 5HORA 4NFMA 1WBTA 4JQ7A 1VLRA 1M17A 3BHVA 4LMUA 4U7ZA 4WT6A 3QUDA 4MQ2A 3FDNA 2QOQA 4LOQA 2Y7JA 4CLJA 3C4ZA 3R71A 5HVJA 3GU6A 2F57A 2J90A 3NCGA 1YI4A 2R3MA 3P7BA 3R1SA 1H25A 2G15A 3V8SA 4YURA 4EH4A 2UW3A 1ZYDA 2B53A 1H1WA 2RL5A 2WZJA 2XAMA 3F2RA 2C1AA 4UEUA 4XP0A 3R7IA 4YSJA 4M7IA 4FNWA 4KRCA 1KE7A 5A3XA 4EK4A 5AUWA 1ZLTA 4ANQA 1OL6A 1GIIA 1TKIA 2Y4IB 3KKVA 3E63A 3RZFA 3FMNA 4YR8A 4Z55A 2F9GA 2W9FB 4PUZA 4RJ8A 2HXQA 2IF8A 3EQIA 4UB7A 4BCGA 3FEGA 3FKLA 4Y85A 3S1HA 4R8QA 4FSWA 4JBVA 2IZSA 3FZRA 4EJNA 5CU6A 3ORXA 5CVFA 3VF8A 3WIKA 1PXNA 5HE2A 4C2VA 5ETFA 3OFMA 4M97A 3GC7A 2BMCA 5HG5A 3UZTA 1U5RA 1E9HA 3BE9A 3FZSA 3I0OA 1DS5A 2WNTA 4D28A 3DK3A 3IW5A 4F7LA 4MKCA 5FQDC 4QMXA 4JG6A 2HYYA 3FZTA 1IA9A 1UU9A 4RT7A 3LKMA 3C13A 3LFBA 3WBLA 5D9HA 4IB1A 3QWJA 1SMHA 1VYWA 2WELA 3FLWA 2O63A 3NSZA 3ODZX 2PVKA 4J96A 4K11A 5CEPA 5JGDA 3BYMA 3U55A 4YJVA 1XBBA 5DRDA 5A4CA 3P23A 4IZAA 3RPSA 2IO6A 4XV9A 4XOYA 2EXEA 5IMXA 4RIXA 1SM2A 1V0PA 1OPKA 2HZ0A 5L3AA 1J7LA 2ZV8A 3GU4A 4I6FA 3DA6A 1JBPE 5CAVA 2OH0E 2AQXA 4XG2A 3QQLA 3OG7A 2CSNA 3BBWA 4TPTA 3H0YA 3VBWA 1BL6A 4GV1A 4IVAA 4ASZA 1R0EA 1PW2A 1H0WA 2YM5A 4AXEA 1ZMUA 2WMAA 3OOMA 2B55A 5M56A 4F78A 4C4IA 2W1GA 3OP5A 1IEPA 2YLFA 4JR7A 2RGPA 2W4JA 3RJCA 4KB8A 1YHVA 3C7QA 4XYFA 5EI6A 4A9SA 4DGLC 2OXXA 4GUEA 1FVRA 1OUKA 2C4GA 3F7ZA 4NEUA 4NTSA 4BWPA 2X4ZA 2YCFA 4LM5A 5D11A 5T3QA 2REIA 2HY81 2XIRA 1H28A 1QPDA 1YXSA 4O27B 1U54B 2XZSA 5CU3A 2VTMA 5FRIA 4ASDA 5HTCA 4BDHA 1WBSA 5AM7A 4BR3A 2BRGA 3R1YA 4MF1A 2PVFA 4FTNA 4YHTA 3RGFA 3NDMA 5A14A 3I7BA 1PXOA 3UQCA 3CY2A 3E3BX 3AMBA 1BYGA 1PXIA 1CSNA 3F3WA 3PY1A 3SX9A 3UOKA 3V3VA 4YJUA 3LFDA 3KXMA 4GKHA 4EZ7A 2YWVA 3NUUA 3BU6A 3B2WA 4RGJA 2C6TA 4IX5A 3WZJA 4A9TA 1Y57A 2OGVA 5L4QA 2BUJA 4DH1A 5KMJA 2E9NA 5ACKA 2PL0A 4KD1A 3G0EA 4D9UA 4L8MA 5EM5A 4BVUA 1MP8A 1P14A 4FT3A 2VTHA 1JQHA 3G15A 3IO7A 4RZVA 1VJYA 4BDJA 4ZSLA 4XV1A 2XANA 2XIZA 4L3JA 3QTQA 3UMXA 4IADA 2FSTX 5CEQA 5JT2A 5FEQA 3BE2A 2AUHA 3OXIA 4O0UA 4QT1A 4WOVA 3HVCA 2OKRA 4TXCA 5C27A 4CXAA 4FTQA 2XS0A 3QKMA 4AACA 1OL7A 2X9FA 1U5QA 4FZ6A 2BRHA 2FSLX 3KMUA 1PHKA 1PXMA 2W17A 3SG8A 4NH1A 4BCOA 4AOJA 3H4JA 3D7TB 2GCDA 3PP1A 5IPJA 4EYMA 5L6PA 4FV1A 2X2MA 3VW8A 3LCSA 2ZAZA 3VNTA 1LUFA 5HBHA 3UNZA 2JIVA 2FSMX 3DBDA 2YIYA 1URWA 3NPCA 1YXUA 4DFXE 4AW0A 4C4HA 4FVRA 3IW7A 3KK9A 3UC4A 4NM5A 5LCKA 3BI6A 2ZB0A 4CVAA 4E7WA 4XG9A 2PE1A 4L6QA 3JPVA 4U97A 1IR3A 5DE2A 4BDKA 1H1PA 4KS7A 2EVAA 3ZZEA 3CQEA 4D4VA 3NYVA 5DH3A 2J2IB 3V6SA 4BCNA 1WBOA 2X6DA 4J99A 3HMMA 3DKOA 4WSQA 4YPSA 4IVCA 4PTCA 4HGEA 1NVQA 4DG3E 3EQCA 4RIWA 3CD3A 3DJ7A 4J8NA 2OZAA 4K0YA 5KHXA 4KIOA 3KRWA 2YAKA 4DA5A 4E6AA 5IDNA 1J7UA 4OTPA 3SQQA 3A2CA 3TZMA 3UG1A 4RJ7A 3FJQE 4FVPA 2B7AA 4KWPA 4GW8A 2ZMCA 4H58A 4RJ3A 4TTHB 2RG6A 4NYEA 1S9JA 2C6KA 3DU8A 4WNKA 1W2FA 2HZIA 4IBMA 3R8PA 4BRXA 1BLXA 5IQDA 4IAIA 5H9BA 1YWVA 4I0SA 4FSZA 3ZXTA 4AT4A 4F7NA 5IQIA 4O96A 3BYVA 4PTEA 2YZAA 3FC1X 3U9CA 4PRJA 4YHJA 5AUXA 5DMZA 3G9NA 5ICPA 4XUFA 2AYPA 3DT1A 3VQUA 5I9UA 3TI1A 4C4GA 1AGWA 4HVDA 5LVMA 5JMSA 3N9XA 2QONA 4BCJA 3ZEPA 2AC5A 3ZHPC 1E1XA 5DBXA 4RC2A 2VUWA 3ZBXA 2HY0A 2XCKA 3U6IA 2YZLA 2QG5A 4FODA 3AXWA 5KBRA 2YDJA 3F9NA 4WUAA 2HENA 2VTAA 2UW6A 4OT5A 5KX8A 5HOAA 4XMOA 4AT3A 1BI8A 2PZPA 2PVMA 4FL2A 5GIOE 4IM0A 2YABA 3QCXA 4Z16A 3D94A 1GZKA 4UXQA 3QCSA 4IXPA 5AP0A 2DUVA 5GZ9A 4IE9A 3ANRA 2CPKE 5CYIA 3FLNC 5FDPA 3TZ9A 2QU6A 4I1ZA 2B54A 4IAAA 2WIHA 3DS6A 3HMPA 4H3PA 5TOZA 4BCIA 5C4LA 5DIAA 3MN3A 1OIQA 3P1AA 3QZIA 3P4KA 4C61A 3ORNA 4O38A 5ANKA 2XRWA 2WMTA 1DI8A 1B6CB 2P2IA 3MW1A 3EJ1A 4EOJA 1OIRA 4YZNA 3F5UA 3HRFA 3UTOA 4F7SA 2CNUA 4BGHA 3ZSIA 5C9CA 4EH3A 1YHWA 1REJA 5AR7A 5CF5A 4ZTSA 4O91A 4V01A 1SVEA 3LQ5A 3TNQB 3UO4A 4OTHA 2C3JA 3OF0A 4E5BA 5IF1A 3EOCA 1YWNA 3QQJA 3E88A 3BGQA 5J87A 1YDTE 3Q53A 4ZLYA 4DEEA 4X2FA 4LL0A 4RIYA 4EI4A 4DTAA 2XMYA 3FMMA 3MIAA 3QQUA 3ZRKA 4AA4A 4AZVA 1OGYA 5BVOA 4LYNA 5EI2A 5AR8A 4NKSA 3IDPA 3PZEA 2GSFA 3AT3A 3CD8A 2X9EA 3F7WA 3GCQA 5DG5A 2PUPA 3ZDUA 2BTRA 2ZOQA 3WZUA 5BPYA 2BZIB 3DTWA 1H1QA 4HGSA 5HKMA 2VNWA 3EQBA 4JRNA 3OEFX 5ANEA 3L8VA 3P7AA 2WO6A 5AR2A 3CCNA 5HG9A 2UZBA 3CS9A 4X3FC 4AQCA 3PJ3A 4O7LA 4FSRA 3VUKA 4FV5A 3H30A 3PY0A 5EHLA 4BDFA 1W2DA 2NYAA 5CAUA 1DAWA 2QG7A 4HVGA 2C6LA 4GKIA 4DBXA 1ZYCA 2J5EA 3P9JA 4H1JA 5HNIX 4GCJA 3ID6C 4FX3A 1CKPA 3MTLA 4G5PA 4ZMFA 2XJ2A 3KXHA 3SVVA 3ET7A 1VYZA 4O0TA 4PY1A 3TT0A 2FVDA 3BEGA 2XA4A 3DAJA 3O2MA 3OS3A 4YLKA 1UKIA 4O7ZA 3CGOA 4JQEA 4YJSA 4IW0A 2GNFA 4LUEA 4Y95A 4APCA 4BZDA 2B4SB 2C3KA 4V04A 3UIMA 4D55A 4PP7A 4W4WA 2B9IA 2R7BA 3R2YA 4JDIA 4ZK5A 1H1RA 4M0ZA 5AUZA 3F3UA 3MJ2A 3JXWA 4RVKA 4J1RA 4IHPA 2H6DA 3GU8A 4UWBA 5HNBA 3U54A 3THBA 4R1VA 5CWZA 3BRBA 1P2AA 3PIXA 3CTQA 4ALWA 5CAOA 4C37A 3MFTA 3Q60A 3UYSA 2BDJA 2CGWA 2EWAA 1TQMA 3ODYX 4FTKA 4NW6A 5EH0A 4ZTQA 2ERKA 5KHWA 1G8JA 4X2GA 3CC6A 3OD6X 2VWZA 4ANLA 2YIRA 1NVRA 3TCPA 3W32A 2XK9A 1ZWSA 2YJRA 3D0EA 4KUJA 2OSCA 3KULA 2AEGA 3RNYA 3OUNB 4FGRA 3UO6A 4XV3A 3RPRA 5IQFA 3OVVA 1L3RE 3R9OA 2RF9A 4MVFA 1YI6A 3LFEA 3W0SA 4BI0A 2JKQA 5E8UA 3AT2A 2GFSA 3OBJA 4FBXA 5AP2A 2UW5A 1Q5KA 4BKJA 5CQUA 4ID7A 2HELA 3PDTA 4KAOA 3QTXA 2ITPA 1KE9A 1YHSA 4ITHA 2ZVAA 4TNBA 4GT4A 4FKPA 5EM8A 2BHHA 5I9YA 3GQLA 2C6MA 3HUCA 5IQEA 4GK4A 5FBNC 4CFVA 3HDNA 1Q97A 3FLQA 1ZYJA 2V0DA 4U9AA 2JGZA 3UZRA 5E1SA 5EDPA 2JDOA 1FVVA 2VZ6A 3EFLA 3ZFXA 4OTQA 1QL6A 3QD2B 3BEAA 4I6HA 4K9YA 4M15A 5FG8A 4AGCA 1QMZA 2QCSA 1J7IA 2OH4A 4O4DA 5AR3A 4ZIMA 4CRLA 3JS2A 3EQDA 2ONLC 3R00A 4A07A 3D4QA 3DNDA 3QHRA 4FTRA 5DFPA 3LE6A 2QR8A 4BCMA 3ZO3A 5IDPA 3L9PA 4AZWA 4EUTA 4C3PA 4J95A 4EH6A 3QRJA 2ZFYA 3EWHA 3TUBA 4FV6A 3QTSA 4OTDA 4DHJA 4TWPA 4PWNA 3IPHA 4O6LA 3SHEA 4Q5HA 3DK6A 3NNWA 5F95A 5B7VA 4O7TA 3P0MA 1G8KA 3OT8A 5CASA 5CSVA 3R8VA 4QMZA 3F6XA 2V62A 1SZMA 4C3FA 3QTIA 4FEQA 4QYYA 4FOBA 5AM6A 4XG4A 4HGTA 3WF6A 1J1CA 3GFEA 4QMOA 4AE9A 4F9CA 3AC5A 3DLSA 3ORTA 3OMVA 2F49A 4D2PA 2PHKA 4FNXA 2JIUA 4HYSA 3RI1A 2E2BA 4IC8A 3CLYA 4L44A 3QUEA 3KMWA 4FV9A 4RVLA 3JY0A 1XBAA 1KV1A 5FBOA 2YA9A 2QKRA 2ZMDA 3HRBA 4U43A 3BKBA 4FKWA 4AZFA 4CQEA 4EOMA 5J1VA 2X7GA 2XAOA 3Q9ZA 3PIZA 5HNGA 4L52A 2PUUA 2R0UA 3W18A 1WAKA 3DDQA 5M4FA 3ENMA 4RIOA 2VX3A 3LXNA 2QOIA 4XOZA 1ZRZA 3LJ2A 4GK2A 4D4SA 4HCVA 3DBQA 1ZOHA 4GYGA 3W1FA 3V5WA 4CMTA 3PJ8A 5HX6A 4AXDA 4M0YA 3LCKA 3ROCA 4FNZA 2CNQA 2R3PA 2IZUA 3K5UA 3OTVA 1F0QA 3WF9A 4F4PA 3PXYA 4Z3VA 3ORMA 3OW3A 4FVQA 2X4FA 3T9TA 3L9LA 3FZOA 3QTZA 4S32A 2WMUA 3EQRA 3WF8A 2OJ9A 4NK9A 3MVLA 3KEXA 1GZ8A 4DDGA 1KV2A 5HVYA 3BHYA 2GNLA 2XIXA 2BIYA 2OU7A 5GJGA 2Z7LA 5DOSA 4FIGA 4DFBA 5H8BA 2UUEA 3K5VA 4HZSA 3KRJA 4WG4A 3WE4A 5C03A 3AC3A 3UQFA 3PFQA 3PXZA 1LR4A 4BIDA 1IRKA 1XMLA 3LMGA 2QVSE 2JIIA 1XH9A 3HYHA 1W2CA 3LOKA 5KE0A 4CCUA 4DH8A 3ORKA 5K4IA 3OWKA 4PL3A 5TR6A 2WGJA 1J91A 3IONA 4BGQA 3FQSA 3NUAA 2R3RA 2EB2A 4ALUA 3FAAA 3BU3A 2HAKA 4C34A 4RWIA 2UW8A 2PZYA 3NAXA 2HZNA 4HOKA 2JAVA 2C6DA 2G2FA 2VTRA 4IM3A 4YC8A 4FTTA 5FP6A 4YUQA 1OECA 4KKGA 1NVSA 2VGOA 4UWYA 4U80A 4L9IA 3SW4A 3VULA 2ZM4A 4C0TA 1OUYA 3GQIA 4M69B 4IZ7A 3UVRA 4FEVA 3FI2A 4X21A 3IDCA 4IANA 5H8EA 4BCFA 2CCHA 3FMEA 4DN5A 3E5AA 3VS7A 3Q04A 4IWQA 3DOGA 4RX8A 5LMKC 3SA0A 3ELJA 4ZJVA 4FSQA 3S2PA 4J53A 1XMMA 3MPAA 4FE2A 1FINA 4A4LA 2FO0A 4MD8E 3QC9A 1PMUA 4ZJIA 2DYLA 4ITJA 3W2OA 3SG9A 3N4TA 1L8TA 3PXRA 3BX5A 4DH3A 3UMWA 4I6QA 5AP1A 4CEGA 2WU7A 4BGGA 3Q9WA 3KRXA 3OTUA 5AUUA 4FJVA 2IVTA 2UZOA 3T8OA 3NYNA 3CSVA 1WFCA 4I0RA 4ZS4A 1Z9XA 3O50A 3ZYAA 2YERA 3IKAA 2R0IA 3QQHA 3VN9A 4YTIA 2UVXA 3FYJX 2QHMA 3L9NA 2QR7A 4EL9A 2V22A 4HYUA 2W7XA 2W5AA 4EC9A 3E8EA 2GPHA 4CZYB 2XCHA 5KMLA 3PUPA 3EZRA 4YZ9A 3I81A 3LAUA 4H3QA 5HG8A 1ZZLA 4EH5A 5HE1A 2A0CX 3W16A 5CSHA 4I20A 3DFAA 3K3IA 2QOBA 3FQHA 1JSVA 3DBEA 4GFGA 5CXHA 5J79A 2CLXA 2UZDA 5JQ8A 1XH5A 3QZFA 3B8QA 2IW8A 3KXNA 5LWNA 3CKXA 4AN2A 3W10A 4MXZA 3SV0A 4EK6A 4HVSA 2YJSA 1PMEA 5F9EA 3CIKA 4F9YA 4PPCA 3R2BA 3RAHA 4PMSA 1PRYA 4EUUA 3L8SA 5IQCA 1WBVA 2KTYA 4LUDA 3VWAA 3C50A 4FKJA 3ZMMA 5KCVA 4TL0A 4EKKA 5FGKA 5HO8A 5LXMA 3H9FA 2C69A 3DAEA 1PYEA 3RALA 2XK7A 4G3CA 2XRUA 2BKKA 2ESMA 3QWKA 5AUYA 3LPBA 4IFCA 4YJNA 3A4OX 3RVGA 4A9YA 3R28A 4IFGA 3WZDA 3ACJA 2YISA 3MB7A 4WNMA 5M4UA 4QYHA 4CT1A 1Q4LA 1KE5A 2GU8A 2V7OA 5HVKA 4ALVA 3UP7A 4FZ7A 5IKWA 4U3ZA 3ETAA 5GZ8A 1OL2A 3P79A 4P5QA 4PNIA 5ANJA 4YJRA 5KO1A 1PXKA 5FUTA 1NA7A 3EQPA 4FKVA 1Y91A 4CTBA 4DAWA 2XK3A 5CU0A 3GCSA 5ETCA 2Y6MA 5AAFA 3CJFA 3GB2A 3RAKA 3C5UA 2JC6A 5HLWA 3D5UA 4HGLA 4QMMA 4QPSA 5HU9A 2B0QA 1U54A 4RFMA 4N4SA 2PMNX 4M14A 4H3BA 1ZOEA 1LPUA 3GOPA 3Q5ZA 2P3GX 4D5KA 4RLKA 4QNAA 5IEXA 3R83A 4DT8A 5LJJA 5TT7A 5CAQA 2IZRA 4F99A 4FIIA 4YNEA 4MXAA 2JDSA 4RVTA 4HPTE 2VTTA 3QQGA 4BI1A 3MVMA 3NUSA 4YBJA 2E9OA 4B0GA 1CM8A 5LVNA 1LEZA 5K0KA 2CMWA 4K6ZA 1UV5A 4AW2A 2IZTA 2VTNA 3EZVA 1ZY4A 3FL4A 4I24A 4EZ5A