4WIHA

Crystal structure of camp-dependent protein kinase a from cricetulus griseus
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
353
structure length
350
Chain Sequence
GHMGNAAAAKKGEQESVKEFLAKAKEEFLKKWESPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structure of cAMP-dependent protein kinase from Cricetulus griseus.
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
total genus 115
structure length 350
sequence length 353
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4wihA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4wihA02
2F7EE 2YIQA 1MP8A 5IA2A 3QBNA 4GUBA 3AT4A 3U6JA 5CS6A 3D94A 4IQ6A 4PP9A 2P3GX 3GXLA 4MD7E 2BRGA 5DR6A 4AZFA 5L6OA 3C4ZA 2XYNA 3FBVA 4FTNA 4R8QA 1REJA 4OGRA 4YJOA 3GUBA 5CU6A 3NIEA 3KA0A 4R5SA 3H9OA 4XG9A 3IQ7A 4EUUA 3C4FA 5IH6A 3WI6A 5TE0A 4CYIA 4M3QA 2X81A 3W32A 1JPAA 5AA8A 4BI2A 1Z5MA 2HIWA 5AX3A 3KRLA 1KSWA 3IS5A 3DS6A 3QF9A 5CEMA 4XG6A 5F95A 1ZXEA 2J5EA 3MY0A 4NTSA 4YZDA 5CAVA 4QQCA 2XNMA 4OTIA 4QP3A 4JDHA 5IKWA 5BVEA 2WMTA 5DA3A 4AOTA 1BYGA 5KKRB 4RVMA 1PMUA 3LXLA 5FRIA 4C61A 2WMXA 4FE2A 1H01A 3BWFA 2BKZA 5HU9A 2YIRA 3C4WA 3KULA 4MWIA 5JK3A 2J6MA 3LFAA 5CVGA 5DBXA 4Z55A 3EWHA 3QD2B 1OKYA 2OJJA 3D7TA 4R3CA 4E4NA 4KKEA 3DAEA 4AOIA 4DLIA 4RIOA 4BYIA 4FL2A 1RE8A 2ITVA 2Q0BA 2XEYA 3CIKA 2QG7A 4PDYA 2W9ZB 3PTGA 3DTCA 4U9AA 3VS1A 5JH6A 2PZYA 4O7YA 3EMGA 4W4WA 4NFNA 4ZJVA 3NUNA 3FC1X 3TV6A 2LGCA 4KD1A 3QL8A 3FMLA 4FZFB 2HOGA 2Q0NA 4ZXTA 4I6FA 4JAIA 3O7LB 1SMHA 2QOBA 3LPBA 3BHUA 4ITJA 4AQCA 3I6UA 1VYWA 2YM8A 4PPBA 4RFMA 3ORZA 4DH1A 4BDJA 3ORIA 2PZ5A 5IMEA 5M09A 2XJ0A 2GHGA 3MN3A 2G1TA 2ZMDA 3QWJA 3RNYA 5IQAA 3BLQA 3ZSGA 2ZV9A 4FT3A 4FKTA 4BCQA 3MESA 2R5TA 4W4VA 5CAUA 3QD4A 4AT3A 3NUYA 1JKKA 4G5JA 4ASDA 1NY3A 2PVHA 3P1AA 4KNBA 5EM6A 4LI5A 3OG7A 3WZEA 4B0GA 5KMOA 5C8KA 2WOTA 2LAVA 2PUUA 2XK3A 2YLEA 2I6LA 4PUZA 5AIKA 1CKPA 2WPAA 2P55A 3MDYA 4DG0E 3AT2A 3PVGA 3QTIA 4TZRA 3ZEWA 5BVFA 4HNFA 4UWCA 4YGAA 4QP2A 5AUVA 1BI7A 4EHZA 2YZLA 2UZEA 4RIWA 1NA7A 4KSQA 4Y5QA 4K33A 2IW8A 4QMVA 3BGZA 2X4ZA 3L1SA 2WFYA 4DT9A 4FVRA 4PL3A 4FKUA 2VWWA 4HYIA 4BHZA 4F7NA 3M2WA 3LJ0A 4IB0A 1Q97A 1OPKA 2R3MA 4PPAA 3UQCA 4L3LA 4Q2AA 4YNOA 2OLCA 4O7NA 2XBAA 4H1JA 4KWPA 4O1OA 4C59A 3BV3A 5HNIX 4O0SA 3BYUA 3SRVA 2ONLA 1OL6A 1YXXA 4EJNA 5ANKA 3OY1A 3JPVA 5BMMA 2BALA 5JKGA 3TL8A 3KF4A 1PXJA 5HQ0A 5LVPA 4FNZA 1Q3WA 5EDQA 2VN9A 1TQIA 4GK3A 3SLSA 5JZNA 4IXPA 3PJCA 3TTIA 3VRZA 1J1BA 4WBBB 4BIEA 4AA5A 4BYJA 2JDOA 2BHEA 5HOAA 4UMPA 4FGRA 5H8BA 3TM0A 5B0XA 2B54A 5C8MA 5IQGA 3U9NA 4DLJA 4FNYA 1Q5KA 2VTHA 2QHNA 1Q99A 4RQKA 1IAJA 5AUYA 1B6CB 4FKJA 1DS5A 3EKKA 2VTNA 4MAOA 4MH7A 5JN2A 3PP1A 4RVKA 4APCA 1H0WA 5JGBA 5L2IA 2QR7A 3LW0A 2GNFA 4G3CA 3BWJA 5E4HA 4FSTA 1YW2A 3I7CA 3IOPA 2V55A 2YDKA 4YZBA 4TYGA 5AEPA 2HAKA 1REKA 1XQZA 3HAVA 3BU3A 3QC4A 3MPMA 3K5VA 4H1MA 3BEGA 4ACHA 4CCUA 5HX8A 4I4EA 4G1WA 1Q8YA 3DKGA 3FLYA 3ODYX 4QO9A 4CKIA 1U54B 4D28A 4IM3A 5FDXA 2VWZA 1OECA 5IQCA 1GZOA 2PMOX 4BFMA 5CTPA 1SNXA 4O82A 3ZM4A 5AUTA 2E2BA 3SOCA 3UIBA 4G5PA 4CNHA 4ENYA 5CAPA 4QPSA 4DITA 3AMYA 4IZ7A 1IA9A 4FTUA 4JG7A 2PE2A 4JBQA 4YJQA 4F08A 3FHRA 3BGQA 4JXFA 1WBTA 3VW6A 3FXWA 2ITYA 5CU4A 4NCTA 5LARA 3W10A 4BKZA 5KNJA 3EOCA 4EK5A 5C27A 1W83A 2YWPA 3MTFA 4L8MA 4CYJA 3RAHA 4EORA 4PX6A 1XO2B 2CNVA 2VAGA 2E9PA 3MBLA 1PKGA 1YHVA 3CPCA 2Y4IC 3LLTA 5FEDA 4ANQA 1BL7A 3MPTA 3OXTA 2QLQA 5TKDA 3QALE 3DB8A 3QFVA 4FTCA 4U80A 4CSVA 3II5A 4IH8A 1K3AA 2XNGA 2YN8A 4LUEA 2R3IA 2WMBA 4L53A 4F65A 3NNXA 4ZZNA 3GNIB 2XUUA 4ZTMA 4F1TA 1G8AA 5G1XA 5JT2A 3D5UA 1IRKA 2C3KA 2H8HA 4J8MA 5FUTA 4UXLA 4U3ZA 4NM3A 5HICA 5FP6A 4YHFA 4IX5A 4L6QA 3N51A 4D1XA 4HOKA 1H27A 3PZHA 4RWJA 3VBWA 4F0FA 3G2FA 4D4YA 3RNIA 4M13A 5HD4A 5M55A 3CTJA 4WIHA 3EH9A 4CG8A 2W1DA 3Q4UA 3KQ7A 4L9IA 1ZY4A 1PYXA 4C36A 1ZYLA 4WOVA 3UVRA 2Y6OA 3AMBA 3K2LA 3ORTA 3FXZA 2QURA 4F1OA 5M07A 2W96B 1FGIA 1P5EA 4D55A 3HGKA 3KRWA 3WF5A 5J79A 1DM2A 5GIPE 4PY1A 3BLRA 4M69B 4QMUA 4G16A 4FSRA 1FINA 2C6DA 4H36A 1UNHA 3QQLA 3TJDA 4IHPA 2VWXA 2RFNA 3QHRA 3V8WA 4PL5A 4XP2A 2CGWA 3TIYA 3CP9A 4FV3A 3FZTA 3QTWA 4GRBA 2UW6A 1A48A 3DGKA 3E92A 3FMJA 4AW0A 2R3JA 4XX9A 2ZAZA 4YSJA 5K4JA 3GB2A 1WBWA 3QA0A 4NTTA 2ITQA 2QOFA 4BDBA 3FE3A 4M68A 4KRCA 4J52A 1UWHA 3SXRA 4I6HA 3ZFXA 3OMVA 4R6VA 2XCKA 4F9CA 2X6EA 3CTHA 1XH7A 3TXOA 2QKWB 1NVRA 2Y6MA 4FK6A 5FEQA 2YEXA 2BRNA 2YITA 1P4FA 3A62A 3MFUA 2X7OA 4WO5A 4Y73A 5E8ZA 2JFLA 5J9ZA 3RI1A 2G01A 4OUCA 3C7QA 3TNPC 4ZK5A 5CAQA 4ZMEA 3KK8A 4RX5A 3V6RA 2OIBA 2YHVA 4O0VA 4U42A 3FEGA 3UOHA 4O81A 1PRYA 4QQTA 5ITAA 2XNPA 3O50A 4C62A 3KU2A 5DEYA 4MXCA 4EC8A 4EK6A 1ZYDA 2V7OA 5HE2A 3MH0A 4BDDA 5I9UA 1OVEA 3MVJA 5AX9A 3FPQA 4IDTA 5B2LA 2GS6A 3UO5A 4EH6A 3CKXA 1P4OA 1Q41A 1JSUA 3LQ8A 4UEUA 3SDJA 4E6QA 4CCBA 4TRLA 2FVDA 3E7VA 3OHTA 3EQRA 4Z9LA 5EYCA 3ULZA 2XP2A 3CKWA 3UYTA 3V04A 4DH5A 3ZHPC 2PY3A 5BVOA 3F2RA 4LFIA 2BDFA 1H26A 3FSFA 3QZGA 4O7VA 5JRQA 3FYKX 3QRIA 4ORKA 4DC2A 3C0GA 5A6NA 4G6NA 3KC3A 3V5TA 4FEUA 2C6LA 2X7FA 4YO4A 2A0CX 2VTTA 4M67A 3ZUVA 3SV0A 5JQ8A 3L9NA 2NRUA 3PY1A 5T68A 3VHEA 3MGYA 3DJ7A 3C4EA 3I6WA 5A4CA 1XR1A 4QTAA 3A7FA 3OXIA 4RWIA 4IE9A 4Y72A 4DGLC 3PXZA 2YM3A 3LAUA 4N6ZA 3Q4CA 4YHTA 3GCPA 3ZH8A 3ATTA 2XNBA 3QTSA 3PZEA 4RFYA 3UVQA 1KV1A 2R9SA 4JDIA 3RM6A 3DLSA 4K11A 5CNNA 4BDFA 4BWKA 5CXZA 3DXPA 1ZOEA 1UU9A 1Y8YA 2Z7SA 4O6LA 4ZSJA 4BCGA 4D4VA 1KUTA 1SVEA 3ZYAA 3HX4A 5FBOA 3I1AA 2BVAA 2EB2A 5HEZA 3FL4A 4LYNA 2R3NA 2FSLX 3UC4A 1RQQA 3UZRA 2JGZA 2UW4A 3ODZX 3AC1A 3O51A 4GJ3A 3D9VA 2KULA 1WBNA 5AP4A 3RK7A 3BYMA 4P90A 2W06A 2P4IA 3K54A 5C03A 2XK4A 4DG3E 1DI8A 4FC0A 4TWOA 5I9ZA 5JQ5A 1TQPA 4PPCA 3IW6A 5CAOA 5AV1A 4MK0A 4UZDA 4O7WA 1J91A 2BHHA 1O6KA 5GZ9A 1JBPE 4ANMA 3VBQA 5I9YA 4CT1A 4DEDA 2BZKB 3DCVA 4QP6A 4BBMA 2AC3A 5AR3A 5IEYA 2C1BA 3VUTA 2P2IA 3RZFA 3QWKA 4FV9A 2PVJA 4HCVA 2R2PA 5CZIA 4AZWA 2WU6A 3NRMA 2J2IB 3IGOA 4XG4A 2XK7A 3HMPA 4FKQA 3W33A 1NXKA 4M8TA 5AR5A 4PWNA 3NW5A 1UKIA 2XYUA 5C9CA 5FDPA 4AA4A 1YWVA 4L43A 2QHMA 5EKNA 2V7AA 3L8SA 4IFGA 5BMSA 4DBXA 4N0SA 2WMRA 5DOSA 4QMMA 3QQKA 4F09A 1DAYA 5H2UA 5GNKA 2B9FA 5JZJA 3G33A 3HRBA 4E26A 4GK4A 5IA4A 4I22A 4ACDA 3PRFA 4XHKB 4USEA 3MB6A 1H24A 4WG5A 4F9AA 5AR7A 1IA8A 1UU3A 1QPCA 3EN4A 5E8XA 4C37A 3Q9XA 4FEXA 2ZB0A 4AOJA 3O2MA 4MNEB 1CDKA 3D5XA 1ZRZA 3DKOA 4QMYA 4U43A 3ROYA 3I4BA 3OOMA 3V3VA 4CZYB 3TUDA 3NVMB 3QTUA 4IX6A 2E9NA 3BIZA 3PA3A 4W9WA 3BYOA 2XH5A 4FVPA 5H8GA 4MD8E 4RJ8A 3S2PA 5LMAA 2VTLA 4D0XA 2G9XA 2UVXA 4FV8A 1VJYA 5EM7A 4AW2A 2X4FA 5LMBA 2I0EA 4O22A 3TNIA 4I92A 2ZM4A 2WTKB 5B2KA 1V0PA 2JITA 3H9FA 4HGLA 5KO1A 4I5PA 4TT7A 3RK5A 3ZBXA 4MD9E 5IQFA 4OBPA 4UN0C 1B38A 4FKWA 3C0IA 1BUHA 4QYYA 3LFDA 5AV3A 5E8YA 3Q6WA 3PPKA 2WTCA 4LRJA 2WKMA 3F6XA 3MY5A 2Z02A 3L9PA 4ZP5A 3VBVA 2YM6A 1NVQA 4OTRA 3R8MA 3A8XA 3DDPA 1K2PA 3P79A 4O2ZA 3TDWA 2GSFA 2OWBA 4GYIA 4TKSA 2OJGA 4XMOA 3VN9A 2RKUA 1MRVA 4HYHA 2O3PA 3A7GA 4N4SA 1PXOA 3QTZA 4PTEA 4XBUA 4C4IA 3PSDA 5GZ8A 3VUMA 3U54A 3SD0A 1PXMA 2XEZA 3NYVA 1YDTE 3QTXA 4TYHB 3OF0A 4D2VA 3SX9A 5BUEA 2R3KA 3SRVB 3DJ5A 3WE8A 1L8TA 2F2UA 3F2AA 2Y4IB 3MVLA 4RX8A 5K5NA 4AZTA 4GVJA 1W8CA 3FV8A 2FYSA 4CXAA 4ZSEA 5HBJA 4YPDA 2CMWA 2BPMA 3NMUF 4AE9A 4DFXE 3EQHA 5CY3A 3OVVA 3ORXA 1Y8GA 5CXHA 4FKPA 4JX7A 4D4SA 4E93A 3LFBA 3TN8A 3H0ZA 2W1ZA 3OEFX 4YLJA 3Q9YA 2X39A 3QZFA 4L01A 5FGKA 3FPMA 3CTQA 3R7VA 3ZXTA 3W2SA 2IVUA 4K1BA 2R64A 1KOBA 5K0KA 1GIJA 3KB7A 4RZVA 3PE2A 2FSMX 3R7YA 5IDPA 5JEBA 4CTBA 2QOOA 2YCSA 4EH8A 3WYYA 4MXXA 3P7BA 4FX3A 3CGOA 2YWVA 3TZ9A 2F2CB 2ITOA 4CFVA 4F63A 4HYSA 4UBAA 1OGUA 2CDZA 3WYXA 4QYEA 4DEAA 4GCJA 4TL0A 5EQYA 3ORMA 3COKA 3PFQA 2UZUE 4EOSA 5HZNA 4FTAA 3GENA 4IVBA 3WBLA 4NSTA 5E7RA 3F5PA 5F94A 3CSVA 4O0WA 5IH5A 4XRLA 4AXAA 1WAKA 4D1ZA 4E5WA 2C6TA 1PXNA 3NNVA 5AV2A 3WE4A 1H1WA 2VX0A 4W8EA 4I23A 5CI7A 2ZM1A 5CQUA 4V0GA 4IM2A 5DHJA 4PTGA 5E91A 3DXNA 1CKJA 3ZFMA 5KMJA 2ETRA 5EW9A 4O27B 3NUAA 4XG3A 2RFSA 4EH2A 5BX0A 5EDRA 2Z7LA 4FYNA 3H0YA 3PVWA 4CFUA 3ORKA 5L2QA 3MJ2A 4D2WA 1GIIA 3GU8A 4FT9A 3L9MA 1LPUA 2W99B 4S30A 4APPA 3UIXA 1X8BA 3NDMA 2HY0A 4RIWB 4GJ2A 4GIIA 4AZEA 4JDKA 3VC4A 4CTCA 3PPJA 3QRKA 4XG8A 4I5MA 2DYLA 3LMHA 2O2UA 3KK9A 4E8AA 2OFUA 1ZYCA 2X8EA 3G5DA 3RKBA 4BDEA 4MXAA 5CYIA 2PZPA 3Q5ZA 4FKVA 3GI3A 3OTVA 5BQ0A 4WRGA 3LFQA 4RJ7A 1MUOA 2HXLA 3G9NA 4J1RA 3E3BX 4ZS0A 5ANJA 1YI6A 3P78A 2WO6A 3GOKA 2OG8A 3LVPA 5ETIA 4ZIMA 3GCUA 3FSKA 4BTFA 1YRPA 1HCLA 2PMNX 1PMEA 1ZWSA 5KHXA 4NIFB 1F5QA 3BCEA 4X3JA 5AMNA 5KUPA 2W9FB 3ACJA 3NPCA 3CXWA 4GK2A 4V05A 5E8WA 5GJDA 5KE0A 2JBOA 4BCKA 4CFWA 2G2FA 4CFMA 3EFWA 3WOWA 2WNTA 2JDTA 4MKCA 4DYMA 3HA8A 4EOKA 2ZDTA 3OUNB 4L7SA 4QMXA 2QOCA 2VWBA 4O0TA 4I0RA 3HLLA 3AD4A 3IGGA 3P5KA 3PVUA 2UW0A 3MA3A 3O8PA 4U5JA 3FYJX 3UQFA 4XV3A 2YM4A 2XNOA 3QRJA 4NFMA 1JOWB 4R1VA 3FQEA 4U7ZA 4F6UA 5L4QA 3S0OA 3LFCA 5E8SA 3SQQA 3PSBA 2HK5A 2C1AA 2PWLA 1YXSA 1O6YA 4BDIA 3ITZA 3SAYA 4AAAA 5A3XA 2Z7QA 3KKVA 4QTEA 2VTIA 3N4VA 3AXWA 5JGAA 3FKNA 4M12A 3E62A 3PIXA 3Q5IA 4W8DA 4BBEA 1OBGA 1OKZA 4GFOA 4CFXA 2PE1A 4Q5HA 2ERKA 3IO7A 5E90A 4AT5A 4NIFA 4RC2A 5J5TA 3G51A 3D7ZA 4FT7A 3IECA 5AP6A 3NUSA 1U5QA 2QKRA 3DY7A 2J4ZA 3FMEA 2GNJA 3E8EA 2GPHA 2YAAA 2WD1A 2DS1A 2DWBA 4NW6A 4BKYA 4AFJA 1OKVA 4L67A 4BDAA 3OY3A 3HUCA 4RSSA 4H39A 5DR2A 1IAHA 5HE1A 3F5GA 3FLZA 5LMKA 2UZDA 3VUDA 5JFWA 4QT1A 3C1XA 4ASXA 3MH2A 3BE2A 3UOJA 3QCQA 4MNEA 1UA2A 3ORPA 2J50A 2VNYA 2YABA 3IDPA 4GT5A 4NU1A 5HLPA 4NM5A 5KKRC 5DEWA 3EQDA 4IAZA 5DN3A 3QTRA 4KAOA 4X2KA 3MWUA 4GYGA 2QG5A 4ZSLA 1R1WA 4TWPA 3WILA 1MQBA 4FIIA 4B9DA 1H25A 5JFVA 1M17A 4CVAA 4DTAA 4L7FA 4S31A 2BROA 4ZMFA 3UIUA 2BUJA 3TV7A 4RBLA 2JFMA 1J3HA 4PNKA 1LEWA 5DT0A 3HMIA 4YTHA 5IG1A 4CV9A 4CGAA 4C33A 5EM8A 4EUTA 3F3UA 2NO3A 3THBA 1STCE 2BRHA 3L8XA 4FG9A 5KMIA 4D9UA 3EQBA 2C0OA 3RM7A 3NCGA 3EHAA 4CQEA 3FI3A 4K2RA 5EOLA 2J7TA 4D4RA 3LQ5A 2X8DA 2WQMA 3PXFA 4YJRA 5DFPA 1MQ4A 2GMXA 3PA5A 3AG9A 4U0IA 3FMDA 3R1NA 3R7GA 2HZNA 5D41A 2W0JA 3GQLA 5H8EA 3ZXZA 3R30A 5IMXA 2YERA 3B2TA 2BKKA 2QC6A 3TCPA 3D5WA 1PXLA 5IQDA 3AQVA 4RWLA 5JMSA 3D0EA 2AC5A 3ZLWA 1JSVA 3BI6A 3F88A 4KBCA 3JXWA 5CLPA 4DEHA 3R71A 2CJMA 4IBMA 3OFMA 4RRVA 3NYOA 3PXRA 3ID6C 4BCNA 4GG5A 4MBIA 3NAYA 3UE4A 4P7EA 4YMJA 4P5QA 2BRMA 4WRSA 4O7TA 1ZMUA 3K3IA 2QOKA 2W5AA 4QP9A 4J8NA 3UVPA 3LCDA 4UWYA 1ZYJA 3E8DA 2YIWA 2CCHA 1L3RE 3ATSA 3AC2A 4IFCA 2J5FA 4FV2A 2OW3A 3F3WA 4K77A 4A4XA 3OOGA 2V5QA 2F4JA 2PULA 2C5XA 3PY3A 3C0HA 3I60A 4IJPA 2W4OA 4H05A 2P33A 5TF9A 2CNQA 2BZHB 2UZNA 5LQFA 4GKHA 1YOJA 4U81A 3UODA 5GHVA 3ZSHA 3R73A 4DTBA 3PJ3A 3Q2MA 3W55A 4AN9A 4D9TA 3R83A 4EKLA 4ITIA 3ZC5A 1Q24A 4FTTA 2YAKA 4RIYB 2WQEA 4KIQA 4DT8A 3JUHA 5DR9A 2FA2A 1SZMA 4A06A 3FI4A 4BN1A 3GCVA 3BHHA 1OPLA 2OJ9A 4GEOA 3HDNA 4JDJA 2OICA 1PJKA 3FMHA 3F5XA 3RAKA 4DCAA 4TWCA 2ETKA 2QCSA 1WBSA 3R63A 4KBAA 1MRYA 2HYYA 1WFCA 2GFCA 2BFXA 1YDSE 2QONA 4B8MA 2OH0E 3OT3A 4J53A 5CEQA 4Y85A 4MF0A 4IVDA 4UY9A 3EQPA 3BU5A 5FG8A 4CKJA 4X2GA 3RALA 1UKHA 4FKLA 3QUPA 4M97A 5CU3A 3OCSA 2QO7A 2OF4A 4PDPA 2QOIA 2ERZE 5ANEA 3TZMA 4CLJA 1OL5A 5KMLA 2O8YA 4CZUA 1ZZLA 2ITTA 3ORLA 3QQFA 2A27A 3S4QA 4IB3A 3AC8A 1APME 1O9UA 4WT6A 4X2FA 2E9UA 3BQRA 4ZSGA 3ZOSA 5AV0A 5HBHA 3RPOA 3ORNA 5D7AA 3VJOA 2HW6A 5LOHA 1M14A 2H96A 5ACBC 3KL8A 3RTPA 1I09A 5LVLA 2R0IA 4O38A 5BNJA 2FGIA 4TXCA 4XG7A 3VS4A 4DFBA 4MQ2A 5L2SA 5AAFA 5BPYA 2Q83A 3TJCA 1BX6A 4KBKA 2J0JA 3T9IA 5FP5A 4O2PA 3HP2A 5CF6A 3A7HA 1R0EA 4J97A 4C4FA 4USFA 3CC6A 4S33A 4O0XA 5K4IA 4O83A 4MEDA 3GCSA 1IR3A 4XLIA 4DEGA 3P23A 4J99A 4QMWA 2W1HA 1UV5A 3NSZA 2RIOA 1YWRA 2A2AA 1BI8A 1H1RA 4IDVA 2C6IA 5T6KA 3O7LD 4A9RA 4FMQA 3PG3A 4U3YA 1KE8A 2VGOA 2VTRA 3UP7A 3VAPA 4WG4A 5IQHA 3C51A 2IW9A 5JRSA 3IKAA 3FQHA 3MIAA 4DE4A 3PVBA 5KCVA 2B1PA 4WNOA 4FIGA 4EOPA 4F0IA 4CV8A 4FTMA 3ZSIA 3FHIA 1ATPE 2W5BA 3ZONA 4S32A 4K18A 2B0QA 4U6RA 5EHOA 3N4TA 1H0VA 2QQ7A 5AR8A 3R8UA 4FSWA 4EH7A 3UC3A 3VS6A 3KXNA 1W98A 4WUAA 4OTFA 3KVWA 3JS2A 4NW5A 4PNIA 5M44A 3Q9ZA 5EW8A 4JBVA 4YHJA 4QYHA 1VZOA 5AJQA 3ZO4A 3U9CA 4EOLA 3EL7A 3T3VA 4U41A 3NEWA 4JIAA 2QO9A 4UALA 4FKRA 2C3LA 3R9DA 3RPVA 3LE6A 4O96A 2PVNA 2PTKA 2R3HA 2XJ2A 4LGDA 4DINA 3F7WA 2A1AB 2WOUA 2V22A 3R21A 4MXYA 3FDNA 3IW8A 3PRIA 5CU2A 4IAAA 3ZZWA 2V62A 5M08A 2VV9A 2GFSA 4RX7A 1YI4A 4ZJJA 4Z3VA 4JI9A 4BR3A 2YLFA 5J5SA 3MSSA 4KRDA 2YCQA 3NW6A 4XRJA 2Z8CA 1CSNA 2UVZA 2ZB1A 4NYEA 3R7UA 2IVSA 1GOLA 3DBFA 3EQCA 4KS8A 3SKCA 4HJOA 3OCGA 3SVVA 3SGCA 3TDVA 3R04A 4KS7A 2XM9A 4TW9A 3NVKI 1SYKA 1URWA 4QQ5A 3RCDA 3AGLA 2IVVA 2WAJA 2P0CA 3ANRA 2IPXA 3U51A 1OIYA 4BCJA 4BIBA 4MQ1A 2ZYBA 4WBOA 4ID7A 4TYEA 4YP8A 4FT5A 3I79A 3MA6A 4YZCA 3TIZA 4QP8A 3D14A 4EBWA 4UWBA 2CNUA 1G5SA 4JQ8A 4IWQA 2EUFB 4GFGA 2GNGA 5HVKA 1CKIA 2PL0A 4MXZA 3E87A 2R3PA 2I0HA 2I1MA 4BY9E 1YOMA 3W2CA 4DAWA 4U97A 4NK9A 3RZBA 1P14A 3D15A 1SVHA 2XRUA 4N57A 1FGKA 4LRMA 2W1GA 4EOIA 2JDVA 3ZBFA 1G3NA 5HO8A 1JWHA 4BDGA 5J9LA 2I0YA 1TVOA 4LM5A 3R9RA 3ROCA 1OL1A 2PHKA 2BZIB 3I81A 5HVYA 2J9MA 2RFEA 5FTOA 5AUUA 3O71A 3OCTA 2PSQA 3COMA 3Q6UA 4FG7A 1ZLTA 4G3DA 4AP7A 4JNWA 3RAWA 3LJ1A 4CMUA 4ZZOA 5DT4A 2J0LA 2GU8A 4EHEA 3V5LA 3PIZA 3GU6A 3VUGA 1OBDA 3UMXA 1T45A 4MTAA 4UYAA 4YTCA 4K0YA 1Z9XA 5AUZA 3RAIA 3N9XA 4AE6A 1QPJA 3A4PA 1YOLA 3PUPA 3NLBA 4F9YA 2CGXA 2EVAA 4I6BA 4BTKA 1OM1A 2G2IA 4I20A 2WQNA 5I5ZA 2E9OA 3Q4ZA 2EWAA 3QHWA 1WCCA 4FG8A 5FM3A 5CF8A 3VS2A 5L6PA 3LKMA 4YC3A 3R9HA 5I0BA 4BZOA 2X1NA 3CE3A 4S2ZA 2FB8A 5HTBA 3KMUA 1M2RA 4CMOA 5A54A 5L2WA 2XKDA 4HZRA 3RWPA 2QOQA 2VTJA 5BUIA 2W1IA 1YXTA 4MVFA 1Q62A 4RLKA 5DG5A 4QD6A 1J7LA 4FZDB 2KTYA 4FICA 4KB8A 3MH1A 2PU8A 3L8VA 3KRXA 4ZTHA 2QNJA 3W2QA 3EIDA 3DLZA 2IZTA 4KINA 4AS0A 4IJ9A 4HW7A 4L45A 3IW4A 3LXNA 4FV1A 3DK3A 3AMAA 3GU5A 5AWMA 5LWNA 3NR9A 1KV2A 4F1MA 1XH9A 4X21A 3CD3A 5EG3A 3P08A 3QCXA 2B55A 3OWPA 4XCUA 3ZDIA 4XYFA 4EZ7A 4PL4A 3LQ3A 2ZMCA 1DI9A 1JKSA 2WU7A 2XVDA 4E4XA 4OAUC 4JBOA 3VQUA 3G9LX 5H3QA 1OL7A 3KRRA 3C4CA 1OITA 3FI8A 3HUBA 1ZOGA 2RSVA 1ZYSA 3BYVA 3COIA 3RP9A 3ENMA 4ZZMA 4QQJA 4F4PA 1M7QA 3HRFA 1UNLA 2VZ6A 3JVRA 3KN6A 1U46A 5FXSA 5GZAA 3DBEA 4NJDA 3Q96A 4ACMA 4FODA 5J95A 1JVPP 3EKNA 1FVVA 2ITUA 2C0TA 3WF9A 5E9EA 3R1QA 2J0MB 4K9YA 5DLSA 4I6QA 1F0QA 4X6QC 2UW9A 4DGGA 1WBPA 2VD5A 4FSZA 2GTNA 2C3IB 1Q4LA 4OBOA 4YSMA 3ZLXA 4RIXB 2FH9A 2WIPA 4WSYA 2CPKE 2UZOA 5DH3A 4J95A 4R3PA 4I94A 5HHWA 3T9TA 1PYEA 5I3RA 3ZRLA 4DGNA 1NT2A 1XH4A 4EKKA 1LEZA 3HV6A 4E1ZA 5EM5A 4AT4A 2VGPA 1FVRA 3HVCA 3LFEA 4G6LA 3EJ1A 2XJ1A 2XNEA 4DBNA 4CKRA 5F4NA 4ZAUA 2RFDA 1KE7A 3FI2A 3JY9A 3A4OX 4W4XA 3R7IA 5IH4A 3SA0A 2YM7A 4EHVA 2ZV8A 3HA6A 3EFKA 4A9TA 4ZY4A 4BRXA 2FSOX 4YZNA 2W1CA 3VBYA 4DFYA 3C4XA 1A06A 3QKLA 4AA0A 3I0OA 2EXMA 4AX8A 3FKOA 4H3BA 3W2PA 5HIEA 2WTDA 2BAKA 4KSPA 3QKKA 3V51A 3ZC6A 4JL9A 4D2SA 2PUPA 5CVFA 3TKUA 4PDSA 1H08A 4OT6A 1AQ1A 3FQSA 3M1SA 4L44A 5EI8A 1GZ8A 2WZJA 3R2YA 4B6LA 4KIKA 2R3LA 5HO6A 4FEVA 3BQCA 4IZYA 1A9UA 4DCEA 4C58A 2CHLA 1V1KA 2OJFE 3R01A 3ACKA 2BIKB 2HENA 4IAFA 3OWLA 3L9LA 2H6DA 2J90A 2YCFA 3NAXA 3RMFA 3A7JA 3ERKA 4QYGA 1JKTA 3KFAA 4I0TA 3BX5A 4MCVA 3FMNA 4CT2A 2VWVA 3RBWA 5AUWA 4ARKA 1YVJA 4FTIA 4LG4A 2C30A 4BBFA 5HTCA 1U59A 3U4UA 4A4OA 3E8CA 5EOBA 4L68A 4AGWA 3QGYA 4RIYA 5E8UA 5AR4A 4GSBA 4HCTA 4HZSA 2ACXA 3ZEPA 5M51A 3EFJA 1H07A 3NWWA 4FIHA 4FOBA 5CX9A 5AUXA 3QYWA 4FA2A 4QMQA 3PY0A 1R39A 3SG8A 2YZAA 2F49A 3GU7A 3V01A 4UB7A 4ZEGA 3SW7A 3UIMA 4NJ3A 5AA9A 3VS0A 4QTBA 4C4GA 4Z7HA 4EEVA 4C0TA 4X7QA 2R3GA 4RX9A 3IG7A 4OT5A 1H1QA 2X7GA 3BLHA 1JLUE 3BHTA 3NUXA 3RVGA 4ENXA 4AACA 2ZM3A 4HVSA 4BVUA 5CF5A 5GINE 3CQEA 4X6RA 4X3FB 1PY5A 2XIRA 5IUGA 4PMTA 3MB7A 1OIUA 4IEBA 4RT7A 2YJSA 4R7IA 1PW2A 3PXQA 4XP3A 4UX9A 3QXPA 3PJ1A 4IAYA 1MRUA 4X2JA 3V5QA 5TOZA 2AUHA 3UYSA 4G3EA 1FBNA 4OW8A 4Q5EA 2BCJA 3MFTA 4F7SA 3EQIA 4X0MA 3SC1A 3UG1A 4BCMA 2BAQA 1Q61A 2W4JA 5HE3A 3PDTA 4E6CA 2RF9A 3MPAA 4GIHA 4OTPA 3R8LA 1T46A 5E1SA 2YIYA 5F1ZA 4ZY6A 4R78A 2GS2A 2R3OA 3DT1A 4MYGA 5DWRA 4B4LA 2OSCA 4BI0A 4JRNA 5KMKA 2WTIA 3FMKA 2B9HA 3DZOA 4YO6A 3UZTA 2YCRA 3RK9A 1WBOA 3V5JA 1K9AA 3GEQA 2HZIA 4X2NA 5E1EA 3UPZA 5GIOE 4QNAA 2WMUA 2VX1A 2XRWA 4USDA 1IASA 5DNRA 4QMTA 5IUIA 2XK6A 3WZJA 3G90X 1YQJA 2A19B 3VUHA 3UNJA 4FTKA 4FUXA 4C2WA 5I9WA 3QLFA 3PA4A 3P7CA 3K5UA 2C4GA 3DB6A 3C50A 4R1YA 4S34A 4WG3A 4F70A 3FZPA 4EH3A 4X3FC 4AGCA 4NKSA 3F61A 2C0IA 3RCJA 2W17A 4E4MA 3HV5A 2W4KA 2OXDA 3P4KA 3R2BA 4FV6A 4RVLA 4L3PA 3VWAA 3S95A 3FY0A 5EI2A 3PJ2A 4FVQA 3GVUA 4JG6A 5AP1A 1WVWA 1JNKA 4RJ3A 4AGUA 3HDMA 3LCOA 5AAEA 4HVGA 5BUJA 3IDBA 4IW0A 3EZRA 3GOPA 3VS3A 5AFVA 5A4QA 4O1PA 4ITHA 2OO8X 4NM0A 3HV3A 4U40A 4DA5A 4W9XA 2FO0A 2W5HA 1M2QA 3LFNA 4RJ6A 4BCOA 3FZRA 2QLUA 3VNTA 5CSHA 3GQIA 1QMZA 4KABA 2C5NA 5LCKA 4YURA 2UUEA 5EH0A 4HPUE 5HU3A 4EWHA 3MFRA 5HD7A 4PRJA 2XKEA 5J1WA 3F3VA 3PXKA 4DGOA 2P2HA 1AD5A 5E92A 2AYPA 3BPRA 4OAVB 1KWPA 4D5KA 2OBJA 4YJTA 5K5XA 4BICA 5L8JA 4CQGA 2PVFA 3KMMA 3PG1A 3PP0A 4LOOA 5HO7A 4AFEA 4UMTA 1R3CA 3EQFA 3GFEA 3OROA 4II5A 2JEDA 2W7XA 3UO6A 4QP1A 5C26A 3TV4A 2HWOA 5M4CA 5BYYA 5BYZA 3N4UA 2W1EA 2F57A 3DKCA 3JVSA 3CGFA 2ITXA 3C13A 5C8NA 4BWPA 3PXYA 1XH6A 4U44A 3VULA 2VTSA 5CENA 4ANBA 4L00A 4I3ZA 2CN8A 4ACCA 5LXMA 4TN6A 1F3MC 5AAGA 3OT8A 2IWIA 3ZRMA 4WKQA 3KREA 4MXOA 3E5AA 4YNEA 4BCHA 5LCJA 4G6OA 2OKRA 4M0YA 3C5IA 1EH4A 5K3YA 5IA1A 4JQ7A 2X0GA 2OI4X 4Z16A 3MI9A 5JGDA 2HY81 5AP7A 3BBWA 5DGZA 4IWDA 4NEUA 3HRCA 3UGCA 5HLNA 3KY2A 4YJPA 3H4JA 2CCIA 3TUBA 4XNEA 2UZWE 1R78A 3F66A 4XV1A 3W1FA 2IZUA 4FIJA 3UP2A 3QGWA 3ZO1A 4EHGA 4I0SA 5A4EA 3M11A 4EOOA 4EZ3A 4FZAB 3R8PA 3T3UA 1IG1A 2ETMA 4EQUA 4O21A 4NWMA 3DOGA 5EFQA 5HCZA 5DT3A 4BZNA 2YDIA 3C5UA 3MFSA 3R0TA 4P4CA 5BYLA 2BIYA 4KA3A 1H1PA 3EN7A 1XJDA 3TZ7A 2OFVA 4FV0A 2J51A 3Q9WA 3LOKA 4YR8A 4ACGA 2WHBA 4EI4A 5LVMA 2O5KA 3S3IA 3WZUA 2ZJWA 4DEIA 5C1QB 4HGEA 2ZV2A 4HPTE 4M7IA 5ICPA 2ZDUA 2IN6A 3UO4A 2JIIA 5A6OA 4FZ6A 5BVNA 5A46A 4FSYA 5K0XA 4ZLYA 2BR1A 1UU8A 3RWQA 5M56A 1Y91A 3GCQA 3CBLA 2VNWA 3UPXA 4EJ7A 4M69A 4C2VA 4D58A 3QCSA 3G6HA 1XHAA 1FVTA 2X2LA 3NNWA 3Q53A 5CI6A 2OU7A 3EQGA 3KXMA 3W2RA 4IWPA 3V8TA 4PV0A 2QU5A 3VHKA 3HV7A 3WZKA 1NW1A 3F7ZA 3DAKA 3FZOA 4YLKA 4JJRA 1W82A 3DZQA 5IZFA 4EONA 3O17A 3MH3A 3MTLA 2UZBA 5FXQA 4G31A 3FZSA 3FY2A 4F6SA 2GHLA 4AG8A 3MIYA 1U54A 1BL6A 3VIDA 3CCNA 1S9JA 4Z7GA 2H34A 3UDBA 3MVHA 4NZWB 3IPHA 3R9NA 3QZIA 4BCPA 4GVAA 4EYMA 3LXPA 3FLWA 1GJOA 2UW3A 2VO7A 3OS3A 2GNHA 4H3QA 3VS5A 4AGDA 1OB3A 1PMNA 4BDCA 2Y9QA 4EK4A 1AGWA 3R02A 5DE2A 2HW7A 2VX3A 5IISA 2C47A 2JBPA 4M15A 4LQMA 5HGIA 4W4YA 3W8QA 3I5ZA 4RJ5A 1LUFA 1Q3DA 1Q8UA 4FGBA 4H58A 3TNHA 1Q8ZA 2OIDA 5KMMA 4G3GA 2GCDA 3LMIA 5LVOA 4BCFA 2BMCA 2OK1A 3TWJA 5HTIA 4RWKA 4DEEA 3LFFA 5IUHA 1WVYA 4EH9A 3I5NA 4QP7A 3F5UA 3QX2A 4DEBA 5K9IA 2WMAA 1E1XA 4WNMA 4XJ0A 2R3FA 3KXGA 2VUWA 5BVDA 2GTMA 2WQOA 4FYOA 3OXZA 2GDOA 4GMYA 2ITWA 2IG7A 5AM6A 5M53A 3U4WA 2WTKC 3P86A 2HCKA 5GJFA 5IEVA 4BWXA 5EQPA 2PVLA 1OPJA 3NIZA 4ANOA 2JC6A 2PZRA 5DI1A 4FKGA 4O0RA 4ZSAA 2WQBA 3LCSA 3TI1A 1WVXA 4R5YA 3LZBA 3I0QA 3MV5A 3HMMA 4M14A 4FTQA 4PQNA 5F20A 3VQHA 1WMKA 2OGVA 4V01A 4ALVA 4YZ9A 2O64A 2HZ4A 4CRLA 3BU6A 4C4HA 1XWSA 1OIRA 4IZAA 3UTOA 4JX3A 3A99A 3R7OA 5J7BA 3FLSA 4YTFA 4IC7A 4I93A 5CEKA 5CSPA 4LOQA 4IIRA 1FQ1B 4FT0A 2XIYA 2EU9A 2XM8A 1ZOHA 4FBXA 3QC9A 2GNLA 1OMWA 4ALUA 4GT4A 1I44A 2HXQA 4FTOA 4ONAA 5E8TA 3UNZA 4MNFA 4ANNA 5LVNA 4OR5A 3FAAA 4GS6A 2ITNA 5J9YA 4GG7A 3BELA 1OUYA 3M42A 3MYGA 3ALOA 4CRSA 4C3PA 3TNQB 3LCKA 4LRKA 2ITPA 2VRXA 2CSNA 2YJRA 3PE1A 3POOA 4K8AA 5AP2A 5FBNC 5FQDC 4KKGA 4ASZA 3T8OA 2C68A 3EL8A 4ANLA 2YA9A 2JDRA 2OH4A 4EQMA 2PVMA 4L52A 3DJ6A 3BE9A 3BGPA 4PMMA 3ZCLA 5F9EA 1PF8A 2VO3A 3CR0A 4RLLA 4DF3A 2BDWA 2IZSA 4JOAA 3FUPA 4IMYA 4G17A 4E7WA 2QU6A 4AZVA 1FMOE 4OTWA 2C5YA 5C01A 5LMKC 3P0MA 5CZHA 5C4LA 4RC4A 3DAJA 4DH3A 4TYHA 3LHJA 1GAGA 2Y0AA 2YISA 4CFNA 5CF4A 2PVYA 3BRBA 4XEYA 3UG2A 2NP8A 2O0UA 1WZYA 5ANDA 4DHFA 4FL3A 3R6XA 5EKOA 3PPZA 3AD5A 5TO8A 5FM2A 3NS9A 3TKIA 1VR2A 5DIAA 4BGHA 3NZ0A 4E5BA 2JAMA 1M52A 4IADA 4BTJA 2UV2A 1W84A 4CEGA 4QNYA 3D2KA 5ANIA 3QZHA 3E3PA 4B7TA 4YJVA 5ETCA 3VVHA 5IPJA 2VO0A 4LOPA 4YC6A 2WEIA 5ANOA 5CEIA 3ZLYA 3TKHA 4ANSA 4GW8A 2WMVA 1KOAA 4ZJIA 4BL1A 5IDNA 2JKMA 2NNWB 2R4BA 4JIKA 4TNBA 2G2HA 2C6EA 1M2PA 3HMOA 3V6SA 4C3FA 4ZS4A 2BRBA 3KXXA 3WF8A 4I24A 1BLXA 1XH8A 4YJUA 2J0IA 2I7QA 2JDSA 5EK7A 5H9BA 2GQRA 4DH8A 2RGPA 3NUPA 1VEBA 2B53A 3A61A 4QOXA 4O84A 5FTQA 5LJJA 4CZTA 2PVKA 5IA0A 4FSMA 4UZHA 3UNKA 3JR1A 4IB5A 5D9HA 5B2MA 4EK8A 2YFXA 3VF8A 1U4DA 5HE0A 4B99A 3QCYA 2Z7RA 2ZVAA 3QUEA 1Z57A 2OZAA 4D2TA 2C3JA 4QTCA 4XUFA 2JAVA 4ZLOA 3LJ2A 1YI3A 3QAME 3O96A 1PXKA 4LL0A 4YLLA 1CTPE 4DG2E 1OKWA 2REIA 3F69A 4OLIA 3DK7A 5LWMA 1ZAOA 4GV1A 4EZ5A 3QXOA 3BZ3A 1UVRA 4WNKA 1SVGA 4E73A 4F64A 5DYJA 4R7BA 3DKFA 4U8ZA 4EOJA 3R22A 5EYDA 1B39A 3CD8A 1YHSA 3G0FA 4GU6A 4D5HA 4WA9A 4HVIA 3DQWA 5TT7A 3ZUTA 3POZA 5CEPA 1TQMA 3KGAA 4QMLA 2YDJA 1P2AA 1RDQE 2BFYA 4RPVA 4UMRA 1BMKA 3DQXA 5EDPA 3AD6A 4QMSA 1QL6A 2CLQA 3O23A 3FMMA 4IM0A 4TYJA 3KMWA 3E8NA 5M4UA 3GC8A 3SW4A 3E93A 4O7RA 3AOXA 3O8TA 1GZKA 3RPYA 1V0OA 5KBRA 4FNXA 4ZOGA 4WNPA 4FTLA 4FR4A 3O8UA 4F7LA 5D12A 2WELA 4C02A 3ETAA 3MS9A 4IVAA 4ALWA 4DFLA 2OIQA 4NCTC 2IVTA 4FV4A 3QUDA 1PMVA 3OBJA 2GNIA 4I5HA 2PK9A 3ZDUA 3ZS5A 3HYHA 1Q8WA 5HIDA 4FEWA 2VU3A 4L3JA 2OZOA 4A9UA 4C38A 2E9VA 4BKJA 2WGJA 2WMQA 4JG8A 4NT4A 4RZWA 4A7CA 5CU0A 3R1SA 2O65A 4IB1A 1W7HA 5IEXA 4JQEA 4XOYA 3L8PA 4NKAA 4WSQA 1FPUA 2WEVA 3PJ8A 3HP5A 3BHVA 2XZSA 4FI1A 3WIKA 4IX4A 2HELA 2HWPA 2X9FA 4C4JA 5A9UA 5CWZA 1ZMVA 2R7IA 3EN5A 5HIBA 4HVHA 1ZMWA 3FXXA 4F9BA 3NGAA 3KVXA 5EW3A 2B52A 3DK6A 3QQHA 2OXXA 2R3RA 2R0UA 5D11A 4CMTA 4AU8A 1H1SA 5JFXA 3DTWA 2UW7A 2UZLA 3TUCA 4TY1A 3UZPA 3HAMA 3UMWA 5A14A 3KF7A 4HGSA 4RJ4A 4TYIA 2XIKA 3S1HA 5HLWA 1SM2A 3G15A 4JVGA 5M06A 1LP4A 4NL0A 2XNNA 3IW5A 4R7HA 3A7IA 3KCKA 4DN5A 4NM7A 2CKEA 3U55A 4I5CA 3GC9A 3IOKA 2VTOA 3OTUA 5FXRA 4F6WA 4WD5A 2UZTA 1JQHA 1S9IA 2NRYA 3FKLA 2OXYA 3A8WA 1OL2A 4IVCA 5DRBA 4DH7A 2JKQA 4DFUA 4FTJA 3E63A 4BGGA 3G6GA 4IZ5A 1M7NA 4D2RA 3O0GA 3F2NA 1Y6BA 3HL7A 4XH6A 2YACA 3R1YA 3EZVA 2WTVA 4FTRA 3DBQA 1GY3A 2CGUA 5T3QA 4YU2A 5L8KA 3QA8A 3RGFA 1CMKE 4ZTNA 2XCHA 2J0KA 2F9GA 5HNGA 3VJNA 2UW8A 3FLNC 3IK3A 3QD3A 3R28A 4RA5A 4AN3A 3W18A 3KRJA 4FSUA 4FK3A 3A60A 2C5VA 4Q9ZA 2Y8OA 1XBCA 5M4FA 5L6WL 3W8LA 4F9WA 5KHWA 4I4FA 4G9CA 4LMNA 4RMZA 2EXCX 4GH2A 4TWNA 3IW7A 4LV8A 3NX8A 4C8BA 1DAWA 3OWJA 5IA3A 3VW8A 5ETAA 3BHYA 1O6LA 5HESA 4EYJA 1UU7A 3PLSA 3SXSA 3UOLA 4BB4A 3V5WA 3ZU7A 5D1JA 3QRTA 2PYWA 3I7BA 5AIRA 4JAJA 5HG5A 5J8IA 5HCXA 2PPQA 3MW1A 1PXIA 5KMNA 3NYNA 1YKRA 3QRUA 5BVKA 3PIYA 4XOZA 4U79A 3RHXA 3ET7A 3DXQA 4GKIA 4JRVA 4A9SA 4JS8A 3MY1A 2C69A 1H28A 2PUIA 2PVRA 2BTSA 3A2CA 2CKPA 4CLIA 4NH1A 1YDRE 5IQIA 2YM5A 2JKKA 1SNUA 2ITZA 4D1SA 4RIXA 5IA5A 4F99A 4EK3A 3FL5A 4MHAA 3QKMA 5DPVA 5FLFA 2RL5A 1YXUA 1GIHA 1Y57A 1OZ1A 1PHKA 2B9IA 4M66A 4V04A 3TG1A 1UWJA 3KN5A 4GL9A 4BTMA 3W16A 2GQSA 3DU8A 4V0GB 3VO3A 5G6VA 2FUMA 3F3TA 4NUSA 3UBDA 4EBVA 1QCFA 2XF0A 2VWYA 4FZ7A 3HNGA 4ZLZA 3HMNA 4E20A 4OBQA 3UOKA 3Q04A 2VO6A 3TEIA 5M4IA 2CKOA 4G34A 2XA4A 4QMNA 5FTGA 1JAMA 3D83A 3RPRA 4DGMA 5L8LA 3LCTA 4ZY5A 4FKOA 3NNUA 1TKIA 3OC1A 5JFSA 3VS7A 2JKOA 2XKFA 2PMIA 1OI9A 2W1FA 5KZ0A 4YZMA 4O86A 1GNGA 4I41A 2H9VA 3UQGA 5C4KA 3LIJA 2W05A 1UNGA 4QMZA 4P2KA 4YC8A 3QX4A 3HV4A 5I9XA 4D0WA 4JT3A 4C7TA 4EQCA 4IAIA 3ZO3A 3GP0A 4KIKB 4MWHA 4RGJA 4UMQA 4UYNA 5FEEA 4M0ZA 5FWKK 3P7AA 2IW6A 4FOCA 3WIGA 4Y83A 5ACKA 2B4SB 5AM7A 3DFCB 1YHWA 3H10A 2VTAA 3C9WA 1KE9A 3SHEA 2C6MA 1OIQA 4G3FA 5DVRA 1J7UA 1JKLA 5HI2A 2A4LA 3VRYA 4E3CA 2QOLA 3TACA 5HVJA 5L2TA 2B9JA 2F7ZE 1H00A 3D5VA 4L42A 2C6KA 4AWIA 3GC7A 4JR3A 4GT3A 4MX9A 5CSXA 3VF9A 3WF7A 3B8RA 4BDKA 4FSNA 4MF1A 3NUUA 4F0GA 1CM8A 4L46A 4EH5A 4O6EA 3RPSA 5CSVA 4OTHA 4YUQA 2DUVA 2BZJA 3Q4TA 3R00A 4IAKA 1QPDA 4ZTLA 4PMSA 1FMKA 3AC3A 4ASEA 2X8IA 2RG6A 3VUIA 4XBRA 3LLAA 4HYUA 1J1CA 3G0EA 4I21A 2ZV7A 2CLXA 3CS9A 4WHZA 4A9YA 4BZDA 1HCKA 2VWUA 3BKBA 3DNEA 5FD2A 5A4LA 3EB0A 5AR2A 3ANQA 5KX8A 4FKIA 5E8VA 5ETFA 4QTDA 4JBPA 1JSTA 3EFLA 4LV5A 2BILB 2EXEA 5HCYA 3W2OA 1Y6AA 5EQEA 5AP0A 4A4LA 4P5ZA 4DTKA 3ZFYA 3AT3A 3WF6A 3HZTA 3EYHA 2RG5A 1BKXA 1ZZ2A 4N70A 4ERWA 2YIXA 3QD0A 5CNOA 4UV0A 4I1ZA 5CSWA 3REPA 5DMZA 1R0PA 2WTWA 2VWIA 2QR8A 2XS0A 2C5OA 5IQBA 5CQWA 3ZM9A 2X9EA 3CY3A 2BAJA 4FV7A 4BDHA 4FUYA 4PTCA 1VYZA 1YXVA 4XV9A 3V8SA 4HGTA 3DNDA 3ZMMA 4UMUA 3F9NA 5CALA 4KIPA 3H3CA 3S00A 4YBKA 2VTQA 4BCIA 4C3RA 2G15A 2UW5A 3CJFA 3WZDA 4FF8A 4FNWA 4TNDA 5TR6A 4XLVA 4GFMA 3GBZA 1YWNA 5M57A 5DRDA 4QRCA 2V0DA 5D10A 5KBQA 4LGGA 2WMWA 3LFSA 5HKMA 4GU9A 4AF3A 4RQVA 5J7HA 4FV5A 2CKQA 3Q2JA 4EH4A 2XB7A 3TTJA 5EYMA 4J96A 2C6OA 1W0XC 3Q32A 3NCZA 2QODA 4PP7A 3ZO2A 4UXQA 2XKCA 1J7IA 1OUKA 5HNBA 4XS2A 4OTQA 4FEQA 4QP4A 3ALNA 2O63A 4M84A 3VUKA 3ZZEA 1ZARA 5JSMA 4N6YA 3DA6A 3GU4A 3ZTXA 4C34A 2XIZA 2XIXA 1KE5A 4Y95A 3RJCA 4BIDA 4O7ZA 1KE6A 4HNIA 3SOAA 5HG9A 2PUNA 1IEPA 4E6DA 5CASA 2VTPA 4BC6A 2FSTX 3UJGA 5CANA 2CGVA 3JY0A 5J87A 1XH5A 1ZY5A 4K6ZA 2B7AA 4E5AX 4PMPA 2X2MA 4YBJA 1G8SA 4PF4A 4PDOA 2CN5A 2OZAB 3MVMA 3AGMA 4KKHA 4XG2A 4YJNA 2XK8A 3R8ZA 3E7OA 3FJQE 3QQUA 3PYYA 4FL1A 3KXHA 3NW7A 3R7EA 2QO2A 2PZIA 4G2FA 1WBVA 5EHYA 5HBEA 2WB8A 2ONLC 2GHMA 5BVWA 3QU0A 2R3QA 5ANGA 4BHNA 2JD5A 5EYKA 3GT8A 2BTRA 1QPEA 2EB3A 5AV4A 4E6AA 4O7SA 2GS7A 2HZ0A 2IO6A 4QPMA 2Y4PA 4EC9A 3H30A 4LUDA 2VTMA 5D7VA 4LL5A 3OD6X 3GC0A 3RHKA 3Q52A 3Q60A 3QLGA 2IZRA 2QD9A 4HCUA 3ENHA 3GFWA 4LGHA 3JYAA 2PE0A 4C35A 4EWQA 3CLYA 3BEAA 1NVSA 4JLCA 3BYSA 5AP5A 4YTIA 4ZTRA 4RFZA 4RVTA 4X3FA 3LXKA 3QQJA 4QPAA 3U8WA 3Q3BA 3COHA 4AN2A 4R3RA 4IX3A 4QMOA 4CFFA 5I9VA 3FZ1A 4A07A 3LM0A 3VBXA 3R9OA 2WMSA 5B7VA 1FOTA 3MJ1A 4QMPA 3LMGA 3B8QA 4FKSA 4G9RA 5L3AA 4J7BA 4XP0A 3E88A 2X2KA 3ELJA 3TZ8A 3BV2A 3KULB 3QQGA 3FC2A 3HKOA 4O91A 3CQWA 4Y8DA 5CT7A 3D7TB 4AZSA 5IU2A 2QOHA 4EOQA 4GUEA 4AW1A 4BI1A 1GZNA 1XBAA 4Y5HA 4ZTQA 3EN6A 3DV3A 4H3PA 4D2PA 4EL9A 4J98A 3EYGA 3H9RA 3HECA 3OEZA 2ZOQA 4TPTA 1XBBA 3U87A 4FSQA 3SG9A 4LMUA 3DDQA 4ERKA 3K3JA 3DPKA 1RW8A 3D2IA 2ESMA 4RA4A 2WTJA 1ERKA 5EHLA 2XMYA 3R8VA 2GQGA 2JIUA 3FWQA 4KIOA 4MBJA 1H4LA 3OP5A 5CT0A 5GJGA 2WXVA 2OJIA 3CPBA 4MBLA 4O0UA 3KCFA 4Y46A 5KZIA 2NPQA 2R7BA 4OTGA 3OCBA 3AC5A 2XBJA 3PSCA 2X6DA 3CEKA 5HG7A 5HG8A 3OWKA 5CVHA 3B2WA 2PMLX 4BGQA 3PLAE 3OW4A 4C4EA 4HVDA 3CQUA 4YJSA 3RINA 4B8LA 1RJBA 4RG0A 4KUJA 3OZ6A 4OTDA 3KXZA 5J1VA 3IONA 5I3OA 2Z2WA 4IACA 5A4TA 2BDJA 2F7XE 1PXPA 3WARA 3EN9A 2Z60A 1E1VA 4ZTSA 3U6HA 2DQ7X 3PWDA 3GGFA 2UZVA 2IJMA 4FIFA 2JLDA 3E64A 3CY2A 4BF2A 4XV2A 3DFAA 2QI8A 4IANA 3KEXA 3QYZA 5HORA 1Q8TA 4FIEA 4E4LA 3QTQA 3ZUUA 3CJGA 3OUKA 4CG9A 3SXFA 5CEOA 4IWOA 3F3ZA 4J71A 3F82A 1XKKA 3LM5A 4EOMA 3PWYA 1ND4A 4WUNA 3AC4A 4AUAA 3NYXA 4QYFA 3ULIA 5AP3A 2SRCA 4TTHB 4IC8A 2XK9A 1LR4A 4U45A 2I40A 3V5PA 5IF1A 1H8FA 2I0VA 1HOWA 2JIVA 4C57A 2UVYA 3ZRKA 5I4NA 1E9HA 3HEGA 4DFZE 3U6IA 4AW5A 3DBCA 5HX6A 2Y7JA 4DFNA 4RC3A 3BBTB 2QVSE 1URCA 5AADA 2WIHA 3FLQA 3P9JA 3VBTA 1V0BA 4JR7A 3D4QA 4YPSA 5IQEA 2OF2A 1U5RA 3IDCA 4O0YA 4O7LA 4F7JA 3OBGA 3TNWA 1PKDA 3TT0A 3DBDA 4CD0A 5EI6A 4Q9SA 3OW3A 4R77A 3ZLSA
chains in the Genus database with same CATH superfamily
2F7EE 2YIQA 1MP8A 5IA2A 3QBNA 4GUBA 3AT4A 3U6JA 5CS6A 3D94A 4IQ6A 4PP9A 2P3GX 3GXLA 4BJJA 4MD7E 2BRGA 5DR6A 4AZFA 5L6OA 3C4ZA 2XYNA 3FBVA 4FTNA 4R8QA 1REJA 4OGRA 4YJOA 3GUBA 5CU6A 1ST4A 3NIEA 3KA0A 4R5SA 3H9OA 4XG9A 3IQ7A 4EUUA 3C4FA 5IH6A 3WI6A 5TE0A 4CYIA 4M3QA 2X81A 3W32A 1JPAA 5AA8A 4BI2A 1Z5MA 2HIWA 5AX3A 3KRLA 1KSWA 3IS5A 3DS6A 3QF9A 5CEMA 4XG6A 5F95A 1ZXEA 2J5EA 3MY0A 4NTSA 4YZDA 5CAVA 4QQCA 2XNMA 4OTIA 4QP3A 4JDHA 5IKWA 5BVEA 2WMTA 5DA3A 4AOTA 1BYGA 5KKRB 4RVMA 1PMUA 3LXLA 5FRIA 4C61A 2WMXA 4FE2A 1H01A 3BWFA 2BKZA 5HU9A 2YIRA 3C4WA 3KULA 4MWIA 5JK3A 2J6MA 3LFAA 5CVGA 5DBXA 4Z55A 3EWHA 3QD2B 1OKYA 2OJJA 3D7TA 4R3CA 4E4NA 4KKEA 3DAEA 3AKKA 4AOIA 4DLIA 4MUQA 4RIOA 4BYIA 4FL2A 1RE8A 2ITVA 2Q0BA 2XEYA 3CIKA 2QG7A 4PDYA 2W9ZB 3PTGA 3DTCA 4U9AA 3VS1A 5JH6A 2PZYA 4O7YA 3EMGA 4W4WA 4NFNA 4ZJVA 3NUNA 3FC1X 3TV6A 2LGCA 4KD1A 3QL8A 3FMLA 4FZFB 2HOGA 1ST0A 2Q0NA 4AXDA 4ZXTA 4I6FA 4JAIA 3O7LB 1SMHA 2QOBA 3LPBA 3BHUA 4ITJA 4AQCA 3I6UA 1VYWA 2YM8A 4PPBA 4RFMA 3ORZA 4DH1A 4BDJA 3ORIA 2PZ5A 5IMEA 5M09A 2XJ0A 2GHGA 3MN3A 2G1TA 2ZMDA 3QWJA 3RNYA 5IQAA 3BLQA 3ZSGA 2ZV9A 4FT3A 4FKTA 4BCQA 3MESA 2R5TA 4W4VA 5CAUA 3QD4A 4AT3A 3NUYA 1JKKA 4G5JA 4ASDA 1NY3A 2PVHA 3P1AA 4KNBA 5EM6A 4LI5A 3OG7A 3WZEA 4B0GA 5KMOA 5C8KA 2WOTA 2LAVA 2PUUA 2XK3A 2YLEA 2I6LA 4PUZA 5AIKA 1CKPA 2WPAA 2P55A 3MDYA 4DG0E 3AT2A 3PVGA 3QTIA 4TZRA 3ZEWA 5BVFA 4HNFA 4O4EA 4UWCA 4YGAA 4QP2A 5AUVA 1BI7A 4EHZA 2YZLA 2UZEA 4RIWA 1NA7A 4KSQA 4Y5QA 4K33A 2IW8A 4QMVA 3BGZA 2X4ZA 3L1SA 2WFYA 4DT9A 4FVRA 4PL3A 4FKUA 2VWWA 4HYIA 4BHZA 4F7NA 3M2WA 3LJ0A 4IB0A 1Q97A 1OPKA 2R3MA 4PPAA 3UQCA 4L3LA 4Q2AA 4YNOA 2OLCA 4O7NA 2XBAA 4H1JA 4KWPA 4O1OA 4C59A 3BV3A 5HNIX 4O0SA 3BYUA 3SRVA 2ONLA 1OL6A 1YXXA 4EJNA 5ANKA 3OY1A 3JPVA 4I6LA 5BMMA 2BALA 4O4BB 3TL8A 5JKGA 3KF4A 1PXJA 5HQ0A 5LVPA 4FNZA 1Q3WA 5EDQA 2VN9A 1TQIA 4GK3A 3SLSA 2AQXA 5JZNA 4IXPA 3PJCA 3TTIA 3VRZA 1J1BA 4WBBB 4BIEA 4AA5A 4BYJA 2JDOA 2BHEA 5HOAA 4UMPA 4FGRA 5H8BA 3TM0A 5B0XA 2B54A 5C8MA 5IQGA 3U9NA 4DLJA 4FNYA 1Q5KA 2VTHA 2QHNA 1Q99A 4RQKA 1IAJA 5AUYA 1B6CB 4FKJA 1DS5A 3EKKA 2VTNA 4MAOA 4MH7A 5JN2A 3W0PA 3PP1A 4RVKA 4APCA 1H0WA 5JGBA 5L2IA 2QR7A 3LW0A 2GNFA 4G3CA 3BWJA 5E4HA 4FSTA 1YW2A 3I7CA 3IOPA 2V55A 2YDKA 4YZBA 4TYGA 5AEPA 2HAKA 1REKA 1XQZA 3HAVA 3BU3A 3QC4A 3MPMA 3K5VA 4H1MA 3BEGA 4ACHA 4CCUA 5HX8A 4I4EA 4G1WA 1Q8YA 3DKGA 3FLYA 3ODYX 4QO9A 4CKIA 1U54B 4D28A 4IM3A 5FDXA 2VWZA 1OECA 5IQCA 1GZOA 2PMOX 4BFMA 5CTPA 1SNXA 4O82A 3ZM4A 5AUTA 2E2BA 3SOCA 3UIBA 4G5PA 4CNHA 4ENYA 5CAPA 4QPSA 4DITA 3AMYA 4IZ7A 1IA9A 4FTUA 4JG7A 2PE2A 4JBQA 4YJQA 4F08A 3FHRA 3BGQA 4JXFA 1WBTA 3VW6A 3FXWA 2ITYA 5CU4A 4NCTA 5LARA 3W10A 4BKZA 5KNJA 3EOCA 4EK5A 5C27A 1W83A 2YWPA 3MTFA 4L8MA 4CYJA 3RAHA 4EORA 4PX6A 1XO2B 2CNVA 2VAGA 2E9PA 3MBLA 1PKGA 1YHVA 3CPCA 2Y4IC 3LLTA 5FEDA 4ANQA 1BL7A 3MPTA 3OXTA 2QLQA 5TKDA 3QALE 3DB8A 3QFVA 4FTCA 4U80A 4CSVA 3II5A 4IH8A 1K3AA 2XNGA 2YN8A 4LUEA 2R3IA 2WMBA 4L53A 4F65A 3NNXA 4ZZNA 3GNIB 2XUUA 4ZTMA 4F1TA 1G8AA 5G1XA 5JT2A 3D5UA 1IRKA 2C3KA 2H8HA 1XMLA 4J8MA 5FUTA 4UXLA 4U3ZA 4NM3A 5HICA 5FP6A 4YHFA 4IX5A 4L6QA 2XANA 3N51A 4D1XA 4HOKA 1H27A 3PZHA 4RWJA 1W2FA 3VBWA 4F0FA 3G2FA 4D4YA 3RNIA 4M13A 5HD4A 5M55A 3CTJA 4WIHA 3EH9A 4CG8A 2W1DA 3Q4UA 3KQ7A 4L9IA 1ZY4A 1PYXA 4C36A 4O4FA 1ZYLA 4WOVA 3UVRA 2Y6OA 3AMBA 3K2LA 3ORTA 3FXZA 2QURA 4F1OA 5M07A 2W96B 1FGIA 1P5EA 4D55A 3HGKA 3KRWA 3WF5A 5J79A 1DM2A 5GIPE 4PY1A 3BLRA 4M69B 4QMUA 4G16A 4FSRA 1FINA 2C6DA 4H36A 1UNHA 3QQLA 3TJDA 4IHPA 2VWXA 2RFNA 3QHRA 3V8WA 4PL5A 4XP2A 2CGWA 3TIYA 3CP9A 4FV3A 3FZTA 3QTWA 4GRBA 2UW6A 1A48A 3DGKA 3E92A 3FMJA 4AW0A 2R3JA 4XX9A 2ZAZA 4YSJA 5K4JA 3GB2A 1WBWA 3QA0A 4NTTA 2ITQA 2QOFA 4BDBA 3FE3A 4AXFA 4M68A 4KRCA 4J52A 1UWHA 3SXRA 4I6HA 3ZFXA 4XBUA 3OMVA 4R6VA 2XCKA 4F9CA 2X6EA 3CTHA 1XH7A 3TXOA 2QKWB 1NVRA 2Y6MA 4FK6A 5FEQA 2YEXA 2BRNA 2YITA 1P4FA 3A62A 3MFUA 2X7OA 4WO5A 4Y73A 5E8ZA 2JFLA 5J9ZA 3RI1A 2G01A 4OUCA 3C7QA 3TNPC 4ZK5A 5CAQA 4ZMEA 3KK8A 4RX5A 3V6RA 2OIBA 2YHVA 4O0VA 4U42A 3FEGA 3UOHA 4O81A 1PRYA 4QQTA 5ITAA 2XNPA 3O50A 4C62A 3KU2A 5DEYA 4MXCA 4EC8A 4EK6A 1ZYDA 3UDSA 2V7OA 5HE2A 3MH0A 4BDDA 5I9UA 1OVEA 3MVJA 5AX9A 3FPQA 4IDTA 5B2LA 2GS6A 3UO5A 4EH6A 3CKXA 1P4OA 1Q41A 1JSUA 3LQ8A 4UEUA 3SDJA 4E6QA 4CCBA 4TRLA 2FVDA 3E7VA 3OHTA 3EQRA 4Z9LA 5EYCA 3ULZA 2XP2A 3CKWA 3UYTA 3V04A 4DH5A 3ZHPC 2PY3A 5BVOA 3F2RA 4LFIA 2BDFA 1H26A 3FSFA 3QZGA 4O7VA 5JRQA 3FYKX 3QRIA 4ORKA 4DC2A 3C0GA 5A6NA 4G6NA 3KC3A 3V5TA 4FEUA 2C6LA 4LV7A 2X7FA 4YO4A 2A0CX 2VTTA 4M67A 3ZUVA 3PUFC 3SV0A 5JQ8A 3L9NA 2NRUA 3PY1A 5T68A 3VHEA 3MGYA 3DJ7A 3C4EA 3I6WA 5A4CA 1XR1A 4QTAA 3A7FA 3OXIA 4RWIA 4IE9A 4Y72A 4DGLC 3PXZA 2YM3A 3LAUA 4N6ZA 3Q4CA 4YHTA 3GCPA 3ZH8A 3ATTA 2XNBA 3QTSA 3PZEA 4RFYA 3UVQA 1KV1A 2R9SA 4JDIA 3RM6A 3DLSA 4K11A 5CNNA 4BDFA 4BWKA 5CXZA 3DXPA 1ZOEA 1UU9A 1Y8YA 2Z7SA 4O6LA 4ZSJA 4BCGA 4D4VA 1KUTA 1SVEA 3ZYAA 3HX4A 5FBOA 3I1AA 2BVAA 2EB2A 5HEZA 3FL4A 4LYNA 2R3NA 2FSLX 3UC4A 1RQQA 3UZRA 2JGZA 2UW4A 3ODZX 3AC1A 3O51A 4GJ3A 3D9VA 2KULA 1WBNA 5AP4A 3RK7A 3BYMA 4P90A 2W06A 2P4IA 3K54A 5C03A 2XK4A 4DG3E 1DI8A 4FC0A 4TWOA 5I9ZA 5JQ5A 1TQPA 4PPCA 3IW6A 5CAOA 5AV1A 4MK0A 4UZDA 4O7WA 4DHJA 1J91A 2BHHA 1O6KA 5GZ9A 1JBPE 3W0NA 4ANMA 3VBQA 5I9YA 4CT1A 4DEDA 2BZKB 3DCVA 4QP6A 4BBMA 2AC3A 5AR3A 5IEYA 2C1BA 3VUTA 2P2IA 3RZFA 3QWKA 4FV9A 2PVJA 4HCVA 2R2PA 5CZIA 4AZWA 2WU6A 3NRMA 2J2IB 3IGOA 4XG4A 2XK7A 3HMPA 4FKQA 3W33A 1NXKA 4M8TA 5AR5A 4PWNA 3NW5A 1UKIA 2XYUA 5C9CA 5FDPA 4AA4A 1YWVA 4L43A 2QHMA 5EKNA 4F78A 2V7AA 3L8SA 4IFGA 5BMSA 4DBXA 4N0SA 2WMRA 5DOSA 4QMMA 3QQKA 4F09A 1DAYA 5H2UA 5GNKA 2B9FA 5JZJA 3G33A 3HRBA 4E26A 4GK4A 5IA4A 4I22A 4ACDA 3PRFA 4XHKB 4DDIA 4USEA 3MB6A 1H24A 4WG5A 4F9AA 5AR7A 1IA8A 1UU3A 1QPCA 3EN4A 5E8XA 4C37A 3Q9XA 4FEXA 2ZB0A 4AOJA 3O2MA 4MNEB 1CDKA 3D5XA 1ZRZA 3DKOA 4QMYA 4U43A 3ROYA 3I4BA 3OOMA 3V3VA 4CZYB 3TUDA 3NVMB 3QTUA 4IX6A 2E9NA 3BIZA 3PA3A 4W9WA 3BYOA 2XH5A 4FVPA 5H8GA 4MD8E 4RJ8A 3S2PA 5LMAA 2VTLA 4D0XA 2G9XA 2UVXA 4FV8A 1VJYA 5EM7A 4AW2A 2X4FA 5LMBA 2I0EA 4O22A 3TNIA 4I92A 2ZM4A 2WTKB 5B2KA 1V0PA 2JITA 3H9FA 4HGLA 5KO1A 4I5PA 4TT7A 3RK5A 3ZBXA 4MD9E 5IQFA 4OBPA 4UN0C 1B38A 4FKWA 3C0IA 1BUHA 4QYYA 3LFDA 5AV3A 5E8YA 3Q6WA 3PPKA 2WTCA 4LRJA 2WKMA 3F6XA 3MY5A 2Z02A 3L9PA 4ZP5A 3VBVA 2YM6A 1NVQA 4OTRA 3R8MA 3A8XA 3DDPA 1K2PA 3P79A 4O2ZA 3TDWA 2GSFA 2OWBA 4GYIA 4TKSA 2OJGA 4XMOA 3VN9A 2RKUA 1MRVA 4HYHA 2O3PA 3A7GA 4N4SA 1PXOA 2IF8A 3QTZA 4PTEA 4C4IA 3PSDA 5GZ8A 3VUMA 3U54A 3SD0A 1PXMA 2XEZA 3NYVA 1YDTE 3QTXA 3ML1A 4TYHB 3OF0A 4D2VA 3SX9A 5BUEA 2R3KA 3SRVB 3DJ5A 3WE8A 1L8TA 2F2UA 3F2AA 2Y4IB 3MVLA 4RX8A 5K5NA 4AZTA 4GVJA 1W8CA 3FV8A 2FYSA 4CXAA 4ZSEA 5HBJA 3TMOA 4YPDA 2CMWA 2BPMA 3NMUF 4AE9A 4DFXE 3EQHA 5CY3A 3OVVA 3ORXA 1Y8GA 5CXHA 4FKPA 4JX7A 4D4SA 4E93A 3LFBA 3TN8A 3H0ZA 2W1ZA 3OEFX 4YLJA 3Q9YA 2X39A 3QZFA 4L01A 5FGKA 3FPMA 3CTQA 3R7VA 3ZXTA 3W2SA 2IVUA 4K1BA 2R64A 1KOBA 5K0KA 1GIJA 3KB7A 4RZVA 3PE2A 2FSMX 3R7YA 5IDPA 5JEBA 4CTBA 2QOOA 2YCSA 4EH8A 3WYYA 4MXXA 3P7BA 4FX3A 3CGOA 2YWVA 3TZ9A 2F2CB 2ITOA 4CFVA 4F63A 4HYSA 4UBAA 1OGUA 2CDZA 3WYXA 4QYEA 4DEAA 4GCJA 4TL0A 5EQYA 3ORMA 3COKA 3PFQA 2UZUE 4EOSA 5HZNA 4FTAA 3GENA 4IVBA 3WBLA 4NSTA 5E7RA 3F5PA 5F94A 3CSVA 4O0WA 5IH5A 4XRLA 4AXAA 1WAKA 4D1ZA 4E5WA 2C6TA 1PXNA 3NNVA 5AV2A 3WE4A 1H1WA 2VX0A 4W8EA 4I23A 5CI7A 2ZM1A 5CQUA 4V0GA 4IM2A 5DHJA 4PTGA 5E91A 3DXNA 1CKJA 3ZFMA 5KMJA 2ETRA 5EW9A 4O27B 3NUAA 4XG3A 2RFSA 4EH2A 5BX0A 5EDRA 2Z7LA 4FYNA 3H0YA 3PVWA 4CFUA 3ORKA 5L2QA 3MJ2A 4D2WA 1GIIA 3GU8A 4FT9A 3L9MA 1LPUA 2W99B 4S30A 4APPA 3UIXA 1X8BA 3NDMA 2HY0A 4RIWB 4GJ2A 4GIIA 4AZEA 4JDKA 3VC4A 4CTCA 4BJJB 3PPJA 3QRKA 4XG8A 4I5MA 2DYLA 3LMHA 2O2UA 3KK9A 4E8AA 2OFUA 1ZYCA 2X8EA 3G5DA 3RKBA 4BDEA 4MXAA 4AAYA 5CYIA 2PZPA 3Q5ZA 4FKVA 3GI3A 3OTVA 5BQ0A 4WRGA 3LFQA 4RJ7A 1MUOA 2HXLA 3G9NA 4J1RA 3E3BX 4ZS0A 5ANJA 1YI6A 3P78A 2WO6A 3GOKA 2OG8A 3LVPA 5ETIA 4ZIMA 3GCUA 3FSKA 4BTFA 1YRPA 1HCLA 2PMNX 1PMEA 1ZWSA 5KHXA 4NIFB 1F5QA 3BCEA 4X3JA 5AMNA 5KUPA 2W9FB 3ACJA 3NPCA 3CXWA 4GK2A 4V05A 5E8WA 5GJDA 5KE0A 2JBOA 4BCKA 4CFWA 2G2FA 4CFMA 3EFWA 3WOWA 2WNTA 2JDTA 4MKCA 4DYMA 3HA8A 4EOKA 2ZDTA 3OUNB 4L7SA 4QMXA 2QOCA 2VWBA 4O0TA 4I0RA 3HLLA 3AD4A 3IGGA 3P5KA 3PVUA 2UW0A 3MA3A 3O8PA 4U5JA 3FYJX 3UQFA 4XV3A 2YM4A 2XNOA 3QRJA 4NFMA 1JOWB 4R1VA 3FQEA 4U7ZA 4F6UA 5L4QA 3S0OA 3LFCA 5E8SA 3SQQA 3PSBA 2HK5A 2C1AA 2PWLA 1YXSA 1O6YA 4BDIA 3ITZA 3SAYA 4AAAA 5A3XA 2Z7QA 3KKVA 4QTEA 2VTIA 3N4VA 3AXWA 5JGAA 3FKNA 4M12A 3E62A 3PIXA 3Q5IA 4W8DA 4BBEA 1OBGA 1OKZA 4GFOA 4CFXA 2PE1A 4Q5HA 2ERKA 3IO7A 5E90A 4AT5A 4NIFA 4RC2A 5J5TA 3G51A 3D7ZA 4FT7A 3IECA 5AP6A 3NUSA 1U5QA 2QKRA 3DY7A 2J4ZA 3FMEA 2GNJA 3E8EA 2GPHA 2YAAA 2WD1A 2DS1A 2DWBA 4NW6A 4BKYA 4AFJA 1OKVA 4L67A 4BDAA 3OY3A 3HUCA 4RSSA 4H39A 5DR2A 1IAHA 5HE1A 3F5GA 3FLZA 5LMKA 2UZDA 3VUDA 5JFWA 4QT1A 3C1XA 4ASXA 3MH2A 3BE2A 3UOJA 3QCQA 4MNEA 1UA2A 3ORPA 2J50A 2VNYA 2YABA 3IDPA 4GT5A 4NU1A 5HLPA 4NM5A 5KKRC 5DEWA 3EQDA 4IAZA 5DN3A 1G8JA 3QTRA 4KAOA 4X2KA 3MWUA 4GYGA 2QG5A 4ZSLA 1R1WA 4TWPA 3WILA 1MQBA 4FIIA 4B9DA 1H25A 5JFVA 1M17A 4CVAA 4DTAA 4L7FA 4S31A 2BROA 4ZMFA 3UIUA 2BUJA 3TV7A 4RBLA 2JFMA 1J3HA 4PNKA 1LEWA 5DT0A 3HMIA 4YTHA 5IG1A 4CV9A 4CGAA 4C33A 5EM8A 4EUTA 3F3UA 2NO3A 3THBA 1STCE 2BRHA 3L8XA 4FG9A 5KMIA 4D9UA 3EQBA 2C0OA 3RM7A 3NCGA 3EHAA 4CQEA 3FI3A 4K2RA 5EOLA 2J7TA 4D4RA 3LQ5A 2X8DA 2WQMA 3PXFA 4YJRA 5DFPA 1MQ4A 2GMXA 3PA5A 3AG9A 4U0IA 3FMDA 3R1NA 3R7GA 2HZNA 5D41A 2W0JA 3GQLA 5H8EA 3ZXZA 3R30A 5IMXA 2YERA 3B2TA 2BKKA 2QC6A 3TCPA 3D5WA 1PXLA 5IQDA 3AQVA 4RWLA 5JMSA 3D0EA 2AC5A 3ZLWA 1JSVA 3BI6A 3F88A 4KBCA 3JXWA 5CLPA 4DEHA 3R71A 2CJMA 4IBMA 3OFMA 4RRVA 3NYOA 3PXRA 3ID6C 4BCNA 4GG5A 4MBIA 3NAYA 3UE4A 4P7EA 4YMJA 4P5QA 2BRMA 4WRSA 4O7TA 1ZMUA 3K3IA 2QOKA 2W5AA 4QP9A 4J8NA 3UVPA 3LCDA 4UWYA 1ZYJA 3E8DA 2YIWA 2CCHA 1L3RE 3ATSA 3AC2A 4IFCA 2J5FA 4FV2A 2OW3A 3F3WA 4K77A 4A4XA 3OOGA 2V5QA 2F4JA 2PULA 2C5XA 3PY3A 3C0HA 3I60A 4IJPA 2W4OA 4H05A 2P33A 5TF9A 2CNQA 2BZHB 2UZNA 5LQFA 4GKHA 1YOJA 4U81A 3UODA 5GHVA 3ZSHA 3R73A 4DTBA 3PJ3A 3Q2MA 3W55A 4AN9A 4D9TA 3R83A 4EKLA 4ITIA 3ZC5A 1Q24A 4FTTA 2YAKA 4RIYB 2WQEA 4KIQA 4DT8A 3JUHA 5DR9A 2FA2A 1SZMA 4A06A 3FI4A 4BN1A 3GCVA 3BHHA 1OPLA 2OJ9A 4GEOA 3HDNA 4JDJA 2OICA 1PJKA 3FMHA 3F5XA 3RAKA 4DCAA 4TWCA 2ETKA 2QCSA 1WBSA 3R63A 4KBAA 1MRYA 2HYYA 1WFCA 2GFCA 2BFXA 1YDSE 2QONA 4B8MA 2OH0E 3OT3A 4J53A 5CEQA 4Y85A 4MF0A 4IVDA 4UY9A 2XAOA 3EQPA 3BU5A 5FG8A 4CKJA 4X2GA 3RALA 1UKHA 4FKLA 3QUPA 4M97A 5CU3A 3OCSA 2QO7A 2OF4A 4PDPA 2QOIA 2ERZE 5ANEA 3TZMA 4CLJA 1OL5A 5KMLA 2O8YA 4CZUA 1ZZLA 2ITTA 3ORLA 3QQFA 2A27A 3S4QA 4IB3A 3AC8A 1APME 1O9UA 4WT6A 4X2FA 2E9UA 3BQRA 4ZSGA 3ZOSA 5AV0A 5HBHA 3RPOA 3ORNA 5D7AA 3VJOA 2HW6A 5LOHA 1M14A 2H96A 5ACBC 3KL8A 3RTPA 1I09A 5LVLA 2R0IA 4O38A 5BNJA 2FGIA 4TXCA 4XG7A 3VS4A 4DFBA 4MQ2A 5L2SA 5AAFA 5BPYA 2Q83A 3TJCA 1BX6A 4KBKA 2J0JA 3T9IA 5FP5A 4O2PA 3HP2A 5CF6A 3A7HA 1R0EA 4J97A 4C4FA 4USFA 3CC6A 4S33A 4O0XA 5K4IA 4O83A 4MEDA 3GCSA 1IR3A 4XLIA 4DEGA 3P23A 4J99A 4QMWA 2W1HA 1UV5A 3NSZA 2RIOA 1YWRA 2A2AA 1BI8A 1H1RA 4IDVA 2C6IA 5T6KA 3O7LD 4A9RA 4FMQA 3PG3A 4U3YA 1KE8A 2VGOA 2VTRA 3UP7A 4DDGA 3VAPA 4WG4A 5IQHA 3C51A 2IW9A 5JRSA 3IKAA 3FQHA 3MIAA 4DE4A 3PVBA 5KCVA 2B1PA 4WNOA 3P5JC 4FIGA 4EOPA 4F0IA 4CV8A 4FTMA 3ZSIA 3FHIA 1ATPE 2W5BA 3ZONA 4S32A 4K18A 2B0QA 4U6RA 5EHOA 3N4TA 1H0VA 2QQ7A 5AR8A 3R8UA 4FSWA 4EH7A 3UC3A 3VS6A 3KXNA 3O5AA 1W98A 4WUAA 4OTFA 3KVWA 3JS2A 4NW5A 4PNIA 5M44A 3Q9ZA 5EW8A 4JBVA 4YHJA 4QYHA 1VZOA 5AJQA 3ZO4A 3U9CA 4EOLA 3EL7A 3T3VA 4U41A 3NEWA 4JIAA 2QO9A 4UALA 4FKRA 2C3LA 3R9DA 3RPVA 3LE6A 4O96A 2PVNA 2PTKA 2R3HA 2XJ2A 4LGDA 4DINA 3F7WA 2A1AB 2WOUA 2V22A 3R21A 4MXYA 3FDNA 3IW8A 3PRIA 5CU2A 4IAAA 3ZZWA 2V62A 5M08A 2VV9A 2GFSA 4RX7A 1YI4A 4ZJJA 4Z3VA 4JI9A 4BR3A 2YLFA 5J5SA 3MSSA 4KRDA 2YCQA 3NW6A 4XRJA 2Z8CA 1CSNA 2UVZA 2ZB1A 4NYEA 3R7UA 2IVSA 1GOLA 3DBFA 3EQCA 4KS8A 3SKCA 4HJOA 3OCGA 3SVVA 3SGCA 3TDVA 3R04A 4KS7A 2XM9A 4TW9A 3NVKI 1SYKA 1URWA 4QQ5A 3RCDA 3AGLA 2IVVA 2WAJA 2P0CA 3ANRA 2IPXA 3U51A 1OIYA 4BCJA 4BIBA 4MQ1A 2ZYBA 4WBOA 4ID7A 4TYEA 4YP8A 4FT5A 1TZDA 5BV3A 3I79A 3MA6A 4YZCA 3TIZA 4QP8A 3D14A 4EBWA 4UWBA 2CNUA 1G5SA 4JQ8A 4IWQA 2EUFB 4GFGA 2GNGA 5HVKA 1CKIA 2PL0A 4MXZA 3E87A 2R3PA 2I0HA 2I1MA 4BY9E 1YOMA 3W2CA 4DAWA 4U97A 4NK9A 3RZBA 1P14A 3D15A 1SVHA 2XRUA 4N57A 1FGKA 4LRMA 2W1GA 4EOIA 2JDVA 3ZBFA 1G3NA 5HO8A 1JWHA 4BDGA 5J9LA 2I0YA 1TVOA 4LM5A 3R9RA 3ROCA 1OL1A 2PHKA 2BZIB 3I81A 5HVYA 2J9MA 2RFEA 5FTOA 5AUUA 1XMMA 3O71A 3OCTA 2PSQA 3COMA 3Q6UA 4FG7A 1ZLTA 4G3DA 4AP7A 4JNWA 3RAWA 3LJ1A 4CMUA 4ZZOA 5DT4A 2J0LA 2GU8A 4EHEA 3V5LA 3PIZA 3GU6A 3VUGA 1OBDA 3UMXA 1T45A 4MTAA 4UYAA 4YTCA 4K0YA 1Z9XA 5AUZA 3RAIA 3N9XA 4AE6A 1QPJA 3A4PA 1YOLA 3PUPA 3NLBA 4F9YA 2CGXA 2EVAA 4I6BA 4BTKA 1OM1A 2G2IA 4I20A 2WQNA 5I5ZA 2E9OA 3Q4ZA 2EWAA 3QHWA 4O4DA 1WCCA 4FG8A 5FM3A 5CF8A 3VS2A 5L6PA 3LKMA 4YC3A 3R9HA 5I0BA 4BZOA 2X1NA 3CE3A 4S2ZA 2FB8A 5HTBA 3KMUA 1M2RA 4CMOA 5A54A 5L2WA 2XKDA 4HZRA 3RWPA 2QOQA 2VTJA 5BUIA 2W1IA 1YXTA 4MVFA 1Q62A 4RLKA 5DG5A 4QD6A 1J7LA 4FZDB 2KTYA 4FICA 4KB8A 3MH1A 2PU8A 3UDTA 3L8VA 3KRXA 4ZTHA 2QNJA 3W2QA 3EIDA 3DLZA 2IZTA 4KINA 4AS0A 3VONA 4IJ9A 4HW7A 4L45A 3IW4A 4DHIB 3LXNA 4FV1A 3DK3A 3AMAA 3GU5A 5AWMA 5LWNA 3NR9A 1KV2A 4F1MA 1XH9A 4X21A 3CD3A 5EG3A 3P08A 3QCXA 2B55A 3OWPA 4XCUA 3PFYA 3ZDIA 4XYFA 4EZ7A 4PL4A 3LQ3A 2ZMCA 1DI9A 1JKSA 2WU7A 2XVDA 4E4XA 4OAUC 4JBOA 3VQUA 3G9LX 5H3QA 1OL7A 3KRRA 3C4CA 1OITA 3FI8A 3HUBA 1ZOGA 2RSVA 1ZYSA 3BYVA 3COIA 3RP9A 3ENMA 4ZZMA 4QQJA 4F4PA 1M7QA 3HRFA 1UNLA 2VZ6A 3JVRA 3KN6A 1U46A 5FXSA 5GZAA 3DBEA 4NJDA 3Q96A 4ACMA 4FODA 5J95A 1JVPP