3RI1A

Crystal structure of the catalytic domain of fgfr2 kinase in complex with arq 069
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
298
structure length
285
Chain Sequence
LPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Fibroblast growth factor receptor 2
publication title A novel mode of protein kinase inhibition exploiting hydrophobic motifs of autoinhibited kinases: discovery of ATP-independent inhibitors of fibroblast growth factor receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 285
sequence length 298
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ri1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ri1A01
3R8LA 2ACXA 2XK3A 4XHKB 1H1SA 4GIHA 2C1AA 3EQCA 4ZTQA 3SXFA 1TKIA 3OD6X 5J9ZA 2YERA 2GNFA 4RQKA 3CKWA 5C1QB 4O7LA 4GW8A 3BHHA 4RVLA 2WTCA 4CT2A 3L8XA 1H01A 4U7ZA 3WBLA 3ZO3A 3GC7A 4AP7A 2BRMA 4O0XA 4JBPA 4R5SA 4G3CA 5AR7A 4ZLYA 5EM6A 5JH6A 3ET7A 4QTBA 4RWLA 2XM8A 4QTDA 5I4NA 1SM2A 4PL5A 4I94A 3OG7A 3Q04A 3QTXA 3LLTA 1T45A 4PNIA 5C8MA 5LWMA 3N4TA 4K9YA 5CQWA 3V8TA 3FDNA 2W5BA 3DJ6A 4ITJA 2LAVA 3RNIA 4DH8A 5EDRA 3VS1A 2VGOA 4I6BA 2XKCA 3DK3A 2QONA 1W0XC 4HPTE 1XBCA 3QX2A 4ZLOA 4PMSA 4RVMA 3RKBA 5FTGA 3V6RA 2HW6A 2JD5A 3A7HA 4BCOA 4JRNA 5AP7A 4IWQA 4BR3A 2YABA 3HZTA 3I1AA 4TZRA 1XH5A 3FEGA 4FSTA 4BBFA 4OT5A 2YIRA 4BBMA 4M68A 3G9LX 3I4BA 1YKRA 4AGCA 4D4YA 5CAOA 3DLSA 4F9WA 4YU2A 2WMXA 3KREA 3R02A 4N70A 4FGRA 4JAIA 1ZARA 2FYSA 4HJOA 3DB6A 1A9UA 5I9UA 3BGZA 3HVCA 4KABA 4GU9A 3EJ1A 4NM0A 4PMTA 3BPRA 3ZXTA 2XP2A 3OS3A 3PPZA 2YISA 4F6WA 4FIGA 4QMXA 5LARA 4R78A 3RPYA 4RX7A 4YZMA 4O7RA 4FKOA 4BHZA 3R9OA 4F9YA 3WE4A 2GNJA 5AV1A 4O7VA 4ARKA 2FSLX 3E3BX 2VWBA 4HYUA 4AW5A 4DGLC 1IAHA 4C02A 4DA5A 1S9IA 4G5PA 4IJ9A 3RM7A 4AW2A 1V0PA 5J7HA 5A46A 2GPHA 3ITZA 2OXXA 5CF8A 4B8MA 2VD5A 4DHFA 2ETKA 2UZLA 4GYGA 4G1WA 2UVYA 2W7XA 2ETMA 1K2PA 1NY3A 3F7WA 3PTGA 2DYLA 3LXNA 2PZPA 1ZY5A 1WVYA 3UNZA 5AR3A 2BKKA 1ZYLA 3O2MA 4HCTA 4GG5A 2UZVA 3R00A 4F70A 2OICA 1OIYA 3LFNA 1NVSA 1H1WA 4ZLZA 4MX9A 3UZRA 2OGVA 5TO8A 2VWZA 2WOUA 2YJRA 3R7EA 4EQUA 4XBUA 4M84A 4E73A 4G3GA 1I09A 3AG9A 5HI2A 5AM7A 3F3WA 3FZRA 3PFQA 1FQ1B 4IW0A 5CT0A 5DWRA 3TJCA 4AF3A 3NRMA 2ZB1A 4HGLA 5K3YA 4AN2A 3CTJA 2W17A 4IZ7A 3MW1A 3TKIA 4E3CA 2PK9A 3CLYA 4MNEA 5FM2A 1EH4A 4R1VA 3KN5A 2BZHB 4D0WA 5KMOA 4EH9A 4ZTMA 5E8ZA 2GTNA 2PMIA 2XF0A 4FOBA 4FV1A 5DOSA 3G6HA 4GMYA 4FKVA 4NT4A 3RVGA 5EI2A 5ITAA 1PYXA 2C6MA 4FV4A 3QAME 4YZBA 5CAUA 2XIKA 3QTQA 3TIZA 4QMMA 3OEZA 5AMNA 3SHEA 4QMUA 4BTJA 2W4JA 3BBWA 5IUIA 4DH5A 5CT7A 1PXLA 4ANOA 1YW2A 2PVHA 5F4NA 2X2LA 2JDTA 4IWOA 4F09A 5HVJA 4YTFA 4X7QA 4FV8A 5CSHA 2X4FA 1B6CB 5IH4A 4FSYA 5IQHA 3QCSA 4RVTA 2IWIA 4QP6A 5IQGA 4J97A 3QXPA 3R9DA 2PVFA 4JX7A 3BI6A 3VNTA 1W98A 3EL8A 4FT9A 3SQQA 5C8KA 5G1XA 3ATTA 4QRCA 1BLXA 1Q3WA 2JITA 2VTJA 3CY2A 3RZBA 4USFA 1VYWA 2VX1A 3Q2JA 1Y91A 2HYYA 5H2UA 5E8VA 1H25A 4FSRA 4OTIA 4CQGA 5ETCA 5DPVA 3S4QA 1ZOEA 4CFUA 1JQHA 4TYJA 5JFSA 3U6IA 2CNUA 2CCIA 5D11A 1T46A 3DLZA 2OZAA 1YHWA 2QOBA 4UN0C 3LLAA 1Y8YA 1FMOE 1OBGA 4DTBA 4FSNA 3LMHA 1M2RA 4UALA 2OH4A 4ACGA 1RW8A 4E5AX 4J8NA 5FLFA 4MBIA 4MBLA 4S30A 5DVRA 5FEDA 4BF2A 1Z57A 4ZSLA 4AN9A 1AGWA 3MWUA 4E4MA 4E5WA 5CNOA 1UKHA 2AYPA 3HMPA 4FIEA 4CFFA 5FGKA 3K5VA 4IC7A 3DKGA 2QR7A 3HYHA 2OIBA 3BYUA 5HBEA 1UWJA 3LMGA 3MJ2A 1PXNA 4NSTA 1NT2A 3Q53A 2JC6A 3NS9A 3OCGA 4YLLA 5C27A 4AE6A 5AUTA 5ICPA 3A4OX 1PHKA 1SVHA 4NCTA 4IJPA 3QA8A 4G6NA 1B38A 3QQJA 3LXPA 4MQ1A 4ZY6A 4M14A 5IMXA 3R30A 1G5SA 1OBDA 4O38A 2H96A 3PLAE 2HZ0A 2R4BA 3RINA 1YDTE 5A9UA 2VX0A 1J7LA 3H10A 2IO6A 3PSDA 2C5XA 4ANSA 4YTHA 5BVWA 1JWHA 3H0YA 3R73A 5CU2A 1QPJA 3D9VA 3L9NA 4U43A 4IZ5A 3DXPA 4C37A 4YJUA 4UWBA 3U8WA 2OF2A 3ZEPA 4EH3A 2I0YA 2HWOA 4FEUA 4FEWA 5DRDA 2JIIA 5CX9A 5CY3A 5IQDA 4O0TA 3UPXA 3TDVA 4DC2A 1VEBA 4BZDA 5DT3A 5CEQA 4BDJA 2F9GA 4RIYA 5EW3A 4ZSJA 5LQFA 3QQFA 4IVDA 3W55A 5AV0A 2ESMA 2BAKA 4F0FA 4K8AA 2XIYA 1H26A 3WIGA 3O17A 4JG8A 2J51A 5JFWA 2CGXA 4I0TA 1OPKA 4FZDB 4AZSA 2UW4A 3EOCA 3G6GA 4FUXA 5HE1A 3AGMA 3E88A 4AWIA 1XH8A 2FH9A 3JVRA 4P7EA 4CKJA 5K0XA 3KCFA 5JT2A 3L8VA 4UMQA 2VZ6A 4YHFA 3GU5A 1FGKA 4QD6A 4D0XA 3RALA 2J0KA 3HX4A 2G01A 1CDKA 2Z7SA 1Q8YA 3DZOA 4FL3A 4I93A 4S33A 3AOXA 5HNBA 3WARA 4BVUA 4F08A 3TV7A 3NVKI 3BU3A 2BTRA 1QCFA 2JLDA 4G3EA 1JKKA 2E9NA 1YDSE 5AUXA 4Q5EA 4ZK5A 5BYLA 3AMAA 2OIQA 4IADA 4A06A 4BWPA 4BGQA 4ERKA 1OKVA 3UP7A 1JOWB 4M0ZA 4WBOA 3W32A 2X39A 3HV7A 2J6MA 2NRYA 2JAVA 2WEVA 4BWXA 4C4GA 5KBQA 5KHXA 5B2LA 3BIZA 5E90A 4ENXA 5FG8A 5I3RA 1OIUA 4H1JA 4C0TA 4FTRA 4O2ZA 2WXVA 3JPVA 4O6LA 4IM2A 4LI5A 3BBTB 5CVFA 3COHA 3PVWA 4CFWA 4BDIA 5CAVA 5HO6A 3L9PA 3ZUVA 3Q4UA 4XP2A 2QC6A 3NAYA 5I3OA 3T3VA 4ZZNA 5M55A 5DYJA 3RAIA 3QCYA 3QCXA 3NNVA 5D10A 1R0EA 3DNEA 4CZUA 4AU8A 3QQHA 3C50A 4TYGA 4J8MA 5ACBC 1KWPA 2GDOA 3DFAA 5BX0A 1GY3A 3FXZA 4FUYA 3JS2A 3HL7A 1OL7A 2OXDA 4MHAA 4HYSA 5FXRA 3UZTA 4KKHA 5HCZA 4W4VA 3N4UA 5L6OA 3AT3A 3QHRA 5KE0A 2Y6MA 3U4WA 4OTPA 3V5JA 2YZLA 4DCEA 2EXCX 4PQNA 3CD3A 5CLPA 2UW9A 1REKA 1KV2A 4KRDA 5EH0A 4BZOA 5LVMA 4MNEB 2BHHA 2GNGA 5LCKA 4PP9A 4Y8DA 1R1WA 2UZNA 3OROA 4I5PA 4C35A 5GZAA 1L3RE 5BPYA 3IW4A 3Q60A 3VULA 2QD9A 4J96A 1GZKA 3KEXA 2VWUA 3PXQA 3VUMA 4S2ZA 2E9VA 3C4CA 3KXXA 4KWPA 2Q0NA 4IDTA 5CU4A 3KGAA 5LMAA 4BICA 2GQSA 3CD8A 4GIIA 4IM0A 4U40A 4B6LA 3NNWA 3ZSIA 4FSZA 4IHPA 4PRJA 4QMTA 2GFCA 3AMBA 2XMYA 2X1NA 3ZTXA 4F7LA 2C1BA 2YDJA 3F6XA 1M14A 3GC0A 1CMKE 3FI2A 3KRWA 2HW7A 5F9EA 5CI6A 5KMJA 3T8OA 1SYKA 5A6OA 4OW8A 2BROA 5GZ9A 2WTKC 2UW5A 3IGGA 3R22A 4NFNA 4XV2A 3RGFA 3GCSA 2WTVA 3UZPA 3P9JA 5E8TA 3C5UA 4JDJA 4E6AA 4EH4A 2YWPA 5CF5A 1Z5MA 5IA0A 3LCKA 5L8KA 3MY1A 4MWIA 3ACJA 4R1YA 3FZ1A 4A7CA 4IAZA 3P0MA 3HEGA 1QPDA 2WB8A 5C4KA 4FT5A 4TT7A 4F7NA 4XG3A 3EH9A 2GHGA 4XRLA 1UV5A 2WTKB 3NIZA 3HRCA 5AAFA 3Q5IA 2OZAB 2ITVA 4NM3A 4EZ7A 1JVPP 4NCTC 3NYXA 3ZO2A 2B54A 2W96B 2YCSA 2QOHA 5EW8A 4UWCA 3GU6A 4FKGA 2PMLX 4DGOA 2CLQA 4RBLA 4G9RA 4KIQA 4EK6A 3UNKA 2XA4A 4B0GA 2F7EE 4E4NA 3R28A 5K4IA 4HVDA 4FT7A 2JKKA 3A61A 4D4VA 4R77A 2YAAA 3SW4A 4IXPA 5HD4A 2JGZA 3V04A 3R7GA 4FV2A 2IW6A 3R8ZA 5BVEA 3DU8A 4RZWA 3PVGA 4BDDA 4P4CA 4DYMA 4JQEA 5D9HA 3QTWA 3ORXA 1IA8A 2YLEA 5CTPA 2LGCA 4TYHA 3GENA 4KBKA 4ID7A 4EORA 2PYWA 5A4QA 3R71A 1K9AA 3LAUA 3EKNA 3KF4A 3QBNA 4TN6A 5IA3A 2BAQA 3ID6C 3VBWA 4BCIA 2PE1A 5E92A 2BRHA 5J5SA 2F2UA 4YTCA 3OWJA 3ORNA 2QOFA 2RF9A 3R2BA 2VUWA 3R9HA 3W2PA 4O0WA 3ODZX 1STCE 4UZDA 5CENA 1PXMA 5CEPA 5CSPA 3UIXA 2YFXA 2YDKA 1YWVA 2PMNX 2C69A 2I7QA 5J79A 4XNEA 4BBEA 3G9NA 4IWDA 5GJFA 3G15A 4WKQA 3FMNA 5FDPA 5JGBA 3SD0A 3LFQA 3MIAA 4K6ZA 2OKRA 4IH8A 3C0HA 2ZDTA 3O7LB 4M97A 4RIYB 4Y5QA 2ZM4A 4A4XA 4BDFA 5FQDC 4W4XA 5AP1A 2PWLA 4C2WA 4TWOA 1U54A 3UVPA 2VNYA 3IW6A 2B9HA 4RJ3A 3HKOA 4LRJA 2P33A 4WG5A 3F5GA 4M15A 3R7OA 3KXGA 3TZ9A 2ZV2A 3FL5A 2Y0AA 3S95A 4HNIA 2I6LA 2PUUA 3CJGA 4LOPA 4ANBA 4UMUA 3G0EA 2CLXA 4OBOA 2A4LA 4L43A 1IASA 4C58A 2O8YA 3Q32A 4DEEA 4EHVA 2FSOX 3I6WA 2RSVA 4I21A 4QTAA 1OL1A 3BWFA 3WZJA 2Y4PA 4Q2AA 4AFEA 4ANNA 3OUKA 3PSCA 5A4LA 1PMVA 3ANRA 4ALUA 3KVXA 2EXEA 2G1TA 2QG5A 2HAKA 2RFEA 3SW7A 3QHWA 3R8PA 3D7TA 4DGGA 2WOTA 5AV2A 1XHAA 1QMZA 3ALOA 4RC2A 4LGDA 4QP2A 4TNDA 3ZOSA 5EHLA 3V5LA 3W2SA 4ZZOA 3HGKA 4ERWA 2G2HA 2XKEA 5DRBA 4H3PA 2QKWB 5KZIA 3MPAA 1Q62A 5DR9A 5AJQA 1Q61A 5ANOA 4E7WA 4EK4A 4OT6A 2BFYA 4QO9A 5E4HA 5EW9A 1JSUA 3UJGA 3I0QA 3H9FA 3LM0A 5E1EA 4C4JA 4GH2A 2YIQA 3ZSHA 4FV9A 2F7XE 4WNMA 4AG8A 4WA9A 5DEYA 4FGBA 1W82A 3OW3A 4FKTA 3Q3BA 4BIDA 2R7IA 5KMNA 1LEWA 3VHKA 3BHUA 4YC6A 3QF9A 4QP1A 4AW1A 3PE2A 5DFPA 3LFEA 4U5JA 3PZHA 3PXRA 4FZAB 4GT5A 1XQZA 4KBAA 3II5A 3SOAA 4JL9A 5I5ZA 4B9DA 2C3JA 5KUPA 5EM7A 4PUZA 3LFCA 4RC3A 4EUUA 5HG7A 1YHSA 2IZTA 4ITHA 3U51A 1NVRA 2BZIB 2WIPA 4W4WA 1W83A 3I5NA 5HQ0A 1OIQA 3FKOA 2ZMDA 4L68A 4NW6A 3SAYA 4JBVA 2FA2A 2W9FB 3L1SA 3OCTA 4W9WA 5IG1A 4EOLA 4JG7A 4E26A 5A4CA 3HMNA 4DT8A 3HP5A 4L9IA 3QUDA 4O86A 1KUTA 3C0IA 4FZ6A 4U81A 4KD1A 5GJDA 1Q8ZA 4QQTA 3WZDA 1J1BA 4NEUA 3V5QA 4ACMA 5HG5A 2Y4IB 4KKGA 3UVQA 3ZUTA 5JZNA 4NYEA 4GVAA 1QPEA 3TNQB 4U6RA 4X3JA 2DUVA 2WD1A 4IFCA 4C38A 4EYJA 4MWHA 1BUHA 3OXZA 4ANMA 4OBQA 4HW7A 2RIOA 5BVOA 3NUXA 4IB3A 3MI9A 4C2VA 4AZFA 4NL0A 2ZYBA 4MH7A 3ZONA 3CEKA 4S31A 2O3PA 4D9UA 4Y83A 3KFAA 5HORA 4LUEA 1W7HA 5J8IA 4U3ZA 3R1NA 4GFOA 3SXRA 2PMOX 5E7RA 2WHBA 3GCQA 4WSQA 2C0OA 4BDBA 1DI8A 2CCHA 3Q9XA 4O7NA 4L7SA 2O64A 2RL5A 2WMSA 4F7JA 3RAWA 4I20A 5IEVA 5M56A 4FKUA 1A06A 4GK3A 4L67A 3Q52A 4RX9A 3LOKA 1P4OA 2C68A 2F57A 4UEUA 4CFMA 1H27A 2OBJA 4Y73A 4QYEA 2CHLA 5AFVA 1PKDA 2VTRA 3GU4A 5HCXA 4PPBA 4EJNA 3HV4A 3MFTA 4S32A 5ANIA 3WYYA 3E93A 2RKUA 2NNWB 2GS7A 4PMPA 5BYZA 2VO7A 4O96A 2QR8A 4QTEA 4KINA 1WBOA 1GZ8A 2VRXA 4JIAA 2X2KA 3FLZA 5F1ZA 1WBTA 4LV8A 3JY9A 4XUFA 3VJOA 2XB7A 3RAKA 3VW8A 2B0QA 5H8EA 3WF6A 2EB3A 5CS6A 4AZVA 4F7SA 3BX5A 2CN8A 3EFJA 1OMWA 4EK5A 4QMOA 4A9TA 3TT0A 4BYIA 1VJYA 3WF9A 1RDQE 2PVNA 4FK3A 2B53A 3TI1A 2CNVA 5KBRA 2XUUA 3KRJA 4NK9A 3U54A 4HGEA 4BIBA 3C7QA 4Y5HA 3KXZA 1Q24A 4NTSA 5AP5A 4BFMA 1R0PA 2X7FA 5BVKA 5AP2A 5BQ0A 4TYHB 4O7SA 3IQ7A 4IX5A 1PXKA 4YGAA 5CYIA 3RI1A 3VUDA 2IVUA 4DBXA 3UTOA 3WZEA 3S00A 3UO5A 3F3ZA 4GK2A 3POZA 2QOIA 2ERKA 4FTIA 2GTMA 5EOBA 1WMKA 3F5XA 1PF8A 4XV1A 4EOPA 1Q97A 3R1YA 1Q8UA 1TQIA 4MXOA 2JEDA 2RG6A 3IDBA 4MD8E 2VO0A 3EHAA 3KMUA 3MN3A 3PXFA 4O0RA 4LL0A 4QMWA 4BI2A 4LGHA 4PMMA 5CQUA 3A7FA 3WZUA 3LQ8A 5HICA 3TV6A 3TL8A 1J7IA 1GIIA 2J50A 4NWMA 3KU2A 3RWPA 4FI1A 4BTKA 4Y46A 3RNYA 5HESA 3VS0A 2W9ZB 4GG7A 1U54B 2PE2A 3CR0A 3PLSA 4B8LA 1ZXEA 5HIEA 2C5NA 3Q6UA 3C4WA 4L3PA 4EH5A 1H1RA 5HKMA 1YRPA 5JGDA 1OL5A 2I1MA 2YIYA 3HV3A 3QGWA 4EH7A 5BUIA 3LKMA 3TDWA 2W4KA 4E5BA 4ACDA 4YJRA 4JVGA 3H0ZA 3MH2A 3NW5A 3Q6WA 2IVSA 2XIRA 2QQ7A 3V5WA 3ORPA 3HP2A 5BUEA 4X2GA 3UE4A 3C5IA 3UNJA 4O91A 4AA4A 3M11A 3F2RA 3D4QA 4IX3A 3D94A 2PY3A 2C5OA 3VUGA 4LMUA 3D7TB 4R7IA 4EKKA 2AC3A 3HA8A 1G3NA 5EQYA 2G2FA 3KXMA 3BQRA 4YC8A 4QPMA 5AUUA 4AGUA 3AC1A 4H58A 3U55A 3IDCA 1PXPA 4AOTA 3E8EA 3VBVA 4QMQA 4WSYA 3FKNA 3D15A 1ZAOA 3DA6A 3G0FA 3OF0A 4O21A 3MFUA 4BCFA 3DXQA 4FKLA 3GCVA 5KO1A 2XJ1A 4FTUA 1I44A 4ZSEA 4QQJA 5TT7A 4XX9A 4CGAA 5GIPE 2VTIA 1DI9A 2W4OA 4YUQA 3C1XA 2W1IA 1OITA 4J98A 5IUGA 1OPLA 3COIA 3IW7A 2JDSA 3GOKA 1YI6A 1YWRA 3O96A 3VQUA 1O6LA 5CALA 4OLIA 2B52A 3B2TA 2X4ZA 3ORIA 2OW3A 3IG7A 3BZ3A 3LQ3A 3L9LA 2HY81 3ZSGA 2QODA 4DEBA 4EWQA 5AAGA 3ORZA 1OL6A 2EVAA 4RRVA 5T6KA 2BVAA 2J0MB 2I0VA 2J90A 5IKWA 4JAJA 4DEDA 3QFVA 1PMEA 4BRXA 3PVUA 1X8BA 1OPJA 3O8UA 3R01A 5HZNA 4XP0A 3A7JA 4EWHA 3ULIA 2NO3A 3FMEA 4O83A 3W1FA 4YBKA 3C4EA 2WQMA 2BALA 5ETAA 4BCKA 4D2RA 2QOCA 3RHKA 4USEA 1U5RA 3IOPA 3O8PA 3NR9A 4FR4A 1G8AA 1NXKA 4QP3A 5M57A 2OH0E 4HVGA 4KB8A 3ANQA 1KSWA 1H08A 4G34A 1Q5KA 5CSVA 1ERKA 2AUHA 2CPKE 4J52A 3OXTA 3S3IA 3SKCA 4RFZA 3NEWA 4YSJA 2X6EA 3DOGA 3BCEA 4D1ZA 1PXIA 2C3LA 3QCQA 3QD4A 4CYJA 5FBOA 4JT3A 4EOSA 3IKAA 4MXYA 3OCBA 2UW8A 3NYOA 3ERKA 2JAMA 2YJSA 4U45A 3OY3A 3CSVA 4NJDA 1XH7A 2BZJA 1H24A 1V0OA 3OBJA 3PY0A 3U87A 5JRSA 4GFMA 3ENHA 1YI3A 1CKJA 4LRKA 4AFJA 5LMKC 4EEVA 4KA3A 1FINA 2ZOQA 3DGKA 4FV6A 5JMSA 2C6EA 2O5KA 4G9CA 3TKHA 4IZAA 1Q8WA 4RA5A 2X9EA 4RMZA 3WZKA 3BV3A 3I60A 2WQBA 4Z7HA 1Y8GA 1MP8A 3DBDA 3EQPA 4BDEA 4PDYA 2WELA 1YHVA 2ZDUA 3SG8A 3NUSA 3HV6A 2PZ5A 3QZIA 2C6KA 5KMMA 5EQEA 5FP6A 4C61A 3SG9A 5H8GA 2W1CA 4FEQA 4PTEA 3E3PA 5CAQA 1PMNA 3THBA 4H39A 5BVFA 3GFEA 5TE0A 2JDVA 1PJKA 3D5VA 4FIJA 4IACA 3MVMA 2B7AA 3DNDA 4UY9A 1W8CA 4FV5A 4X6QC 3AC4A 3NCGA 4HPUE 3S2PA 4ASXA 1YVJA 1YQJA 4Q9ZA 4F65A 4FTTA 4FYOA 2R3RA 3F3UA 5F20A 5IQIA 1ZOGA 3FI3A 1FVTA 2ITWA 3T9TA 3HMIA 3P08A 3ZUUA 5T68A 3W33A 3UYSA 5DA3A 5ANEA 2XIXA 5IEYA 5IQBA 2W5HA 4AZWA 2JKQA 3MVHA 4YJPA 1BL7A 3FMHA 3A60A 4FIIA 4IB1A 3LFBA 3VS5A 3ZFXA 3DDPA 3QA0A 4YTIA 5KZ0A 5CEOA 3RCDA 3GFWA 1ZYJA 5B2MA 4M69A 4GJ2A 4YHTA 4PP7A 2GHLA 2R3LA 4O7ZA 1MRYA 2YCFA 3B2WA 3R0TA 4RJ6A 3FPQA 2Q0BA 4EYMA 5JRQA 4QP8A 3OFMA 4LGGA 3KQ7A 1JSVA 3W2QA 1VR2A 3FLSA 4U42A 4LV5A 4MAOA 3TZ8A 3UGCA 3CTHA 3TV4A 2PVRA 1S9JA 4MD7E 3P86A 1NA7A 5AV4A 3TN8A 1IG1A 2CGUA 3I0OA 3WI6A 4JQ8A 1NW1A 4YO6A 3V5TA 2XEZA 4BGHA 4ZP5A 3KRXA 5J9LA 1M52A 4EJ7A 3BLRA 5AR2A 2ZJWA 2ETRA 1UNHA 4ZMFA 4WRGA 5HTCA 4PPAA 2GQRA 1FBNA 5H3QA 4CG8A 3UVRA 4V0GA 4DFYA 4U9AA 3Q4ZA 1YWNA 3L9MA 2WTDA 4DFUA 3NDMA 5JQ8A 3P7CA 4FTCA 3VBXA 3LFDA 4WRSA 2UVZA 4CZYB 2XM9A 3QQKA 3VBTA 4ALWA 2WQOA 3COMA 1UNLA 4UMPA 5EFQA 1MQBA 3EIDA 2Y6OA 2YEXA 4WG3A 3W8QA 3VUTA 3P7BA 2WQNA 2W0JA 2OJIA 2OJGA 3DZQA 5CXHA 5J1WA 5FUTA 1V0BA 3KULA 3EQFA 2QHMA 2XJ0A 3EFWA 4H3BA 4L00A 4FTQA 2WIHA 2C6LA 3TUCA 3IK3A 3RHXA 3ZCLA 4ZTSA 5L8LA 4DTKA 4DN5A 4NJ3A 2UV2A 5DR2A 1HCKA 2PZRA 1SMHA 3KF7A 3MDYA 4PL3A 2X6DA 3ZFYA 4JJRA 2WNTA 3DTCA 4ASDA 2VWVA 5KKRC 3H30A 3QD0A 2XNMA 4N0SA 4NUSA 4YURA 5FWKK 3E5AA 3VS2A 2Y9QA 4D2SA 4U44A 4HVIA 4YPSA 2KTYA 4UMRA 4LQMA 4EZ5A 3NUUA 2GSFA 4Z16A 4NKSA 2CKEA 5FP5A 4TWPA 3RK5A 3R8MA 4RGJA 5L8JA 4AT5A 4APPA 3HUCA 4F1MA 3LE6A 3MV5A 4GV1A 3DK7A 5DLSA 4WOVA 4FX3A 5KKRB 4RIOA 5BVNA 5IEXA 1KOBA 2CN5A 2OO8X 2IG7A 5K9IA 4GUEA 3UG2A 3V8WA 3EQBA 5KMLA 4D4RA 2B9IA 2QCSA 4NM5A 4F63A 4I23A 5HOAA 3BHYA 3F5PA 4D55A 4I6FA 2XBJA 2NRUA 1PXJA 1YXSA 2VU3A 5FXQA 4ZS4A 2OZOA 4JOAA 5A54A 3OHTA 4EKLA 3SOCA 2YITA 4O27B 4BCMA 3LPBA 3V3VA 2F2CB 1GIHA 2I0HA 3BELA 4RWJA 2W1HA 3PUPA 1GZNA 3QRTA 4AN3A 4DH1A 4NH1A 2FSMX 3VW6A 2YM4A 1FGIA 1LP4A 2GFSA 5D1JA 4CKRA 4YO4A 4MXAA 2RFNA 4IQ6A 1H00A 1WBWA 2GS6A 2J0JA 3NYNA 3LXLA 4LG4A 5M4CA 1RQQA 4O7YA 5HBJA 3ZM9A 1KV1A 2IVVA 3FXWA 3TNPC 4D1SA 3UQGA 5ETFA 3GOPA 4EH2A 2W1ZA 3BEGA 3VF9A 3DPKA 3F61A 4CEGA 3BRBA 2DS1A 5E8YA 2WO6A 3OUNB 1Q4LA 4WT6A 4C34A 3S1HA 3AT4A 4I1ZA 4EHEA 4L44A 5M08A 3LQ5A 5DEWA 5D7AA 2BR1A 1SVEA 4EOOA 4RA4A 4EI4A 2UW0A 4TL0A 1E9HA 4G31A 5C4LA 5AP0A 4C33A 5EOLA 5AR8A 4A4OA 4AE9A 2Z7QA 2WMUA 2X7OA 4OR5A 1H1PA 4FG8A 4M67A 3ZHPC 2ZM3A 4OTRA 1M2QA 2Z8CA 2R3PA 2YIWA 4X21A 2BDJA 3HA6A 3DDQA 4I22A 4TKSA 3VVHA 3ZM4A 5CF4A 3SVVA 3FV8A 4C3RA 1H1QA 2OSCA 5ANJA 1KE5A 2BKZA 2WAJA 1PXOA 3N4VA 2V0DA 3UC4A 2VTTA 1CKPA 3LFAA 3I5ZA 4RX5A 5KCVA 3LFSA 3WYXA 3ELJA 3LJ1A 2W5AA 1YI4A 4AZTA 1JAMA 4MEDA 3MB7A 2JFMA 2A2AA 2G2IA 1Y6AA 3E8NA 1OUYA 4P5QA 1TVOA 4FKWA 4JR7A 4CFVA 4F0GA 4QOXA 4BC6A 5K0KA 5IDNA 1AQ1A 3HNGA 2R0UA 2GQGA 3N9XA 4BCNA 4EC8A 3GQIA 5IA1A 3UQCA 1DS5A 4NFMA 3F9NA 1URCA 2C6OA 5E1SA 4IX4A 3BU5A 3TZMA 4X2JA 1ND4A 3NMUF 2WTWA 4FF8A 2OFVA 3KMWA 4TY1A 2HZIA 4RJ5A 2Z7LA 3C4XA 5AV3A 2BUJA 3BGPA 5IDPA 2XNOA 4W8DA 5JSMA 2YACA 3FLQA 3QRKA 3MH1A 1Y6BA 4AT4A 4M69B 1WAKA 3H9RA 3TNIA 4CLJA 2PPQA 4R3CA 1JSTA 2CSNA 3BYVA 4RLLA 4R3RA 3VIDA 4ORKA 1IEPA 1LEZA 2R3KA 4F9AA 3Q96A 4QNYA 4YJSA 2A27A 2QNJA 1SNXA 3FZTA 3REPA 4O1PA 4ITIA 4YZDA 1YXXA 4Y95A 4MCVA 4C4FA 3PJ8A 1QL6A 4IAFA 3R7VA 2YN8A 1XH6A 4IMYA 4YSMA 3KK8A 5EKNA 3H4JA 4R7BA 4EOIA 5BYYA 2B1PA 1ZZ2A 5FD2A 2ONLA 2WPAA 4QP7A 3C9WA 3CQEA 3D5UA 3DBFA 4CQEA 4YR8A 5K5XA 4FNYA 3FHRA 5D7VA 2CMWA 1KOAA 4I0RA 3FZOA 5B2KA 4V0GB 1NVQA 4IVCA 4RSSA 1M7NA 4DFZE 4KAOA 3QUPA 4C8BA 4WNOA 3M1SA 3WIKA 5KNJA 4DEIA 2RGPA 2YIXA 3LXKA 3KN6A 3D14A 2R3GA 2HZNA 5HG8A 4MTAA 3AXWA 3KY2A 5IU2A 1H0WA 4BDKA 3JXWA 3EFKA 4IANA 4CCBA 5DHJA 2P0CA 2W99B 3PWYA 3PG1A 3UDBA 4CMOA 2C6TA 4I5HA 3EYGA 3KULB 4QP9A 2X0GA 4HCUA 3L8SA 2BRNA 3PWDA 3ZMMA 2J2IB 3PJ1A 1J91A 3ZZEA 4DITA 5EYDA 4C57A 4DINA 3Q4CA 5HLWA 3FQSA 4NW5A 2QU5A 3FSFA 4BI0A 1CM8A 2BMCA 4RPVA 4FSUA 1FMKA 4XCUA 4QP4A 3G5DA 4YC3A 3MH3A 1FPUA 3RPVA 4BDGA 3WE8A 4DEHA 3PJ2A 2VTMA 4PX6A 4QYFA 3U6JA 5CEKA 4F4PA 3E7OA 3EQDA 4K2RA 3VS4A 4AT3A 1UU9A 2YZAA 5EDQA 3R83A 4UYAA 4FOCA 4CYIA 3ORMA 3UPZA 2O0UA 4QMZA 1P14A 5L4QA 3ZRKA 4L46A 2GCDA 4G2FA 4MQ2A 2ITZA 3MESA 1OM1A 4YZNA 3EN5A 3ALNA 4OTHA 5JQ5A 4MXXA 3BWJA 4V01A 4ONAA 2C47A 4CCUA 4Z3VA 5BUJA 4X2NA 1FOTA 4JS8A 2HELA 2YA9A 4KBCA 3ROYA 2PE0A 4FV3A 4K11A 2QO9A 3SX9A 4G3FA 5HE2A 1APME 3QWJA 5CZHA 3E7VA 5AX9A 2IPXA 2VWWA 3CBLA 3DAEA 3O8TA 4RX8A 2C4GA 3RJCA 2BHEA 3QYWA 3ACKA 2W05A 4HYHA 2J5FA 3KXHA 3EQRA 2XEYA 4B4LA 2VX3A 5JFXA 4I5MA 4CTCA 2XNBA 3H3CA 3OP5A 5AR5A 3GCPA 1K3AA 3E87A 3VC4A 4F1TA 3NUPA 1LR4A 2WKMA 3OW4A 4KRCA 3QU0A 3A4PA 3NNUA 3OEFX 4D2WA 3FYJX 1JNKA 5B0XA 3PXZA 3GGFA 1F0QA 5EYCA 4PNKA 4E4XA 2XNPA 3OT8A 2VV9A 3RP9A 3D7ZA 4K0YA 4YJTA 2VN9A 1UKIA 1U59A 2ZV8A 4KIOA 4PY1A 3KL8A 2JDRA 5BMMA 4L52A 3HLLA 3LCSA 2BPMA 4X2FA 4GKHA 2BDWA 5KHWA 2UZDA 4I4EA 2ERZE 5LWNA 3QC9A 3Q9ZA 4EOKA 3BQCA 5I0BA 2ZB0A 1CTPE 4JDHA 5LMBA 2P2IA 2HXLA 5HHWA 5EM5A 3DS6A 3DQWA 3K3IA 3FC2A 3R2YA 4L45A 4XLIA 3LM5A 1O6KA 2HCKA 1U46A 2XYUA 4KIKA 2SRCA 2X8DA 4JXFA 1WVWA 3NCZA 4BYJA 3RPSA 3BLQA 4TTHB 4N6ZA 4EK8A 4OUCA 5IA5A 3BEAA 3MY5A 4ZTHA 2R3QA 3UIUA 2VO6A 3A62A 4FTJA 3UO6A 4D58A 4USDA 2R3OA 2B9JA 3EN6A 4W8EA 3U9CA 4YJOA 3CPCA 3WF5A 4JR3A 5FTQA 3IPHA 5DN3A 5IA2A 2PL0A 4FSQA 2GS2A 4RC4A 1SNUA 3CQWA 4DGNA 3FWQA 5L6WL 4YMJA 4XV3A 1IAJA 5GINE 3DBQA 4U79A 2VTLA 3DXNA 2VTAA 5GZ8A 2XNEA 1MRUA 2XBAA 2Z60A 2FGIA 2XZSA 3EB0A 4LUDA 4B7TA 3IONA 4OBPA 3W18A 3EMGA 3P7AA 2JFLA 4ZMEA 4H3QA 3BYSA 3OOGA 3PJCA 2WMAA 5EHYA 3R7YA 5EQPA 2UVXA 2VWYA 3BKBA 4RVKA 4BHNA 4RIWA 4MD9E 3TG1A 3O50A 3C13A 3EQIA 4H1MA 3HUBA 3U4UA 2RFSA 2E2BA 3W2CA 5C26A 5LMKA 4O0UA 2W1DA 5K5NA 1ZMVA 3PY1A 2HZ4A 2ONLC 3A7GA 3FBVA 3KMMA 4HGTA 3I7BA 4D4SA 2IN6A 4BDAA 4EONA 3LVPA 3F66A 4IIRA 4E1ZA 3B8RA 3GQLA 4ZJIA 3FZSA 2JBPA 3DK6A 3Q9WA 3SV0A 4FG7A 4BKYA 3C4ZA 4BCHA 3MFSA 3QL8A 3ZO4A 3OCSA 5EI8A 2OU7A 5LVLA 2XS0A 3A99A 3NAXA 2WMQA 4YPDA 4L3LA 3FZPA 1KE7A 3AD6A 3DQXA 3G51A 3C0GA 1VYZA 4E20A 2NP8A 4L8MA 3W2RA 3IECA 4ZSGA 5FXSA 4DE4A 3MA3A 1URWA 3FQEA 4LM5A 3ZC6A 3GB2A 3OTUA 2XYNA 2IJMA 4FKQA 5EKOA 2E9PA 3R04A 3TEIA 1E1VA 3NZ0A 3KRRA 3MBLA 3QZHA 1H07A 2C6DA 4FTOA 3IOKA 4L01A 3PPKA 1F3MC 4JRVA 4GYIA 3DKOA 4PTGA 2B9FA 4CKIA 4O84A 4LMNA 3R7UA 5EG3A 5EYKA 2UUEA 5AADA 3D0EA 1R78A 4KS8A 3OWLA 5H8BA 2PZIA 1AD5A 4FBXA 3K3JA 3UIBA 5IISA 4D2PA 3LFFA 4RWKA 3QZGA 2XRUA 5DT0A 2X81A 3TKUA 4ZY5A 5CU0A 4TNBA 5AP4A 1J7UA 3K54A 1Y57A 4RFYA 4DFLA 4UXQA 3LCTA 4JQ7A 3VHEA 3PRFA 1IRKA 2UZOA 4WHZA 1DAWA 3SRVA 1PW2A 3GBZA 5JZJA 4ZOGA 4F9BA 2OJJA 1Z9XA 3QTSA 1A48A 2XK7A 1IA9A 3KA0A 3RAHA 1OB3A 4C62A 4AAAA 4UV0A 5HE0A 3W10A 3NYVA 2QOOA 4YP8A 4EBWA 4FKPA 3WF7A 3MB6A 3UOLA 4CZTA 2R5TA 4FG9A 3CJFA 2JKOA 4TXCA 4OAVB 3FYKX 4DF3A 1PKGA 2XVDA 3BE9A 5HGIA 3TTJA 3G90X 2C6IA 1CSNA 5ETIA 2BIKB 4BCJA 3QQGA 1OVEA 4FVQA 3EN9A 2QOQA 2IZRA 4D5HA 5KMKA 4Q9SA 3FMMA 3CGOA 3PXKA 4R6VA 4TPTA 2OIDA 3FL4A 5ANGA 4EUTA 1RJBA 5GNKA 2QKRA 4GSBA 2ITUA 2QHNA 3MGYA 2FUMA 3ODYX 5J1VA 4CT1A 1BX6A 2PVLA 3F3TA 3GVUA 3ORLA 5ANKA 4BTMA 2WMRA 5EI6A 4GS6A 4V04A 4X0MA 3D83A 3IW8A 5CWZA 2OFUA 3FLWA 3QRUA 3MY0A 2UZEA 4EZ3A 4GT3A 4E6QA 2PU8A 1XJDA 2P55A 4ZXTA 3QD2B 2ZAZA 2R0IA 4G5JA 5HU3A 2VTHA 3ZU7A 3MPMA 2ITTA 4K18A 4DLJA 5EDPA 3R8UA 3W2OA 3T9IA 4ZTRA 4ALVA 3GEQA 4IZYA 4FTAA 2WEIA 3P5KA 5CAPA 4L6QA 4LL5A 3A8XA 2J7TA 1BKXA 3PJ3A 4DEAA 5AEPA 5I9ZA 4O1OA 2C3IB 4ZTLA 1JPAA 5K4JA 2ZMCA 4FTMA 3RMFA 4I24A 5M09A 2EU9A 4KKEA 3F3VA 1WCCA 4DFNA 5IH6A 4C36A 2VO3A 3NW7A 2ITQA 2YM6A 4PTCA 1MRVA 2KULA 4YJNA 5JFVA 3NWWA 3UMWA 4F64A 5HVYA 1DAYA 3OOMA 3UOHA 4EC9A 1U4DA 3FJQE 2V5QA 3QRIA 4GJ3A 1JKSA 3GT8A 4AW0A 4YHJA 2OJ9A 2X8EA 4FTLA 4KIPA 5G6VA 4PV0A 3VF8A 4AA0A 1BMKA 4M12A 5FBNC 5HO7A 5AUWA 3FY2A 2GMXA 2UZBA 1LPUA 3F2NA 4KIKB 4XOYA 5CEMA 4OAUC 2V62A 2CGVA 2VTPA 3CIKA 3EKKA 2FVDA 3BV2A 3I7CA 4IVAA 2WTIA 3EFLA 4XOZA 1R39A 3UOKA 2HY0A 1J3HA 2XKDA 5AAEA 5CF6A 1XR1A 3GXLA 4TRLA 3LHJA 3ZO1A 5BMSA 2Y8OA 5IUHA 3KC3A 5LXMA 4YZ9A 4RLKA 4UYNA 4GKIA 3QTRA 1GIJA 5L2SA 4TWCA 4A9UA 2C0IA 4EL9A 4K33A 2EB2A 4QPSA 4DFXE 3AT2A 3R8VA 4W4YA 2OG8A 2H9VA 3CC6A 4A9RA 2P4IA 2XCKA 3QQUA 3BE2A 2VWXA 2BIYA 3PA4A 3QTZA 4XG6A 3BU6A 3ZXZA 1WFCA 2EXMA 4U3YA 3UG1A 5IH5A 4X3FA 2QLUA 4G6LA 5CXZA 4FC0A 4FZFB 3DV3A 3QX4A 4M66A 1XBBA 2V55A 3O51A 3QUEA 3T3UA 4F99A 4J7BA 3LMIA 4EOQA 4PL4A 3DY7A 2WMTA 4AS0A 5IMEA 1ZLTA 3CS9A 4QQ5A 4HZRA 4RIWB 4EOMA 4HCVA 1LUFA 2WMBA 3ZDUA 3PE1A 4I41A 5M06A 2C0TA 3KXNA 3NX8A 3FPMA 2X8IA 2YHVA 5T3QA 4DGMA 5CANA 3MJ1A 4FKRA 4JBOA 4M3QA 5IF1A 4MVFA 3CP9A 3ZZWA 1GOLA 4WUNA 2W1EA 2PZYA 4Z9LA 3D2IA 5JK3A 3HDNA 1MQ4A 3OVVA 3MTFA 1BYGA 4J95A 4ZZMA 4IWPA 3E64A 5I9VA 2J9MA 4JDKA 1XH4A 4HOKA 4NU1A 4RQVA 2QG7A 5HNIX 3KB7A 2ITPA 3MTLA 5DT4A 4RFMA 5JEBA 3NW6A 2XIZA 3KKVA 2WMVA 4MXCA 4QMYA 3V8SA 2Y7JA 3ZLYA 3IS5A 4P2KA 4BL1A 2X9FA 1Q99A 4M8TA 4QMPA 5L2WA 5CVGA 2C30A 4K77A 3R9RA 5M51A 5FTOA 3WOWA 3KCKA 3O0GA 3PZEA 3LJ2A 4G3DA 3OWKA 5HIDA 4FEXA 4ZAUA 2I40A 3C51A 2HXQA 4BCQA 2EWAA 1UU7A 5EM8A 5CSWA 2E9UA 3S0OA 2CNQA 5I9XA 5DR6A 2UZUE 3VUKA 4J99A 3PIYA 3RZFA 3GUBA 5AP6A 3FKLA 4QMNA 5IPJA 1GAGA 3R9NA 1SVGA 4JI9A 4U80A 4RIXA 3TZ7A 4JLCA 3IDPA 2GNLA 3AD5A 3RK7A 1ZWSA 3Q9YA 3TUDA 5HBHA 3TXOA 3GC9A 4A9SA 3SRVB 4II5A 3I81A 5HNGA 3V01A 1RE8A 4XMOA 3Q4TA 1J1CA 2QU6A 4ENYA 2ZV9A 5DIAA 3UBDA 2XNNA 4IBMA 3AD4A 2H6DA 3PDTA 2XCHA 1UU8A 5JN2A 4KSPA 3EN4A 5L2QA 3TNHA 4XEYA 3VN9A 3O7LD 1F5QA 4G17A 3VS7A 2JKMA 3OT3A 3JVSA 4F6SA 2WTJA 2R7BA 2OWBA 4I5CA 4DLIA 1XBAA 1UA2A 2HK5A 2XK8A 3M2WA 4YNEA 2JIVA 3TJDA 3PIZA 4CRSA 3RTPA 3COKA 4XLVA 4CNHA 3OC1A 2HOGA 3FXXA 4FSMA 1YDRE 3QTUA 3GU8A 4XYFA 4GK4A 2BZKB 4IE9A 4AUAA 2PUNA 2NPQA 3CQUA 4EHZA 3FI8A 1WBVA 1YXUA 3E63A 3OZ6A 2QO2A 4C3PA 3F88A 3LCDA 4FSWA 4FODA 2UZTA 3MSSA 2J5EA 3HMOA 4GVJA 2J0IA 4MF0A 2BILB 5AUVA 4D5KA 2HWPA 4H05A 2ITYA 3DT1A 3R6XA 5HD7A 1KE8A 1JKTA 3EZRA 5DMZA 1GZOA 3IO7A 4OTFA 2JDOA 4N6YA 4OGRA 5HTIA 4ZY4A 4FNWA 3NLBA 1GNGA 2VTOA 3CE3A 3FMKA 4MKCA 4ZJJA 4TYIA 3ZRLA 4AZEA 1O6YA 3K5UA 4PDOA 5BVDA 1HCLA 5FEEA 3IW5A 2CKQA 4F1OA 4CRLA 3VBQA 3HRFA 3MA6A 4CTBA 5J7BA 2W1FA 1P5EA 4FIFA 3TCPA 1H8FA 4I0SA 3DFCB 3UODA 3GCUA 3FAAA 3P4KA 1YOJA 2PHKA 3FY0A 3ZS5A 3MIYA 3P79A 2G15A 3QD3A 4BCPA 4HYIA 4XJ0A 5GHVA 5IQCA 5CU6A 3EYHA 2R9SA 1BI7A 1ZY4A 2DQ7X 2GU8A 3DBCA 4GU6A 4JNWA 3C4FA 4WIHA 4GT4A 5DGZA 2ZM1A 4BKZA 5TKDA 2GHMA 1OZ1A 1BI8A 3ORKA 3QYZA 3ZDIA 3G2FA 3QKKA 1WVXA 4FA2A 1ATPE 5B7VA 2PULA 3IGOA 2VGPA 2HENA 3ETAA 5J95A 2P2HA 3AMYA 4EH8A 5LVOA 1YXVA 3DTWA 4DFBA 2XJ2A 3JYAA 3QXOA 4QTCA 1O9UA 3POOA 4CG9A 3OXIA 4RJ8A 5J5TA 4Y72A 4BDCA 2VTQA 4QMVA 5LVPA 1UWHA 3RPOA 4X3FC 3F7ZA 4ACCA 5CEIA 4AQCA 5L6PA 2XRWA 5HO8A 2PTKA 4IB0A 4CLIA 4JG6A 3MYGA 3TNWA 2BAJA 3R1QA 5CI7A 2QVSE 1W84A 4O7TA 2OF4A 3FI4A 4DAWA 4CVAA 5KMIA 1KE6A 3JY0A 3O23A 4I92A 4E8AA 4WNKA 2R3NA 2VTSA 4TWNA 3MFRA 3DJ7A 2V7AA 4NIFA 1OKYA 3NUYA 4O81A 4X3FB 3UO4A 4FL2A 1OI9A 4N4SA 4QQCA 3EQHA 3FC1X 4R5YA 3PSBA 4WO5A 5DH3A 2YWVA 3PRIA 3RWQA 5DBXA 3VS6A 4D1XA 4WBBB 3D2KA 2UW7A 4BB4A 2A19B 4JDIA 3NIEA 3P23A 4EOJA 5HTBA 3PYYA 4UBAA 4U8ZA 3QLFA 4NKAA 3CKXA 4FK6A 4O0VA 3SC1A 3F2AA 3PY3A 3A2CA 2I0EA 3G33A 4L7FA 2PVKA 2YDIA 2QOKA 4OTQA 3Q2MA 3UMXA 4FZ7A 4BY9E 2OXYA 5J9YA 5IQAA 4RWIA 5KX8A 2AC5A 3QWKA 5FM3A 4CSVA 1BL6A 4ANLA 4M7IA 4DG3E 4UWYA 1SZMA 3PP0A 4CMTA 3ZEWA 2VWIA 5LOHA 4IAKA 3HAMA 2CGWA 4FNXA 3VJNA 1WZYA 2HIWA 3MPTA 4GEOA 1L8TA 4J53A 4PF4A 4NTTA 4O82A 4IM3A 4YBJA 5M4UA 2R2PA 5HLPA 3RBWA 3OWPA 2VNWA 4RZVA 2J0LA 4OTDA 4AGDA 4O2PA 4IFGA 5TOZA 2F7ZE 1PY5A 5A4TA 2YM3A 4FTKA 3FMDA 2Z7RA 3GU7A 4IAIA 5C03A 4ACHA 3TWJA 2OI4X 2PVJA 3NGAA 4L42A 3GP0A 4CFXA 4KUJA 2ITNA 4CFNA 5E8SA 4I6QA 4OTWA 4HVHA 2ITXA 3L8PA 3OBGA 5LVNA 2V22A 4FMQA 1JBPE 3FMLA 5FRIA 5LCJA 2JBOA 5F95A 4P5ZA 4ZEGA 5J87A 3P78A 4MF1A 4FEVA 2WU7A 4E93A 4CD0A 3BLHA 2YM7A 4RIXB 3A7IA 1XO2B 4QYYA 4XH6A 3B8QA 1P2AA 3HMMA 5FEQA 3QQLA 2WMWA 4L53A 4FTNA 4QYHA 4A9YA 5M07A 3JUHA 5FDXA 4S34A 5HIBA 4AOJA 4CV9A 5HX8A 3GNIB 3KVWA 3NUNA 4M13A 4U97A 4ASEA 4BN1A 2F4JA 3VWAA 3QGYA 4BDHA 2ZV7A 5A14A 3AQVA 4J71A 3FLYA 4KNBA 3UIMA 2VTNA 3E8CA 5EYMA 2R3MA 3SLSA 2QOLA 1MUOA 2WQEA 2XH5A 3R1SA 3GC8A 3R21A 4QMLA 4UX9A 3FUPA 5ANDA 3DBEA 3BHVA 1KE9A 4A4LA 4E6CA 4F9CA 5HU9A 5L2IA 3PVBA 4MYGA 2WU6A 4RT7A 5JGAA 2QO7A 5CU3A 4Z55A 3DAJA 4PDPA 5LJJA 2BRBA 3AC3A 3HV5A 4YLJA 4FE2A 2XNGA 5CNNA 3W16A 1ZYSA 1R3CA 3LW0A 4X6RA 4DEGA 2OK1A 4I6HA 4KS7A 4R8QA 3HRBA 1PMUA 1JKLA 1XKKA 2BFXA 2XKFA 3QZFA 4IAYA 5CSXA 3K2LA 3VS3A 4D2TA 3ENMA 1TQMA 4AACA 4F0IA 4MBJA 3D5WA 3RM6A 1ZMWA 3FMJA 2GNHA 4EK3A 5EK7A 4Q5HA 2QI8A 4IX6A 3TTIA 3SDJA 4ZTNA 1OUKA 3AGLA 4HZSA 5AUYA 5BNJA 1QPCA 4NZWB 4FYNA 3FHIA 4UZHA 2UZWE 4D2VA 5JKGA 5F94A 2A0CX 4ZS0A 4JX3A 4MK0A 2PUIA 5AUZA 1ZRZA 3SA0A 2UW3A 4EQCA 1JLUE 4DTAA 4K1BA 1M2PA 1ZYDA 4PWNA 4P90A 3FLNC 3H9OA 4JBQA 4XBRA 3QALE 3A8WA 4HGSA 4RJ7A 1HOWA 3PPJA 4FT0A 4IEBA 4FV7A 4BKJA 2WGJA 2XK9A 3PA5A 5AM6A 4YJQA 2YM5A 5DI1A 3OY1A 3ZYAA 4AXAA 4AGWA 4EHGA 3M42A 4L3JA 5E8WA 5HX6A 4I4FA 4GFGA 1H4LA 3QRJA 3DKCA 3DCVA 4EH6A 3MS9A 5L3AA 4DG0E 5A3XA 3ZLXA 4WG4A 1OGUA 2V7OA 4V05A 4O0YA 4F6UA 5A6NA 3CCNA 4YLKA 3V5PA 4BIEA 4IB5A 3DB8A 3E92A 3ULZA 5GIOE 1WBSA 2YLFA 3F82A 5AIRA 4DBNA 4UXLA 2FSTX 2YCRA 4NM7A 3E62A 3AC5A 4IAAA 4R7HA 3KRLA 3VBYA 4XG9A 2Z02A 4WD5A 2QLQA 4KSQA 3R7IA 1WBPA 3PP1A 3MVLA 3QTIA 4PPCA 5E8UA 2W06A 5I9YA 3D5XA 1B39A 2FO0A 4J1RA 3RK9A 5C8NA 4D28A 5C01A 2J4ZA 5TF9A 1ZZLA 3TIYA 4I3ZA 4Z7GA 2R3FA 1YOLA 3FQHA 1DM2A 3RCJA 4BI1A 3ZH8A 1VZOA 2OJFE 3DAKA 3EWHA 4IDVA 3NUAA 4ZSAA 5M44A 2PSQA 4DH7A 1FVRA 4QNAA 3TUBA 4C7TA 5H9BA 3WF8A 4AX8A 5AA9A 2R3IA 4NIFB 3V51A 1TQPA 2RG5A 4JIKA 2IZUA 3FE3A 4FKIA 4QPAA 3BHTA 4RG0A 3Q5ZA 2Y4IC 4TW9A 5AX3A 1IR3A 2IVTA 3F5UA 4FKJA 2B55A 3TACA 4XG4A 3VQHA 3LZBA 2R3HA 2R3JA 4X2KA 2O65A 4H36A 1E1XA 4ASZA 2G9XA 3VUHA 4QMSA 4YJVA 5E9EA 5AR4A 4FVPA 2CDZA 4XG8A 4GCJA 3DJ5A 2O63A 4FL1A 4M0YA 1UU3A 3VO3A 4ZIMA 5A4EA 2UW6A 2WZJA 4BGGA 4O6EA 1GJOA 3LCOA 1Q41A 5ACKA 5M53A 2BDFA 2P3GX 2A1AB 3EQGA 4CMUA 4AOIA 5M4IA 1OIRA 3F69A 1OECA 4N57A 1OL2A 2REIA 5GJGA 3VRYA 4DG2E 4LFIA 3GI3A 3HECA 2IW9A 1REJA 4G6OA 4BZNA 2WFYA 4XRJA 3SXSA 2VAGA 2XK4A 4QYGA 3I79A 1CKIA 1P4FA 5IZFA 1ZOHA 4TYEA 5CASA 2F49A 3DKFA 5DE2A 1XH9A 4FIHA 3PA3A 3AC8A 4DH3A 1FVVA 4MNFA 4YNOA 3VAPA 4ANQA 3EZVA 2O2UA 4YZCA 3ZLSA 5IA4A 3R63A 3BGQA 1ZMUA 2PVMA 1YXTA 4Y85A 5AA8A 4UB7A 4XG7A 5E8XA 3N51A 2XK6A 5TR6A 3CPBA 3ZBFA 5CZIA 5IQFA 5AIKA 3UYTA 3U9NA 3WILA 2BRGA 5D12A 3HAVA 4XG2A 4GUBA 5E91A 1H0VA 2GNIA 3NPCA 2H8HA 4FVRA 4LOQA 2C3KA 3LIJA 2PVYA 2W1GA 2OLCA 3OMVA 2CKPA 3NSZA 4DCAA 4GRBA 3OTVA 2QURA 4BCGA 3U6HA 4IC8A 2FB8A 4R3PA 3QLGA 2CKOA 4FNZA 2CJMA 2E9OA 5C9CA 3ZRMA 2YAKA 3BYMA 3PXYA 4LRMA 3ZLWA 1UNGA 5HEZA 3UQFA 1YOMA 4CXAA 4C59A 3LJ0A 2IZSA 4AA5A 4BWKA 4GL9A 3NNXA 1G8SA 1XWSA 3BYOA 4IVBA 4WNPA 5HE3A 4A07A 4CV8A 2X7GA 3NVMB 1OKWA 3AC2A 3VRZA 4XP3A 1Q8TA 4FICA 3ZFMA 4B99A 1V1KA 4WUAA 3CGFA 4LYNA 3UC3A 3VUIA 1PYEA 2H34A 3PG3A 2Z2WA 3E8DA 4O22A 4G16A 1M17A 3CTQA 3ZC5A 5M4FA 4U0IA 5D41A 3P1AA 5AWMA 2RFDA 3QC4A 5IQEA 3ROCA 2JIUA 2BCJA 2IW8A 3QKLA 3RPRA 3EL7A 5I9WA 3SGCA 3TM0A 2EUFB 3CY3A 4E4LA 2ITOA 2C5YA 4ZJVA 1M7QA 3ORTA 1WBNA 5HG9A 5HVKA 2YM8A 4LOOA 3O71A 4FV0A 5AP3A 2YCQA 3ZBXA 1OKZA 2ZVAA 4XV9A 3ATSA 4MXZA 3EN7A 4HVSA 3PIXA 4EQMA 1PRYA 5DNRA 4O7WA 4APCA 5HCYA 2BTSA 4C4EA 4PDSA 4BTFA 2C5VA 4FT3A 4C4HA 4C4IA 1UVRA 3QKMA 4DT9A 5DG5A 4C3FA 2R64A 3I6UA 3FSKA 2PUPA 2X2MA 1ZYCA 4E6DA 3UP2A 1U5QA 3JR1A 4O0SA 5HLNA 4U41A 3W8LA 1Q3DA 3CXWA 3UOJA 4UMTA 4QT1A 2Q83A 4RJ4A 2B4SB 5EHOA 3MVJA 4OTGA 4FKSA 5L2TA 4W9XA 1H28A 4XS2A 2DWBA 3HDMA 3KK9A 3MH0A 5CVHA 4D9TA 3V6SA 4HNFA 4EBVA
chains in the Genus database with same CATH superfamily
3R8LA 2ACXA 2XK3A 4XHKB 1H1SA 4GIHA 2C1AA 3EQCA 4ZTQA 3SXFA 1TKIA 3OD6X 5J9ZA 2YERA 2GNFA 4RQKA 3CKWA 5C1QB 4O7LA 4GW8A 3BHHA 4RVLA 4JMQA 2WTCA 4CT2A 3L8XA 1H01A 4U7ZA 3WBLA 3ZO3A 3GC7A 4AP7A 2BRMA 4O0XA 4JBPA 4R5SA 4G3CA 5AR7A 4ZLYA 5EM6A 5JH6A 3ET7A 4QTBA 4RWLA 2XM8A 4QTDA 5I4NA 1SM2A 4PL5A 4I94A 3OG7A 3Q04A 3QTXA 3LLTA 1T45A 4PNIA 5C8MA 5LWMA 3N4TA 4K9YA 5CQWA 3V8TA 3FDNA 2W5BA 3DJ6A 4ITJA 2LAVA 3RNIA 4DH8A 5EDRA 3VS1A 2VGOA 4I6BA 2XKCA 3DK3A 2QONA 1W0XC 4HPTE 1XBCA 3QX2A 4ZLOA 4PMSA 4RVMA 3RKBA 5FTGA 3V6RA 2HW6A 2JD5A 3A7HA 4BCOA 4JRNA 5AP7A 4IWQA 4BR3A 2YABA 3HZTA 3I1AA 4TZRA 1XH5A 3FEGA 4FSTA 4BBFA 4OT5A 2YIRA 4BBMA 4M68A 3G9LX 3I4BA 1YKRA 4AGCA 4D4YA 5CAOA 3DLSA 4F9WA 4YU2A 2WMXA 3KREA 3R02A 4N70A 4FGRA 4JAIA 4AXCA 1ZARA 2FYSA 4HJOA 3DB6A 1A9UA 5I9UA 3BGZA 3HVCA 4KABA 4GU9A 3EJ1A 4NM0A 4PMTA 3BPRA 3ZXTA 2XP2A 3OS3A 3PPZA 2YISA 4F6WA 4FIGA 4QMXA 5LARA 4R78A 3RPYA 4RX7A 4YZMA 4O7RA 4FKOA 4BHZA 3R9OA 4F9YA 3WE4A 2GNJA 5AV1A 4O7VA 4ARKA 2FSLX 3E3BX 2VWBA 4HYUA 4AW5A 4DGLC 1IAHA 4C02A 4DA5A 4QDVA 1S9IA 4G5PA 4IJ9A 3RM7A 4AW2A 1V0PA 5J7HA 5A46A 2GPHA 3ITZA 2OXXA 5CF8A 4B8MA 2VD5A 4DHFA 2ETKA 2UZLA 4GYGA 4G1WA 2UVYA 2W7XA 2ETMA 1K2PA 1NY3A 3F7WA 3PTGA 2DYLA 3LXNA 2PZPA 1ZY5A 1WVYA 3UNZA 5AR3A 2BKKA 4LV7A 1ZYLA 3O2MA 4HCTA 4GG5A 2UZVA 3R00A 4F70A 2OICA 1OIYA 3LFNA 1NVSA 1H1WA 4ZLZA 4MX9A 3UZRA 2OGVA 5TO8A 2VWZA 2WOUA 2YJRA 3R7EA 4EQUA 4XBUA 4M84A 4E73A 4G3GA 1I09A 3AG9A 5HI2A 3NFFB 5AM7A 3F3WA 3FZRA 3PFQA 1FQ1B 4IW0A 5CT0A 5DWRA 3TJCA 4AF3A 3NRMA 2ZB1A 4HGLA 5K3YA 4AN2A 3CTJA 2W17A 4IZ7A 3MW1A 3TKIA 4E3CA 2PK9A 3CLYA 4MNEA 5FM2A 1EH4A 4R1VA 3KN5A 2BZHB 4D0WA 5KMOA 4EH9A 4ZTMA 5E8ZA 2GTNA 2PMIA 2XF0A 4FOBA 4FV1A 5DOSA 3G6HA 4GMYA 4FKVA 4NT4A 3RVGA 5EI2A 5ITAA 1PYXA 2C6MA 4FV4A 3QAME 4YZBA 5CAUA 2XIKA 3QTQA 3TIZA 4QMMA 3OEZA 5AMNA 3SHEA 4QMUA 4BTJA 2W4JA 3BBWA 5IUIA 4DH5A 5CT7A 1PXLA 4ANOA 1YW2A 2PVHA 5F4NA 2X2LA 2JDTA 4IWOA 4F09A 5HVJA 4YTFA 4X7QA 4FV8A 5CSHA 2X4FA 1B6CB 5IH4A 4FSYA 5IQHA 4QEBA 3QCSA 4RVTA 2IWIA 4QP6A 5IQGA 4J97A 3QXPA 3R9DA 2PVFA 4JX7A 3BI6A 3VNTA 1W98A 3EL8A 4FT9A 3SQQA 5C8KA 5G1XA 3ATTA 4QRCA 1BLXA 1Q3WA 2JITA 2VTJA 3CY2A 3RZBA 4USFA 1VYWA 2VX1A 3Q2JA 1Y91A 2HYYA 5H2UA 5E8VA 1H25A 4FSRA 4OTIA 4CQGA 5ETCA 5DPVA 3S4QA 1ZOEA 4CFUA 1JQHA 4TYJA 5JFSA 3U6IA 2CNUA 2CCIA 5D11A 1T46A 3DLZA 2OZAA 1YHWA 2QOBA 4UN0C 3LLAA 1Y8YA 1FMOE 1OBGA 4DTBA 4FSNA 3LMHA 1M2RA 4UALA 2OH4A 4ACGA 1RW8A 4E5AX 4J8NA 5FLFA 4MBIA 4MBLA 4S30A 5DVRA 5FEDA 4BF2A 1Z57A 4ZSLA 4AN9A 1AGWA 3MWUA 4E4MA 4E5WA 5CNOA 1UKHA 2AYPA 3HMPA 4FIEA 4CFFA 5FGKA 3K5VA 4IC7A 3DKGA 2QR7A 3HYHA 2OIBA 3BYUA 5HBEA 1UWJA 3LMGA 3MJ2A 1PXNA 4NSTA 1NT2A 3Q53A 2JC6A 3NS9A 3OCGA 4YLLA 5C27A 4AE6A 5AUTA 5ICPA 3A4OX 1PHKA 1SVHA 4NCTA 4IJPA 3QA8A 4G6NA 1B38A 3QQJA 3LXPA 4MQ1A 4ZY6A 4M14A 5IMXA 3R30A 1G5SA 1OBDA 4O38A 2H96A 3PLAE 2HZ0A 2R4BA 3RINA 1YDTE 5A9UA 2VX0A 1J7LA 3H10A 2IO6A 3PSDA 2C5XA 4ANSA 4YTHA 5BVWA 1JWHA 3H0YA 3R73A 5CU2A 1QPJA 3D9VA 3L9NA 4U43A 4IZ5A 3DXPA 4C37A 4YJUA 4UWBA 3U8WA 2OF2A 3ZEPA 4EH3A 2I0YA 4DHIB 2HWOA 4FEUA 4FEWA 5DRDA 2JIIA 5CX9A 5CY3A 5IQDA 4O0TA 3UPXA 3TDVA 4DC2A 1VEBA 4BZDA 5DT3A 5CEQA 4BDJA 2F9GA 4RIYA 5EW3A 4ZSJA 5LQFA 3QQFA 4IVDA 3W55A 5AV0A 2ESMA 2BAKA 4F0FA 4K8AA 3TMOA 2XIYA 1H26A 3WIGA 3O17A 4JG8A 2J51A 5JFWA 2CGXA 4I0TA 1OPKA 4FZDB 4AZSA 2UW4A 3EOCA 3G6GA 4FUXA 5HE1A 3AGMA 3E88A 4AWIA 1XH8A 2FH9A 3JVRA 4P7EA 4CKJA 5K0XA 3KCFA 5JT2A 3L8VA 4UMQA 2VZ6A 4YHFA 3GU5A 1FGKA 4QD6A 4D0XA 3RALA 2X0QA 2J0KA 3HX4A 2G01A 1CDKA 2Z7SA 1Q8YA 3DZOA 4FL3A 4I93A 4S33A 3AOXA 5HNBA 3WARA 4BVUA 4F08A 3TV7A 3NVKI 3BU3A 2BTRA 1QCFA 2JLDA 4G3EA 1JKKA 2E9NA 1YDSE 5AUXA 4Q5EA 4ZK5A 5BYLA 3AMAA 2OIQA 4IADA 4A06A 4BWPA 4BGQA 4ERKA 1OKVA 3UP7A 1JOWB 4M0ZA 4WBOA 3W32A 2X39A 3HV7A 2J6MA 2NRYA 2JAVA 2WEVA 4BWXA 4C4GA 5KBQA 5KHXA 5B2LA 3BIZA 5E90A 4ENXA 5FG8A 5I3RA 1OIUA 4H1JA 4C0TA 4FTRA 4O2ZA 2WXVA 3JPVA 4O6LA 4IM2A 4LI5A 3BBTB 5CVFA 3COHA 3PVWA 4CFWA 4BDIA 5CAVA 5HO6A 3L9PA 3ZUVA 3Q4UA 4XP2A 2QC6A 3NAYA 5I3OA 3T3VA 4ZZNA 5M55A 5DYJA 3RAIA 3QCYA 3QCXA 3NNVA 5D10A 1R0EA 3DNEA 4CZUA 4AU8A 5BV3A 3QQHA 3C50A 4TYGA 4J8MA 5ACBC 1KWPA 2GDOA 3DFAA 5BX0A 1GY3A 3FXZA 4FUYA 3JS2A 3HL7A 1OL7A 2OXDA 4MHAA 3W2CA 4HYSA 5FXRA 3UZTA 4KKHA 5HCZA 4W4VA 3N4UA 5L6OA 3AT3A 3QHRA 5KE0A 2Y6MA 3U4WA 4OTPA 3V5JA 2YZLA 4DCEA 2EXCX 4PQNA 3CD3A 5CLPA 2UW9A 1REKA 1KV2A 4KRDA 5EH0A 4BZOA 5LVMA 4MNEB 2BHHA 2GNGA 5LCKA 4PP9A 4Y8DA 1R1WA 2UZNA 3OROA 4I5PA 4C35A 5GZAA 3NFGB 1L3RE 5BPYA 3IW4A 3Q60A 3VULA 2QD9A 4J96A 1GZKA 3KEXA 2VWUA 3PXQA 3VUMA 4S2ZA 2E9VA 3C4CA 3KXXA 4KWPA 2Q0NA 4IDTA 5CU4A 3KGAA 5LMAA 4BICA 2GQSA 3CD8A 4GIIA 4IM0A 4U40A 4B6LA 3ML1A 3NNWA 3ZSIA 4FSZA 4IHPA 4PRJA 4QMTA 2GFCA 3AMBA 2XMYA 2X1NA 3ZTXA 4F7LA 2C1BA 2YDJA 3F6XA 1M14A 3GC0A 1CMKE 3FI2A 3KRWA 2HW7A 5F9EA 5CI6A 5KMJA 3T8OA 1SYKA 5A6OA 4OW8A 2BROA 5GZ9A 2WTKC 4AQKA 2UW5A 3IGGA 3R22A 4NFNA 4XV2A 3RGFA 3GCSA 2WTVA 3UZPA 3P9JA 5E8TA 3C5UA 4JDJA 4E6AA 4EH4A 2YWPA 5CF5A 1Z5MA 5IA0A 3LCKA 5L8KA 3MY1A 4MWIA 3ACJA 4R1YA 3FZ1A 4A7CA 4IAZA 3P0MA 3HEGA 1QPDA 2WB8A 5C4KA 4FT5A 4TT7A 4F7NA 4XG3A 3EH9A 2GHGA 4XRLA 1UV5A 2WTKB 3NIZA 3HRCA 5AAFA 3Q5IA 2OZAB 2ITVA 4NM3A 4EZ7A 1JVPP 4NCTC 3NYXA 3ZO2A 2B54A 2W96B 2YCSA 2QOHA 5EW8A 4UWCA 3GU6A 4FKGA 2PMLX 1W2FA 4DGOA 2CLQA 4RBLA 4G9RA 4KIQA 4EK6A 3UNKA 2XA4A 4B0GA 2F7EE 4E4NA 3R28A 5K4IA 4HVDA 4FT7A 2JKKA 3A61A 4D4VA 4R77A 2YAAA 3SW4A 4IXPA 5HD4A 2JGZA 3V04A 3R7GA 4FV2A 2IW6A 3R8ZA 2XAOA 5BVEA 3DU8A 4RZWA 3PVGA 4BDDA 4P4CA 4DYMA 4JQEA 5D9HA 3QTWA 3ORXA 1IA8A 2YLEA 5CTPA 2LGCA 4TYHA 3GENA 4KBKA 4ID7A 4EORA 2PYWA 5A4QA 3R71A 1K9AA 3LAUA 3EKNA 3KF4A 3QBNA 4TN6A 5IA3A 2BAQA 3ID6C 3VBWA 4BCIA 2PE1A 5E92A 2BRHA 5J5SA 2F2UA 4YTCA 3OWJA 3ORNA 2QOFA 2RF9A 3R2BA 2VUWA 3R9HA 3W2PA 4O0WA 3ODZX 1STCE 4UZDA 5CENA 1PXMA 5CEPA 5CSPA 3UIXA 2YFXA 2YDKA 1YWVA 2PMNX 2C69A 2I7QA 5J79A 4XNEA 3W0QA 4BBEA 3G9NA 4IWDA 5GJFA 3G15A 4WKQA 4LDTA 3FMNA 5FDPA 5JGBA 3UDZA 3SD0A 3LFQA 3MIAA 4K6ZA 2OKRA 4IH8A 3C0HA 2ZDTA 3O7LB 4M97A 4RIYB 4Y5QA 2ZM4A 4A4XA 4BDFA 5FQDC 4W4XA 5AP1A 2PWLA 4C2WA 4TWOA 1U54A 3UVPA 2VNYA 3IW6A 2B9HA 4RJ3A 3HKOA 4LRJA 2P33A 4WG5A 3F5GA 4M15A 3R7OA 3KXGA 3TZ9A 2ZV2A 3FL5A 2Y0AA 3S95A 4HNIA 2I6LA 2PUUA 3CJGA 4LOPA 4ANBA 4UMUA 3G0EA 2CLXA 4OBOA 2A4LA 4L43A 1IASA 4C58A 4DHJA 2O8YA 3Q32A 4DEEA 4EHVA 2FSOX 3I6WA 2RSVA 4I21A 4QTAA 1OL1A 3BWFA 3WZJA 2Y4PA 4Q2AA 4AFEA 4ANNA 3OUKA 3PSCA 5A4LA 1PMVA 3ANRA 4ALUA 3KVXA 2EXEA 2G1TA 2QG5A 2HAKA 2RFEA 4BJJA 3SW7A 3QHWA 3R8PA 3D7TA 4DGGA 2WOTA 5AV2A 1XHAA 1QMZA 3ALOA 4RC2A 4LGDA 4QP2A 4TNDA 3ZOSA 5EHLA 3V5LA 3W2SA 4ZZOA 3HGKA 4ERWA 2G2HA 2XKEA 5DRBA 4H3PA 2QKWB 5KZIA 3MPAA 1Q62A 5DR9A 5AJQA 1Q61A 5ANOA 4E7WA 4EK4A 4OT6A 2BFYA 4QO9A 5E4HA 5EW9A 1JSUA 3UJGA 3I0QA 3H9FA 3LM0A 5E1EA 4C4JA 4GH2A 2YIQA 3ZSHA 4FV9A 2F7XE 4WNMA 4AG8A 4WA9A 5DEYA 4FGBA 1W82A 3OW3A 4FKTA 3Q3BA 4BIDA 2R7IA 5KMNA 1LEWA 3VHKA 3BHUA 4YC6A 3QF9A 4QP1A 4AW1A 3PE2A 5DFPA 3LFEA 4U5JA 3PZHA 3PXRA 4FZAB 4GT5A 1XQZA 4KBAA 3II5A 3SOAA 4JL9A 5I5ZA 4B9DA 2C3JA 5KUPA 5EM7A 4PUZA 3LFCA 4RC3A 4EUUA 5HG7A 1YHSA 2IZTA 4ITHA 3U51A 1NVRA 2BZIB 2WIPA 4W4WA 1W83A 3I5NA 5HQ0A 1OIQA 3FKOA 2ZMDA 4L68A 4NW6A 3SAYA 4JBVA 1ST4A 2FA2A 2W9FB 1G8KA 3L1SA 3OCTA 4W9WA 5IG1A 4EOLA 4JG7A 4E26A 5A4CA 3HMNA 4DT8A 3HP5A 4L9IA 3QUDA 4O86A 1KUTA 3C0IA 4FZ6A 4U81A 4KD1A 5GJDA 1Q8ZA 4QQTA 3WZDA 1J1BA 4NEUA 3V5QA 4ACMA 5HG5A 2Y4IB 4KKGA 3UVQA 3ZUTA 5JZNA 4NYEA 4GVAA 1QPEA 3TNQB 3TYKA 4U6RA 4X3JA 2DUVA 2WD1A 4IFCA 4C38A 4EYJA 4MWHA 1BUHA 3OXZA 4ANMA 4OBQA 4HW7A 2RIOA 5BVOA 3NUXA 4IB3A 3MI9A 4C2VA 4AZFA 4NL0A 2ZYBA 4MH7A 3ZONA 3CEKA 4S31A 2O3PA 4D9UA 4Y83A 3KFAA 5HORA 4LUEA 1W7HA 5J8IA 4U3ZA 4AXDA 3R1NA 4GFOA 3SXRA 2PMOX 5E7RA 2WHBA 3GCQA 4WSQA 2C0OA 4BDBA 1DI8A 2CCHA 3Q9XA 4O7NA 4L7SA 2O64A 2RL5A 2WMSA 4F7JA 3RAWA 4I20A 5IEVA 5M56A 4FKUA 1A06A 4GK3A 4L67A 3Q52A 4RX9A 3LOKA 1P4OA 2C68A 2F57A 4UEUA 4CFMA 1H27A 2OBJA 4Y73A 4QYEA 2CHLA 5AFVA 1PKDA 2VTRA 3GU4A 5HCXA 4PPBA 4EJNA 3HV4A 3MFTA 4S32A 5ANIA 3WYYA 3E93A 2RKUA 2NNWB 2GS7A 4PMPA 5BYZA 2VO7A 4O96A 2QR8A 4QTEA 4KINA 1WBOA 1GZ8A 2VRXA 4JIAA 2X2KA 3FLZA 5F1ZA 1WBTA 4LV8A 3JY9A 4XUFA 3VJOA 2XB7A 3RAKA 3VW8A 2B0QA 5H8EA 3WF6A 2EB3A 2AQXA 5CS6A 4AZVA 4F7SA 3BX5A 2CN8A 3EFJA 1OMWA 4EK5A 4QMOA 4A9TA 1ST0A 3TT0A 4BYIA 1VJYA 3WF9A 1RDQE 2PVNA 4FK3A 2B53A 3TI1A 2CNVA 5KBRA 2XUUA 3KRJA 4NK9A 3U54A 4HGEA 4BIBA 3C7QA 4Y5HA 3KXZA 1Q24A 4NTSA 5AP5A 4BFMA 1R0PA 2X7FA 5BVKA 5AP2A 5BQ0A 4TYHB 4O7SA 3IQ7A 4IX5A 1PXKA 4YGAA 5CYIA 3RI1A 3VUDA 2IVUA 4DBXA 3UTOA 3WZEA 3S00A 3UO5A 3F3ZA 4GK2A 3POZA 2QOIA 2ERKA 4FTIA 2GTMA 5EOBA 1WMKA 3F5XA 1PF8A 4XV1A 4EOPA 1Q97A 3R1YA 1Q8UA 1TQIA 4MXOA 2JEDA 2RG6A 3IDBA 4MD8E 2VO0A 3EHAA 3KMUA 3MN3A 3PXFA 4O0RA 4LL0A 4QMWA 4BI2A 4LGHA 4PMMA 5CQUA 3A7FA 3WZUA 3LQ8A 5HICA 3TV6A 3TL8A 1J7IA 1GIIA 2J50A 4NWMA 3KU2A 3RWPA 4FI1A 4BTKA 4Y46A 3RNYA 5HESA 3VS0A 2W9ZB 4GG7A 1U54B 2PE2A 3CR0A 3PLSA 4B8LA 1ZXEA 5HIEA 2C5NA 3Q6UA 3C4WA 4L3PA 4EH5A 1H1RA 5HKMA 1YRPA 5JGDA 1OL5A 2I1MA 2YIYA 3HV3A 3QGWA 4EH7A 5BUIA 3LKMA 3P5JC 3TDWA 2W4KA 4E5BA 4ACDA 4YJRA 4JVGA 3H0ZA 3MH2A 3NW5A 3Q6WA 2IVSA 2XIRA 2QQ7A 3V5WA 3ORPA 3HP2A 5BUEA 4X2GA 3UE4A 3C5IA 3UNJA 4O91A 4AA4A 3M11A 4BJJB 3F2RA 3D4QA 4IX3A 3D94A 2PY3A 2C5OA 3VUGA 4LMUA 3D7TB 4R7IA 4EKKA 2AC3A 3HA8A 1G3NA 5EQYA 2G2FA 3KXMA 3BQRA 4YC8A 4QPMA 5AUUA 4AGUA 3AC1A 4H58A 3U55A 3IDCA 1PXPA 4AOTA 3E8EA 3VBVA 4QMQA 4WSYA 3FKNA 3D15A 1ZAOA 3DA6A 3G0FA 3OF0A 4O21A 3MFUA 4BCFA 3DXQA 4FKLA 3GCVA 5KO1A 2XJ1A 4FTUA 1I44A 4ZSEA 4QQJA 5TT7A 4XX9A 4CGAA 5GIPE 2VTIA 1DI9A 2W4OA 4YUQA 3C1XA 2W1IA 1OITA 4J98A 5IUGA 1OPLA 3COIA 3IW7A 2JDSA 3GOKA 1YI6A 1YWRA 3O96A 3VQUA 1O6LA 5CALA 4OLIA 2B52A 3B2TA 2X4ZA 3ORIA 2OW3A 3IG7A 3BZ3A 3LQ3A 3L9LA 2HY81 3ZSGA 2QODA 4DEBA 4EWQA 5AAGA 3ORZA 1OL6A 2EVAA 4RRVA 5T6KA 2BVAA 2J0MB 2I0VA 2J90A 5IKWA 4JAJA 4DEDA 3QFVA 1PMEA 4BRXA 3PVUA 1X8BA 1OPJA 3O8UA 3R01A 5HZNA 4XP0A 3A7JA 4EWHA 3ULIA 2NO3A 3FMEA 4O83A 3W1FA 4YBKA 3C4EA 2WQMA 2BALA 5ETAA 4BCKA 4D2RA 2QOCA 3RHKA 4USEA 1U5RA 3IOPA 3O8PA 3NR9A 4FR4A 1G8AA 1NXKA 4QP3A 5M57A 2OH0E 4HVGA 4KB8A 4AXEA 3ANQA 1KSWA 1H08A 4G34A 1Q5KA 5CSVA 1ERKA 2AUHA 2CPKE 4J52A 3OXTA 3S3IA 3SKCA 4RFZA 3NEWA 4YSJA 2X6EA 3DOGA 3BCEA 4D1ZA 1PXIA 2C3LA 3QCQA 3QD4A 4CYJA 5FBOA 4JT3A 4EOSA 3IKAA 4MXYA 3OCBA 2UW8A 3NYOA 3ERKA 2JAMA 2YJSA 4U45A 3OY3A 3CSVA 4NJDA 1XH7A 2BZJA 1H24A 1V0OA 3OBJA 3PY0A 3U87A 5JRSA 4GFMA 3ENHA 1YI3A 1CKJA 4LRKA 4AFJA 5LMKC 4EEVA 4KA3A 1FINA 2ZOQA 3DGKA 4FV6A 5JMSA 2C6EA 2O5KA 4G9CA 3TKHA 4IZAA 1Q8WA 4RA5A 2X9EA 4RMZA 3WZKA 3BV3A 3I60A 2WQBA 4Z7HA 1Y8GA 1MP8A 3DBDA 3EQPA 4BDEA 4PDYA 2WELA 1YHVA 2ZDUA 3SG8A 3NUSA 3HV6A 2PZ5A 3QZIA 2C6KA 5KMMA 5EQEA 5FP6A 4C61A 3SG9A 5H8GA 2W1CA 4FEQA 4PTEA 3E3PA 5CAQA 1PMNA 3THBA 4H39A 5BVFA 3GFEA 5TE0A 2JDVA 1PJKA 3D5VA 4FIJA 4IACA 3MVMA 2B7AA 3DNDA 4UY9A 1W8CA 4FV5A 4X6QC 3AC4A 3NCGA 4HPUE 3S2PA 4ASXA 1YVJA 1YQJA 4Q9ZA 4F65A 4FTTA 4FYOA 2R3RA 3F3UA 5F20A 5IQIA 1ZOGA 3FI3A 1FVTA 2ITWA 3T9TA 3HMIA 3P08A 3ZUUA 5T68A 3W33A 3UYSA 5DA3A 5ANEA 2XIXA 5IEYA 2XARA 5IQBA 2W5HA 4AZWA 2JKQA 3MVHA 4YJPA 1BL7A 3FMHA 3A60A 4FIIA 4IB1A 3LFBA 3VS5A 3ZFXA 3DDPA 3QA0A 4YTIA 4FJVA 5KZ0A 5CEOA 3RCDA 3GFWA 1ZYJA 5B2MA 4M69A 4GJ2A 3PFYA 4YHTA 4PP7A 2GHLA 2R3LA 4O7ZA 1MRYA 2YCFA 3B2WA 3R0TA 4RJ6A 3FPQA 2Q0BA 4EYMA 5JRQA 4QP8A 3OFMA 4LGGA 3KQ7A 1JSVA 3W2QA 1VR2A 3FLSA 4U42A 4LV5A 4MAOA 3TZ8A 3UGCA 3CTHA 3TV4A 2PVRA 1S9JA 4MD7E 2NYAA 3P86A 1NA7A 5AV4A 3TN8A 1IG1A 2CGUA 3I0OA 3WI6A 4JQ8A 1NW1A 4YO6A 3V5TA 2XEZA 4BGHA 4ZP5A 3KRXA 5J9LA 1M52A 4EJ7A 3BLRA 5AR2A 2ZJWA 2ETRA 1UNHA 2XALA 4WRGA 5HTCA 4PPAA 2GQRA 1FBNA 5H3QA 4CG8A 4ZMFA 3UVRA 4V0GA 4DFYA 4U9AA 3Q4ZA 1YWNA 3L9MA 2WTDA 4DFUA 3NDMA 5JQ8A 3P7CA 4FTCA 3VBXA 3LFDA 4WRSA 2UVZA 4CZYB 2XM9A 3QQKA 3VBTA 4ALWA 2WQOA 3COMA 1UNLA 4UMPA 5EFQA 1MQBA 3EIDA 2Y6OA 2YEXA 4WG3A 3W8QA 3VUTA 3P7BA 2WQNA 2W0JA 2OJIA 2OJGA 3DZQA 5CXHA 5J1WA 5FUTA 1V0BA 3KULA 3EQFA 2QHMA 2XJ0A 3EFWA 4H3BA 4L00A 4FTQA 2WIHA 2C6LA 3TUCA 3IK3A 3RHXA 3ZCLA 4ZTSA 5L8LA 4DTKA 4DN5A 4NJ3A 2UV2A 5DR2A 1HCKA 2PZRA 1SMHA 3KF7A 3MDYA 4PL3A 2X6DA 4F78A 3ZFYA 4JJRA 2WNTA 3DTCA 4ASDA 2VWVA 2ZFYA 5KKRC 3H30A 3QD0A 2XNMA 4N0SA 4NUSA 4YURA 5FWKK 3E5AA 3VS2A 2Y9QA 4D2SA 4U44A 4HVIA 4YPSA 2KTYA 4UMRA 4LQMA 4EZ5A 3NUUA 2GSFA 4Z16A 4NKSA 2CKEA 5FP5A 4TWPA 3RK5A 3R8MA 4RGJA 5L8JA 4AT5A 4APPA 3HUCA 4F1MA 3LE6A 3MV5A 4GV1A 3DK7A 5DLSA 4WOVA 4FX3A 5KKRB 4RIOA 5BVNA 5IEXA 1KOBA 2CN5A 2OO8X 2IG7A 5K9IA 4GUEA 3UG2A 3V8WA 3EQBA 4O4EA 4D4RA 5KMLA 2B9IA 2QCSA 4NM5A 4F63A 4I23A 5HOAA 3BHYA 1W2DA 3F5PA 4D55A 4I6FA 2XBJA 2NRUA 1PXJA 1YXSA 3W0OA 2VU3A 5FXQA 3VONA 4ZS4A 2OZOA 2XAMA 4JOAA 4O4BB 5A54A 3OHTA 4EKLA 3SOCA 2YITA 4O27B 4BCMA 3LPBA 3V3VA 2F2CB 1GIHA 2I0HA 3BELA 4RWJA 2W1HA 3PUPA 1GZNA 3QRTA 4AN3A 4DH1A 4NH1A 2FSMX 3VW6A 2YM4A 1FGIA 1LP4A 2GFSA 5D1JA 4CKRA 4YO4A 4MXAA 2RFNA 4IQ6A 1H00A 1WBWA 2GS6A 2J0JA 3NYNA 3LXLA 4LG4A 5M4CA 1RQQA 4O7YA 5HBJA 3ZM9A 1KV1A 2IVVA 3FXWA 3TNPC 4D1SA 3UQGA 5ETFA 3GOPA 4EH2A 2W1ZA 3BEGA 3VF9A 3W0RA 3DPKA 3F61A 4CEGA 3BRBA 2DS1A 5E8YA 2WO6A 3OUNB 1Q4LA 4WT6A 4C34A 3S1HA 3AT4A 4I1ZA 4EHEA 4L44A 5M08A 3LQ5A 5DEWA 5D7AA 2BR1A 1SVEA 4EOOA 4RA4A 4EI4A 2UW0A 4TL0A 1E9HA 4G31A 5C4LA 5AP0A 4C33A 5EOLA 5AR8A 4A4OA 4AE9A 2Z7QA 2WMUA 2X7OA 4OR5A 1H1PA 4FG8A 4M67A 3ZHPC 2ZM3A 4OTRA 1M2QA 2Z8CA 2R3PA 2YIWA 4X21A 2BDJA 3HA6A 3DDQA 4I22A 4TKSA 3VVHA 3ZM4A 5CF4A 3SVVA 3FV8A 4C3RA 1H1QA 2OSCA 5ANJA 1KE5A 2BKZA 2WAJA 1PXOA 3N4VA 2V0DA 3UC4A 2VTTA 1CKPA 3LFAA 3I5ZA 4RX5A 5KCVA 3LFSA 3WYXA 3ELJA 3LJ1A 2W5AA 1YI4A 4AZTA 1JAMA 4MEDA 3MB7A 2JFMA 2A2AA 2G2IA 1Y6AA 3E8NA 1OUYA 4P5QA 1TVOA 4FKWA 4JR7A 4CFVA 4F0GA 4QOXA 4BC6A