4E6QA

Jak2 kinase (jh1 domain) triple mutant in complex with compound 12
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
298
structure length
296
Chain Sequence
b'AFEDRDPTQFEERHLKFLRQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEFLPYGSLREYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Identification of Imidazo-Pyrrolopyridines as Novel and Potent JAK1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 96
structure length 296
sequence length 298
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4e6qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4e6qA01
3QLGA 3RK5A 1Q41A 1YXTA 3FBVA 2RFNA 1GZNA 2QG5A 4QP4A 3ELJA 4ASEA 4LOQA 3OTUA 4H3PA 1YWNA 4F7NA 2UW4A 1VEBA 3OFMA 4I6HA 4GG5A 5EKOA 3FDNA 3ZZWA 4C37A 4WKQA 4TYHB 5FP6A 4CMOA 3SXRA 4O7YA 2XYNA 4FTIA 3RINA 4D2WA 1OPKA 4M0ZA 3E7VA 1ZMWA 4P4CA 4EZ5A 3AGMA 3PXRA 4A9YA 2C3LA 4O7RA 3MJ1A 3EFWA 4FSTA 4RX7A 5EI6A 5FQDC 3R9OA 4O0TA 2GDOA 1OZ1A 1UKIA 4QPAA 5IQHA 1H1PA 4LYNA 5HE2A 1OIQA 3VULA 3UZRA 3MTFA 3DS6A 5CI6A 3MB7A 4BDHA 3GU8A 5KO1A 5FTOA 4PMPA 4HZSA 1U4DA 5IH4A 1U59A 3W2CA 3OC1A 4R1VA 3E93A 2ITVA 4DH5A 4A4OA 2Y6OA 4U5JA 2W5AA 4YO4A 2R3IA 2OU7A 2GS7A 2IVUA 5CAUA 5JQ8A 1H27A 2UZUE 2WPAA 5HE0A 2VGPA 4NJ3A 4I4EA 4WT6A 4BCIA 1PXNA 1OMWA 2F9GA 2FB8A 3F9NA 4XG7A 2NRYA 2R3GA 2UVXA 3E5AA 4CFFA 2R3LA 2ZVAA 2RGPA 3FXXA 2XMYA 3ALNA 1F0QA 1K2PA 1Z57A 3KQ7A 4KSQA 4YPDA 5E8YA 5IUGA 3C5IA 4L3PA 2I1MA 4EHEA 5I0BA 1V0PA 4FV3A 4IIRA 4R5YA 3NIZA 4H1JA 3QGWA 2B0QA 4EK6A 3GQIA 5AR8A 4XLIA 1PKDA 4KRCA 4P90A 4BZDA 1BX6A 2XS0A 3IGOA 4JDJA 4O84A 2CGWA 3R8MA 5KMKA 4CCUA 4BDJA 1YHVA 3H10A 3TT0A 3C0HA 3VBWA 4Z3VA 4OBQA 3DTCA 3ZFMA 4DFNA 3EZRA 2C4GA 3TUCA 2XK4A 3D14A 2XNBA 2WKMA 1HOWA 5LOHA 3FMNA 3FY0A 5L6WL 5JH6A 5AP6A 3COHA 4ID7A 4EQUA 3VRZA 1VYWA 4FK6A 3ZEPA 2JDVA 3CSVA 2B7AA 2GHGA 3P4KA 4F1OA 3I0QA 3R9DA 5DNRA 4U45A 4FMQA 4FZ6A 4IAZA 4MXZA 4IC8A 2PUPA 4NWMA 4S30A 3VQHA 1XKKA 1SYKA 3OOGA 4I6QA 4OR5A 4R3PA 2JD5A 3RCJA 4BTJA 4CFXA 3U6JA 3EFJA 4MEDA 4XNEA 4CT1A 2VNWA 3F2RA 3FZOA 2GTNA 4WD5A 1LR4A 3VS1A 2YFXA 4E7WA 2VNYA 5E4HA 4KABA 3BHVA 2XIKA 3HV4A 4M69A 4XV1A 4C3RA 5AV0A 5CAQA 3DV3A 4WNPA 2ITQA 2C0TA 3BHUA 4O0UA 1H1QA 2BZIB 4FZDB 1SVEA 2AUHA 2R3QA 4NK9A 4QNYA 4YZ9A 5HKMA 4QTAA 3VRYA 4OUCA 3F3ZA 1SVHA 2ESMA 4CZYB 4EKKA 3RK9A 4K77A 4KBAA 4Y5HA 2NPQA 1KOBA 1NA7A 2X39A 3EQPA 3R63A 4N4SA 5D7VA 5KMNA 1IAJA 3E62A 1JKKA 3W10A 2XCKA 4PF4A 3P23A 4C0TA 2WQMA 3AOXA 4JRVA 4RLLA 3AG9A 3ZONA 2YLFA 3RP9A 4IFCA 2ERKA 3PFQA 3QKLA 4DFBA 3FXWA 2HW7A 5E92A 2WEIA 3D94A 1H08A 1Q4LA 3KULA 4FV4A 2J90A 4F9BA 4YHTA 3QRIA 3TJDA 4FR4A 4XBUA 3E88A 4ZSEA 4O86A 2E2BA 3HV7A 5GNKA 2UZDA 3ENHA 3OCTA 4RIOA 3LFBA 1ZYCA 4F64A 2ONLC 4PPAA 1YHSA 2UZTA 5M56A 4WRSA 2QR8A 2C5NA 1OIYA 3A8WA 5IA2A 2UW3A 4YNEA 5IISA 3PLSA 4LRKA 4KS8A 3KMWA 5J7HA 2ZMCA 5DR2A 4ONAA 3TUBA 2XM8A 4FYNA 1EH4A 4UWCA 3HAVA 2C1BA 3QD2B 5IQEA 3KULB 3UZTA 2WMBA 2J7TA 4MNEA 5DGZA 1PXOA 3LQ8A 4FIFA 3E7OA 1ZYJA 4I0TA 5CU6A 3QQFA 4HVDA 5AUYA 5CQWA 4FV1A 4QP1A 1V1KA 3IS5A 4A9RA 3K3JA 3DDPA 2HXLA 4GK4A 4JR7A 3IOKA 4QMXA 1JKTA 1L8TA 4DTAA 3E3PA 4J98A 2HAKA 2QVSE 5KKRC 2YABA 1JOWB 2X81A 2VWUA 5H9BA 3MSSA 3SDJA 3D5XA 4GJ2A 5FBOA 3PRFA 3PJCA 5EM7A 3IW7A 3JYAA 4MNEB 4U3YA 2XKCA 4UN0C 1P2AA 3QAME 5CY3A 2IG7A 5E8VA 3BLRA 4MD7E 1ZMUA 5KE0A 4WG4A 2HZNA 3QHRA 1YOMA 3PZEA 3ZLXA 3HRFA 1UA2A 4C02A 4I4FA 3FMLA 2YZLA 4QMYA 4O0XA 3VO3A 3PA4A 4ERKA 5FG8A 3HV3A 1TQPA 4HGEA 2W7XA 3A62A 4UEUA 3TTJA 4D55A 4O7WA 2IZSA 2JLDA 3JVRA 4MKCA 4E1ZA 5EM8A 3A7HA 1CDKA 1HCKA 2OIBA 3CBLA 1H1SA 5AX9A 4FKJA 4B99A 3IPHA 3QQHA 1YXSA 4ZTNA 1OKYA 3QA8A 4G6LA 4YMJA 3LFFA 1ZYDA 3R7EA 3SA0A 5A14A 4O1PA 3ZLYA 4HW7A 1IRKA 3EJ1A 4XOYA 4FSMA 3V5WA 2QU6A 4DCAA 2DUVA 2GNJA 3L9NA 2OJIA 2BAQA 3FMHA 3HMMA 3QRJA 3R73A 4R1YA 3UVQA 2OLCA 3GB2A 5HG5A 4OT5A 4PP9A 4USDA 4FTUA 4FVPA 5M57A 4APPA 3M42A 3ZBXA 3BEAA 1YRPA 3Q60A 5TOZA 4M7IA 3RMFA 2XNPA 2Z7QA 4ANSA 4P5ZA 3EQGA 3SV0A 1REJA 5AX3A 3UO4A 2RG6A 2IVVA 2W1IA 2V7AA 4LGGA 1QPCA 3GOPA 2ITOA 4IX3A 3A2CA 4KAOA 5JRSA 5CEPA 1Q8YA 2P4IA 1ZYLA 2FH9A 2PZ5A 4C4GA 3QRUA 5AP7A 4RVMA 3GI3A 5L3AA 2HWPA 3P7BA 4O7LA 3NYNA 3QTQA 2R3HA 4ZZMA 4DEHA 1CKJA 3HDMA 4L7FA 2XB7A 3NDMA 5LMAA 4F6UA 3WZDA 3I6WA 3TV4A 2VAGA 1CKPA 2WTIA 5AV3A 5IA0A 4QNAA 4CTCA 4QP6A 4YC3A 5FWKK 4P5QA 2HWOA 4X2NA 4AZWA 3HX4A 4D1ZA 4CNHA 3IDPA 3A8XA 1H28A 1RQQA 3UP7A 1Q24A 1OL7A 3Q9XA 3UPZA 5GJGA 4B9DA 3FZSA 5CEQA 1Q5KA 1FBNA 2HXQA 2BIYA 4BC6A 3ID6C 3LPBA 4JNWA 3EN7A 3PSCA 4FT5A 4YZNA 5FUTA 2WXVA 4PUZA 3TV6A 4C33A 2UZWE 2ZB1A 2R64A 4N0SA 3OW4A 4FTCA 2QOBA 1YDRE 2QD9A 4RFZA 4OT6A 4AZFA 4M84A 4PP7A 4L42A 3PP1A 5JT2A 5LMKC 2YWVA 1PXMA 4KUJA 3TXOA 4PWNA 3PXZA 4Z7GA 5BNJA 4IDVA 3M11A 3EQBA 4K8AA 1UNGA 2PTKA 3MS9A 4CYJA 5D7AA 3PPZA 2VTQA 3MVMA 3VUIA 3OCSA 3WF5A 4ZS4A 4AP7A 3DJ7A 3VBQA 2J5EA 3FI3A 3I7BA 4LMUA 1CTPE 3R28A 3HA6A 3VF9A 4ARKA 2PZPA 1Y8YA 3LFCA 5C4LA 4FKRA 3IECA 4BGQA 4DH8A 5BMSA 5AIKA 2WQOA 1PY5A 3IDBA 2YM3A 4YJUA 3D2IA 3UVRA 1ZMVA 4NKAA 3LCTA 5EOLA 1B38A 3TG1A 3R8LA 3U4WA 4CMTA 5A9UA 3NWWA 1XBAA 2XVDA 2XJ1A 4FSNA 3K2LA 2F2UA 5AM7A 3TJCA 4RFMA 1MRUA 2FGIA 2IVSA 4DEEA 5KMJA 4WO5A 3CLYA 3UYTA 5K5NA 4GRBA 2XKDA 3DNDA 5M09A 4FKTA 3W2RA 3PZHA 5ANEA 5EFQA 3V6SA 3NYVA 4MXAA 5BPYA 1GZ8A 1Q3WA 1GIHA 4AOIA 3EN6A 4UBAA 4CKIA 2XBAA 4IZ7A 4MX9A 3EIDA 4GFMA 2W06A 4AW5A 3CGFA 2G01A 5FXRA 3SAYA 3TTIA 2KTYA 4BKJA 4F6WA 2PMOX 5KMOA 2JITA 3RAKA 3R6XA 3SG8A 5TO8A 4PMTA 3NUSA 4BBMA 3MH0A 5FD2A 4F70A 5L6OA 5CF8A 1WFCA 3ZHPC 2C5OA 3KU2A 3WF6A 4TRLA 2XK9A 1PJKA 4CFVA 3RM7A 4K1BA 5C8NA 3ZOSA 3PIZA 3LHJA 2NRUA 4AX8A 4F0GA 5E8WA 3A4PA 3B8RA 3FKNA 3NS9A 4ZSJA 5D1JA 2WTVA 4FC0A 2B4SB 5T68A 2WMXA 4TKSA 4PRJA 3IGGA 4G1WA 1JWHA 2FSMX 4BI2A 5F1ZA 1XH4A 2JAMA 2Y7JA 1URCA 3EFKA 3EQHA 3FLYA 3NRMA 1SZMA 2W99B 3MFTA 4GG7A 4TYIA 2QO2A 3W32A 2WZJA 3Q4TA 3VHKA 3IOPA 4K18A 3IW8A 4I21A 2BCJA 2J0IA 3PP0A 3C50A 4AW1A 5I9ZA 2YM5A 3DQWA 2YEXA 3KF4A 4FUYA 4PDPA 4PDYA 1IG1A 4EJ7A 4O27B 4QTDA 3PWDA 3SXSA 1XWSA 3KRLA 2I6LA 1PYXA 3VNTA 1H01A 1KE6A 4TW9A 1K3AA 2X7OA 1MRYA 3O96A 5DPVA 4EHZA 4USEA 2JAVA 4KIKB 4IZYA 3HV5A 3QX2A 5K0XA 3U6IA 2WMTA 2B54A 4J8NA 4M12A 2WB8A 3BYVA 4QP3A 3S3IA 5BUEA 4F1MA 2XNMA 4IMYA 5A6OA 4OTPA 4YZMA 4HNFA 4PMSA 3TKIA 4C7TA 1J1BA 4LMNA 4MH7A 4Q5HA 3QCYA 3VC4A 4IWQA 1H07A 3UMWA 3B2WA 5F9EA 4IJ9A 2WIPA 3TNWA 5ETCA 3GC9A 4LOOA 3RAHA 4QMQA 5IPJA 4QMZA 3F5UA 2WU7A 3F3UA 4MVFA 3SW4A 2J0JA 5EDRA 5HTIA 2X7GA 5L8LA 3R1YA 5IA4A 3NW7A 4G3DA 2GNHA 4GU6A 3TNHA 4RIXA 5AA9A 2RFDA 4XMOA 4EI4A 3OWJA 4CKRA 5L2SA 1FQ1B 1ZLTA 3SQQA 3TZMA 3H30A 4X3JA 1FMOE 5M51A 5HNGA 2XRUA 5K9IA 2ITNA 3CJGA 4BHZA 3AC1A 5EH0A 1OL6A 1REKA 3IO7A 3RK7A 4A7CA 4AGWA 4UX9A 4QPSA 3TV7A 1WVWA 2FO0A 4APCA 3ITZA 2QOHA 2WFYA 5B2KA 3HDNA 3UOJA 5LJJA 4DGMA 4F09A 4I23A 2GNIA 4F7LA 2X9EA 2PVKA 3A7GA 4PPBA 4U6RA 4RIXB 1OUKA 3UC3A 1GJOA 4XHKB 4AE6A 3R8PA 3DBCA 4FG7A 3II5A 2IPXA 2GU8A 4U3ZA 4QT1A 2VWIA 4FVRA 3VUMA 4I24A 1L3RE 4Y46A 4C57A 5B2LA 2WQEA 2YDKA 3P9JA 3G2FA 4EQCA 4OTDA 4WIHA 4YO6A 2X6EA 5CSWA 4CT2A 4DYMA 1XQZA 3EHAA 3HMNA 4LL5A 4V04A 5M4UA 4BR3A 1YXVA 3OCBA 2JBPA 4FUXA 2OGVA 4WNKA 3L9LA 4C59A 2WMWA 3RGFA 2J5FA 3RPYA 1ZZ2A 4EH6A 2R3RA 4FTJA 2C5VA 4YTIA 3G15A 3PIXA 2J4ZA 3TIYA 1ZRZA 2ZM3A 2PE0A 1UVRA 3I79A 3NUNA 3OROA 4GUBA 4YC8A 4QMLA 2WTCA 3OUNB 5BMMA 3OY3A 2WNTA 3VJOA 4TYGA 5LMBA 3DQXA 4D0WA 2X7FA 3HECA 3NUXA 3CTJA 1NVRA 3E64A 3SRVA 3FV8A 4IANA 4BKYA 4A9UA 5HCYA 1LPUA 2WGJA 3DA6A 4HYHA 5BVEA 4G6NA 3RPRA 2NO3A 4QD6A 5IKWA 4EYMA 5LWMA 4W4XA 3A7JA 4H1MA 4U41A 3V01A 5DG5A 2VTRA 1H26A 3CJFA 3C4CA 5HEZA 2GMXA 4S32A 3FC2A 3CY3A 4FV0A 1JSVA 4IX6A 5IMEA 2ERZE 1T46A 4NFNA 3JR1A 2IZRA 1GIJA 4E5BA 3C4ZA 3VW8A 4CG8A 4KIPA 3SRVB 5KMLA 3I60A 4LV8A 4TTHB 3LFQA 4IE9A 5EQYA 4FKSA 1G8AA 2WEVA 2QO7A 1T45A 3QWJA 1FOTA 2VO7A 2OJGA 3VBVA 1RDQE 5BQ0A 3V8SA 3MVLA 2C6IA 4RWLA 5J8IA 3UNZA 5M4FA 4MF0A 2E9UA 3HUBA 3GT8A 4GFOA 3OF0A 3LZBA 4U7ZA 5HG8A 5TKDA 3UIBA 1F3MC 2GSFA 5E1SA 4FL1A 4S34A 4BCNA 4FIIA 3TNIA 3U87A 4H05A 4XJ0A 3LXLA 2DS1A 3LJ2A 5J5SA 4IZAA 1M2RA 3H9FA 4X6QC 4XG3A 2YJRA 4R8QA 4TY1A 1R0EA 4M8TA 2X8IA 5CU4A 4BCKA 2CCHA 5TR6A 2WTWA 2GTMA 3AD5A 4MK0A 2UZNA 4ACHA 3O2MA 3OUKA 4EUUA 2GNFA 2PMIA 4HGTA 5FBNC 4C4JA 4TYJA 4FGRA 3QCQA 4II5A 4HCTA 1JKLA 4FI1A 5L2WA 1RJBA 1OBGA 5E90A 2IZUA 3EN4A 3IW4A 3KCFA 4FK3A 5ANGA 1SMHA 5FGKA 4BDKA 3F88A 2QR7A 2W1GA 3PY3A 5E8ZA 1ZY4A 4ZZNA 3COKA 1YDSE 2R3MA 4GT4A 4HJOA 4CYIA 3F7WA 4DFUA 4ZXTA 2IW6A 5CXHA 1E1XA 2PZIA 4EOPA 4E93A 3D15A 4PDOA 4YZCA 4ZTQA 3S4QA 1PXPA 2VTPA 4GS6A 2XK6A 3C4WA 4NYEA 3BI6A 4LRMA 5AUTA 2QKWB 2YHVA 1PHKA 2XJ2A 4ANMA 4CV8A 3EQDA 4QPMA 4Z55A 4RJ5A 3W33A 5I9VA 4A07A 4HGLA 5M55A 1A48A 1YXXA 5BYYA 4QP2A 2V22A 2PMLX 5TT7A 4ZMFA 2HK5A 4TWPA 2VGOA 4FV9A 3R9RA 4F9YA 3D0EA 2PZYA 4LQMA 1WCCA 2F49A 3ZZEA 4YSJA 3GCVA 2VV9A 4A06A 3KXZA 4G16A 2B9FA 1UNLA 2NP8A 1Q3DA 2JEDA 1M17A 4L00A 5JZNA 4MCVA 4EKLA 5I4NA 3NUAA 1P14A 3EQCA 3RHKA 3CS9A 3ERKA 4ITJA 4ZIMA 3R7OA 3DTWA 2C3JA 3NYXA 4ALWA 1PRYA 4ITIA 3FPMA 3BU3A 5E91A 2VX0A 1U5QA 4HPUE 1ND4A 4DF3A 1QPJA 3E8CA 4MD8E 3RI1A 1OKZA 3LMHA 3PXKA 4QMSA 3ATSA 2DYLA 3G0FA 4QP8A 2O64A 2YCRA 4E26A 4QYYA 5DBXA 1CM8A 4E5WA 4F99A 4DTKA 4G3CA 4GCJA 3F3VA 4AZTA 3DXNA 1STCE 4EHGA 5LVNA 4DT9A 4ZMEA 3WBLA 1PMVA 3UIXA 2BDWA 2R7IA 2J51A 4A4LA 4I93A 2JDRA 4QMUA 4TNBA 3QGYA 2BZKB 1ZOHA 2F57A 2W1EA 4Q2AA 3PTGA 5K0KA 3ZM4A 1E9HA 1KE8A 2FYSA 4AN3A 3WOWA 2BKZA 2X2KA 5HI2A 3MFRA 3U4UA 4EWQA 4ZY4A 4E8AA 4AT3A 1KE9A 1APME 2J9MA 3OY1A 3VS2A 3KRWA 1R0PA 1WBNA 4XV9A 5EYKA 4AFJA 2G2HA 3ANQA 3FMMA 4G34A 4JVGA 4GVAA 5CQUA 5DT3A 5IUIA 4DG3E 2CN8A 3G6GA 4HVIA 4XRJA 3IK3A 1M2QA 3IG7A 5A4EA 3IW6A 2Z8CA 5CXZA 4XEYA 3KXHA 1DM2A 3O8TA 3EH9A 2PULA 3OWPA 2RFEA 1OKWA 3QWKA 3U54A 4D0XA 3MV5A 3EOCA 5EQPA 2OI4X 3TKUA 3VS5A 2PVMA 4AOJA 3HMOA 4JAJA 5IQGA 1Q99A 2EVAA 4O81A 3FQSA 2C5YA 3PA5A 4XV3A 4RJ4A 3V5LA 3BYUA 5DEWA 3JY9A 4J71A 3P86A 4QP7A 4QTCA 4GIIA 4C38A 3GBZA 2ETMA 5JGAA 2QHNA 5J9LA 3D4QA 3G5DA 2BIKB 2ITWA 4IAIA 3UGCA 3S0OA 3QTZA 1O6YA 2FSOX 4K6ZA 2GS6A 4NT4A 4QMWA 5AV1A 4C62A 4UMQA 5C01A 3CP9A 3ZH8A 3FWQA 5JEBA 1BUHA 5FXQA 5CANA 1KOAA 1JLUE 3R1QA 2HENA 2P2HA 4EQMA 3I6UA 1IAHA 4LUDA 3UJGA 3CE3A 1QMZA 3BIZA 5IDPA 3LFAA 3LQ3A 5L8JA 5AWMA 3JS2A 3ODYX 4JJRA 2QC6A 5HORA 4RA4A 4D4YA 5FDPA 3LFEA 2PVJA 3ZS5A 3FYKX 5LVLA 4QMVA 4AU8A 3L8SA 2FVDA 4Y83A 3BWFA 3RKBA 3D83A 2JBOA 4FX3A 1WBOA 4D2TA 2OH0E 4OW8A 4Y85A 3QZFA 3SLSA 3DBFA 4GV1A 4IB5A 5CWZA 2X2MA 4KKHA 4WNOA 5AP2A 3Q32A 3U8WA 3RNIA 3DK6A 4KNBA 5I9WA 2EB3A 3QC9A 5HE3A 5IEYA 3UO5A 3HUCA 3MH3A 4MXYA 1BL7A 3ZTXA 4AZVA 4L9IA 3BU5A 5JSMA 5JK3A 3SX9A 5I3RA 4IX5A 3Q6WA 3QTWA 4FZFB 4HGSA 4JBOA 4QTEA 4EEVA 1J7IA 3QQUA 4L01A 4BDBA 4FTMA 4C4EA 5JGDA 3PG1A 5FDXA 4NZWB 3ZRKA 4BGHA 4BKZA 4R7IA 2EXEA 4Y73A 5IQBA 2BVAA 3EQIA 4RVLA 4O96A 3JXWA 1ZY5A 3Q04A 1V0BA 3PA3A 2XIYA 3PIYA 3GU5A 3BU6A 3MPMA 5IDNA 1KE7A 4FSZA 4ZAUA 3EKNA 4ZTRA 3EB0A 5HQ0A 3MPTA 3SOAA 2E9NA 5LVMA 2GQRA 3R9NA 4RBLA 2J2IB 3RWQA 4FV8A 3GC7A 3TN8A 5K5XA 2W4OA 5AR7A 3ALOA 3HRBA 5AAEA 2GS2A 3TL8A 2YIYA 4DFYA 3LFSA 3MA3A 4DGGA 2ACXA 2GCDA 4FIHA 4A9TA 4UB7A 1UV5A 4NH1A 3KK9A 4YJRA 4MXXA 1M7QA 3P7CA 2HOGA 2JC6A 3WYYA 2OWBA 2OXDA 4PL5A 3OT8A 4RWKA 3OTVA 3TIZA 5GZ8A 4DBNA 4XG9A 3TNQB 3V5PA 3KN5A 2I0VA 4XP2A 2X4ZA 4IM2A 3ZYAA 3R01A 2X0GA 5AAGA 5J79A 4YP8A 3OMVA 3AC5A 2ZDUA 2OF4A 2OXYA 3UTOA 3LMIA 4ZLYA 5A3XA 4M69B 4AGUA 4KA3A 2ZM4A 4JG8A 3PJ3A 5KZIA 1LEZA 3COIA 3FZ1A 3GENA 3VUTA 2YISA 4BCMA 2OIDA 3I5ZA 4DTBA 2BRMA 3HKOA 3ZO1A 4ERWA 4HVGA 3PE2A 1W84A 3HGKA 3POZA 1IEPA 4JRNA 2I7QA 4HOKA 2IO6A 3EWHA 5HIEA 5AIRA 2VZ6A 2IJMA 2XKFA 4EC8A 1GNGA 4RLKA 2YDJA 5J7BA 2PVFA 4UMRA 3NAXA 3I4BA 4FKVA 4R3CA 3EL8A 4OTQA 4ZEGA 2UZEA 3NEWA 4RRVA 2BZJA 3P7AA 5CU3A 3O8PA 3FMKA 2Z7SA 2UW8A 3PVGA 4NM0A 4JLCA 2ITZA 5M53A 5B2MA 4V05A 1MQ4A 4AAAA 4ACMA 2BRGA 3BGPA 4KRDA 5FRIA 5AUWA 4HCUA 4OBOA 4K0YA 5IG1A 4L3JA 3AMAA 4CXAA 2G15A 2Z60A 1FVTA 3QD3A 3ZU7A 4BCHA 3Q6UA 3RPVA 1YOLA 4AF3A 4QMTA 4EH3A 4BCOA 3P0MA 1YI3A 4CTBA 4IVBA 5EI8A 3SOCA 5A4QA 3BEGA 4AW2A 4EL9A 3BYOA 3QLFA 3ZDIA 5D12A 4J99A 4BDFA 5I5ZA 4AA4A 2R3OA 2UW9A 3H4JA 3EKKA 4UZDA 5J9YA 4BBEA 4C2VA 3CTQA 2EXMA 4W8DA 4LV5A 4XLVA 5KZ0A 4PX6A 5C1QB 4ORKA 3PXFA 4QYHA 2PE2A 1URWA 1ZYSA 1BYGA 3OBGA 3R1NA 5D11A 3CTHA 3UQGA 4E4NA 3EZVA 3REPA 3PVBA 2F2CB 4X2GA 2YZAA 1H24A 1W0XC 4QRCA 3BPRA 2WMVA 4C8BA 3WYXA 4RQKA 3Q9YA 3UOKA 4RVTA 2C68A 5JFWA 2PUUA 4EH9A 2V0DA 3KXMA 5CEMA 1U5RA 3NUUA 3A61A 2J0LA 4LM5A 4YNOA 5CNOA 2C69A 1GAGA 2A19B 4WG5A 2QI8A 4DITA 2XNEA 3ZLSA 3C4FA 2VWZA 4FG8A 4M14A 4BI0A 4CQEA 3OXZA 2R3JA 4GU9A 4QYGA 2VWBA 5GJDA 1UU7A 4RVKA 2UUEA 3SG9A 1ZOGA 3HZTA 3OOMA 4R5SA 4DAWA 4UXQA 4U8ZA 1LP4A 4IWOA 3FMDA 3KVXA 2G9XA 3S00A 3EYHA 4U43A 4R7BA 2OF2A 1NVQA 4IHPA 2GHLA 5L8KA 4U0IA 4LI5A 4YLKA 5JN2A 4FOBA 4YJSA 4NL0A 4XBRA 2CLXA 3NCZA 3U51A 3ORMA 2B9HA 3HL7A 4D28A 4LOPA 3QZIA 2O0UA 1PMNA 4IM3A 4J52A 4Z16A 5A54A 4MBLA 3QX4A 4FTTA 4CEGA 4RWIA 4RWJA 3PY1A 2IZTA 5FP5A 4DCEA 3PVUA 4Y8DA 5HE1A 3B2TA 2CLQA 2OZAA 3C4XA 5B7VA 4GK2A 4FVQA 3C5UA 5BVDA 5L2TA 3P08A 5JZJA 3NVMB 2KULA 1UU8A 3ZFYA 3WZUA 2VN9A 1YQJA 3CEKA 1VYZA 3MY0A 5AJQA 3MW1A 3NVKI 3JUHA 5HCXA 4FEUA 2ITUA 4FEQA 4TXCA 5ITAA 1PYEA 3N4UA 2JKOA 3BKBA 3BX5A 2BPMA 5EYCA 4WHZA 5T3QA 4DEIA 3MIAA 2CGUA 3M1SA 4CQGA 2JDOA 4YTCA 5LVOA 1G8SA 4FSRA 2ZJWA 2VTTA 1UWHA 4U79A 5ANJA 1Z9XA 2EU9A 2OZAB 5ANOA 1WBPA 3HAMA 4HCVA 5DMZA 3HV6A 3VS0A 1WVXA 2BRBA 3BHYA 4FT3A 3RWPA 2I0HA 2WTKB 5CI7A 4I6BA 5H8GA 4FYOA 2CPKE 2R2PA 2ZAZA 4C3PA 5LCJA 2OFVA 1G5SA 1OPLA 5C9CA 5DH3A 1SNXA 2Z2WA 3KRJA 3MFUA 3OG7A 4GSBA 3ZO3A 2XYUA 4BN1A 2YDIA 3TM0A 4EH8A 4IACA 5DHJA 3ORNA 4U42A 4GL9A 3WILA 4ZS0A 4RX9A 5A4LA 3OXIA 2W0JA 3DAJA 2A1AB 1JSTA 4UYAA 5IEXA 2WMUA 2I40A 3GFEA 3DLZA 3GCUA 4NFMA 4UZHA 2CN5A 3R1SA 2OFUA 3CQUA 5HTBA 4O2PA 4YSMA 4OAVB 3NNVA 3OEFX 3AC4A 3DAKA 2QLUA 1JVPP 4GT3A 3T3UA 3WZJA 2W1HA 3H0YA 3WF8A 3C13A 3POOA 2WTDA 4M13A 4EOIA 1R39A 4RJ6A 3AC3A 1KSWA 1P4OA 2V62A 4JIKA 3MVJA 4IC7A 4UXLA 4AT4A 3U55A 4L6QA 3W2PA 2X4FA 2C1AA 4JI9A 3KRXA 5CSVA 4R3RA 1HCLA 2JIUA 3QQGA 2VX3A 2IVTA 1BI7A 4C4HA 4RPVA 1Q62A 4DEDA 1Q8UA 2H8HA 3KA0A 3UG2A 3PUPA 4E73A 2C3IB 3ZFXA 4DINA 3I7CA 4YUQA 2Y4IB 5E8XA 4DN5A 1XH6A 3DJ6A 4G3EA 3BHTA 3CKWA 3OZ6A 3RALA 3OT3A 3RBWA 4W4VA 3D2KA 5HO6A 3SD0A 3AMYA 2FA2A 3I1AA 3VVHA 3MVHA 5LQFA 3HP2A 5CNNA 3F5GA 5AR2A 2QOQA 4J1RA 1WBWA 2QOIA 3TDVA 1J7UA 4FF8A 4U9AA 3DKGA 3D5WA 4QYFA 4GFGA 4B8LA 2OJ9A 3GGFA 2W5HA 4TPTA 4W9XA 4JBVA 5ETAA 1IASA 2C6KA 3KFAA 3R71A 4RT7A 2Z7LA 4WNMA 5F95A 3ZBFA 5L2IA 2F7XE 4ASDA 2PU8A 1GZKA 4D1XA 3H9OA 3QTUA 4QMMA 2JIVA 3BE9A 4A9SA 3O7LD 3LAUA 5C8KA 2BZHB 2YM4A 3NYOA 4BCJA 4CFUA 2Z02A 3UQFA 5DEYA 3NGAA 5AUUA 2DWBA 3FLNC 3HP5A 4O2ZA 4U81A 3G0EA 1M2PA 1F5QA 1OGUA 2GPHA 3LFDA 2VUWA 4FV7A 3QQJA 2WELA 4FIGA 5D41A 5ACBC 1AQ1A 3ETAA 3JPVA 4JQ8A 4F0IA 4G31A 4RMZA 4O0RA 4ZY5A 1YDTE 3MY1A 5BUJA 3BBTB 3G51A 3GP0A 4IFGA 3U9NA 3V5JA 4C4FA 3ZM9A 2ETRA 4RSSA 3R2YA 2QONA 4JQEA 3R7IA 4BYIA 2UV2A 4AG8A 4E6DA 2QOKA 3Q4UA 4D4VA 4PL4A 4DH3A 3KB7A 5FEDA 5DA3A 3ODZX 5CEKA 3PSBA 4KKEA 2YIQA 2OICA 1OB3A 4JS8A 2PE1A 3VS7A 3UDBA 3NCGA 1RE8A 5CAVA 1TKIA 5FM3A 2UZBA 4JR3A 1NVSA 3O71A 2WMSA 3WI6A 2W1DA 4I22A 2I0EA 1SM2A 3ROYA 3RZFA 5ETFA 4FV2A 1WVYA 2WHBA 3KY2A 4DGLC 4FKIA 4WA9A 3LLTA 2UVZA 5FEQA 5FXSA 2LGCA 3ZRMA 4YTHA 3GOKA 5DWRA 5IA5A 2C0IA 3ORZA 4QMPA 4BB4A 4AXAA 3ORPA 3TCPA 3FSKA 1XH5A 3HYHA 2OKRA 4YPSA 4FOCA 2ZV8A 2GNGA 3BV2A 5E8UA 4Q5EA 4UMPA 5BVFA 4FL2A 3D5VA 4JDIA 4XX9A 2XRWA 3VIDA 2ZV2A 4A4XA 5IZFA 3GNIB 2PZRA 3MIYA 3NX8A 3FUPA 4XOZA 3CGOA 4K11A 5ETIA 4ACDA 2GQSA 3F2NA 5HBJA 4IEBA 4MTAA 2XK8A 3MA6A 4OLIA 4C34A 3WZKA 3ZC5A 3AGLA 2RG5A 5JGBA 5J87A 5KBRA 3FHRA 3ACJA 4PQNA 4O6EA 2QG7A 4XCUA 5JMSA 4J7BA 1H25A 4ASZA 4G9RA 2J6MA 3I0OA 4M68A 5HTCA 4EK4A 5HZNA 3QTIA 3FSFA 4PTEA 4UWBA 3GU7A 4L52A 4DE4A 3DJ5A 4DLIA 1YWRA 4GJ3A 1H1RA 2VTOA 5CSXA 2QCSA 2HZ0A 4IAYA 5H8EA 3RM6A 2R0IA 3LCKA 1ZOEA 1PMEA 2BAJA 3R7GA 4MD9E 4DG0E 5CSPA 3LCSA 4BF2A 3CPCA 4L3LA 2UW0A 4K9YA 5E7RA 3BCEA 3R00A 3MWUA 5BYLA 2YA9A 3W2QA 1A06A 2XK7A 1XO2B 3UODA 1K9AA 2E9VA 5KNJA 4WSQA 3PJ8A 3NUYA 2HY0A 2UZLA 3DB8A 1FVRA 1NY3A 3BWJA 1KV2A 4BHNA 4CMUA 4R78A 4RZWA 4YBJA 2Y8OA 4IH8A 3ZEWA 4R7HA 2CMWA 4ENYA 4FTLA 5J5TA 4AGCA 3PG3A 4KD1A 5BYZA 4QMOA 4IWDA 3FI8A 3DKFA 3F7ZA 5CEIA 3CQEA 2XH5A 4N6ZA 5HVJA 3W8LA 4PL3A 5KKRB 4CFMA 4J95A 3E92A 4DC2A 1FGKA 3GU6A 4YZDA 5DE2A 4AUAA 4F7SA 1QPEA 3MI9A 4F65A 3R02A 4MQ1A 3G9NA 3NNUA 3GEQA 3ZSGA 5HD7A 4U80A 5C8MA 5L2QA 4CRSA 3ORLA 5ANKA 4GKHA 4XG8A 3ATTA 5HO8A 4KWPA 1NT2A 4CFNA 1S9IA 2VTIA 1JNKA 4RQVA 4KIOA 4YU2A 3Q9WA 4CKJA 2ITXA 3L9MA 1JKSA 1I44A 3UIUA 1YWVA 4ZSLA 1XH7A 5KMMA 1NW1A 5EHLA 5HBEA 3H0ZA 4OTIA 4PTCA 4D5KA 2G2IA 4BTMA 4CRLA 2VTJA 1XBBA 2O8YA 3T9TA 4CD0A 3QXOA 3QXPA 5EM6A 3SC1A 3KMMA 1X8BA 4C61A 2ZB0A 4I5CA 3VN9A 2XIZA 5B0XA 4MAOA 5K4IA 5CYIA 3EL7A 5LCKA 1UU3A 4RFYA 2IW9A 5JRQA 5CSHA 2RKUA 2P33A 3PVWA 5AFVA 3DB6A 3CD3A 3AXWA 5DIAA 5K4JA 4IM0A 1XR1A 5HNBA 4CG9A 4QTBA 2OO8X 4RC4A 5FTQA 4FSQA 4E4LA 4IWPA 5D10A 2YERA 4AQCA 3QCXA 3QF9A 4FL3A 4XUFA 2J50A 3CY2A 4TYEA 3BBWA 1XH8A 3LE6A 1GY3A 4M67A 1GIIA 4MXOA 3O0GA 5AP1A 2QU5A 4EOQA 3BV3A 2YAAA 2WAJA 5E8SA 3DCVA 3DPKA 3OW3A 3QTXA 3SKCA 3WE4A 2HY81 3LXPA 2ZYBA 3CD8A 4DHFA 2BFXA 3F61A 3THBA 1J1CA 4ZJVA 3O51A 2BTSA 2ZMDA 1IA8A 1FMKA 3LIJA 2XKEA 2YM7A 3QUDA 3WIGA 3FJQE 2OG8A 4FTAA 2EUFB 2A2AA 4TNDA 4ZLOA 4ZLZA 3TZ7A 4G9CA 4EOLA 3FEGA 2GFSA 4JOAA 4N57A 3QYZA 1Y6BA 1JBPE 2ZV9A 4X2JA 3TNPC 4ZK5A 1CSNA 4ANOA 2UVYA 2O65A 2VU3A 4WSYA 4F0FA 3HNGA 1O6KA 3LKMA 3FL5A 4S33A 2J0MB 3OWKA 5DR6A 4ZTHA 5CENA 1LUFA 1Y57A 2ZDTA 3H3CA 1MP8A 4J97A 5HICA 4NM3A 3FHIA 4F6SA 4I41A 4IAKA 2OJFE 4DFXE 4CSVA 4MNFA 1Q8ZA 3OBJA 3HEGA 5IF1A 3MGYA 1FPUA 2EB2A 4V01A 3CPBA 3QRKA 3VAPA 2W1ZA 3MB6A 1YOJA 5HLNA 2B1PA 2E9OA 3GVUA 4S31A 3TKHA 3SXFA 4EBVA 2W9ZB 2PSQA 4MQ2A 3LFNA 3GCQA 2C6MA 5AUVA 4BDAA 2PVHA 2BTRA 2VO6A 2AC3A 4D2PA 3KCKA 1ZAOA 4J53A 3R0TA 4DA5A 3QA0A 1BMKA 2WTKC 4R6VA 4Y72A 5H3QA 3UMXA 1Q8WA 3KVWA 2CDZA 2UW7A 4GT5A 3CXWA 4O22A 1OBDA 2VRXA 3ZC6A 2IWIA 2EXCX 3MFSA 3N4TA 3DXPA 3V5QA 4H58A 5F20A 4IW0A 4PTGA 3VW6A 3RJCA 4BZOA 4E6CA 2P55A 4XV2A 3T8OA 1Q61A 2YIRA 2QNJA 4BDGA 5HHWA 4FSUA 4MBJA 3GU4A 2F4JA 3O50A 4FT7A 4I5MA 4RG0A 4X3FA 4GMYA 4IVDA 4O38A 5HIDA 4FZAB 1H1WA 3T3VA 3W18A 2VWYA 5CT7A 2JFMA 1PW2A 3MH1A 3MYGA 4XYFA 4FE2A 1OKVA 5DFPA 4IB0A 4N6YA 3UOHA 3W55A 4BFMA 3PXYA 4FKLA 4O21A 4NU1A 1ERKA 3BE2A 3FAAA 4G3FA 2R3PA 2B9IA 3QRTA 1WAKA 3V5TA 4DH1A 2YWPA 3UO6A 4LGDA 5HX6A 1W82A 4YLJA 4FTOA 1ZARA 2CKEA 5IQDA 2RFSA 3FMJA 3MPAA 5DT0A 1TQMA 5GZ9A 4O91A 4X3FB 1O9UA 2AYPA 3KKVA 4KS7A 3FY2A 3LMGA 5AUXA 2Y4IC 4C35A 4MXCA 4XS2A 3LVPA 4UV0A 3P1AA 4Z7HA 3P79A 5F94A 2H6DA 3VBXA 3GUBA 3DK7A 2VTMA 2HIWA 2UZVA 2BDJA 2QKRA 5HBHA 4CFWA 4LL0A 3QKMA 1JSUA 1W83A 5HLPA 2WMQA 3D7ZA 4ZZOA 2OSCA 3PDTA 3IQ7A 4ENXA 2CGXA 3AD6A 4PMMA 3Q9ZA 3KXNA 2BDFA 4X7QA 3AT4A 3NIEA 2PY3A 3FQHA 3FL4A 3NMUF 4QQCA 3ZMMA 3V8TA 5HLWA 4DGOA 1WBTA 4BWXA 4G6OA 4WUNA 4IB3A 5EW9A 4NW6A 5IEVA 4U40A 3BLQA 1OM1A 3NSZA 1JAMA 3K5VA 2BRHA 5ACKA 4FSWA 4YJNA 4CGAA 4RC2A 1R78A 2ITPA 3HRCA 3FZPA 3DKOA 4X6RA 2C5XA 2Q83A 4EOKA 3DBQA 2CKOA 2XM9A 3L8PA 5HG9A 5HD4A 4AN9A 3FPQA 4OTWA 4B7TA 5KBQA 2IW8A 4ANBA 5AP5A 3UVPA 2WIHA 3OP5A 3K3IA 2BALA 3FI4A 1WBSA 4GH2A 5AMNA 4IZ5A 3R9HA 3ROCA 4AACA 4BWPA 4O6LA 1KWPA 2Z7RA 3DOGA 3EQFA 5E1EA 2HZ4A 1YVJA 2QO9A 4G5PA 4GEOA 1OL2A 3WARA 4DEGA 3FZTA 3NLBA 4QP9A 2PK9A 4EK3A 5EM5A 3BGQA 1J7LA 2UZOA 4O83A 4ACCA 4GYGA 3MTLA 4TN6A 3ZUTA 4AT5A 1MRVA 5KHXA 2ZV7A 2A4LA 3O8UA 3ZUUA 4JL9A 4UYNA 4YGAA 3GC8A 5EI2A 5J95A 4EOSA 1J91A 1R3CA 4HPTE 5JQ5A 3ULZA 4QQJA 1Y8GA 2YIWA 2WOTA 2CHLA 4QOXA 4YJQA 4RX5A 4DEBA 3E8EA 4BCPA 1YI4A 4D58A 4HYIA 4JG6A 4I0SA 2CKPA 2R4BA 4FZ7A 3QHWA 3OD6X 3VS4A 3PY0A 4KBCA 4NJDA 3EN5A 4DG2E 2JDTA 3W16A 3U6HA 4BBFA 5HO7A 4E4MA 5IQFA 3MH2A 4FICA 3A7IA 4PV0A 4XP3A 3RVGA 4EH5A 4HVSA 5EQEA 4EC9A 4BIEA 4F7JA 1FINA 3NAYA 2C30A 3OCGA 4NCTA 4BIBA 5IH5A 4RJ3A 4BDEA 4RJ7A 3DBDA 2VTAA 3L8VA 1Y91A 3FXZA 1XBCA 4U44A 5JFXA 1JQHA 2B52A 2BRNA 1WBVA 5KHWA 4HYUA 2HELA 3KC3A 5AM6A 1YI6A 2VTNA 1O6LA 2PUNA 3R7UA 2WOUA 3KREA 2V5QA 2P0CA 4K33A 2VWWA 1YKRA 3F3TA 5AV4A 3V04A 4UMUA 3Q5ZA 3UC4A 3P78A 2R3FA 2O5KA 2OW3A 3V51A 4BRXA 4CLIA 5HG7A 4BIDA 3S95A 4E4XA 2O2UA 3K5UA 3W2OA 4ZY6A 3TWJA 2VTSA 2XCHA 3PWYA 4JDKA 4RA5A 4AOTA 4BDIA 3PPJA 3EFLA 4ANQA 3LCDA 2QOOA 4V0GA 2C6EA 1PXKA 3F3WA 4EZ7A 5IMXA 1KV1A 3LW0A 4NIFA 4YJVA 3KK8A 3QQKA 5LVPA 2BFYA 3ET7A 2W1FA 3LXKA 2RL5A 2YM8A 3FLWA 2C47A 4EH7A 5JKGA 1M14A 1U46A 3VBTA 4Y95A 2R9SA 1V0OA 5ANIA 3V6RA 5IH6A 5HU3A 3N9XA 4OTGA 5CASA 3DZOA 3PPKA 1GZOA 5C4KA 3F82A 3GQLA 4FV6A 3U9CA 3F66A 2BHHA 4CCBA 2PL0A 3EMGA 4G17A 4O7VA 4L43A 4AE9A 4V0GB 4JG7A 5M07A 3O23A 4JBQA 2R7BA 3NPCA 4FT0A 3ZSIA 5LWNA 4NIFB 3MN3A 3OXTA 3VUHA 5I9XA 1H00A 2REIA 4L46A 2YJSA 4M15A 4O0VA 5AR4A 2VO0A 4AZSA 5FTGA 1AGWA 1QPDA 3T9IA 5CVGA 4E3CA 4O0SA 2V7OA 3HA8A 3LOKA 3GCSA 2RIOA 2YLEA 3GCPA 3UP2A 2DQ7X 5LXMA 1DI8A 4E20A 3FI2A 4H3BA 3ZCLA 2R5TA 4BYJA 2VX1A 1IA9A 5F4NA 1OECA 4JXFA 4CZTA 3FLZA 1OVEA 3ZLWA 3DDQA 2PVLA 4M97A 2SRCA 1UU9A 3A7FA 4UY9A 4KKGA 4XP0A 4CZUA 3ORTA 4EOJA 2W1CA 4YJPA 5J9ZA 1OL1A 5JFSA 5G6VA 1PXJA 2JKMA 2R3KA 3D5UA 3DZQA 2CCIA 3TI1A 2OK1A 2G2FA 4LRJA 2X8DA 2YM6A 3M2WA 2X8EA 3VWAA 2RSVA 4BDCA 4IJPA 4YJTA 4YTFA 1PMUA 5GZAA 2BMCA 4AGDA 4ZSGA 3LJ1A 2JKQA 3UYSA 2VO3A 4DT8A 4AA5A 3GXLA 2PVYA 2P2IA 1GOLA 3KL8A 3FKOA 5HCZA 3VUKA 4L68A 5EYDA 3E87A 5CZHA 3BQCA 3EQRA 3JVSA 4FODA 4GK3A 5GHVA 4BL1A 4MWIA 5IU2A 4WUAA 1YXUA 1MQBA 1OITA 2HYYA 4HNIA 4HYSA 4W8EA 4D2RA 4ZJJA 4BTKA 5BVNA 1M52A 2VWXA 3G9LX 3WE8A 2A0CX 2GNLA 2YIXA 4DBXA 4EJNA 3R30A 3AT2A 1RW8A 3GFWA 4C3FA 1BL6A 2B9JA 4FIJA 4BDDA 4C4IA 3COMA 2YITA 4FNYA 4DFLA 2W05A 3FMEA 4O7NA 4H39A 5HOAA 2P3GX 1ATPE 2BR1A 3R8VA 4IBMA 3EYGA 4FKWA 3CCNA 2BHEA 3P5KA 1J3HA 4E6QA 5IUHA 3UNJA 4TWOA 3RCDA 3ZSHA 4EOMA 3TZ9A 3R8UA 2GHMA 2Y4PA 2OXXA 3BHHA 2QHMA 3RNYA 2FUMA 4W9WA 4I92A 2AC5A 4WBOA 5KMIA 2I0YA 3HMIA 4GYIA 4BTFA 1H8FA 2X1NA 3C1XA 4QYEA 5CU2A 4QQTA 3QC4A 5J1VA 4JX7A 4D1SA 5M08A 3G33A 1DI9A 1DS5A 3KRRA 1XHAA 3IW5A 4O0YA 3VUDA 5BUIA 4BI1A 2R0UA 5DVRA 2FSLX 3FLSA 3FKLA 3UIMA 4F9AA 1ZWSA 2YCFA 3GC0A 2LAVA 3SHEA 2H9VA 4FEVA 4I3ZA 4GUEA 4TZRA 4ZSAA 5DN3A 4MWHA 3OS3A 4MF1A 4O7ZA 5DLSA 4HVHA 1ZZLA 2CNQA 4FKOA 4P2KA 5E8TA 3UOLA 4HZRA 4I5HA 4D2VA 4WG3A 3QFVA 1B39A 4JX3A 4N70A 3DFAA 2XP2A 3DK3A 4BZNA 3HLLA 3UBDA 3RAWA 3IKAA 2PMNX 3AT3A 4XRLA 2RF9A 3RTPA 3FE3A 5CVHA 5CF4A 4C58A 3WF7A 3KXXA 4ACGA 4L45A 5K3YA 5BVKA 2H96A 2CJMA 2X2LA 3EN9A 4NTTA 1UKHA 1WZYA 4D5HA 2XEYA 4NKSA 3TZ8A 4R77A 2G1TA 4F08A 3Q4ZA 4TWNA 4ALVA 4EORA 4FEWA 2XEZA 4XH6A 3G90X 4EH4A 3AD4A 3DNEA 2O3PA 3LM5A 1OPJA 2BILB 4K2RA 4L67A 2BAKA 2PYWA 4EH2A 3D9VA 5AAFA 5IQIA 5CALA 4ANLA 4FNZA 5TE0A 4F9CA 4X2KA 1Q97A 3AQVA 1OL5A 1R1WA 3NW5A 3ZUVA 2Q0NA 5AEPA 2PUIA 3DGKA 4UALA 1Q8TA 2XF0A 5EDPA 4EK8A 5CT0A 4BWKA 5IQCA 3R21A 1BKXA 3OHTA 3DKCA 4KSPA 5CF5A 3BZ3A 3LM0A 5EHYA 2JGZA 4PPCA 1DAWA 2C0OA 2Q0BA 2XUUA 5C27A 5J1WA 3E63A 5GIPE 1W7HA 2YCSA 3UE4A 4EYJA 3V3VA 2C6OA 4Q9SA 2XNGA 4BCFA 4X2FA 4FSYA 4EK5A 5L4QA 4C36A 3PXQA 2CKQA 3C0GA 4I0RA 4YLLA 3FYJX 4YURA 4FG9A 4FKGA 3RZBA 2GQGA 3I81A 4MBIA 4X3FC 4CV9A 4ZTMA 4Y5QA 4O7SA 2W4KA 4TWCA 1OI9A 3UZPA 2WQNA 4G3GA 5TF9A 3B8QA 2XA4A 3R7VA 3NNXA 2YCQA 3CR0A 4YR8A 4W4YA 5M44A 1UWJA 3BELA 3VJNA 1YHWA 2WMAA 2V55A 4GVJA 4ZOGA 3ZRLA 4YBKA 2ITTA 3HVCA 3Q5IA 5AP3A 5H2UA 3O7LB 4EONA 4IVCA 2XBJA 3QZGA 4PNIA 4L53A 3BGZA 4IDTA 4WRGA 4TL0A 4USFA 4AN2A 3A60A 5L6PA 3FZRA 3L1SA 3E3BX 3PSDA 1CMKE 3DLSA 5BVOA 4OTFA 2IN6A 1NXKA 5EYMA 4KIKA 5CS6A 1IR3A 1A9UA 2OIQA 4QQ5A 4NW5A 1LEWA 4JT3A 2OBJA 2VWVA 3C51A 3BQRA 3F69A 3DBEA 5DI1A 4DH7A 4UWYA 2JKKA 4RJ8A 1KE5A 5C26A 5EG3A 3VQUA 3H9RA 3S2PA 3VUGA 2ZOQA 4B4LA 1SNUA 4OTRA 2X9FA 2C6LA 1CKIA 1XH9A 3OVVA 2O63A 4FT9A 4DLJA 3Q2JA 5ANDA 3QYWA 4DGNA 3ZXTA 2CNVA 5AV2A 1I09A 2FSTX 2Y0AA 2WU6A 2CGVA 3CC6A 3K54A 5I9UA 4QMNA 5IA1A 4E6AA 3PJ2A 4ASXA 3QUPA 5GJFA 4F1TA 5FEEA 4DFZE 5JFVA 2J0KA 1QL6A 3QUEA 3LLAA 3ORIA 2YN8A 5AR3A 1SVGA 4KIQA 3OEZA 2BUJA 4QO9A 2ETKA 3MJ2A 4YHJA 4IQ6A 2B53A 4JBPA 5AADA 4M66A 3VS3A 3S1HA 5EOBA 4FKQA 5BVWA 3C4EA 3A99A 5HESA 2ONLA 3UNKA 3MBLA 2BKKA 4OBPA 4AS0A 2W17A 2WQBA 3NZ0A 4I1ZA 2A27A 4PDSA 3N4VA 3DAEA 1E1VA 1FVVA 3A4OX 4WBBB 3QTRA 5HVKA 4CLJA 5T6KA 5CEOA 3CKXA 2XK3A 3DU8A 3KGAA 1JPAA 1W98A 5CTPA 4BGGA 3F5XA 2PVRA 3DY7A 2QOCA 4XG2A 5EHOA 3MESA 5CZIA 3QU0A 4GKIA 5CX9A 1VZOA 2WTJA 4AW0A 3DT1A 4LG4A 4I5PA 5CAOA 1B6CB 4M0YA 2B55A 2YAKA 5DR9A 4H36A 5M4CA 1H0VA 4RIYA 3I5NA 3LQ5A 4FKPA 4H3QA 5LARA 3F2AA 3D7TA 4FIEA 2JIIA 4UMTA 2PWLA 4IXPA 1S9JA 2JDSA 2UW5A 3Q96A 3UG1A 4JQ7A 4MYGA 4D2SA 4AA0A 4LGHA 1M7NA 1OUYA 4RC3A 4RGJA 2WMRA 2XZSA 3L9PA 5E9EA 5A4CA 2QODA 1AD5A 3FC1X 4EOOA 3NR9A 3RPOA 3R04A 4NEUA 3NNWA 3W2SA 3PE1A 4NCTC 5FLFA 5EK7A 2XNOA 4RIYB 4BICA 3BYSA 4EWHA 3TDWA 2QLQA 5GINE 2HZIA 3D7TB 4M3QA 1BLXA 3ZDUA 4ITHA 5ICPA 2W9FB 1U54A 4XG4A 3R8ZA 3Q4CA 4RZVA 4IAFA 3DFCB 2VD5A 2CNUA 5AA8A 1TVOA 4C2WA 4FKUA 1XJDA 4IVAA 5I3OA 1FGIA 3Q2MA 3IONA 3W8QA 2JFLA 3ZXZA 2F7ZE 4J8MA 4JIAA 1H0WA 1MUOA 3JY0A 5CF6A 2YACA 2Y9QA 4JDHA 4RIWA 4AWIA 1OIRA 4X0MA 3UQCA 3QD0A 3VS6A 1H4LA 3QBNA 4FTNA 4AZEA 4PNKA 4ZTSA 4LFIA 5HVYA 5A46A 5H8BA 4YZBA 2HCKA 3ENMA 3Q52A 1U54B 4GW8A 4RX8A 3DXQA 4NM5A 4AFEA 4D9TA 5AUZA 4NM7A 3QALE 3FLQA 4IADA 2BROA 2GFCA 2W96B 5BX0A 1KUTA 3RHXA 3VBYA 5CU0A 4EHVA 4ZJIA 5DYJA 3AC8A 3WIKA 3HMPA 3R2BA 4NSTA 5CVFA 3QD4A 4OAUC 5EKNA 4IX4A 3QKKA 3BYMA 4RIWB 4I94A 5HIBA 5DRBA 5KUPA 4BCQA 1PKGA 4PY1A 4CVAA 4D4RA 4W4WA 4X21A 4G2FA 4E5AX 3SVVA 2XNNA 4FV5A 4FA2A 3G6HA 4ZTLA 3ZO4A 5M06A 5DOSA 3LJ0A 2W4JA 3WZEA 2PHKA 3KN6A 4KB8A 3QZHA 3QTSA 4U97A 4XG6A 4B6LA 3SW7A 3NUPA 1PF8A 2QURA 1DAYA 2VTHA 3E8NA 4KBKA 5CLPA 1OIUA 3R83A 4L7SA 3CIKA 3C9WA 2PPQA 4G5JA 4FTQA 4D9UA 1QCFA 3ZO2A 4OGRA 4F63A 3BLHA 2F7EE 3QQLA 3CQWA 3QL8A 4EBWA 3RAIA 3R22A 2ZM1A 1PXIA 4FBXA 5HNIX 4TT7A 3ORKA 3ORXA 5D9HA 4ZP5A 5G1XA 1YW2A 5AP0A 2QOFA 4Z9LA 4FTKA 3AC2A 5A6NA 4J96A 3V8WA 2R3NA 2C3KA 4EZ3A 1W8CA 5LMKA 4P7EA 2VTLA 5AR5A 1P5EA 4B8MA 4I6FA 2ITYA 4GIHA 4O82A 4DEAA 1PXLA 2PVNA 3UPXA 1VR2A 4MHAA 3KF7A 4L8MA 2WD1A 4B0GA 4FEXA 2OZOA 4WOVA 3MY5A 5EW8A 5I9YA 3KEXA 1G3NA 4BCGA 5GIOE 2C6TA 5AP4A 4JAIA 3F6XA 5DT4A 4ALUA 3Q53A 2QQ7A 4BVUA 2E9PA 4ANNA 3SGCA 3Q3BA 4IAAA 2C6DA 5CAPA 5EDQA 4LUEA 3TUDA 3MDYA 3O17A 3LXNA 3VF8A 3FQEA 2W5BA 4D4SA 2OJJA 2CSNA 3C0IA 2XJ0A 5EW3A 4L44A 2XIXA 3WF9A 4IB1A 3PJ1A 3ACKA 2WO6A 4FGBA 5FM2A 5HGIA 1P4FA 3C7QA 4YJOA 3W1FA 5KX8A 5HU9A 1TQIA 5M4IA 2X6DA 3E8DA 4KINA 5A4TA 3TACA 4S2ZA 1WMKA 1Y6AA 4NUSA 2Y6MA 3NW6A 4O1OA 3PLAE 2UW6A 3PYYA 5HX8A 5C03A 4F9WA 2H34A 3IDCA 4NTSA 4OTHA 4YHFA 3TEIA 5KCVA 1BI8A 3VHEA 2HW6A 3KMUA 4O7TA 3OWLA 5DRDA 5IQAA 1ZXEA 3KXGA 4FTRA 4F4PA 1Z5MA 3N51A 3QCSA 1UNHA 4I20A 3AMBA 3LCOA 3ULIA 2EWAA 4BY9E 5IA3A 2NNWB 2XIRA 3BRBA 4TYHA 4EUTA 3R7YA 2QOLA 3L8XA 4YC6A 2OH4A 3F5PA 1VJYA 3ANRA 4FNWA 4O0WA 3PRIA 3RPSA 4Q9ZA 4FNXA
chains in the Genus database with same CATH superfamily
3QLGA 3RK5A 1Q41A 1YXTA 3FBVA 2RFNA 1GZNA 2QG5A 4QP4A 3ELJA 4ASEA 4LOQA 3OTUA 4O4EA 4H3PA 1YWNA 2IEWA 2UW4A 1VEBA 4F7NA 3OFMA 4I6HA 4GG5A 5EKOA 2XALA 3FDNA 3ZZWA 4C37A 4WKQA 4TYHB 5FP6A 4CMOA 3SXRA 4LV7A 4O7YA 2XYNA 4FTIA 3RINA 4D2WA 1OPKA 4M0ZA 3E7VA 1ZMWA 4P4CA 4EZ5A 3AGMA 3PXRA 4A9YA 2C3LA 4O7RA 3MJ1A 3EFWA 4FSTA 4RX7A 5EI6A 5FQDC 3R9OA 4O0TA 2GDOA 1OZ1A 1UKIA 3P5JC 4BJJA 4QPAA 5IQHA 1H1PA 4LYNA 5HE2A 1OIQA 3VULA 3UZRA 3MTFA 3DS6A 5CI6A 3MB7A 4BDHA 3GU8A 5KO1A 5FTOA 4PMPA 4HZSA 1U4DA 5IH4A 1U59A 3W2CA 3OC1A 4R1VA 3E93A 2ITVA 4DH5A 4A4OA 2Y6OA 4U5JA 2W5AA 4YO4A 2R3IA 2OU7A 2GS7A 2IVUA 5CAUA 5JQ8A 1H27A 2UZUE 2WPAA 5HE0A 2VGPA 4BJJB 4NJ3A 4I4EA 4WT6A 4BCIA 1PXNA 1OMWA 2F9GA 2FB8A 3F9NA 4XG7A 2NRYA 2R3GA 2UVXA 3E5AA 4CFFA 2R3LA 2ZVAA 2RGPA 3FXXA 2XMYA 3ALNA 1F0QA 1K2PA 1Z57A 3KQ7A 4KSQA 4YPDA 5E8YA 5IUGA 3C5IA 4L3PA 2I1MA 4EHEA 5I0BA 1V0PA 4FV3A 4IIRA 4R5YA 3NIZA 4H1JA 3QGWA 2B0QA 4EK6A 3GQIA 5AR8A 4XLIA 1PKDA 4KRCA 4P90A 4BZDA 1BX6A 2XS0A 3IGOA 4JDJA 4O84A 2CGWA 3R8MA 5KMKA 4CCUA 4BDJA 1YHVA 3H10A 3TT0A 3C0HA 3VBWA 4Z3VA 4OBQA 3DTCA 3ZFMA 4DFNA 3EZRA 2C4GA 3TUCA 2XK4A 3D14A 2XNBA 3W0PA 2WKMA 1HOWA 5LOHA 3FMNA 3FY0A 5L6WL 5JH6A 5AP6A 3COHA 4ID7A 4EQUA 3VRZA 1VYWA 4FK6A 3ZEPA 2JDVA 3CSVA 2B7AA 2GHGA 3P4KA 4F1OA 3I0QA 3R9DA 5DNRA 4U45A 4FMQA 4FZ6A 4IAZA 4MXZA 4IC8A 2PUPA 4NWMA 4S30A 3VQHA 1XKKA 1SYKA 3OOGA 4I6QA 4OR5A 4R3PA 2JD5A 3RCJA 4BTJA 4CFXA 3U6JA 3EFJA 4MEDA 4XNEA 4CT1A 2VNWA 3F2RA 3FZOA 2GTNA 4WD5A 1LR4A 3VS1A 2YFXA 4E7WA 2VNYA 5E4HA 4KABA 3BHVA 2XIKA 3HV4A 4M69A 4XV1A 4C3RA 5AV0A 5CAQA 3DV3A 4WNPA 2ITQA 2C0TA 3BHUA 4O0UA 1H1QA 2BZIB 4FZDB 1SVEA 2AUHA 2R3QA 4NK9A 4QNYA 4YZ9A 5HKMA 4QTAA 3VRYA 4OUCA 3F3ZA 1SVHA 2ESMA 4DHZA 4CZYB 4EKKA 3RK9A 4K77A 4KBAA 4Y5HA 2NPQA 1KOBA 1NA7A 2X39A 3EQPA 3R63A 4N4SA 5D7VA 5KMNA 1IAJA 3E62A 1TFFA 1JKKA 3W10A 2XCKA 4PF4A 3AKJA 3P23A 4C0TA 2WQMA 3AOXA 4JRVA 4RLLA 3AG9A 3ZONA 2YLFA 3RP9A 4IFCA 2ERKA 3PFQA 3QKLA 4DFBA 3FXWA 2HW7A 5E92A 2WEIA 3D94A 1H08A 1Q4LA 3KULA 4FV4A 2J90A 4F9BA 4YHTA 3QRIA 3TJDA 4FR4A 4XBUA 3E88A 4ZSEA 4O86A 2E2BA 3HV7A 5GNKA 2UZDA 3ENHA 3OCTA 4RIOA 3LFBA 1ZYCA 4F64A 2ONLC 4PPAA 1YHSA 2UZTA 5M56A 4WRSA 2QR8A 2C5NA 1OIYA 3A8WA 5IA2A 2UW3A 4YNEA 5IISA 3PLSA 4LRKA 4KS8A 3KMWA 5J7HA 2ZMCA 5DR2A 4ONAA 3TUBA 2XM8A 4FYNA 1EH4A 4UWCA 3HAVA 3AKLA 2C1BA 3QD2B 5IQEA 3KULB 3UZTA 2WMBA 2J7TA 4MNEA 5DGZA 1PXOA 3LQ8A 4FIFA 3E7OA 1ZYJA 4I0TA 5CU6A 3QQFA 4HVDA 5AUYA 5CQWA 4FV1A 4QP1A 1V1KA 3IS5A 4A9RA 3K3JA 3DDPA 2HXLA 4GK4A 4JR7A 3IOKA 4QMXA 1JKTA 1L8TA 4DTAA 3E3PA 4J98A 2HAKA 2QVSE 5KKRC 2YABA 1JOWB 2X81A 2VWUA 5H9BA 3MSSA 3SDJA 3D5XA 4GJ2A 5FBOA 3PRFA 3PJCA 5EM7A 3IW7A 3JYAA 4MNEB 4U3YA 2XKCA 4UN0C 1P2AA 3QAME 5CY3A 2IG7A 5E8VA 3BLRA 4MD7E 4DDIA 1ZMUA 5KE0A 4WG4A 2HZNA 3QHRA 1YOMA 3PZEA 3ZLXA 3HRFA 1UA2A 4C02A 4I4FA 3FMLA 2YZLA 4QMYA 4O0XA 3VO3A 3PA4A 4ERKA 5FG8A 3HV3A 1TQPA 4HGEA 2W7XA 3A62A 4UEUA 3TTJA 4D55A 4O7WA 2IZSA 2JLDA 3JVRA 4MKCA 4E1ZA 5EM8A 3A7HA 1CDKA 1HCKA 2OIBA 3CBLA 1H1SA 5AX9A 4FKJA 4B99A 3IPHA 3QQHA 1YXSA 4ZTNA 1OKYA 3QA8A 4G6LA 4YMJA 3LFFA 1ZYDA 3R7EA 3SA0A 5A14A 4O1PA 3ZLYA 4HW7A 1IRKA 3EJ1A 4QDEA 4XOYA 4FSMA 3V5WA 2QU6A 4DCAA 2DUVA 2GNJA 3L9NA 2OJIA 2BAQA 3FMHA 3HMMA 3QRJA 3R73A 4R1YA 3UVQA 2OLCA 3GB2A 5HG5A 4OT5A 4PP9A 4USDA 4FTUA 4FVPA 5M57A 4APPA 3M42A 3ZBXA 3BEAA 1YRPA 3Q60A 5TOZA 4M7IA 3RMFA 2XNPA 2Z7QA 4ANSA 4P5ZA 3EQGA 3SV0A 1REJA 5AX3A 3UO4A 2RG6A 2IVVA 2W1IA 2V7AA 4LGGA 1QPCA 3GOPA 2ITOA 4IX3A 3A2CA 4KAOA 5JRSA 5CEPA 1Q8YA 2P4IA 1ZYLA 2FH9A 2PZ5A 4C4GA 3QRUA 5AP7A 4RVMA 3GI3A 5L3AA 2HWPA 3P7BA 4O7LA 3NYNA 3QTQA 2R3HA 4ZZMA 4DEHA 1ST0A 1CKJA 3HDMA 4L7FA 2XB7A 3NDMA 5LMAA 4F6UA 3WZDA 3I6WA 3TV4A 2VAGA 1CKPA 2WTIA 5AV3A 5IA0A 4QNAA 4CTCA 4QP6A 4YC3A 5FWKK 4P5QA 2HWOA 4X2NA 4AZWA 3HX4A 4D1ZA 4CNHA 3IDPA 3A8XA 1H28A 1RQQA 3UP7A 1Q24A 1OL7A 3Q9XA 3UPZA 5GJGA 4B9DA 3FZSA 5CEQA 1Q5KA 1FBNA 2HXQA 2BIYA 4BC6A 3ID6C 3LPBA 4JNWA 3EN7A 3PSCA 4FT5A 4YZNA 5FUTA 2WXVA 4PUZA 3TV6A 4C33A 2UZWE 2ZB1A 2R64A 4N0SA 3OW4A 4FTCA 2QOBA 1YDRE 2QD9A 4RFZA 4OT6A 4AZFA 4M84A 4PP7A 4L42A 3PP1A 5JT2A 5LMKC 2YWVA 1PXMA 4KUJA 3TXOA 4PWNA 3PXZA 4Z7GA 5BNJA 4IDVA 3M11A 3EQBA 4K8AA 1UNGA 2PTKA 3MS9A 4CYJA 5D7AA 3PPZA 2VTQA 3MVMA 3VUIA 3OCSA 3WF5A 4ZS4A 2X0PA 4AP7A 3DJ7A 3VBQA 2J5EA 3FI3A 3I7BA 4LMUA 1CTPE 3R28A 3HA6A 3VF9A 4ARKA 2PZPA 1Y8YA 3LFCA 5C4LA 4FKRA 3IECA 4BGQA 4DH8A 5BMSA 1G8KA 5AIKA 2WQOA 1PY5A 3IDBA 2YM3A 4YJUA 3D2IA 3UVRA 1ZMVA 4NKAA 3LCTA 5EOLA 1B38A 3TG1A 3R8LA 3U4WA 4CMTA 5A9UA 3NWWA 1XBAA 2XVDA 2XJ1A 4FSNA 3K2LA 2F2UA 5AM7A 3TJCA 4RFMA 1MRUA 2FGIA 2IVSA 2X0OA 4DEEA 4WO5A 5KMJA 3CLYA 3UYTA 5K5NA 4GRBA 2XKDA 3DNDA 5M09A 4FKTA 3W2RA 3PZHA 5ANEA 5EFQA 3V6SA 3NYVA 4MXAA 5BPYA 1GZ8A 1Q3WA 1XMMA 1GIHA 4AOIA 3EN6A 4UBAA 4CKIA 2XBAA 4IZ7A 4MX9A 3EIDA 4GFMA 2W06A 4AW5A 3CGFA 2G01A 5FXRA 3SAYA 3TTIA 2KTYA 4BKJA 4F6WA 2PMOX 5KMOA 2JITA 3RAKA 3R6XA 3SG8A 5TO8A 4PMTA 3NUSA 4BBMA 3MH0A 5FD2A 4F70A 5L6OA 2NYAA 5CF8A 1WFCA 2ZFYA 3ZHPC 2C5OA 3KU2A 3WF6A 4TRLA 2XK9A 1PJKA 4CFVA 3RM7A 4K1BA 5C8NA 3ZOSA 3PIZA 4DDGA 3LHJA 2NRUA 4AX8A 4F0GA 5E8WA 3A4PA 3B8RA 3FKNA 3NS9A 4ZSJA 5D1JA 2WTVA 4FC0A 2B4SB 5T68A 2WMXA 4TKSA 4PRJA 3IGGA 4G1WA 1JWHA 2FSMX 4BI2A 5F1ZA 1XH4A 2JAMA 2Y7JA 1URCA 3EFKA 3EQHA 3FLYA 3NRMA 1SZMA 2W99B 3MFTA 4GG7A 4TYIA 2QO2A 3W32A 2WZJA 3Q4TA 3VHKA 3IOPA 4K18A 3IW8A 4I21A 2BCJA 2J0IA 3PP0A 3C50A 4AW1A 5I9ZA 2YM5A 3DQWA 2YEXA 3KF4A 4FUYA 4PDPA 4PDYA 1IG1A 4EJ7A 4O27B 4QTDA 3PWDA 3SXSA 1XWSA 3KRLA 2I6LA 1PYXA 3VNTA 1H01A 1KE6A 4TW9A 1K3AA 2X7OA 1MRYA 3O96A 5DPVA 4EHZA 4USEA 2JAVA 2AEGA 4KIKB 4IZYA 3HV5A 3QX2A 5K0XA 3U6IA 2WMTA 2B54A 4J8NA 4M12A 2WB8A 3BYVA 4QP3A 3S3IA 5BUEA 4F1MA 2XNMA 4IMYA 5A6OA 4OTPA 4YZMA 4HNFA 4PMSA 3TKIA 4C7TA 1J1BA 4LMNA 4DHJA 4MH7A 4Q5HA 3QCYA 3VC4A 4IWQA 1H07A 3UMWA 1VLRA 3B2WA 5F9EA 4IJ9A 2WIPA 3TNWA 5ETCA 3GC9A 4LOOA 3RAHA 4QMQA 5IPJA 4QMZA 3F5UA 2WU7A 3F3UA 4MVFA 3SW4A 2J0JA 5EDRA 5HTIA 2X7GA 5L8LA 3R1YA 5IA4A 3NW7A 4G3DA 2GNHA 4GU6A 3TNHA 4RIXA 5AA9A 2RFDA 4XMOA 4EI4A 3OWJA 4CKRA 5L2SA 1FQ1B 1ZLTA 3SQQA 3TZMA 3H30A 4X3JA 1FMOE 5M51A 5HNGA 2XRUA 5K9IA 2ITNA 3CJGA 4BHZA 3AC1A 5EH0A 1OL6A 1REKA 3IO7A 3RK7A 4A7CA 4AGWA 4UX9A 4QPSA 3TV7A 1WVWA 2FO0A 4APCA 3ITZA 2QOHA 2WFYA 5B2KA 3HDNA 3UOJA 5LJJA 4DGMA 4F09A 4I23A 2GNIA 4F7LA 2X9EA 2PVKA 3A7GA 4PPBA 4U6RA 4RIXB 1OUKA 3UC3A 1GJOA 4XHKB 4AE6A 3R8PA 3DBCA 4FG7A 3II5A 2IPXA 2GU8A 4U3ZA 4QT1A 4F78A 2VWIA 4FVRA 3VUMA 4I24A 1L3RE 4Y46A 4C57A 5B2LA 2WQEA 2YDKA 3P9JA 3G2FA 4EQCA 4OTDA 4WIHA 4YO6A 2X6EA 5CSWA 4CT2A 4DYMA 1XQZA 3EHAA 3HMNA 4LL5A 4V04A 5M4UA 4BR3A 1YXVA 3OCBA 2JBPA 4FUXA 2OGVA 4WNKA 3L9LA 4C59A 2WMWA 3RGFA 2J5FA 3RPYA 1ZZ2A 4EH6A 2R3RA 4FTJA 2C5VA 4YTIA 3G15A 3PIXA 2J4ZA 3TIYA 1ZRZA 2ZM3A 2PE0A 1UVRA 3I79A 3NUNA 3OROA 4GUBA 4YC8A 4QMLA 2WTCA 3OUNB 5BMMA 3OY3A 2WNTA 3VJOA 4TYGA 5LMBA 3W0SA 3DQXA 4D0WA 2X7FA 3HECA 3NUXA 1NVRA 3CTJA 3E64A 3SRVA 3FV8A 4IANA 4BKYA 4A9UA 5HCYA 3PUFC 1LPUA 2WGJA 3DA6A 4HYHA 5BVEA 4G6NA 3RPRA 2NO3A 4QD6A 5IKWA 4EYMA 5LWMA 4W4XA 3A7JA 4H1MA 4U41A 3V01A 5DG5A 2VTRA 1H26A 3CJFA 3C4CA 5HEZA 2GMXA 4S32A 1TZDA 3FC2A 3CY3A 4FV0A 1JSVA 4IX6A 5IMEA 2ERZE 1T46A 4NFNA 3JR1A 2IZRA 1GIJA 4E5BA 3C4ZA 3VW8A 4CG8A 4KIPA 3SRVB 5KMLA 3I60A 4LV8A 4TTHB 3LFQA 4IE9A 5EQYA 4FKSA 1G8AA 2WEVA 2QO7A 1T45A 3QWJA 1FOTA 2VO7A 2OJGA 3VBVA 1RDQE 5BQ0A 3V8SA 3MVLA 2C6IA 4RWLA 5J8IA 3UNZA 5M4FA 4MF0A 2E9UA 3HUBA 3GT8A 4GFOA 3OF0A 3LZBA 4U7ZA 5HG8A 5TKDA 3UIBA 3W0NA 1F3MC 2GSFA 5E1SA 4FL1A 4S34A 4BCNA 4FIIA 3TNIA 3U87A 4H05A 4XJ0A 3LXLA 2DS1A 3LJ2A 5J5SA 4IZAA 1M2RA 3H9FA 4X6QC 4XG3A 2YJRA 3PFYA 4R8QA 4TY1A 1R0EA 4M8TA 2X8IA 5CU4A 4BCKA 2CCHA 5TR6A 2WTWA 2GTMA 3AD5A 4MK0A 3UDTA 2UZNA 4ACHA 3O2MA 3OUKA 4EUUA 2GNFA 2PMIA 4HGTA 5FBNC 4C4JA 4TYJA 4FGRA 1XMLA 3QCQA 4II5A 4HCTA 1JKLA 4FI1A 5L2WA 1RJBA 1OBGA 5E90A 2IZUA 3EN4A 3IW4A 3KCFA 4FK3A 5ANGA 1SMHA 5FGKA 4BDKA 3F88A 2QR7A 2W1GA 3PY3A 5E8ZA 1ZY4A 4ZZNA 3COKA 1YDSE 2R3MA 4GT4A 4HJOA 4CYIA 3F7WA 4DFUA 4ZXTA 2IW6A 5CXHA 1E1XA 2PZIA 4EOPA 4E93A 3D15A 4PDOA 4YZCA 4ZTQA 3S4QA 2XAMA 1PXPA 2VTPA 4GS6A 2XK6A 3C4WA 4NYEA 3BI6A 4LRMA 5AUTA 2QKWB 2YHVA 1PHKA 2XJ2A 4ANMA 4CV8A 3EQDA 4QPMA 4Z55A 4RJ5A 3W33A 5I9VA 4A07A 4HGLA 5M55A 1A48A 1YXXA 5BYYA 4QP2A 2V22A 2PMLX 5TT7A 4ZMFA 2HK5A 4TWPA 2VGOA 4FV9A 3R9RA 4F9YA 3D0EA 2PZYA 4LQMA 1WCCA 2F49A 3ZZEA 4YSJA 3GCVA 2VV9A 4A06A 3KXZA 4G16A 2B9FA 1UNLA 2NP8A 1Q3DA 2JEDA 1M17A 4L00A 5JZNA 4MCVA 4EKLA 5I4NA 4QEBA 3NUAA 1P14A 3EQCA 3RHKA 3CS9A 3ERKA 4ITJA 4ZIMA 3R7OA 3DTWA 2C3JA 3NYXA 4ALWA 1PRYA 4ITIA 3FPMA 3BU3A 5E91A 2VX0A 1U5QA 4HPUE 1ND4A 4DF3A 1QPJA 3E8CA 4MD8E 3RI1A 1OKZA 3LMHA 3PXKA 4QMSA 3ATSA 2DYLA 3G0FA 4QP8A 2O64A 2YCRA 4E26A 4QYYA 5DBXA 1CM8A 4E5WA 4F99A 4DTKA 4G3CA 4GCJA 3F3VA 4AZTA 3DXNA 1STCE 4EHGA 5LVNA 4DT9A 4ZMEA 3WBLA 1PMVA 3UIXA 2BDWA 2R7IA 2J51A 4A4LA 4I93A 2JDRA 4QMUA 4TNBA 3QGYA 2BZKB 1ZOHA 2F57A 2W1EA 4Q2AA 3PTGA 5K0KA 3ZM4A 1E9HA 1KE8A 2FYSA 4AN3A 3WOWA 2BKZA 2X2KA 5HI2A 3MFRA 3U4UA 4EWQA 4ZY4A 4E8AA 4AT3A 1KE9A 1APME 2J9MA 3OY1A 3VS2A 3KRWA 1R0PA 1WBNA 4XV9A 5EYKA 4AFJA 2G2HA 3ANQA 3FMMA 4G34A 4JVGA 4GVAA 5CQUA 5DT3A 5IUIA 4DG3E 2CN8A 3G6GA 4HVIA 4XRJA 3IK3A 1M2QA 3IG7A 5A4EA 3IW6A 2Z8CA 5CXZA 4XEYA 3KXHA 1DM2A 3O8TA 3EH9A 2PULA 3OWPA 2RFEA 1OKWA 3QWKA 3U54A 4D0XA 3MV5A 3EOCA 5EQPA 2OI4X 3TKUA 3VS5A 2PVMA 4AOJA 3HMOA 4JAJA 5IQGA 1Q99A 4QDVA 2EVAA 4O81A 3FQSA 2C5YA 3PA5A 4XV3A 4RJ4A 3AKKA 3V5LA 3BYUA 5DEWA 3JY9A 4J71A 3O5AA 3P86A 4QP7A 4QTCA 4GIIA 4C38A 3GBZA 2ETMA 5JGAA 2QHNA 5J9LA 3D4QA 3G5DA 2BIKB 2ITWA 4IAIA 3UGCA 3S0OA 3QTZA 1O6YA 2FSOX 4K6ZA 2GS6A 4NT4A 4QMWA 5AV1A 4C62A 4UMQA 5C01A 3CP9A 3ZH8A 3FWQA 5JEBA 1BUHA 5FXQA 5CANA 1KOAA 1JLUE 3R1QA 2HENA 2P2HA 4EQMA 3I6UA 1IAHA 4LUDA 3UJGA 3CE3A 1QMZA 3BIZA 5IDPA 3LFAA 3LQ3A 5L8JA 5AWMA 3JS2A 3ODYX 4JJRA 2QC6A 5HORA 4RA4A 4D4YA 5FDPA 3LFEA 2PVJA 3ZS5A 3FYKX 5LVLA 4QMVA 4O4FA 3L8SA 2FVDA 4Y83A 3BWFA 3RKBA 4AU8A 3D83A 2JBOA 4FX3A 1WBOA 4D2TA 2OH0E 4OW8A 4Y85A 3QZFA 3SLSA 3DBFA 4GV1A 4IB5A 5CWZA 2X2MA 4KKHA 4WNOA 5AP2A 3Q32A 3U8WA 3RNIA 3DK6A 4KNBA 5I9WA 2EB3A 3QC9A 5HE3A 5IEYA 3UO5A 3HUCA 3MH3A 4MXYA 1BL7A 3ZTXA 4AZVA 4L9IA 3BU5A 5JSMA 5JK3A 3SX9A 5I3RA 4IX5A 3Q6WA 3QTWA 4FZFB 4HGSA 4JBOA 4QTEA 4EEVA 1J7IA 3QQUA 4L01A 4BDBA 4FTMA 4C4EA 5JGDA 3PG1A 5FDXA 4NZWB 3ZRKA 4BGHA 4BKZA 4R7IA 2EXEA 4Y73A 5IQBA 2BVAA 3EQIA 4RVLA 4O96A 3JXWA 1ZY5A 3Q04A 1V0BA 3PA3A 2XIYA 3PIYA 3GU5A 3BU6A 3MPMA 5IDNA 1KE7A 4FSZA 1G8JA 4ZAUA 3EKNA 4ZTRA 3EB0A 5HQ0A 3MPTA 3SOAA 2E9NA 5LVMA 2GQRA 3R9NA 4RBLA 2J2IB 3RWQA 4FV8A 3GC7A 3TN8A 5K5XA 2W4OA 5AR7A 3ALOA 3HRBA 5AAEA 2GS2A 3TL8A 2YIYA 4DFYA 3LFSA 3MA3A 4DGGA 2ACXA 2GCDA 4FIHA 4A9TA 4UB7A 1UV5A 4NH1A 3KK9A 4YJRA 4MXXA 1M7QA 3P7CA 2HOGA 2JC6A 3WYYA 2OWBA 2OXDA 4PL5A 3OT8A 4RWKA 3OTVA 3TIZA 5GZ8A 4DBNA 4XG9A 4O4CA 3TNQB 3V5PA 3KN5A 2I0VA 4XP2A 2X4ZA 4IM2A 3ZYAA 3R01A 2X0GA 5AAGA 5J79A 4YP8A 3OMVA 3AC5A 2ZDUA 2OF4A 2OXYA 3UTOA 3LMIA 4FJVA 4ZLYA 5A3XA 4M69B 4AGUA 4KA3A 2ZM4A 4JG8A 3PJ3A 5KZIA 1LEZA 3COIA 3FZ1A 3GENA 3VUTA 2YISA 4BCMA 2OIDA 3I5ZA 4DTBA 2BRMA 3HKOA 3ZO1A 4ERWA 4HVGA 3PE2A 1W84A 3HGKA 3POZA 1IEPA 4JRNA 2I7QA 4HOKA 2IO6A 3EWHA 5HIEA 5AIRA 2VZ6A 2IJMA 2XKFA 4EC8A 1GNGA 4RLKA 2YDJA 5J7BA 2PVFA 4UMRA 3NAXA 3I4BA 4FKVA 4R3CA 3EL8A 4OTQA 4ZEGA 2UZEA 3NEWA 4RRVA 2BZJA 3P7AA 5CU3A 3O8PA 3FMKA 2Z7SA 2UW8A 3PVGA 4NM0A 4JLCA 2ITZA 5M53A 5B2MA 4V05A 1MQ4A 4AAAA 4ACMA 2BRGA 3BGPA 4KRDA 5FRIA 5AUWA 4HCUA 4OBOA 4K0YA 5IG1A 4L3JA 3AMAA 4CXAA 2G15A 2Z60A 1FVTA 3QD3A 3ZU7A 4BCHA 3Q6UA 3RPVA 1YOLA 4AF3A 4QMTA 4EH3A 4BCOA 3P0MA 1YI3A 4CTBA 4IVBA 5EI8A 3SOCA 5A4QA 3BEGA 4AW2A 4EL9A 3BYOA 3QLFA 3ZDIA 5D12A 4J99A 4BDFA 5I5ZA 4AA4A 2R3OA 2UW9A 3H4JA 3EKKA 4UZDA 5J9YA 4BBEA 4C2VA 3CTQA 2EXMA 4W8DA 4LV5A 4XLVA 5KZ0A 4PX6A 5C1QB 4ORKA 3PXFA 4QYHA 2PE2A 1URWA 1ZYSA 1BYGA 3OBGA 3R1NA 5D11A 3CTHA 3UQGA 4E4NA 3EZVA 3REPA 3PVBA 2F2CB 4X2GA 2YZAA 1H24A 1W0XC 4QRCA 3BPRA 2WMVA 4C8BA 3WYXA 4RQKA 3Q9YA 3UOKA 4RVTA 2C68A 5JFWA 2PUUA 4EH9A 2V0DA 3KXMA 5CEMA 1U5RA 3NUUA 3A61A 2J0LA 4LM5A 4YNOA 5CNOA 2C69A 1GAGA 2A19B 4WG5A 2QI8A 4DITA 2XNEA 3ZLSA 3C4FA 2VWZA 4FG8A 4M14A 4BI0A 4CQEA 3OXZA 2R3JA 4GU9A 4QYGA 2VWBA 5GJDA 1UU7A 4RVKA 2UUEA 3SG9A 1ZOGA 3HZTA 3OOMA 4R5SA 4DAWA 4UXQA 4U8ZA 1LP4A 4IWOA 3FMDA 3KVXA 2G9XA 3S00A 3EYHA 4U43A 4R7BA 2OF2A 1NVQA 4IHPA 2GHLA 5L8KA 4U0IA 4LI5A 4YLKA 5JN2A 4FOBA 4YJSA 4NL0A 4XBRA 2CLXA 3NCZA 3U51A 3ORMA 2B9HA 3HL7A 4D28A 4LOPA 3QZIA 2O0UA 1PMNA 4IM3A 4J52A 4Z16A 5A54A 4MBLA 3QX4A 4FTTA 4CEGA 4RWIA 4RWJA 3PY1A 2IZTA 5FP5A 4DCEA 3PVUA 3W0RA 4Y8DA 4DHIB 5HE1A 3B2TA 2CLQA 2OZAA 3C4XA 5B7VA 4GK2A 4FVQA 3C5UA 5BVDA 5L2TA 3P08A 5JZJA 3NVMB 2KULA 1UU8A 3ZFYA 3WZUA 2VN9A 1YQJA 3CEKA 1VYZA 3MY0A 5AJQA 3MW1A 4MUQA 3NVKI 3TYKA 3JUHA 5HCXA 4FEUA 2ITUA 4FEQA 4TXCA 5ITAA 1PYEA 3N4UA 2JKOA 3BKBA 3BX5A 4AXDA 2BPMA 5EYCA 4WHZA 5T3QA 4DEIA 3MIAA 2CGUA 3M1SA 4CQGA 2JDOA 4YTCA 5LVOA 3W0QA 1G8SA 4FSRA 2ZJWA 2VTTA 1UWHA 4U79A 5ANJA 1Z9XA 2EU9A 2OZAB 5ANOA 1WBPA 3HAMA 4HCVA 5DMZA 3HV6A 3VS0A 1WVXA 2BRBA 3BHYA 4FT3A 3RWPA 3VONA 2I0HA 2WTKB 5CI7A 4I6BA 5H8GA 4FYOA 2CPKE 2R2PA 2ZAZA 4C3PA 5LCJA 2OFVA 1G5SA 1OPLA 5C9CA 5DH3A 1SNXA 2Z2WA 3KRJA 3MFUA 3OG7A 4GSBA 3ZO3A 2XYUA 4BN1A 2YDIA 3TM0A 4EH8A 4IACA 5DHJA 3ORNA 4U42A 4GL9A 3WILA 4ZS0A 4RX9A 5A4LA 3OXIA 2W0JA 3DAJA 2A1AB 1JSTA 4UYAA 5IEXA 2WMUA 2I40A 3GFEA 3DLZA 3GCUA 4NFMA 4UZHA 2CN5A 3W0OA 3R1SA 2OFUA 3CQUA 5HTBA 4O2PA 4YSMA 4OAVB 3NNVA 3OEFX 3AC4A 3DAKA 2QLUA 1JVPP 4GT3A 3T3UA 3WZJA 2W1HA 3H0YA 3WF8A 3C13A 3POOA 2WTDA 4M13A 4EOIA 1R39A 4RJ6A 3AC3A 1KSWA 1P4OA 2V62A 4JIKA 3MVJA 4IC7A 4UXLA 4AT4A 3U55A 4L6QA 3W2PA 2X4FA 2C1AA 4JI9A 3KRXA 5CSVA 4R3RA 1HCLA <