5J9LA

Crystal structure of cpt1691 bound to tak1-tab1
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
306
structure length
286
Chain Sequence
SLHMIDYKEIEVEEVVGRGGVVCKAWRADVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYCLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase 7,TGF-beta-ac
publication title Structure-guided development of covalent TAK1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 286
sequence length 306
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2016-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5j9lA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5j9lA01
4UZDA 3ZM9A 4TNBA 4PPBA 1VYWA 3ZDIA 3BX5A 3AG9A 3V5QA 3M2WA 3MIAA 5DOSA 2UVZA 4DGGA 3R01A 3LCSA 1OUKA 1F5QA 3L9MA 4CMOA 4YZNA 4J8NA 5M4IA 4ZTLA 4QP6A 3FMJA 4FEQA 4IZ7A 2Z7LA 5L8LA 4AT4A 2I0EA 1Y6BA 3D2KA 5L4QA 2V22A 3NNUA 3EHAA 4FSRA 3UQCA 4BN1A 2C6EA 2J0JA 3NW7A 1ZOHA 3IS5A 3NRMA 2XNEA 3F9NA 4O83A 3FXXA 3K54A 1O6YA 5EM8A 1Q61A 4BDJA 3WZEA 4A9RA 2EXMA 4BI2A 5L6OA 4Q9SA 3IQ7A 2VWXA 2VTSA 3CJFA 4O0WA 3RK9A 2DQ7X 5G6VA 3VJOA 1IAHA 3KK9A 5ANDA 2JKQA 3RK5A 2WELA 4H3QA 4IX4A 3B2TA 4GFOA 3Q04A 3DFAA 5ANEA 3NUPA 2WQMA 5B2KA 4P5QA 4X21A 3ZTXA 3MN3A 3QHRA 1O6KA 3PXRA 5DR2A 3TUBA 3FZPA 4D2WA 1YXTA 3U51A 1ZOGA 3HP5A 4X3FB 4FTIA 1R0EA 4F9CA 2VTAA 4D4RA 3P23A 5IQIA 2UZUE 2FO0A 4EOSA 3F2NA 3E7OA 1Y8YA 2F7ZE 1UA2A 4RA4A 4D0XA 3HV7A 5B2LA 5DHJA 3TN8A 4C3PA 4GT5A 2X7FA 3SVVA 3BLRA 3IW8A 1PXIA 3ZXZA 4IX3A 3OS3A 3QXPA 4ZSJA 4N4SA 3I5NA 3C50A 2BVAA 4J97A 4MAOA 3VO3A 2ZYBA 5DE2A 2XA4A 4FSMA 3OHTA 5EYKA 1M14A 4QMLA 3DQXA 1H1QA 3JR1A 3HMOA 5HLNA 5J9YA 3MS9A 3UVPA 3UTOA 4XG4A 3FMHA 3OXZA 4HGTA 4GFMA 5M57A 2IN6A 2C30A 4BDEA 4K8AA 5KBRA 3F88A 5M4FA 2PVMA 3FXWA 2QR8A 5HLWA 1F0QA 5FEEA 4IJPA 1AGWA 2ITTA 3R8MA 3RVGA 1E1XA 3PXYA 3P7BA 4I6BA 1YI4A 4OTWA 3M42A 3KK8A 4YC3A 3UO6A 3MV5A 4APCA 3QKKA 3LFNA 5IQHA 1T45A 4LRMA 5LWMA 4BKZA 4WNMA 2RFEA 2BUJA 3H30A 3LCTA 3V04A 3ORZA 3ZUVA 1JBPE 4E5BA 3QUDA 4KRDA 5F94A 4IDTA 4O7YA 4PMMA 5HD4A 2X8EA 3ERKA 3CY3A 3FWQA 5EDQA 3WZKA 3TIYA 5HO7A 5J5TA 2WMWA 4FKRA 3NYOA 5KMMA 3W55A 2B52A 2WPAA 4RC3A 5ANOA 2AUHA 2G2IA 5CASA 2R3GA 5CEMA 4UZHA 5M51A 2OG8A 3KRJA 1OKWA 3F5XA 5HCZA 5HG9A 3VJNA 2YDJA 3QTQA 2QOQA 3POOA 3ORIA 2GHMA 2X9EA 1SYKA 3PA4A 5GHVA 3UO5A 5AR7A 2R3RA 5BYLA 1ZYLA 1G5SA 2VWUA 3S3IA 4ZP5A 2W5AA 5GIPE 3HLLA 3EFLA 4Z16A 4MWIA 2O63A 4RG0A 2F7XE 3R7EA 4BB4A 1J1CA 5HBJA 2R0IA 3I0QA 4IB3A 5IA5A 2ETRA 3ZC5A 4NTTA 3FL4A 2XNBA 3KCKA 3AC1A 4JAJA 4C7TA 1Q99A 4E8AA 3SG8A 1PXLA 5FM3A 4BWKA 2HELA 3BZ3A 3OOMA 4E93A 2CCIA 3KFAA 4QYFA 5HVJA 5DR9A 1UNHA 4AG8A 4MD9E 3QKLA 2RFSA 2W17A 4ANMA 4E4MA 3KXNA 4YJPA 4RWJA 4UV0A 4G5PA 3OUNB 3ZONA 4AZWA 4PP7A 3KRLA 4QMYA 2CLXA 2VO0A 4NIFB 2XS0A 5L6WL 4ALWA 4FZAB 1FMOE 2FVDA 4QRCA 2QOOA 1H1WA 2YJSA 2JBPA 4C35A 3ZLWA 1ZMWA 1SVHA 3W2QA 1YRPA 5FP6A 1YI3A 3VBYA 3K3IA 3EQDA 4HYSA 2OU7A 2PVRA 4LI5A 1GJOA 5CENA 4A4OA 4QNYA 4OUCA 2YIQA 5HKMA 2NPQA 5CAPA 5ITAA 1Q3WA 4KIKA 4U45A 4DH3A 2YDKA 4OTDA 5EW8A 4AWIA 3VQUA 3U6JA 2LGCA 3P08A 2R3FA 3FLZA 2WAJA 2BKZA 1A9UA 4YC6A 4ZXTA 3HGKA 4IZYA 3GU7A 1ZXEA 4E7WA 3HV5A 2VNWA 2Z7RA 1QCFA 4JX7A 5HO8A 2GNJA 3GGFA 4FKWA 4M68A 5C27A 4EHVA 4CKRA 2WTIA 3NCGA 4CKIA 5IQGA 2CNUA 3BE2A 1STCE 3PRFA 3AC8A 1JSVA 2AC5A 1KE7A 3C4ZA 3NEWA 3QTUA 4O6EA 4RVKA 4W8DA 3VS7A 4F6UA 2R3PA 1M2RA 3KXXA 3QALE 2IO6A 2E9OA 4IWOA 3RM6A 3DY7A 4CRLA 4RZVA 4YZCA 1Y6AA 5C9CA 3E3PA 4FK6A 5FQDC 1IAJA 4M12A 3ZLSA 5ETCA 1QPJA 3E8DA 4MBJA 3V5WA 2R7IA 4FV1A 4GL9A 3PXQA 4XH6A 1E1VA 3QWKA 5AM7A 4IAFA 4FVPA 2W4OA 4CEGA 2IVUA 2XF0A 4AF3A 3OMVA 5JQ8A 2WMBA 2GS7A 3FLQA 1XJDA 2XCHA 1PKGA 1Q24A 3LQ8A 4LM5A 4OBQA 4MWHA 5HHWA 5M08A 3AMAA 3QZIA 4DEHA 4JT3A 4TT7A 3VS5A 4P4CA 3KF7A 5AV1A 3UP7A 4F0GA 1PHKA 3KA0A 1GZKA 2C0OA 3IPHA 1H00A 2RFNA 3DLZA 1ZY5A 3PG1A 2CKPA 4V01A 5E8UA 3TZMA 3BWFA 5KO1A 1OKZA 3D7ZA 3IDPA 2QC6A 3NNVA 4UB7A 4BHNA 5CY3A 5M53A 3ACJA 3QD2B 4PDSA 2CMWA 5AV3A 4IB5A 4YPSA 2PVKA 4A9TA 3GB2A 2IZUA 3ZFXA 1JPAA 4FUYA 2PUUA 3OBJA 3MGYA 2WKMA 4PF4A 5JFWA 3OFMA 4F1MA 4FKOA 4XV1A 1URCA 2OJFE 4IFCA 3RAIA 4FTAA 3OCBA 5J87A 4BYJA 4O7WA 4RJ7A 1H27A 3QKMA 1UNGA 4HOKA 1UU8A 1YOLA 3QYWA 4J8MA 4HJOA 2XBAA 3F69A 3PZEA 3TNQB 3AC5A 2ITXA 1G8SA 2OF2A 4EK8A 3HA8A 4MQ2A 3I7BA 1H28A 1G8AA 3LLTA 3AOXA 2ERKA 1PYXA 2BTRA 4DN5A 4Y95A 4FZDB 1P2AA 1YXXA 1NVQA 4ZSEA 1YDSE 4BICA 5IEYA 3OTVA 4MXXA 3RZFA 3HP2A 4W8EA 2EWAA 4IVDA 4GJ3A 3E8CA 4K0YA 4IC8A 1SNUA 2YCQA 4N6YA 4WG4A 3VS3A 4EC9A 3ATTA 3DJ5A 3QZHA 2VTHA 3CXWA 3A7IA 3Q6WA 4AT5A 1ZARA 5E1SA 3D83A 5D1JA 4OTRA 2OWBA 3RCJA 3ZRMA 4RX7A 5C8MA 2C5NA 5BMSA 4FVRA 4RC4A 2VAGA 4U7ZA 3F5GA 3PWYA 4RWKA 1ZZ2A 5J5SA 4H05A 2PVFA 4R7HA 4AACA 3RI1A 4L3LA 5AX9A 3GBZA 4D4YA 5CANA 2OZOA 3PY0A 4LOQA 1P5EA 2ZDUA 4FVQA 3KMMA 2C47A 4YBKA 5C4KA 4R8QA 4QPAA 4R7IA 4UYNA 1QPEA 1ZMUA 4GKIA 5CAUA 4IM0A 2I6LA 3HZTA 5K0XA 3JXWA 3PP1A 4BGHA 1UU7A 2BAQA 4HGEA 4JDHA 3R8UA 5IQFA 4C59A 4YTFA 3E92A 3EN4A 4KIQA 1H4LA 2GSFA 2HY81 4O22A 3EN9A 3WOWA 4C38A 5B7VA 5BYZA 1FBNA 3FY2A 1R39A 3WYXA 1Q8YA 3IDBA 5L2WA 4RIWA 3H9FA 2XEZA 4JJRA 4PV0A 2R3JA 2WD1A 2XP2A 4L7SA 4XRLA 4FTNA 3RHKA 2E9NA 2QO2A 5CSXA 5AIRA 5LMBA 3C4EA 2B4SB 3UVQA 1B38A 4E6DA 3BI6A 3ORLA 1ATPE 4FTRA 4G16A 4UXQA 3MY1A 4MF1A 4AUAA 4AZVA 5HVYA 4ZZOA 4FKIA 4ANBA 3UP2A 1YI6A 3C0GA 5HEZA 4DT8A 4AW0A 4ARKA 1OZ1A 2Z8CA 3DA6A 2VTOA 4KKEA 3FY0A 1REJA 3CY2A 4I0RA 4JBOA 2CKOA 5BX0A 3OWLA 4A7CA 5DBXA 3LMGA 5FXRA 4O0SA 2WMVA 4QP9A 4DINA 4HYUA 4OTPA 5EFQA 5HICA 1V0OA 2UVYA 3NYXA 2J0MB 4EKKA 5A4CA 5LVLA 4EHZA 1NT2A 3QXOA 5FXQA 4LQMA 4XP0A 3OEFX 4M3QA 2ZJWA 3RPVA 2O2UA 4BBFA 4CTCA 2BHEA 2G2FA 5DEWA 5AP4A 2YLEA 4C4FA 3UE4A 3F2AA 5E9EA 3DAJA 2IPXA 1LP4A 2UW8A 3QRKA 4B8MA 4H1MA 1DI9A 3CQEA 5DFPA 2GNFA 4EZ3A 3GC7A 4O82A 3NS9A 4CGAA 3SD0A 5CF5A 3E88A 3FLNC 3MA6A 5AP3A 1PXPA 3VBWA 1WMKA 5D9HA 4S32A 3UG2A 2XYNA 3LXKA 4DEDA 3ZCLA 5CNOA 4RIYA 4D2VA 5IEXA 5JQ5A 2WIPA 1M2PA 2V62A 5BNJA 3T3UA 5GJFA 5KX8A 4QMPA 5KZIA 1TQIA 5HNBA 2ZMCA 4QYGA 5HG7A 4FKVA 3JVSA 3D5WA 4Y83A 1J1BA 3KRRA 3ODYX 3WE4A 5DNRA 3N4UA 4IXPA 4FL2A 4QYEA 2UW7A 2WTDA 3QZGA 2Z02A 4WBBB 4E4NA 3PZHA 1JNKA 4GFGA 1W7HA 3UYSA 3MI9A 4OTQA 1MQBA 4DCAA 2PPQA 1YWVA 4ZTNA 5I3OA 3FI3A 4NFNA 1M17A 1Z5MA 2ONLC 4ZZNA 4TXCA 4IQ6A 5LVNA 3HYHA 3UZTA 4PRJA 1H0VA 3A60A 5HCXA 4ITHA 4KIPA 4MQ1A 5LMAA 1BL6A 4QTDA 4ITIA 5EQPA 2VO3A 1ZYSA 1CKIA 1U59A 3EYHA 3GU6A 4Q5EA 4K18A 5CVHA 3HMPA 5BUEA 3SLSA 3PSCA 4R78A 5HLPA 5E4HA 4FV0A 5H9BA 4FX3A 4FSNA 5J1VA 5AUWA 1LPUA 2F9GA 2R64A 1NW1A 4CQEA 4QTEA 4C33A 5EI8A 5AEPA 2JDOA 2PMOX 4EH6A 4EQMA 5AADA 5FTGA 2YA9A 4X6RA 5CXZA 5CWZA 4V0GB 5HU3A 2R3LA 3N4TA 1OITA 2GMXA 4JIAA 2W5BA 3G2FA 3QQLA 2IVTA 2HENA 3D4QA 3QCYA 4YO6A 5EH0A 2C6TA 2GQGA 4O0RA 4UX9A 1FPUA 3MY5A 4ORKA 4W4VA 2C4GA 2JBOA 3Q9WA 2UVXA 2VX3A 4JQ7A 3R7VA 4EWHA 1PMEA 3ZSGA 5AP0A 3PVBA 1PXOA 4OR5A 3Q5ZA 1OVEA 3RWQA 4Z3VA 4ONAA 3NR9A 2BDFA 4EEVA 3QF9A 3L9NA 3TKIA 4IW0A 3I6UA 3MW1A 5HE3A 5B2MA 3GCUA 5K0KA 4JDIA 2WTKB 2CJMA 5CU4A 2BZKB 3KXMA 2O5KA 3QHWA 4RPVA 5HI2A 5IA0A 3RINA 2R4BA 1OIYA 3HV6A 3R04A 4NM7A 4NCTA 4Z9LA 4I5PA 1AD5A 3Q9YA 5EOLA 2B54A 4BY9E 4CRSA 3ETAA 2EB2A 4C4EA 1TVOA 4WHZA 3TTJA 4I0SA 2H6DA 2QO9A 1CMKE 1XH6A 4W4YA 5HCYA 4ZJJA 4BKYA 2PU8A 5CQUA 4WA9A 4NW6A 3QC9A 5CZHA 4YJNA 4UMPA 5M4CA 3AT4A 4KIKB 3Q3BA 4IVCA 3DAKA 1GZNA 3HX4A 4MH7A 4IX6A 5HQ0A 3E87A 4JG7A 1CTPE 5I3RA 4GIHA 3LXPA 4UEUA 5EKOA 5A4TA 1Q62A 1ZZLA 2PHKA 4RJ4A 4O1OA 4YGAA 1LUFA 2ITQA 5F4NA 5JGBA 2XNNA 4D5HA 4JLCA 5J7BA 3H0YA 3QGYA 3MYGA 5JK3A 1PXMA 4PDOA 2C0IA 3B8QA 2J51A 1Q41A 3DFCB 5FGKA 3BHVA 3KU2A 1IEPA 3EFWA 4G3DA 2OXXA 2WMAA 4HCUA 3R8PA 3COMA 5HG5A 3QX2A 4N70A 3DOGA 4DITA 5CU3A 5LVMA 4G6NA 1NVSA 2UZTA 3LJ1A 4ZMEA 2JKOA 3TM0A 2JDTA 4F4PA 3W2RA 2QODA 3W2CA 5IUHA 3G6GA 4QMTA 4QTBA 3B8RA 5EYMA 3PPZA 1OPLA 3HNGA 4FKTA 4AGDA 4CT1A 1ZWSA 3BLQA 3F3UA 3QQJA 4O27B 2PUPA 2CKEA 4J7BA 5E91A 4FKSA 4BI0A 1U54A 2I1MA 3FYJX 4BBMA 4O0VA 3DB6A 3RJCA 2YEXA 3B2WA 5LQFA 3FQSA 4O7VA 1ZOEA 3GEQA 3KVWA 2VTQA 3L8XA 4QMNA 5JFXA 5H8GA 2NP8A 3QQGA 2R5TA 2ITNA 2XKEA 2ZV8A 2F7EE 3FJQE 4JX3A 3FHIA 5BUIA 5BVWA 3TACA 2EB3A 3NUAA 3BKBA 5H8BA 4JIKA 5FEDA 4DTAA 3AD5A 4ANNA 5K5XA 5DR6A 3R8ZA 5CX9A 4TWCA 3BBWA 2PL0A 3A7JA 2W99B 2YITA 4I92A 3LMHA 3VHEA 2R3QA 1WCCA 4FC0A 3VS6A 2WZJA 4RJ3A 2C68A 4S30A 3BELA 2ZDTA 4YHTA 5M06A 3VS4A 1K9AA 3FYKX 4J95A 2YM4A 3QTZA 2X4ZA 4MXAA 4ZLOA 3W2OA 4XEYA 3QA8A 1ZY4A 2P2HA 4DEGA 4FTKA 4TWPA 5IMEA 5GJDA 4UWYA 4G1WA 3UBDA 4K77A 4C4IA 1S9IA 3R7IA 1KE6A 3TIZA 4BDHA 4APPA 4F64A 1OIQA 4F0FA 5DPVA 2X1NA 5ETIA 3VUGA 3ZC6A 4QMWA 4S33A 1L3RE 1Y57A 3P0MA 5KHXA 4CSVA 4GK3A 2HW6A 2V55A 3PXFA 4FMQA 2XK9A 4FOCA 4LGGA 3U87A 2B9IA 2CHLA 3R7UA 1XH7A 4XV9A 3N4VA 4I6QA 4JL9A 4BCHA 2ZM4A 5IISA 3QYZA 2R0UA 4TWOA 3PVGA 4CFNA 1B6CB 4OT5A 4ZS0A 1JKTA 2JLDA 4KS8A 4MXCA 1UV5A 4FODA 2X7GA 4IAIA 4G3CA 4QMUA 4FV5A 4J98A 1KE9A 4PTGA 4FOBA 2R3MA 2OZAA 4FYNA 1GNGA 3I5ZA 4CD0A 5CTPA 2WTWA 4C61A 2JKKA 2PZPA 5KCVA 3H0ZA 4BZDA 1U5QA 3BHUA 5ANGA 4IB0A 5JZJA 4LRKA 4ZLYA 2RFDA 1XH4A 3W2SA 5JEBA 4MX9A 2X7OA 4EQUA 3LVPA 5C8NA 5BMMA 3VBTA 4AU8A 5CU6A 2VO7A 3LHJA 3VQHA 5JH6A 2WOUA 3QUPA 5BQ0A 1ZRZA 2VU3A 3E64A 3NUSA 4O81A 3PLSA 3D14A 3HUBA 3FZSA 5HBHA 3QBNA 3A7FA 4AGCA 4PPCA 4C57A 4CKJA 4L44A 4NWMA 3E63A 3E7VA 3ORMA 4JBQA 4YU2A 1W0XC 5AR3A 4FGRA 5I9WA 2HZIA 2X2KA 4RMZA 2ITPA 4FA2A 2XNMA 5IA3A 4GT4A 2RG6A 4MCVA 4AN2A 1KE8A 1GAGA 1SZMA 2Y0AA 1PRYA 3E8NA 5EYDA 4NJDA 2ESMA 3O17A 3S4QA 5EM5A 2GS2A 4XBRA 5E8ZA 3OVVA 3V5LA 4U97A 2XNOA 4GSBA 2C3KA 4CMTA 4WKQA 1JAMA 4DH8A 4BBEA 4FV8A 1SMHA 2XM8A 5L8JA 4FEXA 1FGKA 3GC9A 4JVGA 4G31A 2C6MA 3DCVA 4X7QA 3WIKA 4DFZE 2HZ0A 1LEWA 4WUAA 3HL7A 1W83A 4J99A 2GS6A 4X3JA 3R63A 1YW2A 3QAME 1W8CA 4DBNA 2PULA 4RIXA 3TDVA 5HZNA 1UWHA 4M97A 4AFEA 4TYEA 2EUFB 2W9ZB 4PL3A 4FYOA 2OBJA 3DBFA 1K3AA 4BKJA 2UZLA 1H1SA 3UJGA 5CT7A 3ZBFA 3DNEA 4RIYB 3LXNA 3SGCA 3RPYA 1FVTA 1JWHA 3EQPA 5GNKA 5EHYA 1J7LA 3SXSA 4M69A 3EL8A 4YTIA 2CNVA 3DGKA 4IEBA 3QA0A 2XUUA 5ETAA 3E3BX 3C5IA 4CXAA 5HX6A 3GCQA 3MVMA 4FL3A 4KB8A 2GNIA 2XKFA 3K5UA 4QPSA 3P5KA 5HE2A 4CCBA 5C8KA 1WBTA 2Y9QA 2V0DA 3PVWA 3G0FA 4LUDA 4WSYA 4ZTSA 2C6LA 1GZOA 4Y5HA 5K3YA 4IWQA 4JS8A 3TXOA 3OCTA 5IMXA 2J4ZA 3FKNA 1JSTA 3O8TA 3KXZA 3PIYA 3GI3A 1OM1A 1HCKA 1PF8A 4HPUE 4OTIA 3VW8A 4DFBA 4EOMA 2YAKA 4XMOA 3VWAA 4IAYA 1UU3A 4XLVA 5IKWA 4BTMA 2GNLA 1V0BA 4KBCA 5FP5A 1SNXA 3H9OA 2XK6A 3OCSA 2DS1A 4D9TA 3EH9A 3C7QA 3L9LA 3WZUA 4YUQA 4B99A 1H25A 3BYUA 4AA0A 2YM3A 1J7UA 4G9CA 2AC3A 3UO4A 5J1WA 4NJ3A 4DTBA 2VTPA 4BCPA 1OECA 3AGMA 5CAQA 4K33A 1BMKA 4HNIA 4IAAA 2GPHA 4O7RA 3NIEA 1XO2B 3BGQA 5EKNA 2IJMA 3CR0A 4FUXA 2WU6A 3G9LX 4Y8DA 4V05A 2CGUA 5CSWA 2AYPA 4Q5HA 4U0IA 5E8WA 3VUHA 4UN0C 2O8YA 1RDQE 3V8WA 4LV8A 3HV3A 4ZSGA 2ETMA 3WF5A 2HY0A 3FLWA 4FKPA 1MP8A 4QO9A 3W10A 4I4EA 3DZOA 4GT3A 3BGZA 4QQ5A 4DA5A 2J0LA 4MK0A 2BTSA 4JQ8A 2C6DA 2PE0A 5ACKA 5HIEA 2C3IB 5CEPA 2Z7QA 4ASDA 5EM6A 2Y6OA 4I41A 2YLFA 3PVUA 3QQKA 1FGIA 3DNDA 1MRVA 3DJ6A 3VVHA 4Y46A 4A9UA 4ZMFA 3ZBXA 4XP3A 3RP9A 3PJ1A 3OXTA 4Y5QA 4AOJA 4F7SA 4YTHA 1XH5A 4BDIA 5CU0A 4NTSA 2EXEA 3JUHA 2WTVA 5CSVA 1PJKA 3FQHA 3ZO2A 1UU9A 2BDWA 4QTAA 4QNAA 5AUVA 3SHEA 1ERKA 2WB8A 4IJ9A 4BCOA 3IGOA 4EQCA 3UMXA 5IQDA 2OIDA 4ACDA 4O0YA 5TO8A 1IRKA 4HGLA 5CEQA 3ROCA 5BVFA 4ACCA 3KREA 3HDMA 3KXGA 4IVBA 3W1FA 1APME 3QRUA 4BIBA 1U46A 4U3YA 4YC8A 4RJ6A 1H0WA 3MFUA 2KULA 2JC6A 2NO3A 2WEVA 3S2PA 3CTQA 4HPTE 4K9YA 2WMRA 1HCLA 4I94A 4XX9A 4GKHA 3ULIA 2YABA 3VBXA 3KY2A 3O8UA 3W8LA 4ACHA 4FICA 5DGZA 1WBVA 3HRCA 2WFYA 3M11A 4CMUA 4ERKA 4L67A 4LGHA 2HXLA 4R1YA 3T8OA 5IH6A 4H3PA 3EFJA 1Q97A 4YSMA 3GQLA 2O64A 4F6SA 1IASA 1MQ4A 3LXLA 2QR7A 4WUNA 4PNKA 2YCFA 3SG9A 3KRWA 3WF6A 4XBUA 2WTCA 3UZPA 1U54B 4GK2A 3ZM4A 2XB7A 2XH5A 1WZYA 2X8DA 3U6IA 3NVMB 4O6LA 2PK9A 5CU2A 4F1OA 3LFAA 4GVJA 2GHLA 3VHKA 3BU3A 3FPMA 3OBGA 2WMQA 4HVSA 5AP1A 3VIDA 2XIKA 2RL5A 4EOOA 2ITYA 4F1TA 4IHPA 2YM6A 4FGBA 5DYJA 2YFXA 3BV2A 3F3TA 1J7IA 3DBDA 2J50A 2HOGA 3A62A 4KS7A 2XCKA 2RIOA 2V7AA 3GENA 3RWPA 2H96A 3IW4A 3Q6UA 4QYYA 5CSHA 5I9UA 4BTFA 4N0SA 4F6WA 4GUBA 3UDBA 4P2KA 5LMKA 4CYJA 5LVOA 3DXQA 1PXKA 2PMIA 2Q0NA 4IWDA 4EBVA 2YAAA 2IG7A 4R7BA 2OW3A 4EJ7A 2JKMA 4EH5A 3JY9A 3LQ3A 1FQ1B 4XYFA 4PUZA 2CPKE 3ZU7A 2WO6A 3VULA 4O7LA 4D4SA 5BVNA 4QQJA 5ANJA 3QU0A 4RX8A 3FI4A 4FKLA 2W0JA 2I0HA 4BDDA 4ANQA 3AC3A 4EK3A 3ZLYA 3R22A 4EZ5A 3CSVA 2JFMA 3F7WA 4YSJA 4DG0E 4FG9A 4O21A 5EM7A 1GZ8A 2J5EA 2ACXA 3TV4A 1P4FA 2P55A 4L7FA 2BIKB 3PY3A 2JITA 4FI1A 1VJYA 2YERA 3R7YA 4BYIA 4UMQA 3H9RA 4I6FA 3PFQA 4DEBA 4NEUA 3CGOA 3ZFMA 3I7CA 2WHBA 2ITUA 2JIIA 5AUXA 5A3XA 1NY3A 3MH3A 4NW5A 5CQWA 4C4GA 3M1SA 5HE1A 2J5FA 2J6MA 3OG7A 1MRUA 3QTXA 4PDPA 5FTOA 4LMUA 2PSQA 4PY1A 2P4IA 2W9FB 4ZS4A 5IQAA 4DAWA 4PTCA 4Y85A 5AP2A 4JG6A 3R9HA 3I79A 2FSTX 3LQ5A 3FQEA 1Q8UA 1Z57A 3E8EA 3NUYA 4FEVA 1PW2A 1XWSA 1Z9XA 4R3RA 2ZV7A 5A9UA 4DEEA 3DKCA 4FL1A 4WNKA 5EDRA 3TZ9A 2J9MA 4BIEA 3DBCA 5AR8A 3C1XA 3TNPC 3COHA 3KEXA 3MJ1A 3G9NA 4BDBA 3AD4A 5CALA 1YXUA 1CSNA 3Q32A 5ACBC 2ETKA 2UW4A 3RPSA 3AC2A 2QHNA 4E6CA 2CNQA 3RTPA 5H3QA 4I5MA 3KN6A 2J90A 5FBOA 4FV9A 1O9UA 1YXVA 3VRYA 4AAAA 4BGQA 3MJ2A 3MVLA 4WRSA 3OOGA 3CPBA 4KKHA 4QMZA 2I7QA 4O86A 3RPRA 4GH2A 2VN9A 2XJ0A 3QRIA 5KKRB 3U8WA 4F7NA 4F7LA 2JFLA 4FIGA 4K1BA 5HOAA 2J7TA 4M8TA 4X2KA 2BIYA 2FSOX 3OUKA 3UQFA 4UYAA 2VGPA 3MH2A 5FXSA 4DFUA 3F3ZA 2XK7A 3RM7A 4RVMA 3GNIB 4UMRA 4FT7A 4HVGA 5HESA 4Z7GA 5JRQA 3P86A 4ANOA 5CSPA 5EDPA 5FG8A 4A06A 3F2RA 2WMSA 3F7ZA 4AZTA 4QMMA 3FAAA 4BCJA 3UOJA 3Q52A 5BVDA 2XMYA 3FMMA 2WTKC 3Q96A 2QNJA 1AQ1A 2R3HA 4OTGA 4RIXB 3ATSA 3DK6A 3ZH8A 2ZV9A 2F2UA 2HW7A 3DBEA 4G3EA 4F9AA 3SKCA 5IZFA 5AAEA 2W06A 3NUNA 4YJVA 5F1ZA 4IC7A 4M14A 4YJQA 2C5YA 3P1AA 2PVJA 4YURA 5A4LA 1FINA 1IG1A 4O38A 2OJGA 5HG8A 2VWWA 4O2ZA 1NXKA 2HWPA 3IW5A 5AUYA 4RIOA 2CGXA 4WNOA 2JDSA 2QQ7A 2B1PA 3GVUA 1JVPP 4LL5A 4UBAA 3U9CA 3OTUA 4I3ZA 4EH3A 4ENXA 1U5RA 3BCEA 3JPVA 4MXYA 3OW4A 5EI2A 3W32A 4BVUA 4FKUA 4FV7A 5JKGA 4C2WA 2DWBA 3KCFA 2CCHA 2OI4X 4V04A 2R7BA 4BTJA 3ODZX 4FKJA 4BI1A 3AD6A 5LMKC 3NNXA 4GVAA 2GHGA 3ZRKA 5AV2A 4AGUA 2ZAZA 1Y91A 4PPAA 4L01A 4BC6A 4FG7A 5GZ8A 3C0IA 3BRBA 4FR4A 2CKQA 4PTEA 2PVNA 2CSNA 3TL8A 5EOBA 2J0IA 4ZIMA 3T9TA 5M56A 3GCVA 4U6RA 4ANSA 4X2FA 2UZWE 4UALA 5DA3A 5AA9A 4MBIA 2G01A 3OY1A 4P7EA 3DV3A 2BZIB 4AA4A 1M52A 3EB0A 2B55A 3BEGA 3EWHA 3MB7A 3R9NA 3C4CA 4ZTMA 2B53A 5EQYA 4FSTA 4BDFA 2UZVA 3QD3A 3SRVA 2OO8X 3A7HA 5J95A 3OT3A 3OF0A 2UW6A 4U80A 1PMVA 3W2PA 4DH5A 2VX1A 5E8XA 5A6OA 3ZEWA 3ZS5A 2BFXA 4XUFA 3FV8A 4I4FA 4CFWA 3D0EA 3A4PA 4EH2A 2OFVA 3R71A 3L8VA 3LAUA 4F09A 4FG8A 4L53A 4ZTHA 4F7JA 3E5AA 4E26A 5M09A 3BYMA 1IR3A 5EG3A 2G15A 3MBLA 4FNZA 4O96A 2XK8A 1RW8A 4IWPA 3K5VA 4NZWB 4BFMA 4HNFA 4QMOA 2QHMA 3CGFA 1IA9A 2GFCA 4TYJA 4IZAA 2P2IA 2YIYA 4GCJA 3QLGA 4YLJA 3TJCA 1KOAA 1RE8A 2UV2A 3NDMA 4BWPA 5KMKA 3MB6A 2V5QA 3CD8A 3HA6A 3TUCA 3DTWA 3R00A 2VTNA 1RJBA 4IX5A 3BLHA 4TPTA 2X6EA 1WBPA 3TI1A 3GQIA 3QCSA 3I0OA 4F0IA 5HTCA 4AW5A 2A19B 2FYSA 3EKNA 3Q2MA 1KSWA 2OGVA 4XRJA 2XKDA 3Q4TA 3N51A 1OBDA 2FUMA 3ZO1A 4CV8A 2RF9A 4RFZA 3OY3A 5HNGA 2XIXA 4C2VA 4XV3A 4E4XA 3S0OA 4M66A 2Z7SA 5IG1A 2UW5A 3WYYA 2YM7A 4XG8A 2X8IA 3ZUTA 4XOYA 4JNWA 3TWJA 4EL9A 5LXMA 2GQRA 4OAUC 1XQZA 3FZRA 3NNWA 4G2FA 5FRIA 3QD0A 3RAWA 3SX9A 1Q5KA 2WXVA 2XRUA 2HK5A 2XRWA 3LW0A 4BCNA 3DAEA 4I5HA 3U4UA 3QGWA 4PMSA 3V5JA 4EOQA 1T46A 3P79A 3BU5A 2QOLA 2IZSA 3GU4A 5ANIA 5AUTA 4AE6A 1A06A 2SRCA 2X39A 4ZAUA 3BV3A 2B9FA 4GEOA 3FC1X 3UIBA 5IPJA 2BAJA 4TYHA 3R83A 5J9LA 1BKXA 3BHHA 4W4WA 3V8TA 4CV9A 4F99A 4AW2A 4GG7A 4L3PA 1VYZA 4DH1A 4C0TA 2OH4A 3O0GA 4KIOA 4AOTA 4G3FA 4EOPA 3RKBA 4JQEA 4C8BA 3UPZA 4R6VA 3Q53A 3KMUA 5EHOA 3LE6A 2A4LA 3EMGA 4U8ZA 3RCDA 2E2BA 2VTLA 2ITVA 1OL2A 4ZTQA 1PMUA 4ZZMA 2LAVA 5CI7A 4FV4A 5HO6A 2BKKA 2VWBA 3EQCA 3OEZA 3BWJA 3SOAA 2C5OA 4X2JA 3LFQA 3D94A 4PX6A 1OGUA 4EZ7A 2YZAA 4GU6A 4L6QA 5JGAA 3EN6A 3FSKA 4YZDA 5HIBA 4CLIA 3ULZA 2OXDA 3QC4A 3ALOA 4BDGA 4TYGA 3CKXA 1BI8A 5DT3A 3V6RA 4D2RA 1MUOA 2JEDA 3BPRA 3TV6A 3WBLA 3MY0A 4EI4A 3DBQA 4OT6A 1BX6A 4JAIA 4ALVA 4BCFA 4C4JA 1QPDA 3DQWA 3GC8A 1KV1A 3CC6A 4KBAA 4M67A 2XZSA 4MXZA 3V5PA 1UKHA 3QQHA 3MTLA 2QOHA 3D5VA 4FEUA 3MFSA 3QTWA 4QMVA 1W84A 5JRSA 1FVRA 3BHTA 3WF8A 3PJ2A 4C4HA 4DTKA 3NIZA 2BROA 4RX9A 4DCEA 4HCTA 5IA1A 5L6PA 1XR1A 1WVYA 2WGJA 3H4JA 3OZ6A 5M44A 3FEGA 4FBXA 2VNYA 2V7OA 5FDXA 2O3PA 3Q9ZA 2J0KA 3QRTA 2IW8A 1G3NA 1BUHA 4C3FA 4I22A 4U3ZA 3RNIA 2B9HA 1VZOA 3UOKA 5GZAA 4YHJA 2B0QA 4YJOA 4F63A 4FSYA 4U44A 5KZ0A 3BQCA 3HKOA 2W1EA 4EH4A 3QL8A 4IB1A 3RPOA 3UZRA 3NCZA 3VW6A 4YZ9A 3BEAA 1WBNA 2FSLX 4WBOA 5I9YA 2OJJA 3AMBA 4MD8E 2RKUA 4FV2A 4QP3A 3OCGA 4UY9A 5D11A 2ITOA 4EORA 4DF3A 3I60A 3P78A 3KGAA 5KMOA 3G90X 3U4WA 2WEIA 3C4XA 3EQHA 3NZ0A 1H26A 4MNFA 4N6ZA 4XG7A 2WQOA 4PL4A 2BAKA 1QL6A 1ND4A 5IQBA 5AFVA 3D7TA 4K11A 2VRXA 3LM5A 3WF7A 4RVTA 1UNLA 4BDAA 4CT2A 3GUBA 3NW6A 4GK4A 1CDKA 2PZ5A 4K6ZA 3CQWA 4Y73A 4RFMA 4C3RA 4J96A 5AR4A 3GXLA 4U41A 2RGPA 4BZNA 3FLSA 4DBXA 4LUEA 3PRIA 3SDJA 2QKRA 2QCSA 2YWVA 4M15A 4EJNA 2OXYA 1KV2A 1GIHA 3O71A 3DXPA 3JS2A 3G33A 4OGRA 2B7AA 3GOPA 4D2SA 3AQVA 5FEQA 1I44A 2C69A 3D5UA 1OKYA 2QU5A 4YPDA 5JT2A 4LL0A 3C13A 5F9EA 2XEYA 4QPMA 4FIHA 4EONA 3EIDA 4FIJA 4HGSA 4TRLA 4XOZA 3VNTA 4FZ6A 3FL5A 2UZDA 5CZIA 3U6HA 4OAVB 1PKDA 4FZFB 5LCKA 4ASZA 4GW8A 5IF1A 5LVPA 4YJSA 5J79A 3NX8A 4JG8A 2XNPA 3TDWA 5T6KA 3F6XA 5HIDA 2WMXA 1JKLA 3EFKA 4NM3A 4QP8A 2F4JA 4U42A 3FC2A 4DGOA 4ZLZA 2HAKA 4ACMA 3DDQA 5IH5A 3CTHA 4DH7A 3OXIA 2REIA 4E5WA 2KTYA 4PL5A 4GS6A 3A61A 4P90A 4BCMA 1SVGA 4RIWB 3UQGA 2E9PA 4NCTC 5G1XA 5BVEA 3KULA 3MSSA 1SM2A 4MD7E 4YNOA 3C9WA 2PY3A 4LOPA 4EWQA 4BR3A 3CTJA 2QLQA 4DHFA 4YHFA 4IDVA 1V1KA 3FBVA 4YTCA 4EC8A 3RNYA 5HVKA 1OL1A 1YDTE 4J52A 5C01A 2XVDA 5E8SA 4YBJA 4BTKA 5K9IA 4EH7A 3PE2A 1M7QA 3C4FA 3U55A 4EK4A 4EUTA 2CDZA 5HBEA 4BDKA 1OMWA 2WU7A 4BCIA 4E4LA 3Q9XA 3R0TA 2VTIA 3SQQA 5K5NA 3I1AA 3VBVA 5AP5A 2VWYA 3PTGA 2CLQA 3UG1A 3ZZWA 4BF2A 2YIWA 5HX8A 1FVVA 2UZEA 4BCKA 1YHVA 3ZO4A 1Q8TA 2YISA 3EYGA 4FSUA 2BZJA 3PUPA 3CKWA 3W16A 2JDVA 4LYNA 4ZJVA 3RBWA 4BRXA 3SRVB 4MEDA 1TQMA 2QVSE 4QMXA 2PE2A 3ZEPA 1GIIA 3CS9A 4CZYB 4YNEA 2VUWA 2F2CB 2OF4A 5AWMA 1XHAA 4RJ8A 4E73A 3DB8A 2VWZA 3A8WA 1OUYA 5JFSA 4M0ZA 4B7TA 4EYJA 5C26A 4W9XA 3MWUA 2F57A 3KRXA 3BE9A 3PSDA 4IVAA 3T9IA 5CXHA 1CKPA 4H39A 1XBCA 3UNZA 3OP5A 3CIKA 3ORTA 3WZDA 4D55A 4CLJA 5EI6A 3GP0A 3W8QA 2XJ2A 5IDNA 3UNJA 3KVXA 4MNEA 3VUTA 4R77A 2C3JA 2CGVA 3HMIA 3PPJA 4K2RA 3QTSA 1WAKA 3VAPA 2PUNA 4AOIA 3BGPA 3JY0A 4XP2A 2FSMX 5E8YA 4EOLA 2BZHB 2VD5A 2W05A 4BL1A 4CTBA 3QX4A 1GOLA 2QOBA 3PJ3A 5HE0A 3TTIA 4HW7A 3R9RA 1P4OA 1XKKA 4RJ5A 5GIOE 1PYEA 5C1QB 4I21A 2H8HA 4XHKB 3SW7A 1CKJA 3R1YA 3R2YA 4CNHA 5L8KA 4CFMA 1QMZA 4S31A 4AN9A 3RMFA 4NSTA 2GU8A 4WT6A 3D15A 5HTBA 2XIYA 2Y8OA 4KA3A 5E8TA 2R3KA 4D1XA 3V6SA 4M7IA 4MYGA 2GFSA 2R9SA 3IK3A 4EYMA 3AC4A 4CFUA 3OW3A 2YCSA 4ZJIA 2UW9A 2ZM3A 5DRBA 4NFMA 3R1NA 3A8XA 3NWWA 2NNWB 2UW3A 4L46A 1J91A 1XBAA 3UODA 4DEAA 4O84A 2WOTA 3IO7A 3P9JA 4RLKA 3NUUA 4OBOA 5CYIA 5C03A 4ENYA 4GV1A 2QURA 3Q4ZA 2YN8A 3TZ8A 2P3GX 5DT0A 2NRYA 2UW0A 5CEIA 3WILA 4L45A 3GOKA 3VS2A 2JAVA 5LWNA 4L3JA 3R1QA 3QRJA 1I09A 3MFTA 2I0YA 1WFCA 4JDJA 2ZMDA 3AXWA 1BLXA 3TNIA 3FPQA 3KB7A 3HECA 4KD1A 1OPKA 3WARA 3ZXTA 4FV3A 3CPCA 3LM0A 2QOFA 4LFIA 2IVVA 5DRDA 2UZNA 5KNJA 1WBOA 3QTRA 4TYHB 4AGWA 2QONA 3S95A 4MHAA 3GT8A 5ANKA 4OTFA 3R21A 4DGMA 3AMYA 3FMDA 4HVIA 2HZ4A 2W5HA 1W98A 5AX3A 4F65A 2UZOA 4B6LA 2J2IB 1DI8A 3GU5A 3IDCA 4PMTA 3LCKA 4AX8A 4GYGA 5IA4A 3KC3A 4O0XA 1B39A 2QKWB 3IW7A 3IECA 4OLIA 1NVRA 5DWRA 4RZWA 5A54A 3DTCA 4I0TA 4LV5A 5KE0A 4DGLC 5CF6A 3FE3A 4YR8A 1WVWA 5D7AA 5KMNA 5ICPA 2HXQA 4B8LA 4F9YA 4QOXA 4G5JA 4NK9A 1X8BA 2PVYA 2VO6A 4R1VA 2BRGA 2ITZA 2ZVAA 4ITJA 1OIRA 4RVLA 4RX5A 3I6WA 3QCXA 4GUEA 4JOAA 1OL7A 4IH8A 3MVHA 5M55A 3ZLXA 3BU6A 4FTCA 2C5VA 3FMKA 4OTHA 4Z7HA 5KKRC 4DYMA 3DKFA 4LOOA 1ZLTA 4O7TA 2JD5A 3NSZA 3R02A 1JKKA 3LJ0A 3PE1A 4ZOGA 3DK7A 3VF9A 3EKKA 3NAXA 2PZRA 3THBA 4O7SA 4BGGA 4II5A 3ORNA 4IANA 4CFXA 4RC2A 4V0GA 1L8TA 3MH1A 3O51A 2X6DA 2Y4PA 3LFBA 3UGCA 4YZBA 3FI8A 5IA2A 1XH9A 2QOCA 3KL8A 3O50A 3R1SA 2W1ZA 3E93A 4MBLA 2PTKA 2W1DA 2Y4IC 4M0YA 4DC2A 4USFA 3LFEA 4PP9A 5AR5A 2IZRA 4F70A 1KOBA 2OIQA 3KKVA 5FTQA 4MVFA 4ZY6A 4E1ZA 3DDPA 4R5SA 5AUZA 5DI1A 2YJRA 4S2ZA 1Q8WA 3DKOA 4CZUA 5IQCA 5FLFA 4DFYA 3JVRA 4FT9A 5CT0A 5DIAA 1JOWB 5E92A 2QD9A 3RK7A 5LARA 5TOZA 4ASEA 5BPYA 4GJ2A 2OIBA 2XJ1A 4LG4A 1K2PA 5HTIA 4CFVA 4B9DA 5I9ZA 5IDPA 4NYEA 2ZOQA 1H1PA 5AAGA 4NM0A 5JFVA 1REKA 4XG9A 4NKAA 4I20A 3VS0A 2OH0E 3ANRA 5HGIA 5C4LA 4RA5A 3CLYA 3C0HA 2JAMA 3D7TB 4TN6A 3P7AA 4CZTA 4D58A 4XG3A 1VR2A 4LMNA 2G1TA 4NM5A 3BQRA 1H8FA 4Z55A 4L8MA 4F9BA 3HEGA 4A4LA 4ALUA 2BRBA 2PVLA 3II5A 4GIIA 4NKSA 3FZTA 4L52A 3SXRA 4QP7A 3EZVA 3WE8A 2QI8A 3FMNA 2X9FA 4FT5A 4USEA 1DS5A 4D4VA 2QOKA 3L8SA 1JLUE 2BRHA 2G9XA 1S9JA 3LFFA 5L2IA 4TY1A 4EUUA 3HMNA 3QZFA 4FZ7A 3KQ7A 2YACA 5HNIX 3O96A 4JBVA 4NT4A 3SA0A 2OFUA 4OBPA 5BYYA 3IOKA 3PLAE 3ORXA 3TNHA 3U9NA 4QQCA 1YQJA 1A48A 3R9DA 2VTMA 5A4QA 3K3JA 1OBGA 3ZRLA 3OD6X 4DFLA 5KMJA 5LJJA 2QG7A 1PXNA 3EQRA 4ZY5A 5TKDA 2QOIA 4IACA 2QLUA 2PZIA 5EYCA 4UWBA 2CN8A 3TEIA 4AZEA 3GCSA 5L2TA 5GINE 1M7NA 3Q4CA 4I24A 4DE4A 2OK1A 1YHSA 2YIXA 1FMKA 3VUMA 1UWJA 2OZAB 2R2PA 5HU9A 2JIVA 4D28A 2CGWA 5IH4A 3EOCA 3S1HA 3FDNA 5GJGA 4D2PA 3UVRA 3JYAA 3A2CA 5IUIA 3C4WA 4FNXA 2P0CA 3ZFYA 2X4FA 4NUSA 3C5UA 5AP7A 5IUGA 4O7ZA 3KULB 3F66A 4CG8A 5DT4A 3ORPA 1KUTA 3CD3A 2W1CA 4PQNA 4BDCA 4X0MA 3FZOA 3R73A 2ONLA 4MTAA 4EHGA 3EQIA 4JI9A 4CCUA 1HOWA 1OL6A 4RT7A 4N57A 2Y7JA 5DMZA 1GY3A 4BIDA 2VGOA 1Y8GA 5EHLA 1H07A 4FT3A 3A7GA 2PZYA 3ROYA 5KUPA 1RQQA 3I4BA 4JBPA 4PNIA 4WOVA 4FIFA 2I0VA 4TYIA 1YDRE 3DLSA 2PVHA 4EHEA 4KAOA 4TL0A 4KKGA 3UPXA 2ZB0A 3HRFA 3O7LB 4FEWA 2WMTA 4YZMA 3SV0A 3PDTA 2OLCA 2VZ6A 4UWCA 3ALNA 4F08A 1TKIA 1OKVA 2XKCA 4KBKA 4QTCA 3V3VA 3F5UA 3PSBA 5D41A 4RFYA 2R3IA 5F95A 2HYYA 2YWPA 1PY5A 1DAYA 4HZRA 5FWKK 3LFDA 3LPBA 2XIZA 4JR3A 4YJRA 3GU8A 4U9AA 4O0UA 3ANQA 1OL5A 2YM5A 4YLKA 4MF0A 2B9JA 2G2HA 3UMWA 2X2LA 5B0XA 4M13A 3W33A 3LZBA 3PJ8A 3LMIA 2Y4IB 2W4JA 4O91A 3PA3A 3F61A 2XIRA 3PXKA 3QUEA 4FTLA 5AM6A 5E8VA 1XBBA 3GFEA 3FKLA 5AV0A 3RGFA 2WQEA 1WBSA 4AA5A 4QMQA 2C1AA 2Z2WA 4FIIA 3COKA 4AXAA 4DG3E 4FNYA 2BRNA 5TE0A 5A46A 5J7HA 4IM2A 5DLSA 3SW4A 4G17A 3ZSIA 1WVXA 4Q9ZA 3GFWA 4M69B 2GQSA 2YDIA 3QCQA 4TTHB 2BR1A 3RZBA 3KN5A 5CF4A 4XNEA 3P7CA 4IE9A 2PWLA 2BDJA 3DK3A 4MNEB 4I5CA 3EZRA 4YO4A 4HYHA 4R5YA 4GU9A 4ZSLA 5EW9A 3IW6A 2FB8A 3CP9A 2UZBA 5TR6A 3SC1A 1ZAOA 4A4XA 1Q3DA 2IZTA 4H1JA 4LRJA 3EL7A 1YOMA 4D1ZA 4EH8A 1PMNA 3V8SA 5F20A 3WIGA 5K4JA 3NVKI 3ZOSA 2GDOA 3UC3A 1O6LA 4Y72A 4DFNA 4JRNA 3RAHA 4EOKA 3ZHPC 3BIZA 3KF4A 2VV9A 4U79A 2VTJA 2BFYA 2P33A 3FSFA 4BZOA 4IADA 4XLIA 4M84A 5J9ZA 2A27A 3LOKA 5TT7A 2VTRA 3NW5A 4FTOA 4C02A 4UMTA 4FSZA 5A4EA 4JXFA 2C5XA 5JN2A 4FKQA 4CG9A 2A0CX 4WO5A 4P5ZA 3NMUF 3QWJA 3UOHA 1LR4A 4RWIA 3UNKA 3DS6A 3ENMA 3G0EA 2HZNA 4G3GA 4C62A 4KSPA 2OJIA 3MVJA 5EQEA 3EN7A 4G6OA 5DH3A 3L9PA 3NYNA 4B4LA 3ET7A 3G15A 5LOHA 1U4DA 3D2IA 3QD4A 4H58A 4X2GA 2VX0A 4TNDA 5I0BA 4RQVA 4YJUA 4WNPA 2GTNA 3V5TA 2O0UA 3R28A 3GCPA 2QU6A 3OC1A 4AZSA 3LFCA 4F9WA 3WI6A 3V01A 3VUDA 3DXNA 3R8VA 1Q4LA 3TNWA 2NRUA 3VBQA 1R78A 3MFRA 1OB3A 2W1IA 3R7OA 3BBTB 3OWKA 4L9IA 1XH8A 3PPKA 4KABA 1KWPA 3OT8A 4O0TA 2BPMA 2GCDA 3Q5IA 3NPCA 4CQGA 5AV4A 5DG5A 3REPA 2IW9A 3R7GA 5CEOA 3TCPA 3R30A 2A1AB 3VN9A 4IAZA 4AZFA 2OKRA 2GTMA 2WQNA 4CYIA 4E6QA 3OWJA 4S34A 3RALA 4UMUA 3EN5A 4AP7A 3FLYA 3ITZA 3PYYA 3Q4UA 3IONA 4C34A 4JDKA 5JZNA 5JSMA 3LLAA 3BYSA 2HIWA 2W7XA 3AT3A 3EQGA 3R6XA 4GG5A 5CNNA 3FHRA 3TKUA 4D5KA 2YHVA 4G34A 5AAFA 3TZ7A 3P4KA 2O65A 4FIEA 5H2UA 3PP0A 3UYTA 2Y6MA 3IG7A 3OWPA 4EK6A 5DVRA 1LEZA 4X3FA 2C6KA 5ETFA 5AA8A 3HAMA 1YWNA 4KUJA 1ZMVA 2Q0BA 4LGDA 4TWNA 4USDA 3UOLA 2XBJA 5KMLA 1VEBA 2XK3A 2DUVA 3WZJA 4EBWA 4YP8A 4HYIA 4WG5A 4EOIA 2XK4A 5A14A 1H1RA 3MPAA 4BHZA 1R1WA 4X6QC 5HORA 2QG5A 3KMWA 4WIHA 2YCRA 1F3MC 3PWDA 2PYWA 4L43A 4BCQA 3O7LD 4E6AA 4RQKA 3E62A 2WMUA 1OIUA 5EW3A 5KBQA 2X2MA 4U81A 2PUIA 4O7NA 4R3CA 2BILB 4JRVA 4AN3A 4IFGA 4XS2A 3L8PA 4ANLA 5JGDA 4J1RA 2BMCA 4ZK5A 2H9VA 3LIJA 4ACGA 5TF9A 1JSUA 4CFFA 4ID7A 4X2NA 1BYGA 4FTJA 1IA8A 5IQEA 4HVHA 5I4NA 5KMIA 2HCKA 1M2QA 4ASXA 3QQUA 4C58A 3DT1A 1OI9A 3PY1A 3F3WA 4QP1A 5AUUA 4IAKA 3A4OX 3CE3A 4QP4A 2CN5A 2XM9A 3G6HA 5CEKA 4UXLA 4O1PA 5A6NA 4FTQA 3K2LA 5GZ9A 3LFSA 3FMEA 3R9OA 4MXOA 4A9SA 4DLIA 5BVOA 5T3QA 4XJ0A 5DN3A 3SAYA 4QMSA 1BI7A 2DYLA 4IZ5A 4QYHA 4IIRA 3FXZA 3A99A 2FGIA 2ITWA 1H08A 2IWIA 3VF8A 4I23A 4JR7A 4ZSAA 1ZYJA 3AT2A 2ZM1A 4QD6A 1YOJA 2PE1A 2XYUA 4AFJA 3D9VA 3DKGA 3W18A 4NU1A 1H01A 4AQCA 2EVAA 4IMYA 4EH9A 2F49A 5BVKA 1FOTA 3ACKA 1PXJA 2OJ9A 1EH4A 3HUCA 3KXHA 3ENHA 3LCDA 3MIYA 5D12A 3FMLA 3R8LA 2RG5A 2YM8A 4EK5A 4E3CA 1P14A 1ZYDA 3F3VA 5J8IA 5L3AA 2C6IA 3PJCA 1UKIA 2XNGA 3IOPA 3MTFA 4FV6A 1E9HA 4MKCA 4ZEGA 4BWXA 4QQTA 3HAVA 5AJQA 4TW9A 2VWVA 3L1SA 4GRBA 4EKLA 2I40A 4RRVA 5D7VA 2A2AA 4DG2E 4DLJA 4D2TA 3VUIA 4E5AX 5BUJA 3O8PA 4H36A 1OPJA 1YKRA 5K4IA 5T68A 3S00A 4D9UA 4J53A 4ZY4A 3PG3A 1DM2A 4RSSA 3ZSHA 1UVRA 3HMMA 4FNWA 2BRMA 4NL0A 1J3HA 4G9RA 5CF8A 3CBLA 3D5XA 3HRBA 3TUDA 2OSCA 3HDNA 3QQFA 4FTMA 4A9YA 4L00A 2OICA 3RHXA 2EXCX 4YLLA 4NIFA 1NA7A 4ERWA 3TV7A 4RWLA 1TQPA 5FUTA 4FF8A 2ZB1A 3POZA 3TG1A 1YWRA 2ZV2A 4AW1A 1CM8A 1GIJA 3ZUUA 4AE9A 2Q83A 3F5PA 2ERZE 3LKMA 2EU9A 2WQBA 5LCJA 2IW6A 3MPMA 4BCGA 4CVAA 4FT0A 3TKHA 4D1SA 4L68A 4KRCA 5DEYA 2FA2A 3WF9A 3ZYAA 4XCUA 5CVGA 2VTTA 5KHWA 3BYOA 2UUEA 4AS0A 3FI2A 4FSWA 4C37A 3R2BA 4HZSA 3TJDA 2WIHA 3PIZA 3V51A 5FD2A 3G51A 2JIUA 5AMNA 3CQUA 4HCVA 5FDPA 4J71A 3ZZEA 1JKSA 3CEKA 5JMSA 4DEIA 5AIKA 2Z60A 3EQBA 4FKGA 4C36A 2W96B 5E1EA 5H8EA 3LCOA 3HV4A 5L2SA 2W1GA 4X3FC 5CAOA 4FTTA 3NAYA 4TKSA 4WRGA 4W9WA 4WSQA 5E90A 5HD7A 4GMYA 4RBLA 3ELJA 4I1ZA 1URWA 3IGGA 3G5DA 3NUXA 5AP6A 3DZQA 2X81A 3FKOA 4KINA 4XG6A 3FZ1A 4DGNA 4HVDA 3SOCA 3CCNA 1V0PA 3HVCA 3QFVA 3U54A 4D0WA 1SVEA 4L42A 2X0GA 1R3CA 2W1HA 2YIRA 4IM3A 3MA3A 4PMPA 3MESA 3MDYA 2VWIA 5E7RA 4B0GA 4R3PA 2JGZA 3BYVA 1YVJA 3NGAA 3ORKA 4IBMA 4ZTRA 2WTJA 5EK7A 3DJ7A 3FUPA 4XG2A 3F82A 4FK3A 2R3NA 4O2PA 3UIMA 1QPCA 5CLPA 1H24A 2HWOA 3VC4A 3UC4A 5D10A 5M07A 2RSVA 4DFXE 5L2QA 3DU8A 2C6OA 4WD5A 3UIUA 4U43A 3TT0A 4G6LA 3EQFA 4XV2A 2C1BA 1BL7A 5I9XA 5FM2A 1YHWA 4I93A 3O23A 4KSQA 4U40A 4W4XA 2E9VA 1Q8ZA 4I6HA 2JDRA 3H10A 2YZLA 5CS6A 4H3BA 3Q2JA 1JQHA 3UIXA 2QO7A 2BALA 2FH9A 3VS1A 3O2MA 5AR2A 2W1FA 4Q2AA 5IEVA 1MRYA 4FE2A 4PDYA 2BHHA 3PIXA 4QT1A 3EJ1A 4YMJA 3GC0A 5CI6A 2C3LA 3VRZA 3QLFA 3RAKA 4WG3A 2R3OA 4EOJA 3ID6C 3COIA 3MPTA 3I81A 5CAVA 3DPKA 3LJ2A 4YJTA 3H3CA 3IKAA 4PWNA 4A07A 3T3VA 4KWPA 2PMLX 1KE5A 4GYIA 4E20A 1W82A 4U5JA 3NLBA 3ZO3A 3OROA 3ZMMA 2PMNX 4RGJA 4NH1A 2BCJA 1R0PA 4AT3A 3AGLA 3PA5A 2W4KA 4FTUA 4KNBA 5I9VA 2IVSA 5CVFA 4QP2A 3MH0A 3NYVA 3SXFA 2WNTA 2E9UA 2H34A 4FSQA 4RLLA 1ZYCA 5IU2A 4OW8A 1YXSA 3BHYA 5M4UA 3CJGA 4DT9A 4TZRA 2GNHA 2GNGA 3ZDUA 3VUKA 3QTIA 2C0TA 3N9XA 3Q60A 5I5ZA 1DAWA 1WBWA 3PXZA 3C51A 5FBNC
chains in the Genus database with same CATH superfamily
4UZDA 3ZM9A 4TNBA 4PPBA 1VYWA 3ZDIA 3BX5A 3AG9A 3V5QA 3M2WA 3MIAA 5DOSA 2UVZA 4DGGA 3R01A 3LCSA 1OUKA 1F5QA 3L9MA 1G8JA 4CMOA 4YZNA 4J8NA 5M4IA 4ZTLA 4QP6A 3FMJA 4FEQA 4IZ7A 2Z7LA 5L8LA 4AT4A 2I0EA 1Y6BA 3D2KA 5L4QA 2V22A 3NNUA 3EHAA 4FSRA 3UQCA 4BN1A 2C6EA 2J0JA 3NW7A 1ZOHA 3IS5A 3NRMA 2XNEA 3F9NA 4O83A 3FXXA 3K54A 1O6YA 5EM8A 1Q61A 4BDJA 3WZEA 2X0PA 2EXMA 4A9RA 4BI2A 5L6OA 4Q9SA 3IQ7A 2VWXA 2VTSA 3CJFA 4O0WA 3RK9A 2DQ7X 5G6VA 3VJOA 1IAHA 3KK9A 5ANDA 2JKQA 3RK5A 2WELA 4H3QA 4IX4A 3B2TA 4GFOA 3Q04A 3DFAA 5ANEA 3NUPA 2WQMA 5B2KA 4P5QA 4X21A 3ZTXA 3MN3A 3QHRA 1O6KA 3PXRA 1W2CA 5DR2A 3TUBA 3FZPA 4D2WA 1YXTA 3U51A 1ZOGA 3HP5A 4X3FB 4FTIA 1R0EA 4F9CA 2VTAA 4D4RA 3P23A 5IQIA 2UZUE 2FO0A 4EOSA 3F2NA 3E7OA 1Y8YA 2F7ZE 1UA2A 4RA4A 4D0XA 3HV7A 5B2LA 5DHJA 3TN8A 4C3PA 4GT5A 2X7FA 3SVVA 3BLRA 3IW8A 1PXIA 3ZXZA 4IX3A 3OS3A 3QXPA 4ZSJA 4N4SA 3I5NA 3C50A 2BVAA 4J97A 4MAOA 3VO3A 2ZYBA 5DE2A 2XA4A 4FSMA 3OHTA 5EYKA 1M14A 4QMLA 3DQXA 1H1QA 3JR1A 3HMOA 5HLNA 5J9YA 3MS9A 3UVPA 3UTOA 4XG4A 3FMHA 3OXZA 4HGTA 4GFMA 5M57A 2IN6A 2C30A 4BDEA 4K8AA 5KBRA 3F88A 5M4FA 2PVMA 3FXWA 2QR8A 5HLWA 1F0QA 5FEEA 4IJPA 1AGWA 2ITTA 3R8MA 3RVGA 1E1XA 3PXYA 2IF8A 3P7BA 4I6BA 1YI4A 4OTWA 3M42A 3KK8A 4YC3A 3UO6A 3MV5A 4APCA 2X0QA 3QKKA 3LFNA 5IQHA 1T45A 4LRMA 5LWMA 4BKZA 4WNMA 3BLAA 2RFEA 2BUJA 3H30A 3LCTA 3V04A 3ORZA 3ZUVA 1JBPE 4E5BA 3QUDA 4KRDA 5F94A 4IDTA 4O7YA 4PMMA 5HD4A 2X8EA 3ERKA 3CY3A 3FWQA 5EDQA 3WZKA 3TIYA 5HO7A 5J5TA 2WMWA 4FKRA 3NYOA 5KMMA 3W55A 2B52A 2WPAA 4O4CA 4RC3A 5ANOA 2AUHA 2G2IA 5CASA 2R3GA 5CEMA 4UZHA 5M51A 2OG8A 3KRJA 1OKWA 3F5XA 5HCZA 5HG9A 3VJNA 4F78A 2YDJA 3QTQA 2QOQA 3POOA 3ORIA 2GHMA 2X9EA 1SYKA 3PA4A 5GHVA 3UO5A 5AR7A 2R3RA 5BYLA 1ZYLA 1G5SA 2VWUA 3S3IA 4ZP5A 2W5AA 5GIPE 3HLLA 3EFLA 4Z16A 4MWIA 2O63A 4RG0A 2F7XE 3R7EA 4BB4A 1J1CA 5HBJA 2R0IA 3I0QA 4IB3A 5IA5A 2ETRA 3ZC5A 4NTTA 3FL4A 2XNBA 3KCKA 3AC1A 4JAJA 4C7TA 1Q99A 4E8AA 3SG8A 1PXLA 5FM3A 4BWKA 2HELA 3BZ3A 3OOMA 4E93A 2CCIA 3KFAA 4QYFA 5HVJA 5DR9A 1UNHA 4AG8A 4MD9E 3QKLA 2RFSA 2W17A 4ANMA 4E4MA 3KXNA 4YJPA 4RWJA 4UV0A 4G5PA 3OUNB 3ZONA 4AZWA 4PP7A 3KRLA 4QMYA 2CLXA 2VO0A 4NIFB 2XS0A 5L6WL 4ALWA 4FZAB 1FMOE 2FVDA 4QRCA 2QOOA 1H1WA 2YJSA 2JBPA 4C35A 3ZLWA 1ZMWA 1SVHA 3W2QA 1YRPA 5FP6A 1YI3A 3VBYA 3K3IA 3EQDA 4HYSA 2OU7A 2PVRA 4LI5A 1GJOA 5CENA 4A4OA 4QNYA 4OUCA 1ST0A 2YIQA 5HKMA 2NPQA 5CAPA 5ITAA 1Q3WA 4KIKA 4U45A 4DH3A 2YDKA 4OTDA 5EW8A 4AWIA 3VQUA 3U6JA 2LGCA 3P08A 2R3FA 3FLZA 2WAJA 2BKZA 1A9UA 4YC6A 4ZXTA 3HGKA 4IZYA 3GU7A 1ZXEA 4E7WA 3HV5A 2VNWA 2Z7RA 1QCFA 4JX7A 5HO8A 2ZFYA 2GNJA 3GGFA 4FKWA 4M68A 5C27A 4EHVA 4CKRA 2WTIA 3NCGA 4CKIA 5IQGA 2CNUA 3BE2A 1STCE 3PRFA 3AC8A 1JSVA 2AC5A 1KE7A 3C4ZA 3NEWA 3QTUA 4O6EA 4RVKA 4W8DA 3VS7A 4F6UA 2R3PA 1M2RA 3KXXA 3QALE 2IO6A 2E9OA 4IWOA 3RM6A 3DY7A 4CRLA 4RZVA 4YZCA 1Y6AA 5C9CA 3E3PA 4FK6A 5FQDC 1IAJA 4M12A 3ZLSA 5ETCA 1QPJA 3E8DA 4MBJA 3V5WA 2R7IA 4FV1A 4GL9A 3PXQA 4XH6A 1E1VA 3QWKA 5AM7A 4IAFA 4FVPA 2W4OA 4CEGA 2IVUA 3W0QA 2XF0A 4AF3A 3OMVA 5JQ8A 2WMBA 2GS7A 3FLQA 1XJDA 2XCHA 1PKGA 1Q24A 3LQ8A 4LM5A 4OBQA 4MWHA 5HHWA 5M08A 3AMAA 3QZIA 4DEHA 4JT3A 4TT7A 3VS5A 4P4CA 3KF7A 5AV1A 3UP7A 4F0GA 1PHKA 3KA0A 1GZKA 2C0OA 3IPHA 1H00A 2RFNA 3DLZA 1ZY5A 3PG1A 2CKPA 4V01A 5E8UA 3TZMA 3BWFA 5KO1A 1OKZA 3D7ZA 3IDPA 2QC6A 3NNVA 4UB7A 4BHNA 5CY3A 5M53A 2IEWA 3ACJA 3QD2B 4PDSA 2CMWA 5AV3A 4IB5A 4YPSA 2PVKA 2XANA 4A9TA 3GB2A 2IZUA 3ZFXA 1JPAA 4FUYA 2PUUA 3OBJA 3MGYA 2WKMA 3W0OA 4PF4A 5JFWA 3OFMA 4F1MA 4FKOA 4XV1A 1URCA 2OJFE 4IFCA 3RAIA 4FTAA 3OCBA 5J87A 4BYJA 4O7WA 4RJ7A 1H27A 3QKMA 1UNGA 4HOKA 1UU8A 1YOLA 3QYWA 4J8MA 4HJOA 2XBAA 3F69A 3PZEA 3TNQB 3AC5A 2ITXA 1G8SA 2OF2A 4EK8A 3HA8A 4MQ2A 3I7BA 1H28A 1G8AA 3LLTA 3AOXA 2ERKA 1PYXA 2BTRA 4DN5A 4Y95A 3AKJA 4FZDB 1P2AA 1YXXA 1NVQA 4ZSEA 1YDSE 4BICA 5IEYA 3OTVA 4MXXA 3RZFA 3HP2A 4W8EA 2EWAA 4IVDA 4GJ3A 3E8CA 4K0YA 4IC8A 1SNUA 2YCQA 4N6YA 4WG4A 3VS3A 4EC9A 3ATTA 3DJ5A 3QZHA 2VTHA 3CXWA 3A7IA 3Q6WA 4AT5A 1ZARA 5E1SA 3D83A 5D1JA 4OTRA 2OWBA 3RCJA 3ZRMA 4RX7A 5C8MA 2C5NA 5BMSA 4FVRA 4RC4A 2VAGA 4U7ZA 3F5GA 3PWYA 4RWKA 1ZZ2A 5J5SA 4H05A 2PVFA 4R7HA 4AACA 3RI1A 4L3LA 5AX9A 3GBZA 4D4YA 5CANA 2OZOA 3PY0A 4LOQA 1P5EA 2ZDUA 4FVQA 3KMMA 2C47A 4YBKA 4O4DA 4R8QA 5C4KA 4QPAA 4R7IA 4UYNA 1QPEA 1ZMUA 4GKIA 5CAUA 4IM0A 2I6LA 3HZTA 5K0XA 3JXWA 3PP1A 4BGHA 1UU7A 2BAQA 4HGEA 4JDHA 3R8UA 5IQFA 4C59A 4YTFA 3E92A 3EN4A 4KIQA 1H4LA 2GSFA 2HY81 4O22A 3EN9A 3WOWA 4C38A 5B7VA 5BYZA 1FBNA 3FY2A 1R39A 4QDEA 3WYXA 1Q8YA 3IDBA 5L2WA 4RIWA 3H9FA 2XEZA 4JJRA 4PV0A 2R3JA 2WD1A 2XP2A 4L7SA 4XRLA 4FTNA 3RHKA 2E9NA 2QO2A 5CSXA 5AIRA 5LMBA 3C4EA 2B4SB 3UVQA 1B38A 4E6DA 3BI6A 3ORLA 1ATPE 4FTRA 4G16A 4UXQA 3MY1A 4MF1A 4AUAA 4AZVA 5HVYA 4ZZOA 4FKIA 4ANBA 3UP2A 1YI6A 3C0GA 5HEZA 4DT8A 4AW0A 4ARKA 1OZ1A 2Z8CA 3DA6A 2VTOA 4KKEA 3FY0A 1REJA 3CY2A 4I0RA 4JBOA 2CKOA 5BX0A 3OWLA 4A7CA 5DBXA 3LMGA 5FXRA 4O0SA 2WMVA 4QP9A 4DINA 4HYUA 4OTPA 5EFQA 5HICA 1V0OA 2UVYA 3NYXA 2J0MB 4EKKA 5A4CA 5LVLA 4EHZA 1NT2A 3QXOA 5FXQA 4LQMA 4XP0A 3OEFX 4M3QA 2ZJWA 3RPVA 2O2UA 4BBFA 4CTCA 2BHEA 2G2FA 5DEWA 5AP4A 2YLEA 4C4FA 3UE4A 3F2AA 5E9EA 3DAJA 2IPXA 1LP4A 2UW8A 3QRKA 4B8MA 4H1MA 1DI9A 3CQEA 5DFPA 2GNFA 4EZ3A 3GC7A 4O82A 3NS9A 4CGAA 3SD0A 5CF5A 3E88A 3FLNC 3MA6A 5AP3A 1PXPA 3VBWA 1WMKA 5D9HA 4S32A 3UG2A 2XYNA 3LXKA 4DEDA 3ZCLA 4QDVA 5CNOA 4RIYA 4D2VA 5IEXA 5JQ5A 2WIPA 1M2PA 2V62A 5BNJA 3T3UA 5GJFA 5KX8A 4QMPA 5KZIA 1TQIA 5HNBA 4LDTA 2ZMCA 4QYGA 5HG7A 4FKVA 3JVSA 3D5WA 4Y83A 1J1BA 3KRRA 3ODYX 3WE4A 5DNRA 3N4UA 4IXPA 4FL2A 4QYEA 2UW7A 2WTDA 3QZGA 2Z02A 4WBBB 4E4NA 3PZHA 1JNKA 4GFGA 1W7HA 3UYSA 3MI9A 4OTQA 1MQBA 4DCAA 2PPQA 1YWVA 4ZTNA 5I3OA 3FI3A 4NFNA 1M17A 1Z5MA 2ONLC 4ZZNA 4TXCA 4IQ6A 5LVNA 3HYHA 3UZTA 4PRJA 1H0VA 3A60A 5HCXA 4ITHA 4KIPA 4MQ1A 5LMAA 1BL6A 4QTDA 4ITIA 5EQPA 2VO3A 1ZYSA 1CKIA 1U59A 3EYHA 3P5JC 3GU6A 4Q5EA 4K18A 5CVHA 3HMPA 5BUEA 3SLSA 3PSCA 4R78A 5HLPA 5E4HA 4FV0A 5H9BA 4FX3A 4FSNA 5J1VA 5AUWA 1LPUA 2F9GA 2R64A 1NW1A 4CQEA 4QTEA 4C33A 5EI8A 5AEPA 4AQKA 2JDOA 2PMOX 4EH6A 4EQMA 5AADA 5FTGA 2YA9A 4X6RA 5CXZA 5CWZA 4V0GB 5HU3A 2R3LA 3N4TA 1OITA 2GMXA 4JIAA 2W5BA 3G2FA 3QQLA 2IVTA 2HENA 3D4QA 3QCYA 4YO6A 5EH0A 2C6TA 2GQGA 4O0RA 4UX9A 1FPUA 3MY5A 4ORKA 4W4VA 2C4GA 2JBOA 3Q9WA 2UVXA 2VX3A 4JQ7A 3R7VA 4EWHA 1PMEA 3ZSGA 5AP0A 3PVBA 1PXOA 4OR5A 3Q5ZA 1OVEA 3RWQA 4Z3VA 4ONAA 3NR9A 2BDFA 4EEVA 3QF9A 3L9NA 3TKIA 4IW0A 3I6UA 3MW1A 5HE3A 5B2MA 3GCUA 5K0KA 4JDIA 2WTKB 2CJMA 5CU4A 2BZKB 3KXMA 2O5KA 3QHWA 4RPVA 5HI2A 5IA0A 3RINA 2R4BA 1OIYA 3HV6A 3R04A 4NM7A 4NCTA 4Z9LA 4I5PA 1AD5A 3Q9YA 5EOLA 2B54A 4BY9E 4CRSA 3ETAA 2EB2A 4C4EA 1TVOA 3UDZA 4WHZA 3TTJA 4I0SA 2H6DA 2QO9A 1CMKE 1XH6A 4W4YA 5HCYA 4ZJJA 4BKYA 2PU8A 5CQUA 4WA9A 4NW6A 3QC9A 5CZHA 4YJNA 4UMPA 5M4CA 3AT4A 4KIKB 3Q3BA 4IVCA 3DAKA 1GZNA 3HX4A 4MH7A 4IX6A 5HQ0A 3E87A 4JG7A 1CTPE 4O4FA 5I3RA 4GIHA 3LXPA 4UEUA 5EKOA 5A4TA 1Q62A 1ZZLA 2PHKA 4RJ4A 4O1OA 4YGAA 1LUFA 2ITQA 5F4NA 5JGBA 3W0PA 2XNNA 4D5HA 4JLCA 5J7BA 3H0YA 3QGYA 3MYGA 5JK3A 1PXMA 4PDOA 2C0IA 3B8QA 2J51A 1Q41A 3DFCB 4FRFA 5FGKA 3BHVA 3KU2A 1IEPA 3EFWA 4G3DA 2OXXA 2WMAA 4HCUA 3R8PA 3COMA 5HG5A 3QX2A 4N70A 3DOGA 4DITA 5CU3A 5LVMA 4G6NA 1NVSA 2UZTA 3LJ1A 4ZMEA 2JKOA 3TM0A 2JDTA 4F4PA 3W2RA 2QODA 3W2CA 5IUHA 3G6GA 4QMTA 4QTBA 3B8RA 5EYMA 3PPZA 1OPLA 3HNGA 4FKTA 4AGDA 4CT1A 1ZWSA 3BLQA 3F3UA 3QQJA 4O27B 2PUPA 2CKEA 4J7BA 5E91A 4FKSA 4BI0A 1U54A 2I1MA 3FYJX 4BBMA 4O0VA 3DB6A 3RJCA 2YEXA 3B2WA 5LQFA 3FQSA 4O7VA 1ZOEA 3GEQA 3KVWA 2VTQA 3L8XA 4QMNA 5JFXA 5H8GA 2NP8A 3QQGA 2R5TA 2ITNA 2XKEA 2ZV8A 2F7EE 3FJQE 4JX3A 3FHIA 3O5AA 5BUIA 5BVWA 3TACA 2EB3A 3NUAA 3BKBA 5H8BA 4JIKA 5FEDA 4DTAA 3AD5A 4ANNA 5K5XA 5DR6A 3R8ZA 5CX9A 4TWCA 3BBWA 2PL0A 3A7JA 2W99B 2YITA 4I92A 3LMHA 3VHEA 2R3QA 1WCCA 4FC0A 3VS6A 2WZJA 4RJ3A 2C68A 4S30A 3BELA 2ZDTA 4YHTA 5M06A 3VS4A 1K9AA 3FYKX 4J95A 2YM4A 3QTZA 2X4ZA 4MXAA 4ZLOA 3W2OA 1G8KA 4XEYA 3QA8A 1ZY4A 2P2HA 4DEGA 4FTKA 4TWPA 5IMEA 5GJDA 4UWYA 4G1WA 3UBDA 4K77A 4C4IA 1S9IA 3R7IA 1KE6A 3TIZA 4BDHA 4APPA 4F64A 1OIQA 4F0FA 5DPVA 2X1NA 5ETIA 3VUGA 3ZC6A 3BL9A 4QMWA 4S33A 1L3RE 1Y57A 3P0MA 5KHXA 4CSVA 4GK3A 2HW6A 2V55A 3PXFA 4FMQA 2XK9A 4FOCA 4LGGA 3U87A 2B9IA 2CHLA 3R7UA 1XH7A 4XV9A 3N4VA 4I6QA 4JL9A 4BCHA 2ZM4A 5IISA 3QYZA 2R0UA 4TWOA 3PVGA 4CFNA 1B6CB 4OT5A 4ZS0A 1JKTA 2JLDA 4KS8A 4MXCA 1UV5A 4FODA 2X7GA 4IAIA 4G3CA 4QMUA 4FV5A 4J98A 1KE9A 4PTGA 4FOBA 2R3MA 2OZAA 4FYNA 1GNGA 3I5ZA 4CD0A 5CTPA 2WTWA 4C61A 2JKKA 2PZPA 5KCVA 3H0ZA 4BZDA 1U5QA 3BHUA 5ANGA 4IB0A 5JZJA 4LRKA 4ZLYA 2RFDA 1XH4A 3W2SA 5JEBA 4MX9A 2X7OA 4EQUA 3LVPA 5C8NA 5BMMA 3VBTA 4AU8A 5CU6A 2VO7A 3LHJA 3VQHA 5JH6A 2WOUA 3QUPA 5BQ0A 1ZRZA 2VU3A 3E64A 3NUSA 4O81A 3PLSA 3D14A 3HUBA 3FZSA 5HBHA 3QBNA 3A7FA 4AGCA 4PPCA 4C57A 4CKJA 4L44A 4NWMA 3E63A 3E7VA 3ORMA 4JBQA 4YU2A 1W0XC 5AR3A 4FGRA 5I9WA 2HZIA 2X2KA 4RMZA 2ITPA 4DDIA 4FA2A 2XNMA 5IA3A 4GT4A 2RG6A 4MCVA 4AN2A 1KE8A 1GAGA 1SZMA 2Y0AA 1PRYA 3E8NA 5EYDA 4NJDA 2ESMA 3O17A 3S4QA 5EM5A 2GS2A 4XBRA 5E8ZA 3OVVA 3V5LA 4U97A 2XNOA 4GSBA 2C3KA 4CMTA 4WKQA 1JAMA 4DH8A 4BBEA 4FV8A 1SMHA 2XM8A 5L8JA 4FEXA 1FGKA 3GC9A 4JVGA 4G31A 2C6MA 3DCVA 4X7QA 3WIKA 4DFZE 2HZ0A 1LEWA 4WUAA 3HL7A 1W83A 4J99A 2GS6A 4X3JA 3R63A 1YW2A 3QAME 1W8CA 4DBNA 2PULA 3W0MA 4RIXA 3TDVA 5HZNA 1UWHA 4M97A 4AFEA 4TYEA 2EUFB 2W9ZB 4PL3A 4FYOA 2OBJA 3DBFA 1K3AA 4BKJA 2UZLA 1H1SA 3UJGA 5CT7A 3ZBFA 2XAMA 3DNEA 4RIYB 3LXNA 3SGCA 3RPYA 1FVTA 1JWHA 3EQPA 5GNKA 5EHYA 1J7LA 3SXSA 4M69A 3EL8A 4YTIA 2CNVA 3DGKA 4IEBA 3QA0A 2XUUA 5ETAA 3E3BX 3C5IA 4CXAA 5HX6A 3GCQA 3MVMA 4FL3A 4KB8A 2GNIA 2XKFA 3K5UA 4QPSA 3P5KA 5HE2A 4CCBA 5C8KA 1WBTA 2Y9QA 2V0DA 3PVWA 3G0FA 4LUDA 4WSYA 4ZTSA 2C6LA 1GZOA 4Y5HA 5K3YA 4IWQA 4JS8A 3TXOA 3OCTA 5IMXA 2J4ZA 3FKNA 1JSTA 3O8TA 3KXZA 3PIYA 3GI3A 3NFFB 1OM1A 1HCKA 1PF8A 4HPUE 4OTIA 3VW8A 4DFBA 4EOMA 2YAKA 4XMOA 3VWAA 4IAYA 1UU3A 4XLVA 5IKWA 4BTMA 2GNLA 1V0BA 4KBCA 5FP5A 1SNXA 3H9OA 2XK6A 3OCSA 2DS1A 4D9TA 3EH9A 3C7QA 3L9LA 3WZUA 4YUQA 4B99A 1H25A 3BYUA 4AA0A 2YM3A 1J7UA 4G9CA 2AC3A 3UO4A 5J1WA 4NJ3A 4DTBA 2VTPA 4BCPA 1OECA 3AGMA 5CAQA 4K33A 1BMKA 4HNIA 4IAAA 2GPHA 4O7RA 3NIEA 1XO2B 3BGQA 5EKNA 2IJMA 3CR0A 4FUXA 4JMQA 2WU6A 3G9LX 4Y8DA 4V05A 2CGUA 5CSWA 2AYPA 4Q5HA 4U0IA 5E8WA 3VUHA 4UN0C 2O8YA 1RDQE 3V8WA 4LV8A 3HV3A 4ZSGA 2ETMA 3WF5A 2HY0A 3FLWA 4FKPA 1MP8A 4QO9A 3W10A 4I4EA 3DZOA 4GT3A 3BGZA 4QQ5A 4DA5A 2J0LA 4MK0A 2BTSA 4JQ8A 2C6DA 2PE0A 5ACKA 5HIEA 2C3IB 5CEPA 2Z7QA 4ASDA 5EM6A 2Y6OA 4I41A 2YLFA 3PVUA 3QQKA 1FGIA 3DNDA 1MRVA 3DJ6A 3VVHA 4Y46A 4A9UA 4ZMFA 3ZBXA 4XP3A 3RP9A 3PJ1A 3OXTA 4Y5QA 4AOJA 4F7SA 4YTHA 1XH5A 4BDIA 5CU0A 4NTSA 2EXEA 3JUHA 2WTVA 5CSVA 1PJKA 3FQHA 3ZO2A 1UU9A 2BDWA 4QTAA 4QNAA 5AUVA 3SHEA 1ERKA 2WB8A 4IJ9A 4BCOA 3IGOA 4EQCA 3UMXA 5IQDA 2OIDA 4ACDA 4O0YA 5TO8A 1IRKA 4HGLA 5CEQA 3ROCA 5BVFA 4ACCA 3KREA 3HDMA 3KXGA 4IVBA 3W1FA 1APME 3QRUA 4BIBA 1U46A 4U3YA 4YC8A 4RJ6A 1H0WA 3MFUA 2KULA 2JC6A 2NO3A 2WEVA 3S2PA 3CTQA 4HPTE 4K9YA 2WMRA 1HCLA 4I94A 4XX9A 4GKHA 3ULIA 2YABA 3VBXA 3KY2A 3O8UA 3W8LA 4ACHA 4FICA 5DGZA 1WBVA 3HRCA 2WFYA 3M11A 4CMUA 4ERKA 4L67A 4LGHA 2HXLA 4R1YA 3T8OA 5IH6A 4H3PA 3EFJA 1Q97A 2XALA 4YSMA 3GQLA 2O64A 4F6SA 1IASA 1MQ4A 3LXLA 2QR7A 4WUNA 4PNKA 2YCFA 3SG9A 3KRWA 3WF6A 4XBUA 2WTCA 3UZPA 1U54B 4GK2A 3ZM4A 3UDTA 2XB7A 2XH5A 1WZYA 2X8DA 3U6IA 3NVMB 4O6LA 2PK9A 5CU2A 4F1OA 3LFAA 4GVJA 2GHLA 3VHKA 3BU3A 3FPMA 3OBGA 2WMQA 4HVSA 5AP1A 3VIDA 2XIKA 2RL5A 4EOOA 2ITYA 4F1TA 4IHPA 2YM6A 4FGBA 5DYJA 2YFXA 3BV2A 3F3TA 1J7IA 3DBDA 2J50A 2HOGA 3A62A 4KS7A 2XCKA 2RIOA 2V7AA 3GENA 3RWPA 2H96A 3IW4A 3Q6UA 4QYYA 5CSHA 5I9UA 4BTFA 4N0SA 4F6WA 4GUBA 3UDBA 4P2KA 5LMKA 4CYJA 5LVOA 3DXQA 1PXKA 2PMIA 2Q0NA 4IWDA 4EBVA 2YAAA 2IG7A 1W2FA 2OW3A 4R7BA 4EJ7A 2JKMA 4EH5A 3JY9A 3LQ3A 1FQ1B 4XYFA 4PUZA 2CPKE 3ZU7A 2WO6A 3VULA 4O7LA 4D4SA 5BVNA 4QQJA 5ANJA 3QU0A 4RX8A 3FI4A 4FKLA 2W0JA 2I0HA 4BDDA 4ANQA 3AC3A 4EK3A 3ZLYA 3R22A 4EZ5A 3CSVA 2JFMA 3F7WA 4YSJA 4DG0E 4FG9A 4O21A 5EM7A 1GZ8A 2J5EA 2ACXA 3TV4A 1P4FA 2P55A 4L7FA 2BIKB 3PY3A 2JITA 4FI1A 1VJYA 2YERA 3R7YA 4BYIA 4UMQA 3H9RA 4I6FA 3PFQA 4DEBA 4NEUA 3CGOA 3ZFMA 3I7CA 2WHBA 2ITUA 2JIIA 5AUXA 5A3XA 1NY3A 4FJVA 3MH3A 4NW5A 5CQWA 4C4GA 3M1SA 4LV7A 5HE1A 2J5FA 2J6MA 3OG7A 1MRUA 3QTXA 4PDPA 5FTOA 4LMUA 2PSQA 4PY1A 2P4IA 2W9FB 4ZS4A 5IQAA 4DAWA 4PTCA 4Y85A 5AP2A 4JG6A 3R9HA 3I79A 2FSTX 3LQ5A 3FQEA 1Q8UA 1Z57A 3E8EA 3NUYA 4AXCA 4FEVA 1PW2A 1XWSA 1Z9XA 4R3RA 2ZV7A 5A9UA 4DEEA 3DKCA 4FL1A 4WNKA 5EDRA 3TZ9A 2J9MA 4BIEA 3DBCA 5AR8A 3C1XA 3TNPC 3COHA 3KEXA 3MJ1A 3W0NA 3G9NA 4BDBA 3AD4A 5CALA 1YXUA 1CSNA 3Q32A 5ACBC 2ETKA 2UW4A 3RPSA 3AC2A 2QHNA 4E6CA 2CNQA 3RTPA 5H3QA 4I5MA 3KN6A 2J90A 5FBOA 4FV9A 1O9UA 1YXVA 3VRYA 4AAAA 4BGQA 3MJ2A 3MVLA 4WRSA 3OOGA 3CPBA 4KKHA 4QMZA 2I7QA 4O86A 3RPRA 4GH2A 2VN9A 2XJ0A 3QRIA 5KKRB 3U8WA 4F7NA 4F7LA 2JFLA 4FIGA 4K1BA 5HOAA 2J7TA 4M8TA 4X2KA 2BIYA 2FSOX 3OUKA 3UQFA 4UYAA 2VGPA 3MH2A 5FXSA 4DFUA 3F3ZA 2XK7A 3RM7A 4RVMA 3GNIB 4UMRA 4FT7A 4HVGA 5HESA 4Z7GA 5JRQA 3P86A 4ANOA 5CSPA 5EDPA 5FG8A 4A06A 3F2RA 2WMSA 3F7ZA 4AZTA 4QMMA 3FAAA 4BCJA 3UOJA 3Q52A 5BVDA 2XMYA 3FMMA 2WTKC 3Q96A 2QNJA 1AQ1A 2R3HA 4OTGA 4RIXB 3ATSA 5BV3A 3DK6A 3ZH8A 2ZV9A 2F2UA 2HW7A 3DBEA 4G3EA 4F9AA 3SKCA 5IZFA 5AAEA 2W06A 3NUNA 4YJVA 5F1ZA 4IC7A 4M14A 4YJQA 2C5YA 3P1AA 2PVJA 4YURA 5A4LA 1FINA 1IG1A 4O38A 2OJGA 5HG8A 2VWWA 4O2ZA 1NXKA 2HWPA 3IW5A 4AXFA 5AUYA 4RIOA 2CGXA 4WNOA 2JDSA 2QQ7A 2B1PA 3GVUA 1JVPP 4LL5A 4UBAA 3U9CA 3OTUA 4I3ZA 4EH3A 4ENXA 1U5RA 3BCEA 3JPVA 4MXYA 3OW4A 5EI2A 3W32A 3UDSA 4BVUA 4FKUA 4FV7A 5JKGA 4C2WA 2DWBA 3KCFA 2CCHA 2OI4X 4V04A 2R7BA 4BTJA 3ODZX 4FKJA 4BI1A 3AD6A 5LMKC 3NNXA 4GVAA 2GHGA 3ZRKA 5AV2<