5J9LA

Crystal structure of cpt1691 bound to tak1-tab1
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
306
structure length
286
Chain Sequence
SLHMIDYKEIEVEEVVGRGGVVCKAWRADVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYCLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase 7,TGF-beta-ac
publication title Structure-guided development of covalent TAK1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 286
sequence length 306
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2016-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5j9lA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5j9lA01
4TWOA 1H1PA 4TN6A 5HVYA 4B6LA 4L6QA 5LARA 5M55A 3DNEA 5BVDA 3K5VA 3VS5A 2VTRA 4XMOA 4NK9A 4FTTA 3W8LA 3F7WA 4XHKB 3ZZEA 4EHGA 3Q6WA 4IAYA 2F7EE 2A4LA 2ITVA 3FMNA 3FMMA 2VX0A 5A9UA 3RHKA 4HYHA 4ASDA 1JVPP 3WF7A 5A14A 2CKPA 3JY9A 3K3JA 3QUEA 4ZSJA 5DEWA 3EB0A 4IANA 3IDBA 3C4EA 4OTFA 5CAUA 3IW5A 3ZUTA 4BRXA 2UZUE 4CV8A 2GHMA 4X3FC 5IQHA 5IA4A 5FD2A 4D1ZA 3F82A 4UXLA 4ZY5A 5DI1A 4EH9A 2VWBA 4BCHA 4D5HA 2BRNA 2IZTA 3G6GA 4L7FA 1OL1A 1R39A 2PVHA 1X8BA 4DH3A 3OY1A 4FC0A 3CE3A 4KBKA 5AR8A 2XM9A 2JD5A 3FZRA 1GJOA 4IX3A 5LVPA 4FL1A 4FTUA 3SW7A 4AT5A 2C3IB 4DT9A 4CMTA 5LXMA 3MYGA 3RK9A 3PJ3A 1OZ1A 4QYEA 4IBMA 3TZ9A 3VQUA 3F3WA 4H1MA 3GCQA 3SXSA 2PVMA 4U9AA 3FLYA 4IXPA 3S1HA 1K2PA 2QVSE 4G3CA 3PXQA 3RPYA 3D9VA 5ETAA 3PY3A 1BL7A 3UP2A 5LVOA 3NS9A 3VS6A 3UPZA 4K0YA 4QMWA 5AUZA 5JH6A 2QD9A 3Q96A 3BQCA 4FR4A 3ULZA 1PXPA 1Q24A 4I5HA 4NTSA 4AZVA 2FVDA 4RJ8A 4PRJA 3MB6A 1ZOHA 2A27A 4KSQA 5AX9A 2CJMA 4C62A 4QTEA 2WMAA 4QNYA 5DYJA 3SDJA 3UODA 3PXYA 4YZDA 2OFVA 2BDWA 3EFWA 4R1VA 3HZTA 2Z7QA 4IE9A 5CALA 3DJ5A 2ETRA 1Q3WA 2ZDTA 5E8XA 2CGXA 2E9NA 4MK0A 4DGMA 1OKZA 4YNOA 3TN8A 4XRJA 3SA0A 4G9CA 5J5TA 3KQ7A 3A2CA 4HNFA 3M2WA 1V1KA 5HBHA 5E4HA 1E1VA 3I5NA 3QTUA 4AOJA 5J7HA 2CSNA 4FV7A 3QWJA 3ZRLA 4N0SA 4ZZOA 3R63A 2WU6A 2F2CB 3FLWA 5ETIA 1GY3A 5L6WL 3V5TA 3WI6A 3GCUA 3QZFA 1KOAA 1BX6A 2C6OA 1OVEA 3H4JA 4GFOA 4UYAA 5HIEA 1DI8A 1OIUA 4QYYA 5IH5A 2IZSA 2G2IA 3FZPA 4J52A 3NLBA 4WNPA 3VN9A 4I5MA 2JAVA 4ZLZA 2OIDA 4FICA 2W99B 3LFAA 4NJDA 3U6JA 1OIRA 3MBLA 4IWQA 4IB0A 2VTTA 3KULB 4L52A 4CRLA 5GZAA 5HNGA 1WBNA 4RWIA 3ELJA 5CWZA 3QCSA 1H01A 2RKUA 5EM5A 4FA2A 4CVAA 3NYVA 1XO2B 2JKQA 2ERKA 4I3ZA 3LE6A 4JL9A 3DU8A 2XP2A 3NUPA 2R0IA 4AXAA 2PUIA 2PK9A 2HZNA 4DGOA 1WFCA 4RIXB 4DFLA 3FQEA 4GRBA 3LMGA 4P5QA 4FEUA 2ITTA 3BHUA 2UZDA 2ZYBA 3BU3A 1PF8A 3UZRA 4NSTA 3KN6A 5DE2A 4KB8A 1M2RA 3E8CA 4KIQA 2PZYA 4AGWA 4EZ7A 3TIZA 4FTOA 4XP3A 4F0GA 4KS8A 4MD7E 5HCZA 4GG7A 3DB6A 5FWKK 3PVUA 4APCA 5IG1A 2GDOA 4E5BA 2REIA 4YSMA 5A4EA 4NU1A 1XH8A 2WMSA 2YA9A 3MFUA 2FYSA 4CFWA 4EK4A 4I4FA 4U44A 4HPUE 4G3EA 5LOHA 4Z7GA 5B7VA 1E9HA 5EKNA 2WEIA 4D2TA 4HGEA 3F5XA 3SC1A 4OGRA 3NVMB 4NL0A 5ANEA 1Q8YA 2BTRA 3I6UA 4WG4A 1Y57A 2CLQA 4BDAA 3ZRKA 3FWQA 1M2PA 3O7LB 2VO7A 1OUYA 3H10A 4M14A 2R3PA 1H0WA 2OW3A 4PL5A 5CVGA 2C6DA 3JUHA 2OZAB 4TY1A 1ZOEA 3RNIA 2OG8A 2XNOA 1KWPA 2R3FA 5AWMA 1IG1A 3QAME 4DEIA 4E4NA 5LMKC 4FSZA 3SG8A 4UMUA 4QYGA 4NIFA 2IVUA 4WG3A 4EOLA 4GKHA 4QP7A 1PRYA 1B6CB 4MEDA 1OPJA 3GU7A 4ZTHA 4YC6A 3UG2A 4DFBA 4O1OA 2I7QA 3HP2A 2Q0BA 4RIWB 3BEAA 4MKCA 5LWNA 2QLUA 4MAOA 5TR6A 2ZB0A 3A60A 5K4JA 1Q3DA 3O8TA 4HCTA 2V5QA 4BZDA 3BKBA 2ZV2A 2QODA 2UZLA 4ZLYA 4FV2A 1UKIA 4G3FA 5EM6A 3MVHA 1PMEA 4O7RA 2RGPA 4IM3A 4USEA 4AW5A 3VULA 1H1QA 4QO9A 2C3KA 2XBAA 4D1XA 3CY2A 2GS7A 3CQUA 1DAYA 1A06A 3RPOA 1J7LA 3DK7A 5EHLA 1OGUA 4M13A 5DT4A 3TV6A 3R7UA 5L2WA 3E8NA 2BZJA 5J8IA 4C7TA 2I0VA 4DITA 2OFUA 1WBVA 1H27A 2C0IA 2FH9A 4MTAA 2XF0A 4QMNA 4OTDA 3ALNA 3TUBA 3CC6A 2ACXA 1OL5A 3OY3A 5CVHA 2WFYA 4YO6A 3UYTA 1CSNA 1U54A 5HBEA 2BMCA 3VUKA 3W18A 2EXMA 5HU9A 1KE9A 2GQGA 3ZFYA 4ANMA 2FA2A 4C38A 5JN2A 4FYOA 4G6NA 4K33A 3KL8A 4UALA 1BMKA 4DTAA 2J0KA 4ZSEA 2PU8A 1UNGA 3RAKA 4FZ7A 1JKKA 4AT4A 3ZEPA 5CAPA 4R5YA 1H28A 4L7SA 3UMWA 3BLHA 4RJ3A 5F95A 3FC1X 4V0GB 2QHNA 3D83A 4BDFA 3R04A 1MP8A 4TRLA 4PQNA 4IACA 4NH1A 4ZMFA 4ZY4A 1WBSA 4F6UA 2J2IB 5F94A 3MV5A 1H8FA 2UW8A 3DDPA 3EN7A 3SQQA 1A48A 4CG8A 3I4BA 4AZEA 2BROA 4XBUA 3CKWA 4B7TA 3OTUA 3EQHA 3VIDA 5T6KA 2WU7A 2RFSA 4AFEA 3BWFA 3RPSA 2HCKA 3FAAA 5AR7A 2YFXA 2YDIA 3F5UA 3LFDA 4WNOA 5EI6A 3SX9A 1YHVA 4FSUA 4KBCA 3PFQA 4JBOA 3P86A 1P14A 4GYIA 5KE0A 2IZRA 3FLNC 3I0QA 3ODYX 2QR7A 3I79A 4KSPA 4LUEA 4V01A 4BCOA 3DKOA 3UTOA 3MY1A 5L2IA 5CEQA 4FT9A 4AU8A 5CAVA 5IQCA 4PDSA 5HU3A 4G6OA 1ND4A 3DGKA 3DJ6A 2NRYA 3K3IA 3KXNA 2VTMA 4BF2A 4JG6A 5L8LA 3LKMA 3OW4A 3E7VA 3FHRA 3GC8A 2CGUA 1H4LA 2O2UA 2IW8A 4BVUA 4A4XA 3RI1A 4AT3A 2YABA 2G9XA 4UZDA 4YHFA 3BHYA 3W32A 2BHEA 3QTRA 2C69A 4RLKA 5EW9A 3C0IA 4QOXA 5C4KA 5AP7A 4G1WA 2I0HA 4IZ7A 4MBLA 3RTPA 1G8AA 4MBIA 4YC8A 4S33A 3COIA 3E92A 3NUXA 5DH3A 1YXUA 5DFPA 4E93A 3NYNA 5KMKA 4IB1A 4QYHA 5AV2A 2V22A 3C0HA 5DOSA 1XBAA 1SNXA 4F1OA 4Z16A 4DC2A 4EOJA 4M66A 4DINA 5K4IA 3FKOA 4PPBA 4QMLA 2VO3A 4DH5A 2DYLA 4IC8A 4U6RA 2UUEA 4NM3A 4XUFA 2XIKA 3HMPA 3O71A 5FXQA 5FXRA 3QC9A 4FKQA 3TNQB 4EI4A 2GQSA 5HGIA 3JS2A 3WIKA 4YMJA 5CASA 4ZMEA 4JQ8A 3NNWA 4ALWA 4U40A 5J79A 5J9YA 4RWJA 4KS7A 3DT1A 4G16A 1L3RE 3TWJA 3RAWA 3Q04A 2C30A 3II5A 5KHXA 3Q4ZA 4DG2E 4APPA 2NO3A 2YM7A 3M42A 3QTIA 3V01A 3AGLA 4M0YA 2X2MA 1YWRA 1YOJA 2GHGA 2OKRA 3UO4A 1O6LA 2CCHA 1YI4A 4GH2A 1Q8WA 3PWDA 2G01A 4YZNA 5CU2A 2UVYA 1IAHA 4RWKA 4O7NA 2X7FA 4NUSA 5HNBA 3TZ8A 3RBWA 5HX8A 3GC7A 2ZOQA 3ZLXA 2YHVA 4O0TA 2W96B 4QP3A 4JG7A 3V3VA 4HYUA 4DHFA 4R78A 1YVJA 3KRXA 3RK5A 5BVOA 3VBYA 4C35A 3MW1A 3R9HA 4ZZMA 3MY5A 5BPYA 3DLSA 1VEBA 3E93A 3KMWA 3ZLYA 4PPAA 3R7OA 3Q2MA 3ULIA 3ZDIA 1QPCA 2OJJA 3QXPA 3ITZA 4O0RA 5D9HA 4XLVA 2ZB1A 4D5KA 3PDTA 3BBTB 5BVKA 5AFVA 4MYGA 5IMXA 3NUYA 3R1QA 4CMOA 1GZKA 5DEYA 3IG7A 4L44A 2GPHA 3KC3A 2RF9A 2ZVAA 4EH5A 1Y8GA 3U9NA 4XG8A 2IZUA 3DZQA 3JVSA 5EYCA 4CSVA 5C26A 2GNIA 4ZLOA 3MPTA 4IZAA 4IWOA 4E5WA 3FZOA 4TPTA 2BUJA 1NA7A 3PIXA 4I23A 5CU4A 3VBTA 4BZOA 5IUGA 4M0ZA 3LXKA 3KULA 3TM0A 2UW7A 3UNJA 2XM8A 1IASA 2G2FA 3NEWA 3PRIA 2CNUA 3EL7A 3K5UA 4JJRA 3RHXA 3IW6A 4FMQA 5CNNA 3DLZA 4JX3A 2VZ6A 3LMIA 3Q4UA 1IR3A 3DXNA 2XJ1A 4FGRA 2J0LA 2WOUA 4E73A 3DZOA 4AAAA 4RIXA 2B55A 3ZSHA 3QQLA 4M15A 4P7EA 2B9JA 3L9MA 4YPDA 3BPRA 5F20A 1FVVA 2PZPA 5ACBC 1OKWA 4EL9A 4HW7A 4FKSA 2IG7A 3N51A 3HAVA 3QTSA 4RLLA 3OT3A 2FSLX 4EQUA 5HO8A 2VTQA 5J9LA 2WPAA 3FMHA 2C47A 3AMBA 5FQDC 3LLTA 5AR3A 5IUIA 2ONLC 3FMLA 5AUVA 2C6EA 2C5OA 2ERZE 3NX8A 3KRLA 5I3RA 4DGGA 1CKJA 3IQ7A 4Y95A 1BKXA 3GCSA 3AT2A 3A61A 2X4ZA 3DNDA 4CQEA 2XH5A 4U3YA 3C5UA 5FBOA 4KKGA 1R0PA 2YITA 3BYOA 4O6EA 4PP9A 3S3IA 1ZARA 4M67A 4U8ZA 5EH0A 4U41A 3Q53A 4KRCA 4JOAA 4MXOA 2X9FA 4QPAA 2HK5A 2QO2A 4ZTNA 3SLSA 5BUIA 2VTJA 3R00A 4TZRA 3PA5A 1F5QA 3CTJA 2A2AA 2HW7A 3QGWA 4JAJA 5IQEA 3I81A 3RINA 4QMMA 3BE2A 3BE9A 3LCOA 2CKQA 4F6WA 3U55A 2VV9A 2WTKC 5IU2A 5HG7A 2OZAA 4LGHA 3VW8A 4ERKA 3QHWA 1KOBA 3AT3A 5AP2A 1OIQA 3THBA 5ANDA 3HECA 3NGAA 5FEDA 4E4XA 4BCKA 1ZMVA 3TDWA 3TDVA 5AP6A 2PE0A 3GP0A 4XCUA 5H8EA 3TZMA 5EK7A 4CCBA 2HIWA 4NM7A 1JBPE 3ETAA 5IA0A 4FVRA 4IB5A 4RIWA 4JQEA 4RJ4A 4C4JA 3D5WA 3FXWA 5M4FA 2W1ZA 4RIYB 1ZZLA 1G5SA 4USDA 3IONA 4FUXA 4Q5HA 3NW7A 3RJCA 1UKHA 3FV8A 2F2UA 1W84A 3DPKA 5HG8A 4Q9ZA 5JGAA 1OKYA 2BFYA 4ZEGA 3ANRA 4EOIA 1LR4A 3EOCA 3S2PA 3MIYA 4FEVA 1APME 2VGPA 3MSSA 3OD6X 2PTKA 4Y5HA 5I9YA 3MN3A 4D55A 4O38A 2Y4IC 4G17A 3QA0A 4D1SA 4O7VA 3TV7A 5HE0A 5JZNA 2CLXA 4KD1A 3ZZWA 4TWPA 3RNYA 4D4YA 4F08A 5E8ZA 2XKEA 3A8WA 3BWJA 4W4XA 3BHTA 4BB4A 1I09A 2C6IA 4R3PA 4E4MA 4XG9A 4B4LA 3KCKA 2R3RA 4LOPA 3EQIA 2QOKA 3MJ1A 5KKRC 1QPDA 4D9TA 4FTIA 3B2TA 2PE2A 4DF3A 4BCMA 4JDIA 5DWRA 4YLJA 4DEEA 3ORXA 4RX9A 4TTHB 4FKVA 3ROYA 5L2SA 3FI8A 5D7AA 3UOHA 2FSOX 1GOLA 4GK4A 3FL5A 2CNVA 2J9MA 3FXZA 2X8EA 2R3LA 4V0GA 3LJ1A 3RCDA 4FF8A 3WIGA 4LG4A 1Q8TA 2OI4X 3JY0A 3OUKA 4RMZA 3DAKA 2F57A 3W10A 4DFYA 2IPXA 2UZWE 4GU6A 5IA3A 2VTHA 2JC6A 2J6MA 5HCXA 2OXYA 3VNTA 4BHZA 3CCNA 4B8LA 1FMKA 4EWQA 3N9XA 4M97A 5TO8A 2QOOA 5IH4A 1JKLA 3V5QA 3FZ1A 4UMQA 2EU9A 2OICA 2WQNA 4CYJA 3OCTA 2JDOA 5BUEA 3AD5A 1S9IA 2WQMA 2C68A 3QQJA 3LXLA 3C9WA 3PSBA 5FXSA 2QU6A 2VWXA 1YXTA 4UBAA 3KXZA 4HZSA 4JDJA 5FBNC 4IVDA 5EM7A 1RW8A 3NPCA 4LOQA 4YTCA 3CJGA 3CQWA 4JRVA 4K2RA 3S00A 3CP9A 2F4JA 2EUFB 5CAQA 4LV5A 5CZIA 2ZV9A 3RGFA 3E62A 5EOBA 1XQZA 4RC2A 2ITUA 3BRBA 5KX8A 3LFSA 2YM6A 1CM8A 5CI7A 4FV6A 4GT3A 4ZK5A 3FLSA 3CGFA 3ZCLA 4CRSA 4CGAA 5HNIX 2J0MB 2Q0NA 5AP4A 1F0QA 1YXSA 4FNYA 4KWPA 4PY1A 3LCTA 5DLSA 4DCEA 4BBMA 4EBWA 4ID7A 1YHWA 2OXXA 4U0IA 2CKOA 3MVMA 4I92A 4C3PA 3AC1A 4F4PA 2J51A 5JFVA 2PUNA 3FEGA 3KXXA 3ZO1A 5BUJA 2QC6A 1M17A 3SV0A 3CD3A 4BGHA 5FDPA 3D5VA 2XBJA 2RFDA 3IK3A 2DWBA 1XWSA 4RG0A 3TACA 5AV1A 3ZUVA 4BDEA 4OBOA 3M1SA 5A4LA 2VD5A 2RL5A 2WO6A 3ZO4A 3CD8A 3TNWA 4BDKA 4ENXA 4G31A 2YM3A 4IM0A 4WSQA 4XYFA 1ZOGA 3VJOA 1KE6A 4QQJA 4WUAA 4J53A 4AW1A 1ATPE 3MB7A 4NT4A 5HQ0A 4WUNA 2VX1A 1H26A 2XUUA 3EQDA 3HP5A 2HWOA 4IC7A 5JQ8A 4PTGA 4USFA 3ID6C 5AP5A 4IDVA 2R7IA 1Q99A 2PMNX 3G51A 4FTRA 1HOWA 5D12A 4I4EA 5KO1A 2XNMA 1ZY5A 2CGVA 2VU3A 4L9IA 4NW6A 3W2OA 5BMSA 3AC8A 4TWCA 5CEMA 3R02A 3I7CA 5B2MA 5IQGA 4FG8A 3F9NA 4ORKA 2YERA 1YDTE 3IPHA 3NUSA 4QTDA 3NW6A 3ENMA 3LQ5A 3BU5A 4LYNA 3ZLSA 5L3AA 4GL9A 4FIFA 4WKQA 3EKKA 2QOBA 3ZFXA 2ITXA 3VBQA 3E8EA 3NYOA 3UOLA 4H3QA 3VBWA 4ACGA 2R3JA 3AC4A 2VNWA 3PE2A 5TE0A 5HTBA 4OTQA 4YZ9A 2OJGA 4FZDB 4FUYA 4MVFA 5CI6A 1Q4LA 3OEZA 3DK3A 2IJMA 3COMA 3F66A 4FK6A 5F4NA 1SNUA 4BWXA 2VWZA 3IKAA 5HG9A 3COKA 5EHOA 4RIOA 4FSNA 5I9UA 3VWAA 3WBLA 4CLIA 5JRQA 5I9VA 3P23A 5CSVA 4UX9A 2WMWA 3MESA 4QRCA 4FSMA 1BUHA 3AC3A 4FTMA 2FGIA 4FKWA 4GK2A 4RWLA 1F3MC 4ZJIA 4ZJJA 2YZLA 3QTWA 4FSWA 5CXHA 1Q61A 3W2RA 4FIHA 4FZ6A 4BI2A 1XH6A 1YOMA 3DBEA 2Y7JA 2W5BA 3R22A 4QP8A 5M57A 3U9CA 4N4SA 2ITYA 4IMYA 2G15A 4XP0A 4DFXE 2V55A 2HZ4A 3V04A 1OIYA 2BALA 2BRMA 4C59A 4O7SA 2PVYA 4LGDA 4UV0A 3KF7A 4C34A 1G8SA 5IQBA 3DTCA 3IGGA 2XNNA 3MH1A 4RA5A 5AM7A 2VN9A 2XB7A 4MNEB 4FKTA 5HICA 4E6DA 4GFGA 4B9DA 2WTVA 3GC9A 4TYIA 3E5AA 3LCSA 1TKIA 4FE2A 4TYGA 4C4FA 4BBEA 3ZM9A 3WZEA 1FMOE 2R9SA 4XV9A 4PMTA 4AW0A 2UZEA 3O0GA 3AMYA 3QTQA 3K54A 2QOLA 5IEYA 3QQHA 4IX4A 4S30A 4HVDA 1WVYA 2IWIA 1REKA 4BTMA 5IDNA 2QG5A 3LFQA 4XV3A 4EC9A 3O8UA 4NWMA 5BYLA 1H0VA 5CYIA 3UIXA 3VAPA 5I9XA 4LRKA 1VYWA 3D7TB 4I5CA 2WNTA 4FV3A 3V5WA 3C4XA 2YIRA 2UZVA 3EJ1A 1ZXEA 3LHJA 4O2ZA 5AAGA 5HHWA 4KAOA 5CANA 3DAJA 3I60A 4MD8E 3KK8A 3SGCA 4U7ZA 3LLAA 5D1JA 4MXZA 4EZ5A 4CKJA 1BL6A 3O8PA 4X21A 3AT4A 3DY7A 4RRVA 5CF4A 4E6AA 1UA2A 2B0QA 3I5ZA 4N6YA 3Q60A 3C4CA 3VHEA 1UWHA 4O1PA 1WBPA 2C0TA 3LFNA 3BLRA 1OMWA 1P5EA 3KKVA 4PL3A 3GEQA 3QYWA 4U80A 4J96A 5D41A 5HG5A 3WF6A 3KXHA 3ZU7A 3QZHA 4LMUA 4ITJA 4UZHA 4AWIA 4H05A 1B39A 3DK6A 4IWPA 4GV1A 1U5RA 4BTJA 3M11A 2AC5A 2IVTA 3UGCA 4DEDA 1DM2A 3QFVA 2GS2A 3R7GA 5FEEA 4W4WA 3BX5A 3R01A 2YACA 2BPMA 4YZMA 2C1BA 2YCRA 1H00A 2BDJA 4AW2A 4RIYA 4NKAA 3ACKA 2XEZA 2O0UA 3NUAA 3PLSA 3ALOA 2AUHA 3ZBFA 1BLXA 4NYEA 4BCNA 4FK3A 5CVFA 2GNHA 3R7EA 3EKNA 3RAHA 4CZYB 4U43A 3CJFA 1OBDA 3QWKA 4MXXA 4QP1A 5AUWA 1H08A 2XCHA 3OS3A 4C2VA 2WIHA 3AGMA 2YEXA 3F5GA 4C4IA 2BDFA 4E6QA 3JYAA 4ITHA 2Z60A 3EN4A 5ANGA 4CMUA 4TWNA 4WD5A 3QGYA 3Q2JA 4JLCA 3KB7A 4UWBA 5KMIA 4BKZA 3IW7A 2O3PA 4AF3A 2RFEA 2KTYA 3UE4A 3BYSA 5E8WA 5HD4A 3TJCA 4EZ3A 3A4OX 4FIEA 4JDKA 5E91A 4YJSA 3EH9A 2F7XE 4YJQA 2PHKA 2C6LA 3A7FA 4G2FA 2HY81 3CBLA 3HYHA 3ZSGA 4P5ZA 1Q5KA 3ORKA 1GNGA 5FM3A 2UZNA 4RX8A 5ANOA 1ZY4A 3P7BA 1PKDA 4G6LA 2JEDA 5KBQA 3EZVA 4FIJA 4BICA 2V7AA 1M52A 3T9TA 4AFJA 3UP7A 3ATTA 1A9UA 5HVKA 2UV2A 3FKLA 5HLNA 4BGGA 5E8VA 3UVQA 2F7ZE 3NUUA 3HV3A 1M7QA 5KBRA 2JDTA 4I6HA 4UB7A 3EHAA 3F3VA 4AE9A 5M4IA 5D7VA 4BIEA 2OO8X 4PDPA 4D2WA 1PHKA 5FUTA 4BY9E 5H2UA 2O64A 5FM2A 2ZDUA 3TI1A 2HWPA 3UVPA 4F7NA 4FSRA 2DS1A 3G33A 3BYVA 1WZYA 4RX5A 5HO7A 4QT1A 5FP5A 3GOPA 1LEWA 2JFLA 3MFRA 3LM0A 4FV0A 1JSTA 4S32A 3PZHA 4ANBA 4C36A 4E8AA 5BX0A 4X6QC 3PJ1A 4RT7A 1Z5MA 2CCIA 3DQXA 4JBVA 2Y0AA 4QTAA 4DAWA 1YOLA 1VZOA 4LUDA 2WIPA 3L8SA 2F49A 3EYGA 3ORMA 4OTIA 5G6VA 3I6WA 4RJ6A 4MXAA 3FL4A 5T68A 5T3QA 3TEIA 3HGKA 3UYSA 4NFNA 1PXOA 3CPBA 3QF9A 4EOOA 1RE8A 2R0UA 1OI9A 2I6LA 3B2WA 4X0MA 3PE1A 5I5ZA 4ZSAA 3R7VA 3RALA 5KKRB 3REPA 4P2KA 4O91A 3VC4A 4D9UA 4L68A 1GZ8A 4FKJA 4GVJA 5M4UA 3ZHPC 2PVKA 4DEGA 2W1EA 2X2KA 4RVTA 3MJ2A 2PVFA 4HJOA 2X2LA 5FTQA 5C8NA 2ITPA 1J91A 5H8GA 4YGAA 4IQ6A 1JSUA 1XH4A 3EQRA 2XA4A 4I20A 5DT0A 4U3ZA 4EEVA 3CXWA 4U79A 3Q52A 3RWPA 4ACMA 4UMTA 1WVXA 4JR3A 2VTOA 3TNHA 5AR5A 1QMZA 5M06A 4WNKA 3UC3A 1JPAA 4RVLA 4YJVA 5CSPA 1U46A 5K5XA 4K9YA 2HZ0A 1CDKA 4L45A 4P4CA 3BV2A 4IAKA 5BYYA 2UW5A 3QD0A 4GSBA 3MGYA 1NT2A 3S95A 2G1TA 3WILA 4BDDA 3NMUF 4AA4A 3U4WA 4BDIA 5BQ0A 1U5QA 4GVAA 4R6VA 3FPQA 2I0YA 5FGKA 3R1SA 4GUEA 4E1ZA 4O0XA 1ZYJA 3NNUA 3ENHA 5BVNA 4FTLA 2W1HA 4D58A 3KN5A 4RC4A 3NSZA 1MUOA 3BU6A 3QKMA 4FOCA 3DAEA 2E9OA 4U81A 2PVLA 2ZV7A 5HE3A 4Z3VA 3NRMA 5M53A 1ZRZA 1H25A 2PYWA 5C8KA 3VS0A 1SVEA 3RZFA 2XNPA 3ZFMA 5DGZA 4YJNA 4EONA 4OTHA 3H9FA 4IVCA 3HMOA 4XS2A 4G5JA 3PG3A 3DKCA 1MQ4A 3GXLA 5DVRA 5EW3A 1IA8A 3BHVA 4I0TA 3F2NA 5AM6A 3QBNA 2A1AB 2O8YA 3NR9A 2XK9A 3OF0A 4Y46A 3VW6A 4DH1A 1SYKA 4N57A 5KZ0A 4LFIA 4PDYA 3ZXTA 2YAKA 4EC8A 2G2HA 3T3UA 1GZNA 3UQGA 3SXFA 4CD0A 3Q5IA 3FQHA 4P90A 3V8SA 2ETMA 4OT5A 4ASEA 2YM8A 4C37A 3TZ7A 2FB8A 1Y6AA 3GGFA 3G90X 3O2MA 3BZ3A 3FE3A 3ZMMA 4GKIA 4C33A 4CFNA 3KRRA 2HXLA 2BZHB 3U51A 3HNGA 4XNEA 4FX3A 2WMVA 4QP6A 1E1XA 2W1DA 4IX6A 5DN3A 3VF8A 4F6SA 4IB3A 2CPKE 2QOIA 3NCZA 5E8TA 4FOBA 1V0BA 1NVRA 3DQWA 3E88A 3PYYA 4O27B 2ITOA 5AV4A 4FV8A 3QQGA 3ZO3A 4OTPA 3ZDUA 5IUHA 3ZYAA 1HCLA 4MNEA 4DG3E 2OBJA 3O23A 3SAYA 5A6OA 1OL6A 2P55A 3HV5A 3QX4A 4J8NA 4EK5A 1MRVA 2OH4A 1WVWA 3KEXA 2AYPA 2PZRA 2VX3A 4V05A 2GFCA 5CF5A 5I9WA 5K5NA 1VR2A 3O51A 4O7ZA 5AUXA 4QP2A 2H8HA 3AD6A 4AACA 4XBRA 4HVIA 3TG1A 2XKCA 5IF1A 3A4PA 1JKTA 3L8XA 3SRVB 4GT4A 3BEGA 3I0OA 3LVPA 4BGQA 3R2BA 5EQYA 5M44A 3S4QA 2PMLX 4J1RA 3D7TA 4DG0E 4RFMA 2Y6OA 4G3GA 3PA3A 2WB8A 4FYNA 4OBQA 5LVLA 1OITA 3OROA 3AC2A 3PXKA 5E7RA 4ZTLA 5HO6A 2XK7A 1KE5A 1YHSA 3LPBA 3R8MA 2VTNA 3DFAA 1R78A 2FSMX 4CFVA 3N4UA 4Y73A 3P0MA 4ANLA 2DQ7X 5HX6A 4A4LA 1QPJA 3P4KA 3PA4A 5KUPA 3Q9WA 5KCVA 4WG5A 3NYXA 1XH5A 2IW9A 4WBOA 3QLFA 4O86A 3JXWA 2IN6A 3CLYA 5HIBA 4L53A 4ANNA 3LFCA 2JKMA 2R3KA 4TNDA 4FTJA 4XLIA 1OBGA 3QKLA 1FVRA 3WZJA 4BTKA 3FJQE 4I6FA 3F88A 4X3FB 4CFXA 2XRUA 2ZJWA 3VS7A 3GB2A 2UVZA 3PXFA 4O81A 2JIIA 4CYIA 1R0EA 4AGDA 1IAJA 4A06A 3HA6A 5E8SA 2Z7LA 1RDQE 4FKRA 4ANOA 4QMOA 4XEYA 4ZOGA 5L4QA 3L9LA 2BRGA 4XOYA 4HNIA 5HCYA 5KHWA 2C6MA 3PRFA 3UJGA 4C3RA 2BRBA 2CHLA 3GQIA 3WZUA 3V51A 5FEQA 4H1JA 1PKGA 2W7XA 4KA3A 2ZV8A 2YCQA 5CX9A 5CXZA 2ONLA 4FKPA 3GQLA 4UN0C 2WZJA 3NUNA 3OTVA 5CEKA 3VUIA 3ZONA 3LFEA 4IAFA 5EG3A 2PPQA 3HVCA 4OUCA 5LVNA 3KXMA 4G34A 4CTBA 3ORZA 3OWJA 2ESMA 2C3JA 4ZJVA 2ZM1A 4CQGA 5CU0A 2PULA 3UMXA 3QUPA 5M51A 4H36A 4FNXA 2XKDA 5EYKA 2HW6A 3IDPA 3EWHA 3E64A 3FBVA 1Q41A 3GVUA 3MTLA 4IW0A 5KMOA 3C4WA 2C0OA 2CGWA 3MPMA 4EH3A 2JKKA 4CT2A 1L8TA 4YBKA 5J1VA 2E9PA 4QMQA 4HPTE 3OG7A 2YWVA 1REJA 2XK3A 4A9UA 4CEGA 3AXWA 2QHMA 4IAAA 4BDCA 2VTSA 3UIUA 2GNGA 4PNKA 1CMKE 2YIXA 4FZAB 4GIHA 4EQMA 4M69B 2X9EA 4GK3A 2WGJA 3MFTA 1PMVA 1ZWSA 3KVWA 3QCQA 4G5PA 3A7GA 4IAZA 4IX5A 5D11A 3VHKA 4A7CA 2C6TA 2BRHA 3Q5ZA 3F3TA 4PL4A 5IKWA 4YJUA 3FYJX 5HESA 4M7IA 4DBXA 4PTCA 4R1YA 3R8LA 4C02A 2R3HA 1EH4A 5ANIA 3WF9A 3CEKA 1YI6A 1H1SA 3TJDA 4ALUA 3DTWA 4F9AA 5GINE 3O7LD 4ASZA 3PY1A 2W1FA 2WQOA 3PWYA 4HGSA 4AZWA 4FTNA 3KVXA 1V0PA 3GBZA 2XEYA 2QONA 4MWIA 4ZY6A 2BTSA 1H24A 4K8AA 4ONAA 5EDPA 3IOPA 2NPQA 3PPJA 5DR6A 1NXKA 4YTIA 4LI5A 3BYUA 3CIKA 4QTCA 3ZUUA 3PSDA 4LV8A 3KMUA 2B7AA 4K18A 2XJ2A 1M7NA 1YWNA 2RSVA 4XOZA 2O5KA 5K3YA 3UOKA 2PMOX 4CCUA 5CT0A 4EYMA 2OJFE 3G5DA 3TIYA 3C4FA 3C51A 2QOCA 4I41A 5C4LA 5AJQA 1FVTA 4I94A 3G9NA 4XX9A 3RPVA 1ZAOA 2YM5A 3DCVA 1O6KA 1AQ1A 4GEOA 4OLIA 4GU9A 4F1MA 2XZSA 4AZSA 4DEAA 1MRUA 3RK7A 5EDRA 3KFAA 4EHEA 2VAGA 5FRIA 3OBGA 1Y8YA 1UNHA 2BKZA 3FZTA 3L9PA 4H3BA 4TYHB 5E1SA 3C4ZA 4QMZA 3R9NA 1ZZ2A 4QMXA 1YW2A 3C1XA 1PXNA 3NCGA 3P7CA 2EB3A 2J4ZA 2BZIB 3F7ZA 3HRBA 4QPMA 3QRIA 3NAYA 4KIKB 2ITQA 4NCTA 4O21A 4EUUA 5ACKA 4LM5A 2C1AA 5HIDA 3FDNA 3FKNA 3EQCA 5LCJA 1Q8UA 4AUAA 2I0EA 5CEOA 5GJGA 1WBOA 3ROCA 2JDRA 3QQUA 4V04A 4WT6A 3EQPA 4YJTA 4IWDA 3DKFA 3R1NA 3RAIA 1J7UA 2XIZA 4WOVA 3FLZA 1WCCA 3NNVA 4C0TA 3FXXA 5HBJA 3RVGA 3D5UA 2XK8A 4E6CA 3MWUA 3OXTA 3ZS5A 4ZS4A 4AOTA 5C1QB 2W1IA 3Q9YA 1S9JA 3WZKA 4EOPA 5M09A 2HY0A 2BHHA 2Q83A 3EN9A 1BI8A 5K0XA 2WTCA 4XG3A 1JSVA 5CNOA 3PXZA 5E8YA 2ZM3A 4AQCA 5JSMA 2OJIA 2B4SB 5CS6A 4HVHA 3ODZX 5K9IA 4FV4A 3E3BX 2WMBA 2WHBA 2YJRA 3KXGA 4UWCA 1FINA 5AIRA 3EFJA 4UYNA 2SRCA 4J95A 1IA9A 4KKHA 2RG5A 4M68A 1H1RA 2QCSA 4EH8A 2B54A 4F64A 3DBFA 3QL8A 2X7OA 3BYMA 1P2AA 5M4CA 5M07A 4PMSA 2OSCA 4ZSGA 3BQRA 4DA5A 4Y85A 2GTNA 4OTGA 2UW6A 4NM5A 3IW4A 1I44A 1YRPA 3P9JA 4X2FA 3D4QA 4EKLA 4TT7A 4RZVA 4J97A 1B38A 4CXAA 4PUZA 1W7HA 4XG6A 3TT0A 4CZUA 1SMHA 2CN5A 1OM1A 5M08A 1PXMA 3RWQA 4GCJA 4C57A 4I0RA 4DLJA 3CQEA 4PP7A 4X3JA 1UV5A 2XJ0A 5KMJA 5LWMA 4IZ5A 5GIPE 4FSYA 1J7IA 4IVAA 2PVNA 3KMMA 4WO5A 4IJPA 2IVVA 3ZEWA 4CNHA 4YZBA 3HLLA 3F6XA 1WBTA 1PW2A 4Y83A 1JNKA 2JGZA 4LRMA 4QYFA 3UIBA 2WMRA 4YTFA 1DAWA 4UEUA 4DCAA 2LGCA 2UW3A 3QC4A 3LM5A 3GFEA 5IA1A 4XG4A 3DOGA 1TVOA 1XKKA 3O17A 1FQ1B 2R64A 5CZHA 3R2YA 3MA3A 3LIJA 1YWVA 3PTGA 3UG1A 5IDPA 1Z57A 2YM4A 3C0GA 5IQIA 3QALE 2NP8A 3GUBA 4PTEA 5AA8A 5FDXA 4YR8A 3ZH8A 2OIBA 5J1WA 4EH7A 4YSJA 4W4VA 5J7BA 3SRVA 4YURA 1GIIA 2ITWA 4I21A 3R8PA 2GQRA 4D4VA 3ORLA 2R3OA 2X81A 4LGGA 1QCFA 4JBQA 3HUCA 3HL7A 1ZMWA 3QX2A 3DBCA 3BIZA 4ZXTA 2BIKB 3W33A 3PPKA 4Y72A 4I22A 2C5VA 3HUBA 3OP5A 2W4OA 2B1PA 1JAMA 2OIQA 3MH3A 4HVGA 4IADA 3LZBA 2YLEA 3ACJA 2R5TA 3H0YA 4AZTA 4K77A 1ERKA 1OPLA 4JX7A 4HGLA 4JNWA 5IZFA 4KKEA 5E9EA 3D5XA 2BIYA 3H9OA 2EXCX 3FY0A 2YZAA 2GHLA 5AV3A 1FBNA 4WRGA 5DR2A 3HRFA 4WIHA 3PJ8A 4AG8A 4GW8A 4AGCA 4ANQA 2XNBA 4DN5A 2XVDA 4TYEA 4U42A 2W06A 1RJBA 2YLFA 4U97A 3VQHA 1ZYSA 3GU5A 4X3FA 3D2IA 3MY0A 2A19B 4S31A 4IHPA 3WE8A 3QHRA 4L42A 4HZRA 3SG9A 4R3RA 4QQCA 3UBDA 4C61A 4D0XA 2XYUA 3WE4A 2R3IA 5HORA 4PF4A 5A46A 3GU4A 5CY3A 2UW4A 3B8RA 4CFFA 2PVRA 4FIGA 3Q9ZA 4LQMA 5DPVA 2R7BA 4TKSA 4ZIMA 3VF9A 4R7IA 2GMXA 3DFCB 3VRZA 4F7LA 2JAMA 4WSYA 5CQUA 3D0EA 4C8BA 3K2LA 2F9GA 3RCJA 3POOA 4O6LA 2J0JA 3LFFA 4FGBA 3BGPA 2Z7SA 4ZP5A 3OXZA 4ACHA 1ZYDA 3R9DA 3SKCA 2ZMDA 4N6ZA 4BDHA 3SW4A 4E20A 3BLQA 3GC0A 3UPXA 3V8TA 3NWWA 3HDMA 5FTOA 5A4CA 2J5EA 2OGVA 2PUUA 4WNMA 3R73A 5JRSA 3ZSIA 4GUBA 3R8ZA 3EMGA 4O7LA 2B9IA 3ERKA 1YXXA 2PUPA 2ZMCA 3HV4A 4DLIA 2OF4A 2X8DA 5AX3A 3QRJA 3BBWA 1YI3A 1PMUA 3CKXA 4EH6A 4R77A 1W82A 4ACCA 2QLQA 3UO5A 4QQ5A 2XIXA 4D2PA 3UZTA 4EHZA 3AMAA 3BCEA 1VYZA 3LCKA 5DNRA 4BL1A 5HLWA 4RJ5A 2YIYA 2YN8A 3ZTXA 3WF8A 4FTQA 1UVRA 2VO6A 5AUUA 4K6ZA 4RVKA 5L8KA 5JK3A 2C5XA 4YHJA 5JQ5A 4M69A 4QMPA 1PXKA 3OWLA 5TF9A 3R7IA 1SVHA 4FVQA 2OXDA 3Q4CA 2WEVA 1ZYCA 2R3GA 2VWYA 3W2PA 5I0BA 2WMXA 3UNKA 2X0GA 2GCDA 3OCGA 3E63A 3VBXA 5IA2A 3KREA 4DFNA 4N70A 1KUTA 4RZWA 4TNBA 2PE1A 4J8MA 2CKEA 4YJOA 5CEIA 5AADA 1T46A 1JQHA 2WAJA 4IH8A 5EHYA 4ZTSA 3SVVA 4HCUA 3EFLA 4YO4A 4R5SA 3FC2A 2WMUA 3UIMA 5CENA 4MXYA 3ZC5A 1Y6BA 3OFMA 4IM2A 3FYKX 5TKDA 3P5KA 2UW9A 4A07A 4O22A 4UMRA 3DXPA 4F7JA 3MS9A 2BAJA 3T8OA 3MIAA 3U87A 4EBVA 3QQFA 4AN9A 4BTFA 5KMNA 3GCVA 1Q8ZA 4YLLA 5K0KA 1JOWB 3F3ZA 2W9FB 3ZLWA 4GFMA 5D10A 4MH7A 3Q6UA 4QP4A 3BV3A 4FG9A 3R21A 4A9YA 3CGOA 1W0XC 3HA8A 5H9BA 1XR1A 4BC6A 1FPUA 5J95A 2OF2A 3U8WA 4A9TA 3F69A 3KY2A 1JLUE 4W8DA 5EKOA 4BCQA 2ETKA 3G6HA 3QLGA 4BBFA 5JFSA 3W16A 1GAGA 2EXEA 4UMPA 2GNJA 3KRJA 3LFBA 4KBAA 3FQSA 3QD4A 4YZCA 5ANJA 2C6KA 5IMEA 4TYHA 4BDJA 3W55A 3WYYA 3PY0A 1XJDA 2GU8A 2WTWA 1J1BA 3NZ0A 5BVWA 2BCJA 1YDSE 5C9CA 3KA0A 4O2PA 4BYIA 4KIKA 5CQWA 2W17A 3G0EA 3ZRMA 4TL0A 3W8QA 4X2GA 4MWHA 4RSSA 5AUYA 4C3FA 4ALVA 3U6IA 2KULA 3IO7A 1PXLA 3UQFA 3QZGA 4DTKA 4F99A 3OW3A 4FKOA 3TXOA 4OR5A 4L3JA 4L01A 4ZTRA 4DTBA 4RC3A 2OU7A 5B2KA 3EIDA 4FODA 2B9HA 3COHA 3N4TA 2IO6A 3SOCA 5TOZA 1UU7A 3CTQA 4Z55A 5AIKA 4WRSA 4W8EA 5E8UA 5IPJA 1BYGA 3NAXA 4RBLA 4DEBA 4JR7A 2FUMA 3P78A 4BR3A 4FEQA 4OTRA 3FMEA 4QMSA 4RQKA 5HD7A 3OC1A 3QRUA 4HGTA 4AA0A 1FGKA 5KMMA 1DS5A 3B8QA 3PP0A 5C8MA 2WTKB 3DKGA 4JS8A 3R30A 2J0IA 3E87A 3OMVA 3KK9A 4NKSA 2GNLA 4J71A 4B99A 5EYMA 4BWKA 4GG5A 3A7JA 4YPSA 4BI1A 4ZTMA 5LMKA 3PIYA 3CPCA 4IZYA 1ZYLA 1W98A 2BKKA 3TUDA 2YCSA 4MX9A 3RM7A 2QOFA 3OWKA 5HI2A 5CU3A 3VUDA 2VTIA 3VO3A 4MBJA 3GOKA 4XH6A 4BZNA 3FSFA 4CZTA 3ZBXA 2Z8CA 3FY2A 2JDSA 2JDVA 3QKKA 5E90A 4LL5A 5LVMA 4GS6A 3BELA 4BCPA 4O96A 4IFCA 4QNAA 1K9AA 1WAKA 2QO9A 3GCPA 3HDNA 2Z2WA 4XV1A 3ORPA 4GIIA 1KE7A 2WOTA 3HKOA 4RFYA 2W5HA 4EQCA 4O0WA 3EZRA 2QOQA 4DFZE 3A62A 2JFMA 2J50A 5JEBA 3DB8A 4L00A 2XCKA 2Y4IB 3PSCA 3IDCA 2J7TA 3AG9A 3H9RA 3D94A 4JXFA 4JIAA 2E9UA 3LMHA 4WA9A 4CV9A 3WF5A 5L8JA 3UOJA 5A3XA 1PYEA 4O84A 4Q9SA 2Z7RA 5IQFA 2OH0E 5A6NA 4Y5QA 4YP8A 4QPSA 4M84A 3MTFA 4H3PA 5CEPA 2W5AA 3TTJA 4C4EA 4EH2A 2XMYA 4EYJA 3HMNA 3O50A 2RG6A 4FKIA 2QURA 3H0ZA 5GZ9A 5AP3A 3TNIA 5GIOE 1P4FA 2Y8OA 1YKRA 2WD1A 3IGOA 4JI9A 5JGDA 2JIVA 4JDHA 1UU8A 4FKLA 2YDKA 1UNLA 5AMNA 4KABA 1BI7A 4DE4A 2HZIA 4PX6A 3UNZA 1CKPA 3ZO2A 4QD6A 2JLDA 4QQTA 3V6RA 4K11A 4B0GA 4EJNA 3G9LX 5HTIA 3C5IA 4F09A 3MVLA 2R3MA 3IOKA 4F9BA 3G0FA 1PY5A 3PVGA 5IEVA 3TUCA 4LMNA 4DH8A 4RGJA 5DHJA 5EI8A 4FI1A 4EWHA 2QOHA 3WYXA 4C2WA 5IQAA 2PZ5A 2VRXA 4YJRA 2HAKA 4CFUA 4HOKA 2ITNA 4FT3A 2VTPA 3MFSA 1FOTA 1OECA 3CTHA 3WARA 2PVJA 3FHIA 4JVGA 5JFWA 5DIAA 3NIEA 5EQEA 4O0SA 2WMQA 2VWWA 5IQDA 1OB3A 3P08A 5I9ZA 2PWLA 3N4VA 2NNWB 2JIUA 3GFWA 3HMMA 3QRTA 5HKMA 3SHEA 1WBWA 3OZ6A 3MH0A 3EL8A 3P7AA 5AAFA 3ZM4A 4DYMA 3GI3A 3W2SA 5CF8A 4KIOA 4ASXA 4WHZA 4UY9A 1M2QA 3MDYA 1SVGA 1M14A 3QD3A 3EYHA 4Z9LA 4C58A 5FP6A 3QTZA 3QU0A 5DR9A 3GT8A 5HEZA 3A7IA 4L3PA 4F0FA 3OVVA 4W9XA 1LPUA 3BGQA 3IS5A 3OXIA 3CSVA 5HVJA 4MQ2A 5FTGA 4ZS0A 3T3VA 3UC4A 3R7YA 4EOSA 3EQBA 4FV5A 2C3LA 2QKWB 3F61A 3G2FA 4M3QA 4MXCA 4YC3A 1V0OA 3C13A 3KU2A 1O6YA 5L2TA 4I24A 4D4SA 2OJ9A 5AR2A 4AP7A 2PSQA 3R0TA 2C4GA 5JFXA 4FEXA 2CNQA 2HOGA 4H58A 4L43A 1IRKA 5J87A 3FMJA 5A4TA 2EVAA 4X2JA 3VUTA 3PXRA 5M56A 3C50A 4ZSLA 5GHVA 4JQ7A 2WELA 2XNGA 3AD4A 5GJDA 2EWAA 3QQKA 1UWJA 2LAVA 5ANKA 2JITA 3U54A 1PMNA 3MA6A 3OT8A 3TL8A 4KNBA 3HRCA 2WTDA 3I7BA 4PPCA 3MH2A 1GIHA 2VTLA 4IEBA 3MPAA 4NEUA 4E3CA 2R3QA 2V62A 3OCBA 1W8CA 3E8DA 3ORTA 4TYJA 4KINA 2RFNA 3ZC6A 4YLKA 5AV0A 2OZOA 3LJ2A 4EJ7A 1XBCA 4D0WA 3PJ2A 4CT1A 4AA5A 2BILB 1LUFA 3VUGA 5GZ8A 5AP1A 5ICPA 4NFMA 4MF1A 1HCKA 4I93A 2YIQA 3EQFA 3NIZA 2W05A 1CKIA 3GU6A 4C4HA 4WBBB 2YAAA 4AZFA 2X6DA 3R8VA 4J7BA 4M12A 3H30A 4Y8DA 5I4NA 3FI3A 2W4KA 4HVSA 4D2VA 2C5YA 4DH7A 3V5LA 1PXIA 2I1MA 2FSTX 4NM0A 2VNYA 4AN2A 3LW0A 2C5NA 3V8WA 4BDBA 4J99A 1URWA 3RP9A 4R8QA 1QL6A 5DRDA 4GJ2A 5EYDA 2QR8A 3FI2A 3L8PA 2GS6A 3FSKA 5C27A 4CLJA 2IW6A 3A8XA 5BVFA 1Z9XA 3AC5A 2VTAA 2PMIA 4BCFA 1ZMUA 2XS0A 3U4UA 2GSFA 4G3DA 4TXCA 3I1AA 3NDMA 5ETCA 2BZKB 2VWUA 1LP4A 4FNZA 4JIKA 2X8IA 5HZNA 4FG7A 3KCFA 4S34A 4Q5EA 3TTIA 2P0CA 4XRLA 3LXPA 2XIYA 2OK1A 3TCPA 2W9ZB 5DBXA 4K1BA 4QTBA 4A9SA 5DA3A 5KMLA 4F7SA 2YJSA 4BIDA 4DT8A 4I6BA 5CSWA 4EOQA 5A4QA 4F9CA 5B2LA 4J98A 2CN8A 4LRJA 3HV7A 4GYGA 4FT0A 4B8MA 1YDRE 4BFMA 2VUWA 2VWVA 1P4OA 4E7WA 5GNKA 3GNIB 2R3NA 2B9FA 3FMDA 2JBOA 2CMWA 3LAUA 3OWPA 3PJCA 4GJ3A 4TW9A 4W4YA 4E4LA 3DA6A 5E1EA 2P2HA 5JGBA 3F2RA 4BN1A 5GJFA 1J3HA 2J5FA 4F9WA 5AR4A 1J1CA 1ZLTA 4OAVB 2PL0A 4IVBA 2DUVA 4OBPA 4OTWA 2VGOA 3WZDA 4CTCA 4BKYA 2P4IA 4AOIA 3R71A 3T9IA 3VRYA 2X6EA 4D28A 3W1FA 2VWIA 5FLFA 1KSWA 3PPZA 4FKGA 4L67A 3ZXZA 3OEFX 4U45A 3DXQA 4QP9A 5C03A 4F1TA 3R83A 4RJ7A 3VS2A 3W2QA 1XH9A 5CTPA 5CAOA 3SD0A 4XG2A 3LQ8A 4XJ0A 3FI4A 4X6RA 3CY3A 4XG7A 4O7WA 1T45A 1OPKA 5C01A 2XNEA 3FUPA 4PNIA 4EH4A 3HAMA 2ITZA 5L2QA 4F65A 3VJNA 5JKGA 2X39A 3BGZA 3VS3A 3EN6A 3MI9A 2YIWA 2BAQA 4FL2A 1OL7A 5HTCA 5BVEA 1XBBA 3VUMA 5BMMA 4PMPA 4RPVA 4CKRA 3QXOA 4I6QA 1R1WA 4BCIA 3DDQA 3KRWA 3OHTA 4FTAA 4ZZNA 3V5PA 4DGNA 4FT5A 4YU2A 4A4OA 3PP1A 4U5JA 1UU3A 2H96A 4PV0A 4PDOA 3H3CA 3GENA 3OUNB 4RX7A 4UXQA 1PJKA 5IA5A 4F70A 1GIJA 1STCE 4R7BA 3S0OA 4YJPA 4RA4A 2O65A 3L8VA 2QO7A 4MCVA 4W9WA 2QNJA 3QRKA 4BYJA 2R2PA 3UQCA 2I40A 5J9ZA 4DEHA 4YTHA 1SM2A 4ARKA 1KV2A 3RPRA 2YWPA 3PVWA 4BIBA 4F63A 4FTCA 4F9YA 1VJYA 4O0VA 4FT7A 4O83A 2W1GA 4JBPA 3RKBA 3QCYA 4X7QA 3JPVA 3PZEA 3OOMA 2E2BA 4BI0A 5CT7A 4C4GA 1MQBA 4DFUA 2QKRA 3F2AA 4PWNA 3C7QA 2QQ7A 2J90A 3VBVA 4EOKA 1H1WA 4JRNA 1K3AA 2RIOA 4QMVA 2HENA 2YDJA 4AE6A 4L46A 4F0IA 4L3LA 3FPMA 1AD5A 4H39A 2YISA 4YHTA 5CSHA 4MD9E 4MQ1A 4FSTA 3VS4A 2PY3A 4G9RA 4AGUA 3R9RA 3UVRA 4DGLC 4OAUC 5HE1A 3EQGA 2R4BA 2PZIA 3U6HA 4PMMA 2HXQA 1GZOA 3R28A 3LOKA 4M8TA 1H07A 5IH6A 2Z02A 4ANSA 1OL2A 2W1CA 4II5A 2P3GX 4D2RA 2AC3A 2WMTA 2JBPA 4CKIA 3NVKI 4ITIA 1URCA 3NW5A 1OKVA 4O0YA 4BKJA 5H3QA 1KV1A 3SOAA 5G1XA 3Q32A 4BHNA 2Y9QA 2UZOA 3ORNA 3LQ3A 1AGWA 4JAIA 3VS1A 3L1SA 4IFGA 5JMSA 3ATSA 2CDZA 4X2KA 2X7GA 5AAEA 3RZBA 3O96A 2Y4PA 4YUQA 1UU9A 1RQQA 4RQVA 5AP0A 2UW0A 5LMBA 3DS6A 3FZSA 2ZAZA 4KIPA 4R7HA 3POZA 1IEPA 4XP2A 3QYZA 3EFKA 4X2NA 3BHHA 2EB2A 4FV9A 4I1ZA 4FEWA 4EHVA 2H6DA 3F5PA 3NNXA 4NW5A 3PUPA 4QMUA 2OLCA 2B52A 2HYYA 2W0JA 5J5SA 5JZJA 5IISA 2OWBA 2P2IA 2X4FA 4FKUA 3JVRA 4A9RA 3DV3A 3DJ7A 3F3UA 5JT2A 3G15A 4MF0A 5HE2A 3HX4A 4ZTQA 2X1NA 3QZIA 3E7OA 5LMAA 4E26A 3D14A 5BNJA 4QMYA 4FZFB 1KE8A 3W2CA 4S2ZA 5E92A 5HOAA 3R9OA 3ET7A 4D4RA 3HEGA 5B0XA 2VO0A 4YBJA 5EI2A 3QA8A 4ACDA 5HLPA 5CSXA 4ENYA 5ITAA 4EUTA 3JR1A 4FTKA 3OCSA 3QD2B 4MHAA 2JKOA 2GTMA 4NCTC 1TQMA 5AUTA 5EQPA 1XHAA 4GMYA 5DMZA 3HMIA 4NJ3A 4LL0A 3RMFA 5AA9A 4DBNA 2H9VA 5H8BA 3LXNA 2O63A 2WQBA 1G3NA 2WTIA 3P1AA 1U4DA 3R8UA 4BCJA 4IDTA 3HV6A 3PG1A 4IJ9A 3L9NA 4EOMA 4MNFA 4QMTA 4HCVA 1W83A 2UZBA 4BCGA 4KUJA 2P33A 2ZM4A 3ORIA 4LOOA 5LCKA 4OT6A 3FLQA 4IAIA 5AEPA 3KGAA 4I0SA 3D15A 1XH7A 2UZTA 2QI8A 4O0UA 2B53A 1LEZA 2BFXA 2WQEA 3UO6A 2WTJA 1JKSA 1Y91A 3IECA 1QPEA 1TQPA 2HELA 4YNEA 5EM8A 3PLAE 2A0CX 1PYXA 3VUHA 4NIFB 2UVXA 3WOWA 5L6PA 4HYSA 3SXRA 4O7TA 2FO0A 4RVMA 5BYZA 4O7YA 2GNFA 3A99A 3EN5A 3TKUA 4JG8A 4L8MA 4Z7HA 1CTPE 5CU6A 1U59A 5DG5A 4AN3A 3DBDA 2NRUA 5F9EA 5LJJA 4EORA 3MVJA 3AOXA 3Q9XA 4FL3A 4D2SA 1Q62A 1OUKA 5CF6A 2V7OA 2QG7A 1FGIA 3LJ0A 4RFZA 4AX8A 4ERWA 3D2KA 3P79A 2XK6A 4HYIA 3DBQA 4O82A 2W4JA 2XIRA 5IEXA 1NY3A 3AQVA 3A7HA 4FVPA 4E5AX 4CFMA 5DT3A 4FV1A 2IVSA 4FSQA 1PXJA 4FBXA 4OW8A 2V0DA 4FNWA 3TKHA 3UZPA 5L6OA 3KF4A 1O9UA 4EK3A 4NZWB 5EOLA 5CLPA 3TV4A 5ETFA 5I3OA 2XRWA 3D7ZA 5DRBA 3TNPC 1Q97A 3PIZA 2H34A 2XYNA 3R1YA 1YQJA 2WKMA 3GU8A 3QUDA 1NW1A 4EK6A 4Q2AA 1NVSA 4KRDA 1TQIA 1U54B 4AS0A 3QTXA 2WXVA 3CR0A 4JT3A 3RM6A 4ZAUA 3E3PA 2XK4A 3UDBA 3Q3BA 1MRYA 2E9VA 5EFQA 2Y6MA 1NVQA 3ZOSA 3PVBA 4BDGA 4EKKA 4GT5A 4XV2A 5KZIA 2YCFA 3TKIA 4NTTA 4IIRA 1R3CA 3QCXA 4CG9A 5TT7A 1YXVA 3CS9A 3OBJA 2BVAA 2BR1A 3FMKA 2QU5A 2XKFA 5EDQA 5EW8A 3V6SA 4BWPA 3Q4TA 3ANQA 2BAKA 4EK8A 4I5PA 5KNJA 1DI9A 3BI6A 1JWHA 5FG8A 4UWYA 4R3CA 5F1ZA 1WMKA 1SZMA 5A54A 3VVHA 5LQFA 2GFSA 3IW8A 4FIIA 3LCDA 3OOGA 3R6XA 3V5JA
chains in the Genus database with same CATH superfamily
4TWOA 1H1PA 4TN6A 5HVYA 4B6LA 4L6QA 5LARA 5M55A 3DNEA 5BVDA 3K5VA 3VS5A 2VTRA 4XMOA 4NK9A 4FTTA 3W8LA 3F7WA 4XHKB 3ZZEA 4EHGA 3Q6WA 4IAYA 2F7EE 2A4LA 2ITVA 3FMNA 3FMMA 2VX0A 5A9UA 3RHKA 4HYHA 4ASDA 1JVPP 3WF7A 5A14A 2CKPA 3JY9A 3K3JA 3QUEA 4ZSJA 5DEWA 3EB0A 4IANA 3IDBA 3C4EA 4OTFA 5CAUA 3IW5A 3ZUTA 4BRXA 2UZUE 4CV8A 2GHMA 4X3FC 5IQHA 4AXFA 5IA4A 5FD2A 4D1ZA 3F82A 4UXLA 4ZY5A 5DI1A 4EH9A 2VWBA 4BCHA 4D5HA 2BRNA 1W2DA 2IZTA 3G6GA 4L7FA 1OL1A 1R39A 2PVHA 1X8BA 4DH3A 3OY1A 4FC0A 3CE3A 4KBKA 5AR8A 2XM9A 2JD5A 3FZRA 1GJOA 4IX3A 3NFFB 5LVPA 4FL1A 4FTUA 3SW7A 4AT5A 2C3IB 4DT9A 4DHJA 4CMTA 5LXMA 3MYGA 3RK9A 3PJ3A 1OZ1A 4QYEA 4IBMA 3TZ9A 3VQUA 3F3WA 4H1MA 3GCQA 3SXSA 2PVMA 4U9AA 3FLYA 4IXPA 3S1HA 1K2PA 2QVSE 4G3CA 3PXQA 3RPYA 4FRFA 3D9VA 5ETAA 3PY3A 1BL7A 3UP2A 5LVOA 3NS9A 3VS6A 3UPZA 4K0YA 4QMWA 5AUZA 5JH6A 2QD9A 3Q96A 3BQCA 4FR4A 3ULZA 1PXPA 1Q24A 4I5HA 4NTSA 4AZVA 4QEBA 2FVDA 4RJ8A 4PRJA 3MB6A 1ZOHA 2A27A 4KSQA 5AX9A 2CJMA 4C62A 4QTEA 2WMAA 4QNYA 5DYJA 3SDJA 3UODA 3PXYA 4YZDA 2OFVA 2BDWA 3EFWA 4R1VA 3HZTA 2Z7QA 4IE9A 5CALA 3DJ5A 2ETRA 1Q3WA 2ZDTA 5E8XA 2CGXA 2E9NA 4MK0A 4DGMA 1OKZA 4YNOA 3TN8A 4XRJA 3SA0A 4G9CA 5J5TA 3KQ7A 3A2CA 4HNFA 3M2WA 1V1KA 5HBHA 4AQKA 5E4HA 1E1VA 3I5NA 3QTUA 4AOJA 5J7HA 2CSNA 4FV7A 3QWJA 3ZRLA 4N0SA 4ZZOA 3R63A 2WU6A 2F2CB 3FLWA 5ETIA 1GY3A 5L6WL 3V5TA 3WI6A 3GCUA 3QZFA 1KOAA 1BX6A 2C6OA 1OVEA 3H4JA 4GFOA 4UYAA 5HIEA 1DI8A 1OIUA 4QYYA 5IH5A 2ZFYA 2IZSA 2G2IA 3FZPA 4J52A 3NLBA 4WNPA 3VN9A 1ST0A 4I5MA 2JAVA 4ZLZA 2OIDA 4FICA 2W99B 3LFAA 4NJDA 3U6JA 1OIRA 3MBLA 4IWQA 4IB0A 2VTTA 3KULB 4L52A 4CRLA 5GZAA 5HNGA 1WBNA 4RWIA 3ELJA 5CWZA 3QCSA 1H01A 2RKUA 5EM5A 4FA2A 4CVAA 3NYVA 1XO2B 2JKQA 2ERKA 4I3ZA 3LE6A 4JL9A 3DU8A 2XP2A 3NUPA 2R0IA 4AXAA 2PUIA 2PK9A 2HZNA 4DGOA 3VONA 1WFCA 4RIXB 4DFLA 3FQEA 4GRBA 3LMGA 4P5QA 2XAMA 2ITTA 3BHUA 4FEUA 2UZDA 2ZYBA 3BU3A 1PF8A 3UZRA 4NSTA 3KN6A 5DE2A 3W0OA 4KB8A 1M2RA 3E8CA 4KIQA 2PZYA 4AGWA 4EZ7A 3TIZA 4FTOA 4XP3A 4F0GA 4KS8A 4MD7E 5HCZA 4GG7A 3DB6A 5FWKK 3PVUA 4APCA 5IG1A 2GDOA 4E5BA 4DDGA 2REIA 4YSMA 5A4EA 4NU1A 1XH8A 2WMSA 2YA9A 3MFUA 2FYSA 4CFWA 4EK4A 4I4FA 4U44A 4HPUE 4G3EA 5LOHA 4Z7GA 5B7VA 1E9HA 5EKNA 2WEIA 4D2TA 4HGEA 3F5XA 3SC1A 4OGRA 3NVMB 4NL0A 5ANEA 1Q8YA 2BTRA 3I6UA 4WG4A 1Y57A 2CLQA 4BDAA 3ZRKA 3FWQA 1M2PA 3O7LB 2VO7A 1OUYA 3H10A 4M14A 2R3PA 1H0WA 2OW3A 4PL5A 5CVGA 2C6DA 3JUHA 2OZAB 4TY1A 1ZOEA 3RNIA 2OG8A 2XNOA 1KWPA 2R3FA 5AWMA 1IG1A 3QAME 4DEIA 4E4NA 5LMKC 4FSZA 3SG8A 4UMUA 4QYGA 4NIFA 2IVUA 4WG3A 4EOLA 4GKHA 4QP7A 1PRYA 1B6CB 4MEDA 1OPJA 3GU7A 4ZTHA 4YC6A 3UG2A 4DFBA 4O1OA 2I7QA 3HP2A 2Q0BA 4RIWB 3BEAA 4MKCA 5LWNA 2QLUA 4MAOA 5TR6A 2ZB0A 3A60A 5K4JA 1Q3DA 3O8TA 4HCTA 2V5QA 4BZDA 3BKBA 2ZV2A 2QODA 2UZLA 4ZLYA 4FV2A 1UKIA 4G3FA 5EM6A 3MVHA 1PMEA 4O7RA 2RGPA 4IM3A 4USEA 4AW5A 3VULA 1H1QA 4QO9A 2C3KA 2XBAA 4D1XA 3CY2A 2GS7A 3CQUA 1DAYA 1A06A 3RPOA 1J7LA 3DK7A 5EHLA 1OGUA 4M13A 5DT4A 3TV6A 3R7UA 5L2WA 3E8NA 2BZJA 5J8IA 4C7TA 2I0VA 4DITA 2OFUA 1WBVA 1H27A 2C0IA 2FH9A 4MTAA 2XF0A 4QMNA 4OTDA 3ALNA 3TUBA 3CC6A 2ACXA 1OL5A 3OY3A 5CVHA 2WFYA 4YO6A 3UYTA 1CSNA 1U54A 5HBEA 2BMCA 3VUKA 3W18A 3ML1A 2EXMA 5HU9A 1KE9A 2GQGA 3ZFYA 4ANMA 2FA2A 4C38A 5JN2A 4FYOA 4G6NA 4K33A 3KL8A 4UALA 1BMKA 4DTAA 2J0KA 4ZSEA 2PU8A 1UNGA 3RAKA 4FZ7A 1JKKA 4AT4A 2X0PA 3ZEPA 4R5YA 5CAPA 1H28A 4L7SA 3UMWA 3BLHA 4RJ3A 5F95A 3FC1X 4V0GB 2QHNA 3D83A 4BDFA 3R04A 1MP8A 4TRLA 4PQNA 4IACA 4NH1A 4ZMFA 4ZY4A 1WBSA 4F6UA 2J2IB 5F94A 3MV5A 1H8FA 2UW8A 3DDPA 3EN7A 3SQQA 1A48A 4CG8A 3I4BA 4AZEA 2BROA 4XBUA 3CKWA 4B7TA 3OTUA 3EQHA 3VIDA 5T6KA 2WU7A 2RFSA 4AFEA 3BWFA 3RPSA 2HCKA 3FAAA 5AR7A 2YFXA 2YDIA 3F5UA 3LFDA 4WNOA 5EI6A 3SX9A 1YHVA 4FSUA 4KBCA 3PFQA 4JBOA 3P86A 1P14A 4GYIA 5KE0A 2IZRA 3FLNC 3I0QA 3ODYX 2QR7A 3I79A 4KSPA 4LUEA 4V01A 4BCOA 3DKOA 3UTOA 3MY1A 5L2IA 5CEQA 4FT9A 4AU8A 5CAVA 5IQCA 4PDSA 5HU3A 4G6OA 1ND4A 3DGKA 3DJ6A 2NRYA 3K3IA 3KXNA 2VTMA 4BF2A 4JG6A 5L8LA 3LKMA 3OW4A 3E7VA 3FHRA 3GC8A 2CGUA 1H4LA 2O2UA 2IW8A 4BVUA 4A4XA 3RI1A 4AT3A 2YABA 2G9XA 4UZDA 4YHFA 3BHYA 3W32A 2BHEA 3QTRA 2C69A 4RLKA 5EW9A 3C0IA 4QOXA 5C4KA 5AP7A 4G1WA 2I0HA 4IZ7A 4MBLA 3RTPA 1G8AA 4MBIA 4YC8A 4S33A 3COIA 3E92A 3NUXA 5DH3A 1YXUA 5DFPA 4E93A 3NYNA 5KMKA 4IB1A 4QYHA 5AV2A 2V22A 3C0HA 5DOSA 1XBAA 1SNXA 4F1OA 4Z16A 4DC2A 4EOJA 4M66A 4DINA 5K4IA 3FKOA 4PPBA 4QMLA 2VO3A 4DH5A 2DYLA 4IC8A 4U6RA 2UUEA 4NM3A 4XUFA 2XIKA 3HMPA 3O71A 5FXQA 5FXRA 3QC9A 4FKQA 3TNQB 4EI4A 2GQSA 5HGIA 3JS2A 3WIKA 4YMJA 5CASA 4ZMEA 4JQ8A 3NNWA 4ALWA 4U40A 5J79A 5J9YA 4RWJA 4KS7A 3DT1A 4G16A 1L3RE 3TWJA 3RAWA 3Q04A 2C30A 3II5A 5KHXA 3Q4ZA 4DG2E 4APPA 2NO3A 2YM7A 3M42A 3QTIA 3V01A 3AGLA 4M0YA 2X2MA 1YWRA 1YOJA 2GHGA 2OKRA 3UO4A 1O6LA 2CCHA 4AXDA 1YI4A 4GH2A 1Q8WA 3PWDA 2G01A 4YZNA 5CU2A 2UVYA 1IAHA 4RWKA 4O7NA 2X7FA 4NUSA 5HNBA 3TZ8A 3RBWA 5HX8A 3GC7A 2ZOQA 3ZLXA 2YHVA 4O0TA 2W96B 4QP3A 4JG7A 3V3VA 4HYUA 4DHFA 4R78A 1YVJA 3KRXA 3RK5A 5BVOA 3VBYA 4C35A 3MW1A 3R9HA 4ZZMA 3MY5A 5BPYA 3DLSA 1VEBA 3E93A 3KMWA 3ZLYA 4PPAA 3R7OA 3Q2MA 3ULIA 3ZDIA 1QPCA 2OJJA 3QXPA 3ITZA 4O0RA 5D9HA 4XLVA 2ZB1A 4D5KA 3PDTA 3BBTB 5BVKA 5AFVA 4MYGA 5IMXA 3NUYA 3R1QA 4CMOA 1GZKA 5DEYA 3IG7A 4L44A 2GPHA 3KC3A 2RF9A 2ZVAA 4EH5A 1Y8GA 3U9NA 4XG8A 2IZUA 3DZQA 3JVSA 5EYCA 4CSVA 5C26A 2GNIA 4ZLOA 3MPTA 4IZAA 4IWOA 4E5WA 3FZOA 4TPTA 2BUJA 1NA7A 3PIXA 4I23A 5CU4A 3VBTA 4BZOA 5IUGA 3AKJA 4M0ZA 3LXKA 3KULA 3TM0A 2UW7A 3UNJA 2XM8A 1IASA 2G2FA 3NEWA 3PRIA 2CNUA 3EL7A 3K5UA 4JJRA 3RHXA 3IW6A 4FMQA 5CNNA 3DLZA 4JX3A 2VZ6A 3LMIA 3Q4UA 1IR3A 3DXNA 2XJ1A 4FGRA 2J0LA 2WOUA 4E73A 3DZOA 4AAAA 4RIXA 2B55A 3ZSHA 3QQLA 4M15A 4P7EA 2B9JA 3L9MA 4YPDA 3BPRA 5F20A 1FVVA 2PZPA 5ACBC 1OKWA 4EL9A 4HW7A 4FKSA 2IG7A 3N51A 3HAVA 3QTSA 4RLLA 3OT3A 2FSLX 4EQUA 5HO8A 2VTQA 5J9LA 2WPAA 3FMHA 2C47A 3AMBA 5FQDC 3LLTA 5AR3A 5IUIA 4QDEA 2ONLC 3FMLA 5AUVA 2C6EA 2C5OA 2ERZE 3NX8A 3KRLA 5I3RA 4DGGA 2AQXA 1CKJA 3IQ7A 4Y95A 1BKXA 3GCSA 3AT2A 3A61A 2X4ZA 3DNDA 4CQEA 2XH5A 4U3YA 3C5UA 5FBOA 4KKGA 1R0PA 2YITA 3BYOA 4O6EA 4PP9A 3S3IA 1ZARA 4M67A 4U8ZA 5EH0A 4U41A 3Q53A 4KRCA 4JOAA 4MXOA 2X9FA 4QPAA 2HK5A 2QO2A 4ZTNA 3SLSA 5BUIA 2VTJA 3R00A 4TZRA 3PA5A 1F5QA 2A2AA 2HW7A 3CTJA 3QGWA 4JAJA 3W0SA 3I81A 5IQEA 4MUQA 3RINA 4QMMA 3BE2A 3BE9A 3LCOA 2CKQA 4F6WA 3U55A 2VV9A 2WTKC 5IU2A 5HG7A 2OZAA 4LGHA 3VW8A 4ERKA 3QHWA 1KOBA 3AT3A 5AP2A 1OIQA 3THBA 5ANDA 3HECA 3NGAA 5FEDA 4E4XA 4BCKA 1ZMVA 3TDWA 3TDVA 3BLAA 5AP6A 2PE0A 3GP0A 4XCUA 5H8EA 3TZMA 5EK7A 4CCBA 2HIWA 4NM7A 1JBPE 3ETAA 5IA0A 4DHIB 4FVRA 4IB5A 4RIWA 4JQEA 4RJ4A 4C4JA 3D5WA 3FXWA 5M4FA 2W1ZA 4RIYB 1ZZLA 1G5SA 4USDA 3IONA 4FUXA 4Q5HA 3NW7A 3RJCA 1UKHA 3FV8A 2F2UA 1W84A 3DPKA 5HG8A 4Q9ZA 5JGAA 1OKYA 2BFYA 4ZEGA 3ANRA 4EOIA 1LR4A 3EOCA 3S2PA 3MIYA 4FEVA 1APME 2VGPA 3MSSA 3OD6X 2PTKA 4Y5HA 5I9YA 3MN3A 4D55A 4O38A 2Y4IC 4G17A 3QA0A 4D1SA 4O7VA 3TV7A 5HE0A 5JZNA 2CLXA 4KD1A 3ZZWA 4TWPA 3RNYA 4D4YA 4F08A 5E8ZA 2XKEA 3A8WA 3BWJA 4W4XA 3BHTA 4BB4A 1I09A 2C6IA 4R3PA 4E4MA 4XG9A 4B4LA 3KCKA 2R3RA 4LOPA 3EQIA 2QOKA 3MJ1A 3TMOA 5KKRC 1QPDA 4D9TA 4FTIA 3B2TA 2PE2A 4DF3A 4BCMA 4JDIA 5DWRA 4YLJA 4DEEA 3ORXA 4RX9A 4TTHB 4FKVA 3ROYA 5L2SA 3FI8A 5D7AA 3UOHA 2FSOX 1GOLA 4GK4A 3FL5A 2CNVA 2J9MA 3FXZA 2X8EA 2R3LA 4V0GA 3LJ1A 3RCDA 4FF8A 3WIGA 4LG4A 1Q8TA 2OI4X 3JY0A 3OUKA 4RMZA 3DAKA 2F57A 3W10A 4DFYA 2IPXA 2UZWE 4GU6A 5IA3A 2VTHA 2JC6A 2J6MA 5HCXA 2OXYA 3VNTA 4BHZA 3CCNA 4B8LA 1FMKA 4EWQA 3N9XA 4M97A 5TO8A 2QOOA 5IH4A 1JKLA 3V5QA 3FZ1A 4UMQA 2EU9A 2OICA 2WQNA 4CYJA 3OCTA 2JDOA 5BUEA 3AD5A 1S9IA 2WQMA 2C68A 3QQJA 3LXLA 3C9WA 3PSBA 3PUFC 5FXSA 2QU6A 2VWXA 1YXTA 4UBAA 3KXZA 4HZSA 4JDJA 5FBNC 4IVDA 5EM7A 1RW8A 3NPCA 4LOQA 4YTCA 3CJGA 3CQWA 4JRVA 4K2RA 3S00A 3CP9A 2F4JA 2EUFB 5CAQA 4LV5A 4O4FA 5CZIA 2ZV9A 3RGFA 3E62A 5EOBA 1XQZA 4RC2A 2ITUA 3BRBA 5KX8A 3LFSA 2YM6A 1CM8A 5CI7A 4FV6A 4GT3A 4ZK5A 3FLSA 3CGFA 3ZCLA 4CRSA 4CGAA 5HNIX 2J0MB 3PFYA 2Q0NA 5AP4A 1F0QA 1YXSA 4FNYA 4KWPA 4PY1A 3LCTA 5DLSA 4DCEA 4BBMA 4EBWA 4ID7A 1YHWA 2OXXA 4U0IA 2X0OA 2CKOA 3MVMA 4I92A 4C3PA 3AC1A 4F4PA 2J51A 5JFVA 2PUNA 3FEGA 3KXXA 3ZO1A 5BUJA 2QC6A 1M17A 3SV0A 3CD3A 4BGHA 5FDPA 3D5VA 2XBJA 2RFDA 3IK3A 2DWBA 1XWSA 4RG0A 3TACA 5AV1A 3ZUVA 4BDEA 4OBOA 3M1SA 5A4LA 2VD5A 2RL5A 2WO6A 3ZO4A 3W0RA 3CD8A 3TNWA 4BDKA 4ENXA 4G31A 2YM3A 4IM0A 4WSQA 4XYFA 1ZOGA 3VJOA 1KE6A 4QQJA 4WUAA 4J53A 2XANA 4AW1A 1ATPE 3MB7A 4NT4A 5HQ0A 4WUNA 2VX1A 1H26A 2XUUA 3EQDA 3HP5A 2HWOA 4IC7A 5JQ8A 4PTGA 4USFA 3ID6C 5AP5A 4IDVA 2R7IA 1Q99A 2PMNX 3G51A 4FTRA 1HOWA 5D12A 4I4EA 5KO1A 3UDSA 2XNMA 1ZY5A 2CGVA 2VU3A 4L9IA 4NW6A 3W2OA 5BMSA 3AC8A 4TWCA 5CEMA 3R02A 3I7CA 5B2MA 5IQGA 4FG8A 3F9NA 4ORKA 2YERA 1YDTE 3IPHA 3NUSA 4QTDA 3NW6A 3ENMA 3LQ5A 3BU5A 4LYNA 3ZLSA 5L3AA 4GL9A 4FIFA 4WKQA 3EKKA 2QOBA 3ZFXA 2ITXA 3VBQA 3E8EA 3NYOA 3UOLA 4H3QA 3VBWA 4ACGA 2R3JA 3AC4A 2VNWA 3PE2A 5TE0A 5HTBA 4OTQA 4YZ9A 2OJGA 4FZDB 4FUYA 4MVFA 5CI6A 1Q4LA 3OEZA 3DK3A 2IJMA 3COMA 3F66A 4FK6A 5F4NA 1SNUA 4BWXA 2VWZA 3IKAA 5HG9A 3COKA 5EHOA 4RIOA 4FSNA 5I9UA 3VWAA 3WBLA 4CLIA 5JRQA 5I9VA 3P23A 5CSVA 4UX9A 2WMWA 3MESA 4QRCA 4FSMA 1BUHA 3AC3A 4FTMA 2FGIA 4FKWA 4GK2A 4RWLA 1F3MC 4ZJIA 4ZJJA 4F78A 2YZLA 3QTWA 4FSWA 5CXHA 1Q61A 3W2RA 4FIHA 4FZ6A 4BI2A 1XH6A 1YOMA 3DBEA 2Y7JA 2W5BA 3R22A 4QP8A 5M57A 3U9CA 4N4SA 2ITYA 4IMYA 2G15A 4XP0A 4DFXE 2V55A 2HZ4A 3V04A 1OIYA 2BALA 2BRMA 4C59A 4O7SA 2PVYA 4LGDA 4UV0A 3KF7A 4C34A 1G8SA 5IQBA 3DTCA 3IGGA 2XNNA 3MH1A 4RA5A 5AM7A 2VN9A 2XB7A 4MNEB 4FKTA 5HICA 4E6DA 4GFGA 4B9DA 2WTVA 3GC9A 4TYIA 3E5AA 3LCSA 1TKIA 4FE2A 4TYGA 4C4FA 4BBEA 3ZM9A 3WZEA 1FMOE 2R9SA 4XV9A 4PMTA 4AW0A 2UZEA 3O0GA 3AMYA 3QTQA 3K54A 2QOLA 5IEYA 3QQHA 4IX4A 4S30A 4HVDA 1WVYA 2IWIA 1REKA 4BTMA 5IDNA 2QG5A 3LFQA 4XV3A 4EC9A 3O8UA 4NWMA 5BYLA 1H0VA 5CYIA 3UIXA 3VAPA 5I9XA 4LRKA 1VYWA 3D7TB 4I5CA 2WNTA 4FV3A 3V5WA 3C4XA 2YIRA 2UZVA 3EJ1A 1ZXEA 3LHJA 4O2ZA 5AAGA 5HHWA 4KAOA 5CANA 3DAJA 3I60A 4MD8E 3KK8A 3SGCA 4U7ZA 3LLAA 5D1JA 4MXZA 4EZ5A 4CKJA 1BL6A 3O8PA 4X21A 3AT4A 3DY7A 4RRVA 5CF4A 4E6AA 1UA2A 2B0QA 3I5ZA 4N6YA 3Q60A 3C4CA 3VHEA 1UWHA 4O1PA 1WBPA 2C0TA 3LFNA 3BLRA 1OMWA 1P5EA 3KKVA 4PL3A 3GEQA 3QYWA 4U80A 4J96A 5D41A 4LV7A 5HG5A 3WF6A 3KXHA 3ZU7A 3QZHA 4LMUA 4ITJA 4UZHA 4AWIA 4H05A 1B39A 3DK6A 4IWPA 4GV1A 1U5RA 4BTJA 3M11A 2AC5A 2IVTA 3UGCA 4DEDA 1DM2A 3QFVA 2GS2A 3R7GA 5FEEA 4W4WA 3BX5A 3R01A 2YACA 2BPMA 4YZMA 2C1BA 2YCRA 1H00A 2BDJA 4AW2A 1TZDA 4RIYA 4NKAA 3ACKA 2XEZA 2O0UA 3NUAA 3PLSA 3ALOA 2AUHA 3ZBFA 1BLXA 4NYEA 4BCNA 4FK3A 5CVFA 2GNHA 3R7EA 3EKNA 3RAHA 4CZYB 4U43A 3CJFA 1OBDA 3QWKA 4MXXA 4QP1A 5AUWA 1H08A 2XCHA 3OS3A 4C2VA 2WIHA 3AGMA 2YEXA 3F5GA 4C4IA 2BDFA 4E6QA 3JYAA 4ITHA 2Z60A 3EN4A 5ANGA 4CMUA 4TWNA 4WD5A 3QGYA 3Q2JA 4JLCA 3KB7A 4UWBA 5KMIA 4BKZA 3IW7A 2O3PA 4AF3A 2RFEA 2KTYA 3UE4A 3BYSA 5E8WA 5HD4A 3TJCA 4EZ3A 3A4OX 4FIEA 4JDKA 5E91A 4YJSA 3EH9A 2F7XE 3NFGB 4YJQA 2PHKA 2C6LA 1TFFA 3A7FA 4G2FA 2HY81 3CBLA 3HYHA 3ZSGA 4P5ZA 1Q5KA 3ORKA 1GNGA 5FM3A 2UZNA 4RX8A 5ANOA 1ZY4A 3P7BA 1PKDA 4G6LA 2JEDA 5KBQA 3EZVA 4FIJA 4BICA 2V7AA 1M52A 3T9TA 4AFJA 3UP7A 3ATTA 1A9UA 5HVKA 2UV2A 3FKLA 5HLNA 4BGGA 5E8VA 3UVQA 2F7ZE 3NUUA 3HV3A 1M7QA 5KBRA 2JDTA 4I6HA 4UB7A 3EHAA 3F3VA 4AE9A 5M4IA 5D7VA 4BIEA 2OO8X 4PDPA 4D2WA 1PHKA 5FUTA 4BY9E 5H2UA 2O64A 5FM2A 2ZDUA 3TI1A 2HWPA 3UVPA 4F7NA 4FSRA 2DS1A 3G33A 3BYVA 1WZYA 4RX5A 5HO7A 4QT1A 5FP5A 3GOPA 1LEWA 2JFLA 3MFRA 3LM0A 4FV0A 1JSTA 4S32A 3PZHA 4ANBA 4C36A 4E8AA 2AEGA 5BX0A 4X6QC 3PJ1A 4RT7A 1Z5MA 2CCIA 3DQXA 4JBVA 2Y0AA 4QTAA 4DAWA 1YOLA 1VZOA 4LUDA 2WIPA 3L8SA 2F49A 3EYGA 3ORMA 4OTIA 5G6VA 3I6WA 4RJ6A 4MXAA 3FL4A 5T68A 5T3QA 3TYKA 3TEIA 3HGKA 3UYSA 4NFNA 1PXOA 3CPBA 3QF9A 4EOOA 1RE8A 2R0UA 1OI9A 2I6LA 3B2WA 4X0MA 3PE1A 5I5ZA 4ZSAA 3R7VA 3RALA 5KKRB 3REPA 4P2KA 4O91A 3VC4A 4D9UA 4L68A 1GZ8A 4FKJA 4GVJA 5M4UA 3ZHPC 2PVKA 4DEGA 2W1EA 2X2KA 4RVTA 3MJ2A 2PVFA 4HJOA 2X2LA 5FTQA 5C8NA 2ITPA 2A98A 1J91A 5H8GA 4YGAA 4IQ6A 1JSUA 1XH4A 3EQRA 2XA4A 4I20A 5DT0A 4U3ZA 4EEVA 3CXWA 4U79A 3Q52A 3RWPA 4ACMA 4UMTA 1WVXA 4JR3A 2VTOA 3TNHA 5AR5A 1QMZA 5M06A 4QDVA 4WNKA 3UC3A 1JPAA 4RVLA 4YJVA 5CSPA 1U46A 5K5XA 4K9YA 2HZ0A 1CDKA 4L45A 4P4CA 2XAOA 3BV2A 4IAKA 5BYYA 2UW5A 3QD0A 4GSBA 3MGYA 1NT2A 4LDTA 3S95A 2G1TA 3WILA 4BDDA 3NMUF 2XARA 4AA4A 3U4WA 4BDIA 5BQ0A 1U5QA 4GVAA 4R6VA 3FPQA 2I0YA 5FGKA 3R1SA 4GUEA 4E1ZA 4O0XA 1ZYJA 3NNUA 3ENHA 5BVNA 4FTLA 2W1HA 4D58A 3KN5A 4RC4A 3NSZA 1MUOA 5BV3A 3BU6A 3QKMA 4FOCA 3DAEA 2E9OA 4U81A 2PVLA 2ZV7A 5HE3A 4Z3VA 3NRMA 5M53A 1ZRZA 1H25A 2PYWA 5C8KA 3VS0A 1SVEA 3RZFA 2XNPA 3ZFMA 5DGZA 4YJNA 4EONA 4OTHA 3H9FA 4IVCA 3HMOA 4XS2A 4G5JA 3PG3A 3DKCA 1MQ4A 3GXLA 5DVRA 5EW3A 1IA8A 3BHVA 4I0TA 3F2NA 5AM6A 3QBNA 2A1AB 2O8YA 3NR9A 2XK9A 3OF0A 4Y46A 3VW6A 4DH1A 1SYKA 4N57A 5KZ0A 4LFIA 4PDYA 3ZXTA 2YAKA 4EC8A 2G2HA 3T3UA 1GZNA 3UQGA 3SXFA 4CD0A 3Q5IA 3FQHA 4P90A 3V8SA 2ETMA 4OT5A 4ASEA 2YM8A 4C37A 3TZ7A 2FB8A 1Y6AA 3GGFA 3G90X 3O2MA 3BZ3A 3FE3A 3ZMMA 4GKIA 4C33A 4CFNA 3KRRA 2HXLA 2BZHB 3U51A 3HNGA 4XNEA 4FX3A 2WMVA 4QP6A 1E1XA 4JMQA 2W1DA 4IX6A 5DN3A 3VF8A 4F6SA 4IB3A 2CPKE 2QOIA 3NCZA 5E8TA 4FOBA 1V0BA 1NVRA 3DQWA 3E88A 3PYYA 4O27B 3KIOC 2ITOA 5AV4A 4FV8A 3QQGA 3ZO3A 4OTPA 3ZDUA 5IUHA 3ZYAA 1HCLA 4MNEA 4DG3E 2OBJA 3O23A 3SAYA 5A6OA 1OL6A 2P55A 3HV5A 3QX4A 4J8NA 1OGYA 4EK5A 1MRVA 2OH4A 1WVWA 3KEXA 3BL9A 2AYPA 2PZRA 2VX3A 4V05A 2GFCA 5CF5A 5I9WA 5K5NA 1VR2A 3O51A 4O7ZA 5AUXA 4QP2A 2H8HA 3AD6A 4AACA 4XBRA 4HVIA 3TG1A 2XKCA 5IF1A 3A4PA 1JKTA 3L8XA 3SRVB 4GT4A 3BEGA 3I0OA 3LVPA 4BGQA 3R2BA 5EQYA 5M44A 3S4QA 2PMLX 4J1RA 3D7TA 4DG0E 4RFMA 2Y6OA 4G3GA 3PA3A 2WB8A 4FYNA 4OBQA 5LVLA 1OITA 3OROA 3AC2A 3PXKA 5E7RA 4ZTLA 5HO6A 2XK7A 1KE5A 1YHSA 3LPBA 3R8MA 2VTNA