4IX6A

Crystal structure of a stt7 homolog from micromonas algae soaked with atp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
346
structure length
346
Chain Sequence
b'LKARGGPKTLRRTPGVEPKDIRVLPGPLGSGNFGTVFRGVFKGDQDVVLKNAKADVMAAEELLECEMDVNYHVHANAKGTCARFMGCIELGAKDGGEIYNGTLTEGLWLMWANEGENTVEALMRRGTAPLATAMACADATELGVTKKAMRELLGSLARLHECGVVHRDVKPANLIAAEKDGGVLKLIDLGAAALCLPLPETLNYYPGDGPADPRYAKADELYLLPPGSPRPTKDNAAKLWEAHKPDRFDSWSAGCVMLQLAVVGLRTDAGLERFLADYKAVGYDVNAFRGEKSGEYGTMDFAALDANGGAGWDLCQRLMEAERDARASCEAALSHAFFDAAALEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MsStt7d protein
publication title Structure of the catalytic domain of a state transition kinase homolog from Micromonas algae
pubmed doi rcsb
source organism Micromonas
molecule tags Transferase
total genus 106
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ix6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ix6A01
2O5KA 4NM7A 4C3FA 4C35A 3O8TA 2XEZA 3P7CA 3KVXA 4DF3A 4H1MA 4BDJA 4BTJA 3NRMA 5DFPA 2UVZA 3OCSA 3ALOA 2BAQA 4CMOA 3CQWA 4R8QA 3QTXA 3JR1A 2W1EA 2EXEA 2IZTA 5L8LA 3QQFA 2YM4A 4YGAA 5HIBA 5HLPA 3V5QA 2BAJA 2QODA 3LJ1A 4CXAA 2A2AA 1IR3A 4CRLA 2UW9A 1UA2A 3KN6A 4S30A 5HO6A 3CKXA 5M57A 3IO7A 3ROCA 3UOLA 4F99A 4F7SA 3TNPC 1ERKA 3CD3A 4FKGA 4FV4A 2CNQA 4AUAA 5IH5A 3UQGA 3WBLA 4WUNA 3R9NA 5D7VA 2PTKA 3BRBA 2W4KA 2XMYA 3D5VA 4FKUA 2YDJA 3A99A 4O0RA 2XNNA 4LFIA 3GU7A 4E6QA 2I0YA 4NWMA 3IPHA 2OH4A 2UZWE 3W10A 5KMMA 2CNVA 3R00A 3S1HA 4G16A 3AG9A 4NM0A 4GV1A 4KS7A 3BYSA 1BUHA 2X6EA 3E3BX 4Z7HA 4P4CA 4QMSA 2WFYA 3QWKA 1H01A 1U54A 3QTQA 4K6ZA 3DAKA 4D4SA 5L3AA 1ZZ2A 1XKKA 3F3VA 3MY5A 4I41A 4QMVA 4ZSJA 1OKZA 4RIYB 1H1RA 3TXOA 4AAAA 5FEQA 4IANA 2O63A 2XVDA 3KEXA 4PMSA 1FBNA 4QMZA 4W4VA 4C7TA 1ZYSA 5E8SA 2OJJA 2QO7A 4MBIA 2VTOA 1WBTA 3TV6A 3U6HA 4WO5A 3R9DA 3CXWA 3ZLSA 5D1JA 1UKIA 3EIDA 3EQDA 4HNFA 4I23A 4CTBA 2Z2WA 3TTIA 4BYIA 3QXPA 3OG7A 2YABA 3UO4A 5JFXA 3VS2A 4RWKA 3QD2B 2GQSA 2VN9A 3VUMA 3MVHA 4DN5A 1JOWB 5BUJA 4M12A 4O2ZA 4FTQA 3FKOA 2G2FA 4F1OA 3VUGA 2I0HA 3R01A 4TYGA 4XMOA 3QA8A 2WMRA 3PVBA 4BBEA 4QQ5A 4KUJA 4DLJA 2I0VA 4HYIA 4DTKA 5L8JA 3LQ3A 3G6HA 3TKUA 4CQEA 2IO6A 2ZJWA 3F5XA 4W4WA 5HZNA 4MXAA 1XH8A 3Q3BA 4PDSA 4DEAA 5G6VA 4RVLA 4KBAA 1XJDA 3BHHA 4R5YA 3FV8A 4FKIA 4QYYA 4WG3A 2JEDA 4RC2A 3F3ZA 3EQCA 3HV6A 4UXQA 2OXYA 2QHMA 4AGWA 4J1RA 1PXPA 2EWAA 2WTVA 3VUIA 4MXXA 5JQ5A 3EQGA 1OL6A 5M51A 5M08A 1UU3A 4EOOA 1XH7A 2Z60A 3S2PA 3M42A 3P5KA 2GNLA 3R63A 3LAUA 3VW8A 1JLUE 2C3IB 4EUTA 1AGWA 3MFRA 5EDQA 4KAOA 2FUMA 1V0PA 4K0YA 3O50A 4FK3A 3NUSA 4C4JA 1J7IA 3A8XA 2C68A 1U5RA 2ZM4A 2E9UA 2RFDA 3UNKA 4MTAA 5ITAA 5CU6A 1AQ1A 4DC2A 4EOLA 5CSWA 3FAAA 4I24A 3ENMA 4ACHA 4QMNA 3ATSA 4RJ7A 4ITJA 2Z02A 4HGEA 1XO2B 4A06A 4O0WA 4G6NA 3JY9A 4UB7A 4G2FA 1OIYA 4UMQA 3ZEWA 1YOMA 4LGDA 5LMKA 4WIHA 1CTPE 2C3KA 1Q3WA 4KABA 3W32A 4A9SA 2X4ZA 5M53A 2OZAB 1K3AA 3LXPA 2R7IA 4LV5A 4ZTMA 1JWHA 2WMSA 3OEFX 4CFXA 3E88A 4K1BA 3ZO2A 4CZYB 5JT2A 4AW5A 3UE4A 3WZEA 4AA5A 4FV9A 4BCOA 4B4LA 1FVTA 2OK1A 2QOLA 2WTCA 1S9JA 3LZBA 4CMUA 3LFCA 5H9BA 3E7VA 5TOZA 3ZLXA 1F5QA 5I4NA 3PLSA 2WOUA 4YBKA 2HXQA 3AD4A 4L7SA 4CFMA 3SG9A 4PMMA 4WSQA 5ANGA 2BHEA 2RG6A 1L3RE 2IWIA 2R64A 4FKSA 1IRKA 4EONA 1BLXA 3GC7A 2YM8A 2OJGA 2UW7A 2R3NA 3PXRA 1KOBA 5J1WA 4WT6A 2OFUA 4F7NA 2WTJA 4YTCA 2WD1A 4USDA 2F4JA 4QYHA 3A7GA 3OS3A 3LLAA 3Q9WA 4JAJA 5LVOA 5FM2A 1AD5A 2PZPA 2CN8A 2VWIA 4HJOA 4RT7A 4EKLA 4N57A 3OY3A 3DLZA 4I21A 3T9TA 3QF9A 3IDCA 3MH2A 5ACBC 2X2LA 5IEVA 4FYNA 1QPCA 3GUBA 3A62A 4DEDA 1OPJA 3SHEA 3UNJA 4CV8A 4XUFA 2ZOQA 2XIRA 3Q6UA 4IVBA 4YLJA 3PY3A 3KA0A 5E92A 3HLLA 4YP8A 3VBVA 3IW5A 2NRYA 5IPJA 4C8BA 3PIXA 4AXAA 4O84A 1ZMVA 3C50A 3TNWA 2JKOA 3A4PA 4E20A 4NW6A 4C57A 2BRMA 4X0MA 1MP8A 2WZJA 3AC4A 4UALA 3MVJA 4HYUA 3RHKA 3UTOA 2GPHA 4RX9A 3MS9A 4DEEA 4E4XA 2BR1A 3NYOA 3Q5ZA 3HGKA 5C4KA 2QLQA 4OTQA 4K2RA 3LCOA 5AV4A 5JFVA 1H26A 2PMIA 4OTPA 5CT7A 3L9MA 5C9CA 5JGBA 3CKWA 4XLIA 5HG5A 3GC8A 5CSXA 4BTFA 2QLUA 2W4OA 4DG3E 2O8YA 2BFXA 3GCPA 2JLDA 4YZDA 1UNGA 4XBUA 2P3GX 3BLHA 1RDQE 2P2IA 2XA4A 3F7WA 4U6RA 5FD2A 5CNOA 4I5PA 4M13A 2VO0A 3OP5A 2HZ0A 3V6SA 4RPVA 3EOCA 2BUJA 3C9WA 5IUIA 3ACJA 5DOSA 5CXZA 1Q8YA 5KMJA 2C5OA 3U9CA 4A9TA 3MB7A 4J99A 3EQPA 2BCJA 4IIRA 4O0YA 1LP4A 2ZAZA 2XKFA 4GT3A 4QMOA 5JEBA 2GFCA 4BDCA 4R1YA 4DEHA 3BHVA 4WNOA 3PP0A 2JAMA 5HOAA 4Q9ZA 5DE2A 2NRUA 3NLBA 1Q4LA 2H8HA 3MH1A 5HG7A 4FBXA 3HV5A 3OTVA 3FWQA 4P5QA 4NM3A 4A9UA 2Y6MA 1FMOE 2A1AB 1RJBA 3WF5A 5C1QB 2IVTA 4WG4A 1A06A 4OUCA 4FIGA 3ZUTA 4C4HA 4E7WA 2PZRA 4AE6A 4HCUA 2C6OA 4USEA 4JX3A 4YNOA 2B52A 3GCUA 4J97A 4Z7GA 4KKGA 2E9VA 2W1GA 4P2KA 3W33A 5IQCA 1FOTA 3Q53A 4ANOA 2HW6A 3LFBA 3UPZA 4WRGA 3COHA 3VS1A 2R5TA 4IEBA 1H1QA 4EQMA 1Z5MA 3UG1A 4FSMA 4CCBA 5IA5A 4F6UA 4DCAA 4IH8A 4EQUA 1OMWA 4YPDA 5L4QA 5CU2A 3RPYA 4FNYA 5K5XA 3QD3A 2ZDTA 4I5MA 3GU5A 3JYAA 4LRKA 4YJUA 4C4IA 3S3IA 2CMWA 4AT4A 5C8MA 2BZJA 1OBGA 3GCVA 2QURA 3KK9A 3P23A 3CGFA 4HZRA 5AUVA 3OUKA 1PXJA 5GZ9A 1TQIA 5IKWA 4AX8A 3ACKA 2WTWA 3GOPA 5E8YA 3UBDA 4L9IA 1UNHA 2ITOA 2HENA 4MYGA 4LGHA 3Q52A 3D14A 3QX4A 3CIKA 3MPTA 4CT1A 3EZVA 5CALA 4BBMA 3VS0A 2VX0A 4EQCA 1DAWA 3THBA 4RJ4A 2XK7A 3PTGA 5CQUA 1OM1A 3PA3A 4IWQA 5AP1A 4GS6A 3SKCA 4ZLYA 3LKMA 4BR3A 4IZ5A 4ZTSA 4YUQA 3ORMA 1PXOA 4C33A 5AAFA 4FZDB 1BI7A 3VQHA 4NUSA 4U5JA 2FSTX 4D1SA 3FJQE 3MFSA 4IX5A 3PWDA 4NL0A 2QOKA 1V0OA 4D4YA 4IB5A 1FINA 3M2WA 4XX9A 2GNJA 5E8ZA 3TUCA 3CY2A 4NM5A 2P4IA 2G2HA 4BI2A 5IQAA 1OL5A 5L2QA 2QOIA 4RC4A 3BHTA 3OY1A 3MJ2A 3RZBA 2YIXA 4UV0A 4U44A 1KE6A 1Z57A 1PMUA 4RRVA 5JZJA 5GJDA 4FV5A 3AMAA 1M2QA 4NKSA 3ET7A 3MFUA 4APCA 4DFXE 2E9OA 2ITTA 4NTTA 1WZYA 2PVJA 4UMPA 3DQWA 4OAUC 4OTRA 4PTEA 4CFVA 1Y6AA 3G15A 3BV3A 4QP4A 1OKVA 4PMTA 3R8VA 2X7FA 1YOLA 2ZB1A 3UIBA 5CEQA 3I6WA 4F70A 2Y6OA 3FSFA 4TXCA 4FEXA 3CJFA 3TNHA 3QA0A 2YZAA 3H0YA 1CDKA 2WMVA 4QNAA 5FM3A 3K5VA 2UZNA 4PQNA 2FA2A 1BKXA 3FC2A 4AZFA 4HGSA 1WVXA 3CJGA 3Q5IA 1E1VA 4EOKA 4EWQA 3CTHA 3T9IA 5A54A 4NIFA 2V55A 4FR4A 1JKLA 4FVRA 4G5PA 5CNNA 5I9WA 2PULA 4ZTRA 2CCHA 5AMNA 3NMUF 3QCYA 4WNPA 4KKHA 1WBVA 5E8VA 5E8TA 2WIPA 2GQRA 3A7FA 3UJGA 5A14A 3LCSA 3WF8A 5AEPA 2W5BA 2X6DA 1PKGA 3RNIA 3VW6A 1KWPA 2FSLX 3R9RA 2X1NA 3TZ7A 3KXGA 5CVHA 3TZ8A 5GZAA 3I0QA 5ANKA 3HECA 4S32A 2YLFA 4HVGA 2Y9QA 3E8CA 3WF7A 1Q3DA 3BELA 4QP2A 4I93A 3EB0A 4DITA 5T3QA 3ZO1A 2XK8A 3QTSA 3VULA 5M09A 2J90A 4LOOA 4U97A 3POZA 5FDXA 3DB8A 2YCSA 3KXHA 2VTIA 3BYVA 3ZZEA 4IX4A 3HEGA 2PL0A 4MAOA 3C0IA 4BGQA 3T8OA 3DKOA 2PZYA 3BX5A 5AADA 3F61A 3VN9A 2UW3A 4QP7A 1SZMA 4XV9A 1Q41A 2EB3A 1RW8A 4IB0A 3NCZA 4J96A 1U4DA 2BTRA 4HCVA 1UKHA 2UV2A 4FEWA 4EH6A 2Y4PA 3C4WA 4OT6A 2J5FA 4XG4A 3ZC6A 5E7RA 3V5TA 4FTUA 2I7QA 2HOGA 3KF4A 5HVYA 4YZMA 3ROYA 4F0GA 5LMAA 5EYKA 2WAJA 4ZSAA 4IWDA 2IW9A 4J7BA 1MRYA 4EHEA 2VO3A 2JIUA 3QYWA 4O2PA 3I81A 4JDIA 4QQCA 4N4SA 1JPAA 4AT3A 3B2WA 3BWFA 3RAKA 4AQCA 1P5EA 5DMZA 4E5WA 3PSBA 3POOA 3QTIA 3UYSA 3QC4A 3MVMA 3FL5A 3NAYA 4X2GA 3O51A 5HU3A 5IQHA 2QOBA 3BE9A 2CGXA 4YJQA 5IG1A 3AC8A 2W96B 2BRNA 3C0GA 3I60A 1HOWA 3A7IA 4R3PA 5DA3A 5FUTA 4E4NA 1ZWSA 3U51A 4OAVB 5B7VA 3H4JA 4BKZA 1OL7A 2B53A 2X0GA 4O82A 3TN8A 4GJ3A 2WQBA 4FSUA 4OTDA 1XWSA 5HO8A 4C59A 4JRNA 1YRPA 4RA4A 5HQ0A 4ORKA 4J53A 2BALA 4FSRA 4IC7A 3G33A 4Y5QA 5KZ0A 4D5KA 1K2PA 2VWZA 3MB6A 2JFMA 4IVCA 5CF4A 4O7YA 2WQOA 4U79A 4LMNA 1WVYA 3KVWA 3OCBA 2JD5A 3LFEA 4D0XA 1O6KA 4QO9A 4X2FA 4AFJA 4GG7A 2XNPA 4RJ6A 3B8QA 4CLJA 3MY0A 3V8TA 2VD5A 2ZV2A 3R7UA 4EK5A 3BYOA 2QNJA 4ZIMA 4O7VA 1ZARA 5DN3A 4FT7A 3LVPA 4I6HA 5T68A 4JDJA 2XF0A 4JDKA 3SOAA 5DVRA 3RPRA 2W1HA 4E6CA 5KBQA 4QYFA 1WBPA 1YXXA 2PZ5A 2B9IA 3QBNA 5CXHA 4W8EA 2JKMA 2CSNA 3ORTA 4GFMA 4H3PA 1APME 2ZV9A 4N70A 2VNYA 1YXTA 3NYXA 5FG8A 2YN8A 4MXCA 4ARKA 5JZNA 2XJ0A 5BX0A 5ETIA 1G3NA 4ANQA 4F9AA 2BKKA 4MVFA 4DAWA 4JQ8A 3RWPA 3WZKA 5B2MA 4DEIA 4QRCA 3ALNA 3D5UA 3G6GA 2WTKB 3PLAE 3C4ZA 4Y46A 2PVKA 2HZ4A 2XS0A 5A6OA 4EH2A 1OZ1A 5CZHA 5B2KA 3IQ7A 4U81A 3ZLWA 3W2SA 3ID6C 1OKYA 3W2CA 4UXLA 1OBDA 2SRCA 3H9RA 4L3PA 4J52A 2QI8A 2XK6A 4OTFA 4TYHA 5H2UA 4O81A 2PYWA 1CKIA 2GHLA 2I6LA 3PSDA 4MKCA 2XH5A 2LGCA 2OXXA 5B2LA 1O6YA 4D2TA 4EC9A 4CGAA 4KIKA 1HCLA 3GCQA 4IAZA 3V51A 4FT5A 3RPOA 1QPJA 4FG9A 4JJRA 3ZBXA 4L42A 1Q8WA 2YCRA 2R3KA 5CY3A 4DINA 5A4EA 5HD4A 2BKZA 4F9YA 5A4TA 3AD6A 1YDRE 5JGDA 3ITZA 3HUCA 3RK5A 3KULA 4OBOA 4W4XA 2UZDA 1BMKA 4GT5A 4NCTA 2CPKE 4Q5HA 4M69A 4CD0A 4AF3A 2YM7A 2WMXA 5B0XA 1OGUA 5CLPA 4AG8A 4B8LA 5EH0A 3LCTA 3D5WA 5ANDA 4EBWA 5FXRA 5KMOA 3LJ0A 3DS6A 1OPKA 5BVWA 5F94A 5CEIA 3TNQB 1TQPA 3GEQA 4FIHA 4MBJA 2YACA 4ITHA 3UC4A 3ZO4A 4EC8A 2CLQA 2IZUA 4C3RA 3LXLA 2B9JA 4FSWA 1PXNA 4O21A 4OBQA 3DKGA 4BCMA 4BZOA 3FQEA 2X8DA 2ETRA 4FSZA 4PWNA 4ASZA 1TQMA 1P4FA 1YW2A 2WO6A 4H3BA 4M67A 4UYNA 1A48A 1W83A 4W9XA 2DS1A 3O96A 3UZPA 5LCKA 3IDPA 3UNZA 3GNIB 3NWWA 2BRGA 3WYYA 4HVSA 1BL7A 1VEBA 5M06A 3R02A 3P9JA 3QFVA 2GTNA 3RAIA 3QQUA 2ITUA 4GSBA 4H39A 4L8MA 4I4FA 4QTAA 4S2ZA 3R8PA 4CFWA 2CLXA 5BVOA 2IW6A 5FRIA 3UMWA 4QTEA 3E62A 4QP1A 2OF4A 4FYOA 2VGOA 4YO6A 4PNIA 2VO6A 2UZOA 2WGJA 3QLGA 5M56A 3R1NA 5AV3A 3R0TA 4O91A 3RCJA 4FMQA 1H24A 3AD5A 1GZ8A 4JIKA 2XNEA 5C27A 3D4QA 1WFCA 4BDGA 5HLWA 4F63A 3W16A 4GKHA 5HVJA 5C01A 3ERKA 3DXPA 5F4NA 5A9UA 1OIRA 4HPUE 2C1AA 1L8TA 5J5TA 5BVFA 2JDRA 2YCFA 4WBBB 2QOHA 3ANQA 4EH4A 1CKJA 4R6VA 4G1WA 1OUKA 1JVPP 4JBQA 4WOVA 5CX9A 3PA4A 2PVFA 2O0UA 2W99B 3FZ1A 3Q60A 4BI0A 4E6AA 4FKVA 5D10A 1GY3A 2R2PA 4FICA 2IVUA 2BDFA 2PVLA 5DT4A 4CRSA 2C30A 4TNBA 4TKSA 5GZ8A 3O2MA 3U55A 1M2PA 4ZK5A 1J1CA 4IZAA 5C8NA 5JMSA 1Y8YA 1GJOA 4I1ZA 4APPA 3BU5A 4YJSA 3CTJA 4ALUA 5LVMA 2VV9A 2WKMA 3AXWA 4IM3A 4BCPA 3H9FA 2PUIA 2BPMA 3CSVA 1YVJA 4XV1A 5TR6A 4XJ0A 2WHBA 4K9YA 3BBTB 3W2QA 4L46A 3UO5A 3R21A 3E63A 4MD9E 1B38A 5L2SA 3FMJA 5JKGA 2UW8A 2VTMA 3VBTA 4F9CA 3IDBA 1URWA 2QU5A 2PZIA 3HZTA 4IAYA 3UQCA 3K3IA 2Q0BA 4XHKB 5E9EA 4GUEA 4IBMA 3ZC5A 3ZONA 3QKKA 3MGYA 4K8AA 2PUUA 1XQZA 2W5AA 2HWPA 3ZDUA 3NYNA 4QMLA 4MQ2A 3O7LB 5CZIA 3QXOA 5BUIA 4NFNA 3NNXA 4ZS0A 2XZSA 4O7WA 3W8QA 5DT3A 4FKJA 3NYVA 1XH6A 5HCZA 4F7JA 4DE4A 4XNEA 3RWQA 4YTIA 2LAVA 1J1BA 2Z7SA 2R3FA 4QPMA 2Z7QA 3PJ8A 2W5HA 3NUNA 5AP5A 5CEOA 4BWXA 4OLIA 4DBXA 3D83A 2CJMA 4YZ9A 4ACGA 1DS5A 2QCSA 3RTPA 4ACCA 4E5BA 4IB1A 3DB6A 4MK0A 4NSTA 5CSHA 3V5WA 4FTTA 2QO2A 3GQLA 2CN5A 3DXNA 2HW7A 1OB3A 3TKIA 4I6QA 3TUBA 2QOFA 2XK9A 2ETKA 2UVXA 3EL8A 4FK6A 1J7UA 3PY1A 2CKPA 3EQBA 3FDNA 4M0YA 5HIDA 4AZSA 4X21A 1XH9A 4JG7A 1SYKA 3WF9A 4RZVA 5EW8A 4ANLA 4F0IA 3D7ZA 4FV7A 5AR4A 4CG9A 4JG8A 4YHTA 4RJ8A 5AP3A 4F1TA 3ZTXA 4JOAA 4UX9A 2VTSA 5M44A 3BQCA 4Y85A 4KKEA 5G1XA 4ZLOA 5K0KA 4DFYA 3C7QA 3DAJA 3ZXTA 4ZY4A 3R7GA 3VRZA 4ACDA 4X3FC 2I1MA 4MNEA 5FXQA 3FL4A 3AT3A 3KC3A 3MDYA 4HCTA 4BCKA 2VWYA 2XYNA 4ZSGA 5I3OA 4N6YA 4B0GA 2R9SA 2VX1A 3DBFA 3G5DA 4BCQA 4D2WA 3ZSGA 1J7LA 3UVPA 2KULA 2IW8A 5BMMA 3R28A 4FSQA 2ITZA 2REIA 3GU8A 4LQMA 1UV5A 3FMDA 3L8VA 3ORXA 5ACKA 3GFEA 4IE9A 4ENYA 3P78A 2G15A 4QMPA 1ZXEA 2E9NA 2WU7A 2XK4A 4B99A 4TW9A 4P90A 4S33A 5A3XA 2CGVA 4AWIA 4Z16A 1H27A 2JFLA 4PDOA 1P2AA 1OIQA 1S9IA 4K33A 4V04A 2R3GA 2FVDA 3LW0A 5ANIA 4X6QC 3RAWA 3ULZA 2C1BA 4YMJA 5IEXA 1OIUA 3F2RA 3G90X 4O7TA 5CSPA 4IM0A 4HVHA 2OJ9A 1ZAOA 5DPVA 1Q62A 2C6EA 1GZOA 4FV6A 1H8FA 3R2BA 3PXYA 4AN9A 5IUHA 4IFGA 5AP6A 1RQQA 3VBXA 1H1PA 2F2UA 2ITXA 1MRVA 4XRLA 5K0XA 2YJSA 3WE4A 5M55A 2VWXA 3C4CA 4ITIA 5IQEA 3QZIA 2YM6A 4GIIA 4FEUA 2YIQA 2HY0A 2JDTA 1IA9A 2UZEA 4A4XA 3WZUA 3QKMA 1CKPA 3W55A 4FV1A 5D9HA 4YNEA 2CDZA 2J5EA 2VRXA 2W1IA 4GU9A 2H9VA 3CD8A 3D9VA 2RFNA 1K9AA 1LEZA 3COKA 4E5AX 4XG3A 4EOMA 1W0XC 4KIOA 2OIDA 1Q8UA 4G34A 4I0TA 1WVWA 4QT1A 5CI6A 4C2VA 3K54A 4D55A 3CQEA 1WBWA 5IQBA 4DFUA 4YJOA 2C3LA 4G9CA 3FZRA 4KRDA 5IQIA 3AC3A 5TKDA 3Q2MA 3R7YA 3REPA 2R4BA 4ASEA 2ACXA 3MY1A 3QCXA 4PL4A 4ERWA 5HEZA 4PP9A 2FGIA 1VZOA 1YHSA 3UVRA 4Y5HA 4BICA 1ZYCA 2ETMA 3R8ZA 3LMHA 4AS0A 3UG2A 3DA6A 4D0WA 3DU8A 3BLRA 5HVKA 4KBCA 2Q83A 3R30A 4IXPA 3DLSA 4IM2A 3R7IA 1YDSE 3QTZA 4RQVA 1XH5A 3V5JA 4FTIA 2C6TA 3FZTA 4CFUA 3VAPA 1WAKA 4AGUA 3OTUA 3QU0A 2HY81 4E4MA 3PG3A 2R3JA 4O0UA 5EFQA 3RVGA 4C58A 1U54B 2XCHA 4I4EA 5I0BA 4D2PA 5KMKA 4CG8A 3S95A 3C1XA 5CVGA 1OKWA 3RHXA 4M15A 2W17A 4ANSA 4FG7A 2X7OA 3DOGA 4Z55A 1R78A 3II5A 2NP8A 5IA4A 3CPCA 3UZTA 3EFWA 3QQHA 2XYUA 4IJ9A 3G0EA 3E93A 3NUYA 2QG7A 3KRXA 1FQ1B 5EI8A 2C5NA 3WOWA 4XCUA 5FP6A 4XH6A 4YO4A 1PXIA 3LFNA 3ZDIA 5GJFA 3KF7A 2QVSE 2X9FA 2XJ2A 2R3RA 1E1XA 1CM8A 2G9XA 1ZYLA 3ETAA 3D5XA 2Z8CA 3E64A 5AP2A 2VAGA 5BUEA 5DBXA 4QMUA 3QZGA 4O7SA 5AV1A 4O7RA 2ZYBA 5GINE 3BPRA 3BEAA 4YPSA 3LFQA 2WTDA 2CKEA 3RZFA 4FNWA 4F0FA 2V22A 5KX8A 2BMCA 3EJ1A 5CF5A 4FVQA 2QHNA 2NPQA 2UW6A 3EZRA 4TY1A 5J9LA 1GOLA 5J7BA 3FI3A 2JBPA 2OGVA 2ESMA 2YFXA 1CMKE 3MW1A 4MNEB 5L2WA 2E2BA 4BDEA 4G3CA 4YJVA 3VJNA 2XB7A 3ZU7A 4Y83A 3K2LA 3PP1A 1H1WA 2R3OA 4DFLA 2Y4IB 2FO0A 2ONLC 3FKLA 5JRSA 2Y7JA 3MI9A 3OWPA 4CV9A 2B9FA 3ZSIA 4BBFA 4BYJA 4J71A 4FIEA 5ETCA 3ZRLA 3A7HA 2HZNA 3E8EA 4XYFA 4BTMA 2OI4X 5DR6A 3QZHA 5L6OA 1NY3A 1YXVA 2WB8A 1SVHA 2WXVA 3FE3A 3CC6A 1W98A 5HU9A 2ITYA 5EHYA 4EJNA 1U5QA 5JFSA 3KXXA 3O71A 2QKWB 1G5SA 2J50A 4J98A 3ZSHA 1KV2A 3HMMA 3ZFYA 5CEKA 4IVAA 5FQDC 4H05A 4PMPA 4HGTA 5KMLA 5GNKA 3PY0A 5AM7A 3O17A 3RK7A 4EHGA 2GS7A 3U9NA 4EOSA 3EN9A 3VUDA 3KRRA 4TN6A 4P7EA 4BN1A 1GNGA 4KIPA 3GXLA 3NNUA 1ZOGA 3IGGA 4ANBA 3DY7A 2IJMA 4CFNA 4YHFA 5JH6A 1PW2A 1H08A 5E8XA 4AA4A 4FC0A 3FXXA 3NSZA 2O3PA 1ZMWA 2WIHA 2EXCX 3JUHA 3OWJA 4QPSA 5DGZA 3BU3A 3QCQA 4JLCA 5HG9A 5A6NA 5AUUA 3QD0A 5LOHA 2UW0A 3Q32A 3U6JA 1H4LA 2AC5A 1PRYA 3IONA 2VWWA 2PE1A 3FXWA 3LMIA 3LFFA 5I9XA 2ZV7A 4J8NA 2W05A 3A4OX 3DNEA 4V0GA 4EYJA 4HW7A 3D7TA 4MX9A 1I09A 4WRSA 4G3EA 4YZNA 3CBLA 3UGCA 4C02A 3EL7A 1WMKA 3MSSA 4HYSA 4FT0A 3U4WA 4GK3A 2XCKA 2J0IA 4NT4A 2OW3A 4UZHA 5AUTA 3TM0A 3UP2A 2RL5A 3C5IA 1R39A 3HVCA 2XIYA 4FIFA 2J0KA 4TNDA 4DGLC 3OCTA 3KB7A 5CAQA 1KOAA 1PYXA 4IVDA 1OPLA 2UZLA 1OL1A 4YSMA 4EI4A 2GU8A 1H07A 4RIWA 2YERA 2YITA 3P86A 4ZMEA 5C03A 2OIBA 4H3QA 2BZKB 4R5SA 4JS8A 4ZMFA 2XIKA 2RFEA 4KWPA 4CEGA 4R78A 2O65A 3DBDA 4XOYA 3SV0A 4H1JA 4ZP5A 4RBLA 1MQ4A 3Q6WA 2Y8OA 3BHUA 5M4IA 3GC0A 3GFWA 4PRJA 5ICPA 1IA8A 2R3IA 5EM5A 3VQUA 1O9UA 2WMTA 3UQFA 2J9MA 5A4LA 2AC3A 3NUPA 2XKCA 4NZWB 5F95A 3ENHA 1QMZA 4ZY6A 3I7CA 4LM5A 1LEWA 4EZ3A 2XP2A 3VF9A 2C5XA 2G2IA 3HDMA 3VS7A 5LXMA 5E1EA 4L68A 2WQMA 5DHJA 4GFGA 4RIXA 3WYXA 3RNYA 4S31A 5CSVA 3TTJA 3SXSA 5LVPA 4ZJJA 4FF8A 3QUEA 4BC6A 2FSOX 3P0MA 2EU9A 3C13A 5CS6A 1M7QA 2XUUA 3DJ7A 3EQHA 5DEYA 3BQRA 3TJCA 3DTWA 5K4IA 4F09A 2AUHA 4M3QA 3UP7A 4BDIA 4O86A 5DYJA 3NNWA 5HNBA 2OLCA 3SOCA 1ZOHA 4K18A 5IH4A 3EFKA 2BDJA 2J0JA 4FSYA 5A4QA 4F64A 4M7IA 5D12A 5H8GA 2W1DA 2F9GA 1M14A 3Q4CA 5K5NA 1ZYDA 5LMBA 2GNFA 3F6XA 4L00A 4X2KA 3C4FA 4H36A 3BHYA 4FUYA 2QKRA 4PV0A 1WBSA 1YXUA 3DJ6A 3SXFA 5I3RA 5IEYA 4RX5A 4R1VA 2OZOA 3LMGA 4DLIA 4FSTA 3I1AA 3OMVA 5EM6A 3NZ0A 1FVRA 1PXMA 1YQJA 1QCFA 3PPZA 4CZTA 4FTCA 5J5SA 2UZBA 4BGGA 3Q4UA 3SDJA 4GU6A 2P33A 1MUOA 3MA6A 2WQEA 4FL2A 3ZBFA 3ZEPA 1W84A 4DG0E 1NVRA 5AAEA 5EDPA 1NT2A 5JSMA 4H58A 1NVSA 2VTRA 2XJ1A 3IG7A 3OWLA 4FL1A 5E91A 3L1SA 4D2VA 3V5PA 3QD4A 3ZZWA 4ACMA 5CASA 2X39A 3OBJA 2PWLA 5HTCA 4HNIA 4BKJA 4EK8A 3VBWA 4EHZA 5ETAA 1LUFA 3BLQA 3E8DA 3MFTA 5JRQA 5HTBA 2PVRA 4MCVA 3NIEA 4F9WA 4WKQA 4O7ZA 3EKKA 4C0TA 2WMUA 4AW1A 4I3ZA 2G1TA 1KE5A 2RFSA 3DJ5A 3HV7A 4LYNA 4FNZA 1FPUA 4NU1A 1UWHA 4TT7A 4I22A 4EOQA 3HMIA 5EQYA 4U9AA 2RIOA 4QMQA 3G9NA 3UMXA 4TYIA 4BL1A 4GYIA 5D7AA 5IA3A 4R77A 3SC1A 4QP9A 3KKVA 2O2UA 5AIRA 3D94A 4DGGA 3PDTA 3R1QA 3AOXA 3KMWA 4GH2A 4E4LA 3F69A 3DK3A 2YISA 3WILA 2A0CX 3EN7A 4UYAA 5JK3A 3HYHA 3PXFA 3SVVA 3RALA 4RMZA 3TIZA 5IA1A 2X2MA 4BZNA 3PFQA 4MXYA 3TDWA 5EW9A 3KCKA 4IAAA 3A2CA 4XV2A 5EYCA 4YSJA 2I40A 3BIZA 1NA7A 4IADA 4Y95A 3N4UA 4QMXA 2OKRA 4FKTA 4IB3A 3ORPA 4ZXTA 3FEGA 5H8BA 4GG5A 5AJQA 2XRWA 4RVKA 4N6ZA 4BFMA 4FI1A 4AN3A 2OF2A 2WPAA 2VTAA 2XM9A 5HG8A 5HO7A 3KK8A 3PRFA 3Q4TA 4DCEA 1SVEA 4QOXA 3HMPA 3F3WA 4LUEA 3EYGA 2AYPA 1UU8A 3EN6A 5J95A 4D28A 4DFBA 2GDOA 3M11A 4U40A 3L8XA 4OGRA 1GIHA 4ZZNA 2GTMA 3FC1X 5CU0A 2G01A 4CZUA 2EUFB 3UIMA 3FLYA 3QRIA 4KA3A 2RSVA 3SA0A 3AMYA 2X8IA 3LXKA 3QRTA 4N0SA 4F6WA 3OBGA 1W7HA 4DTAA 1PF8A 3SRVA 4JBOA 5EI6A 1ZY5A 3ORKA 3FLNC 4G6OA 3PUPA 5AR3A 3N51A 4QPAA 4RVTA 3DQXA 3OT3A 3G9LX 3LPBA 4NEUA 4EHVA 3VIDA 1Q8ZA 3LJ2A 3F2AA 1STCE 2C3JA 4FV8A 1GZKA 3GCSA 3R71A 4IDTA 4JVGA 4WHZA 1OUYA 2GS2A 2VTJA 2BRHA 5ETFA 3N4VA 4W8DA 4AGDA 5CEPA 4IACA 1MQBA 2PMLX 2YEXA 3F88A 2C0OA 1KE7A 1Q8TA 3LFDA 4TPTA 1CSNA 2PVYA 3KXZA 5KKRB 2WMBA 3ANRA 2F7EE 3JY0A 2X7GA 3IOPA 4FKWA 5DR2A 3R7OA 4X7QA 5EQEA 3QGYA 1OL2A 1RE8A 3FLQA 4FZAB 4K11A 4U7ZA 3NVMB 4WBOA 4JAIA 3Q96A 3PJ2A 5IMXA 2H6DA 3GB2A 3ORZA 4EOPA 3HP5A 3FMMA 3TWJA 2YAAA 3AQVA 4HOKA 4R7HA 4RSSA 3UOKA 4BDBA 4JDHA 5A46A 4NIFB 1UU9A 4KNBA 5DRDA 4OR5A 4F1MA 3MJ1A 3DTCA 3FI2A 2WMWA 4AZVA 4PF4A 4DFNA 2B4SB 3QAME 5FXSA 4L6QA 4YJPA 5CQWA 4CKRA 3ZM4A 2BIKB 4MH7A 4O7NA 4ZS4A 4LUDA 5E90A 2HK5A 4J8MA 2RG5A 5LWMA 3A7JA 5FP5A 4ZZOA 3GVUA 3Q04A 4GCJA 1P4OA 4JL9A 4QMMA 3KFAA 3UIUA 3R7VA 5H3QA 3V01A 4BIDA 3HX4A 4RJ5A 3IOKA 4B6LA 2BRBA 4QQTA 4GIHA 2WMAA 4UMTA 3SD0A 2CGUA 2JITA 3QWJA 3LIJA 5I9YA 4ZTLA 3W8LA 5IA0A 4EORA 3QKLA 1YKRA 3EHAA 4W4YA 5IUGA 2QQ7A 4HVIA 4ZEGA 5EKOA 5C4LA 4RIYA 1XH4A 4BWPA 1KUTA 3V5LA 5I9UA 4BCGA 2BAKA 3NPCA 4YTHA 2H96A 3QHWA 1NW1A 3PE2A 3MPMA 5T6KA 3RM6A 4YC6A 5BYYA 5IZFA 3MTLA 4MEDA 3H3CA 3VWAA 4OTIA 4AOJA 4YJTA 4NK9A 2QU6A 2XEYA 3M1SA 3PJ1A 3FMNA 2JIVA 2ZMDA 2F2CB 2XK3A 3NVKI 3LOKA 1M2RA 3LM0A 3LFAA 1VR2A 2P0CA 4TWNA 3PYYA 4E1ZA 5IQFA 3HKOA 4AW2A 4C3PA 4HVDA 2C4GA 3OEZA 4QTDA 4UY9A 3QLFA 4EYMA 5JN2A 2C0TA 5DH3A 4D5HA 2J7TA 4UMUA 2V0DA 3LQ5A 4IAIA 2XBAA 4AP7A 4BHZA 2VTPA 4WD5A 4CYIA 4LI5A 4EK4A 4CKJA 2QONA 2J2IB 3HV3A 3EQIA 3O8UA 4MWIA 5IH6A 5LJJA 5CU3A 4DH1A 3TIYA 1M17A 3TZ9A 2VTTA 4R3CA 4V05A 2EB2A 4XG6A 5GJGA 4MF0A 4A07A 3PJCA 3O0GA 2PU8A 3SLSA 3MH3A 4KSQA 5DWRA 3VS5A 5HTIA 4IQ6A 3KMMA 5AA8A 1IAJA 4QQJA 4ANMA 4RJ3A 4F7LA 1YDTE 2EXMA 2YJRA 3DKCA 5EK7A 4AOTA 2ZM1A 1ZYJA 3JS2A 1H0WA 3JVSA 4BVUA 5J1VA 5EHLA 3ZFXA 4C38A 4YZCA 2RGPA 3ZFMA 1PYEA 4AT5A 1BL6A 3KCFA 2C6KA 3F3UA 3OD6X 4FGBA 4K77A 5HBHA 5F20A 5LVLA 4BRXA 2VO7A 3QTWA 5JFWA 4BKYA 3SG8A 4GUBA 4WUAA 4B9DA 2UVYA 4JRVA 1Q61A 3NDMA 3R2YA 1UVRA 4USFA 5IU2A 4L67A 1REJA 2O64A 3RINA 4QD6A 5BYZA 4PTGA 3BGZA 2YIYA 2OJIA 3EKNA 3FSKA 4LRMA 5HCYA 3AC5A 1OI9A 3H9OA 3SXRA 3SRVB 5CU4A 3EWHA 2OZAA 3C51A 1E9HA 4JXFA 4QYEA 4FKQA 3WE8A 3D15A 4EH7A 1JKKA 1VJYA 2A27A 4EOJA 5FTOA 3MTFA 2FSMX 2YLEA 1DI9A 2XIZA 3FQHA 4TYJA 4DT9A 2YDIA 1F0QA 4FIJA 5HE0A 4DH3A 3PXZA 4ZTNA 3MH0A 3TT0A 1YHVA 4XS2A 3KMUA 4Q5EA 3K5UA 2BDWA 5CANA 3NUUA 5KHWA 4JR7A 1BI8A 1Q97A 3I5ZA 4GW8A 4IDVA 3VHEA 4DFZE 4LL0A 3RBWA 3U4UA 4AFEA 4BB4A 4F4PA 2UZTA 3KREA 3NW7A 4IWOA 4B8MA 2OO8X 4IWPA 5FGKA 1J91A 3FBVA 4D2SA 3L8PA 2UW5A 3ZM9A 4LG4A 5AAGA 5HICA 3WARA 3OOMA 1GIJA 5H8EA 4CKIA 2QOCA 2Y4IC 4FZFB 4UMRA 4TYHB 2PUNA 2JDVA 2J0MB 4FVPA 5FTGA 3T3UA 4XRJA 5EKNA 1WBOA 1QPDA 4LGGA 2BILB 4EK3A 4PP7A 1ZMUA 3E8NA 4FEQA 3QL8A 2PHKA 1Y57A 4KIKB 5BNJA 2P55A 3UVQA 3VVHA 4A9RA 1ZLTA 2OICA 3ODZX 3FUPA 5E8UA 4L3JA 3R1SA 3QHRA 2VX3A 2PMNX 2R3HA 5TF9A 5BMSA 4FIIA 3BEGA 5HESA 2CNUA 3UO6A 5AUXA 3KXNA 3MVLA 3HNGA 4FV2A 3KULB 4ZJIA 3VBYA 1YXSA 4EZ7A 4IW0A 3TCPA 4BIBA 4M69B 3TNIA 5KO1A 3OXZA 4Z9LA 4FEVA 3VF8A 4FODA 5EOBA 5LMKC 4FGRA 4PDPA 3OWKA 4B7TA 4RFZA 2C69A 2IVSA 3P7AA 2VTNA 3ORNA 3QALE 3R04A 3RGFA 4BDHA 5F9EA 3RK9A 5FLFA 1Z9XA 4AZWA 3V04A 2CCIA 2UW4A 4J95A 4XLVA 2CKOA 4FKOA 3HA8A 4TWOA 2HXLA 5HBEA 3EQFA 4LV8A 3U87A 2OU7A 3DBQA 3OOGA 4G9RA 3DKFA 1M7NA 2C5VA 2H34A 3H0ZA 4JQ7A 2C6MA 4NKAA 4RG0A 3DDQA 3K3JA 3ULIA 2F7XE 3DDPA 3I7BA 3CEKA 2UZUE 3I0OA 4GFOA 3PWYA 4XOZA 5M4FA 3BGQA 5L2IA 4FV3A 3EFLA 4M14A 3CPBA 3QC9A 4ASDA 5BVKA 2XNOA 1YWNA 2OBJA 1QPEA 4FKRA 5DNRA 4KINA 4Z3VA 3WZDA 3F9NA 2J0LA 4QP8A 5EI2A 3P4KA 4NH1A 3E5AA 3I6UA 3WI6A 1SMHA 1Y8GA 3OFMA 1ZY4A 4L3LA 4LOPA 3GP0A 5EDRA 4O6LA 3WF6A 2QO9A 3FLZA 3QCSA 3N9XA 5BYLA 4O1OA 1JKSA 3F5GA 2VTQA 3B2TA 3DCVA 3BE2A 3F7ZA 3AT4A 1PKDA 3LFSA 4KB8A 2B0QA 3O7LD 3BGPA 3QGWA 4FT9A 4ID7A 5E8WA 3ORIA 2BVAA 2WU6A 3PG1A 4EH8A 3ZS5A 2IG7A 3C0HA 3IGOA 3NNVA 2C0IA 5KNJA 3UIXA 3HDNA 4EH3A 4CFFA 4FOBA 5GIOE 4KIQA 4RX8A 5HIEA 1ND4A 4YZBA 1JSUA 1F3MC 3CR0A 4FV0A 2DQ7X 2VNWA 3IW8A 5KBRA 5HCXA 3R7EA 3ODYX 3H30A 3QQKA 1DM2A 4TYEA 5KHXA 2GSFA 2WNTA 3DFCB 3C4EA 4QTCA 3ZYAA 3ZXZA 5I5ZA 2C6LA 3C4XA 3EYHA 2XKEA 4BDKA 3PA5A 2OH0E 2W1CA 5LQFA 4G3FA 3FXZA 5BQ0A 3CP9A 4HPTE 4YC3A 3MWUA 5ANOA 4FE2A 4G17A 4L45A 3QX2A 4AZTA 3OXIA 4I92A 4BCNA 3R8LA 3AT2A 4UWYA 5HD7A 2X81A 4O27B 5KUPA 4X3FA 2HAKA 2Q0NA 3OVVA 5LWNA 5KZIA 5AA9A 2PUPA 3FZOA 4QYGA 3U54A 3GC9A 1B6CB 3RM7A 2QOQA 1GIIA 2BHHA 2W9FB 3A61A 3GI3A 4RX7A 2VTLA 3COMA 5KMNA 3FLWA 1G8AA 2BFYA 2JAVA 4KRCA 3FLSA 5AX9A 3NUAA 4LRJA 2GFSA 2PK9A 3CE3A 4YLKA 3FMLA 3TZMA 3UODA 5CF6A 4M66A 2OJFE 4FSNA 3H10A 3KQ7A 3LLTA 4ERKA 4UZDA 5IDNA 4FOCA 4FTLA 3TJDA 1NXKA 4Y8DA 5I9VA 3EN4A 3KN5A 4M8TA 5DG5A 2XNMA 4EJ7A 2X2KA 3IKAA 4HYHA 3QUPA 4L7FA 1URCA 2ZVAA 5HX8A 4GJ2A 2PPQA 2XNBA 2B7AA 5HGIA 2YZLA 3DBCA 2QOOA 3IECA 3IS5A 2J4ZA 4G5JA 3I79A 3OCGA 4I6BA 4Y73A 4TWCA 2QR8A 2IPXA 4RLLA 3BYMA 2WTIA 3TDVA 2Z7LA 3QQJA 4TRLA 3QZFA 4U3ZA 5FDPA 3PSCA 1SNUA 3GT8A 2ERKA 3Q9YA 3G0FA 4D58A 4MF1A 3SX9A 4QP3A 4XV3A 3CQUA 3TI1A 4UEUA 3R9HA 3JVRA 3OZ6A 1V1KA 5KCVA 3HRCA 4OT5A 3L9LA 3PJ3A 5FWKK 3F82A 4Q2AA 3F5UA 3PPKA 4UN0C 1TVOA 1W82A 4GEOA 3LE6A 4TL0A 4DA5A 3R73A 4O1PA 4GKIA 2RF9A 2YIRA 2W7XA 4I0SA 4IZ7A 3Q9XA 2ITQA 4E93A 2WEVA 3TEIA 4C37A 3CTQA 4RWLA 3W1FA 4AOIA 4UWCA 4E26A 4O38A 2IZSA 4C2WA 3HUBA 5HX6A 5AUZA 4FZ7A 4DHFA 2B54A 3P1AA 2YCQA 3P79A 4GYGA 3A60A 2ITVA 2NNWB 3QYZA 3ZH8A 5D11A 5DRBA 4M84A 4M97A 2W0JA 1PY5A 2ITNA 5F1ZA 4DG2E 2BZHB 5CAPA 4EH9A 1HCKA 3NIZA 4ZJVA 1G8SA 4MD8E 3Q9ZA 4MWHA 3U6IA 2ERZE 3F2NA 3FY2A 4G3DA 4U42A 2YM5A 4F08A 4JT3A 4GL9A 4JX7A 4YC8A 3UC3A 3HA6A 2FB8A 5EM7A 4ZY5A 2HELA 3ZMMA 3MN3A 5CAVA 2PY3A 2ZDUA 4RFYA 1ZZLA 2R3MA 3VHKA 2C6IA 4WNKA 4IHPA 3RMFA 4BY9E 5K9IA 4PPAA 3C5UA 2GMXA 2GCDA 3UPXA 4II5A 4C61A 4CMTA 5LVNA 2YHVA 5DEWA 3JXWA 5AIKA 1YI3A 2R3LA 3PZEA 3AC1A 5IMEA 5E4HA 2W4JA 2XM8A 4C62A 4FG8A 5IQGA 5EHOA 1YWVA 4JBPA 3TKHA 2EVAA 3EQRA 4DEBA 4XEYA 4RWJA 2A19B 3BCEA 4QP6A 3UDBA 1T45A 3VBQA 2GS6A 2PE0A 4EKKA 4R7BA 5TE0A 4ZOGA 1Q5KA 4DGNA 1IEPA 4CSVA 4D1XA 5AM6A 3L9PA 4RGJA 4YJNA 1PMEA 2JGZA 4O0SA 1W8CA 1YOJA 4HGLA 3DK7A 3OW4A 4PPCA 4U8ZA 5HE1A 4L52A 4WG5A 1KV1A 4U45A 3V3VA 4F9BA 5KKRC 3HAVA 2QR7A 3L9NA 4MBLA 3PIZA 3VS6A 5AV0A 2X8EA 2HWOA 2WTKC 3S0OA 4AA0A 2RKUA 4IX6A 4KS8A 2YA9A 3MIYA 3FHRA 3FPMA 3VC4A 3G51A 2GHMA 3IW6A 4OTWA 1PMNA 4U43A 2GQGA 3N4TA 2GNGA 3R9OA 3GQIA 3ZHPC 2B9HA 5CENA 2WQNA 2Y0AA 4XG2A 2OXDA 3GENA 5IF1A 2B1PA 3UOJA 4FNXA 4PL5A 4X3FB 4RC3A 4M68A 3QUDA 4G3GA 3V8WA 2OIQA 3T3VA 4X6RA 5EYMA 1H25A 5AR2A 5CEMA 4GRBA 2PE2A 3F66A 3GU4A 3O23A 3R6XA 1XHAA 5FEEA 2HIWA 2ONLA 3WZJA 3CGOA 1GAGA 4JR3A 2IZRA 4ZTHA 4LMUA 1H0VA 3O8PA 3KXMA 4DYMA 1IASA 4I0RA 5L2TA 3CCNA 2C5YA 3MV5A 5AV2A 2V7OA 3KU2A 4P5ZA 3WIKA 4YLLA 4NFMA 3PIYA 4QMTA 5AR8A 1UWJA 1ZOEA 4DTBA 3FMKA 4DBNA 2HZIA 3MYGA 3BWJA 1VYZA 1BYGA 1B39A 1P14A 3BKBA 3VRYA 2FH9A 2J6MA 4PUZA 1DI8A 1BX6A 3NGAA 3W2OA 4AGCA 3HP2A 3QRUA 1T46A 3NCGA 1QL6A 4IZYA 5KE0A 4AW0A 4O22A 4IJPA 5K3YA 2VTHA 4L44A 3SW7A 4FTNA 5BVNA 4RVMA 4FA2A 4BIEA 5AUWA 5EW3A 3P08A 4GMYA 4PL3A 3QQLA 3EH9A 3MPAA 3UYTA 1LR4A 1J3HA 3DT1A 3WIGA 2KTYA 2R7BA 4L43A 3ORLA 3ZOSA 1UU7A 4BDDA 3I4BA 3PXQA 2YM3A 4L53A 4BTKA 4D1ZA 3DAEA 3A8WA 4NYEA 4AU8A 3PRIA 4FTJA 4CTCA 1FGKA 1H00A 4ONAA 4YBJA 2QC6A 4RQKA 4E3CA 5IQDA 5DLSA 4C34A 5CT0A 3GGFA 2W1ZA 3OF0A 4I6FA 1R3CA 3PXKA 2JKKA 4ASXA 3OUNB 4NTSA 4BCHA 4FKPA 5HBJA 1JSTA 5FBOA 2YIWA 3EFJA 2JKQA 4MHAA 4QMWA 2XNGA 2PVHA 2R3PA 4BGHA 1SVGA 4JIAA 4O0VA 4RA5A 5CF8A 2UZVA 2I0EA 4AE9A 2OWBA 3MIAA 3CLYA 1X8BA 4NW5A 5DT0A 2OSCA 3GOKA 4D9UA 3F5PA 5BVEA 4BDAA 3DGKA 4G6LA 4I94A 4L01A 4XBRA 4CQGA 5CAOA 4PDYA 3E92A 1YI6A 4IAFA 5L6WL 5J87A 3VUHA 1WCCA 2W06A 3RPVA 3VNTA 4DGMA 1VYWA 5HE2A 3BZ3A 3TL8A 5CYIA 1XR1A 3SAYA 4O0TA 1GZNA 3ZO3A 3PVWA 4NJ3A 1U46A 3FYKX 5AR7A 5M4CA 2YWVA 4FTKA 4A4OA 4EH5A 1WBNA 5CTPA 5HKMA 5C26A 4IMYA 4HZSA 4BF2A 3R8MA 3OW3A 3KRWA 4TTHB 1FVVA 1Q24A 4JNWA 1JAMA 3L8SA 2B55A 4A4LA 3E87A 3HRBA 3V8SA 4AZEA 4ZAUA 4OTHA 4XG8A 3R83A 4D4VA 4DGOA 3LCDA 4Q9SA 4I5CA 4O6EA 4F6SA 3F3TA 2PVNA 4DH7A 4EWHA 5L6PA 3NUXA 2YWPA 4ANNA 3DNDA 4KSPA 5FEDA 5K4JA 1YHWA 2BIYA 1OITA 2HCKA 3BU6A 4ZLZA 4MXZA 5CI7A 2WELA 4CYJA 1ATPE 3FMEA 3VUTA 4EOIA 5I9ZA 3MESA 4GVAA 3QQGA 4YHJA 1OVEA 4FTRA 1MRUA 2P2HA 4FT3A 1YWRA 4KBKA 4BZDA 2C47A 1PJKA 2PMOX 5EG3A 3RKBA 3VUKA 3NS9A 4JG6A 2DYLA 5J8IA 1JQHA 5EOLA 5KMIA 2F57A 2XBJA 1KE8A 3DZQA 4QMYA 3DXQA 4V0GB 4BDFA 2JDOA 3D7TB 4FZ6A 4RLKA 4U41A 5LARA 5L8KA 3ZCLA 4EL9A 4BHNA 4E8AA 1JKTA 4YR8A 4ENXA 3ZUUA 2V7AA 3RAHA 2VU3A 3ZLYA 4A7CA 4PTCA 5IDPA 2XIXA 4A9YA 4C4GA 4GVJA 4BCIA 2E9PA 5JQ8A 5J79A 4XG9A 3HL7A 4C36A 5CAUA 4ALWA 4MD7E 5AP7A 3FZPA 5C8KA 2R3QA 4I5HA 4RIWB 2PVMA 3TV4A 1FGIA 3FHIA 4AACA 5HLNA 4JBVA 3FKNA 4YU2A 3VO3A 2GNIA 4UWBA 2GNHA 4CLIA 5BVDA 3SQQA 4F65A 2ZMCA 4NCTC 5FBNC 2V62A 3D0EA 4M0ZA 4FL3A 4U3YA 1PXKA 5DI1A 2VGPA 3IW7A 3R1YA 4E73A 3HAMA 4O83A 4I20A 3HRFA 5AP0A 5J7HA 3PE1A 5EYDA 5AWMA 4D4RA 3OXTA 1V0BA 2WMQA 1YI4A 2ZB0A 3Q2JA 5M07A 3HMNA 4ZZMA 4RWIA 5D41A 4IAKA 4O0XA 3D2IA 3SGCA 4V01A 4RIXB 2IN6A 4EUUA 3FYJX 3GBZA 3OC1A 1KE9A 1R0PA 4TWPA 1KSWA 3B8RA 4YURA 5BPYA 1SNXA 4YJRA 1EH4A 3S00A 4CCUA 1JSVA 3QRJA 3G2FA 5HNIX 3ZUVA 1DAYA 3PZHA 4X2JA 4XP2A 3LHJA 1JNKA 4PPBA 1XBBA 2VWBA 3E7OA 3NW5A 2CKQA 2DWBA 3AMBA 3IK3A 1H1SA 2CGWA 3CS9A 4ZSLA 5HI2A 5J9ZA 4BCFA 2XKDA 2GHGA 4PNKA 4RZWA 3BBWA 4RFMA 3P7BA 3VJOA 3VS4A 4DEGA 1XBCA 2CHLA 2DUVA 2XRUA 3OROA 5CWZA 5TT7A 2OG8A 4BCJA 4O7LA 3DV3A 3OHTA 3KGAA 4EK6A 3ATTA 3I5NA 5M4UA 5J9YA 3S4QA 2YAKA 3FI4A 4IC8A 4WNMA 1Y91A 5AX3A 3NEWA 4LL5A 4X3JA 1TKIA 3BI6A 4AN2A 5A4CA 3KRLA 4FTAA 1U59A 2WEIA 4MQ1A 1FMKA 4GK4A 3KL8A 3AC2A 5ANEA 2C6DA 2JBOA 1Y6BA 4FKLA 2UUEA 4BWKA 2W1FA 4X2NA 4EBVA 1I44A 2VUWA 3HV4A 3PVGA 4IFCA 4U80A 5HNGA 5JGAA 4E6DA 3UZRA 1R1WA 5HORA 5AFVA 3DFAA 4WSYA 5ANJA 1H28A 5EM8A 4Y72A 3SW4A 3U8WA 4D2RA 4RIOA 3UOHA 4C4EA 3LXNA 1M52A 3RCDA 4MNFA 3RPSA 4EEVA 4OBPA 2ZM3A 3RP9A 3ELJA 3TUDA 2VWUA 5AR5A 1PHKA 3TG1A 2F7ZE 4R7IA 1XBAA 3FQSA 3ZRMA 2PSQA 4BI1A 4YTFA 2JDSA 3E3PA 1A9UA 2W9ZB 3R22A 1IG1A 3BYUA 4PX6A 5AUYA 4OTGA 3QTUA 2HYYA 1OECA 1SM2A 2BZIB 3KRJA 1JBPE 1PXLA 3ZRKA 1PMVA 3MBLA 4GK2A 4EZ5A 2ITWA 3FY0A 3LM5A 5DIAA 2VWVA 5HHWA 3VS3A 3RI1A 4DT8A 4ZTQA 3DK6A 2QG5A 3AGMA 5LCJA 4QTBA 3R8UA 4UBAA 1REKA 2X4FA 1ZRZA 3W2PA 2YDKA 3DZOA 4DH5A 4CVAA 4G31A 2Z7RA 3PVUA 3CY3A 2ITPA 3FPQA 2JIIA 1Q99A 5CVFA 2BROA 2J51A 2IVVA 1O6LA 3NR9A 4JQEA 4ALVA 3D2KA 1LPUA 4JI9A 3PPJA 2F49A 3NX8A 4WA9A 3FMHA 3AGLA 3RJCA 3BV2A 1UNLA 3Q4ZA 2JC6A 4FTMA 5TO8A 3TACA 1NVQA 3EN5A 3FZSA 3OT8A 4DH8A 4XP3A 3NW6A 2R0UA 4TZRA 2ZV8A 2FYSA 2R0IA 4OW8A 5GHVA 3HMOA 2OFVA 4MXOA 1R0EA 4FUXA 3W18A 2A4LA 5DR9A 4CT2A 4C4FA 2QD9A 4IX3A 5E1SA 4XG7A 5HE3A 1IAHA 3LCKA 5FTQA 4R3RA 4KD1A 4NJDA 5EQPA 4GT4A 4O96A 2X9EA 4U0IA 3V6RA 4D9TA 3GU6A 3DPKA 2BTSA 5AP4A 4QNYA 2VZ6A 4FTOA 3MA3A 5GIPE 5IISA 4S34A 3W2RA 2V5QA 3NAXA 3KY2A 3QTRA 3QRKA 4ZSEA 3TV7A 4CNHA 3COIA 3JPVA 2WOTA 4FX3A 4PY1A 3LQ8A 4XP0A 4W9WA 3DBEA 5IA2A 3FI8A 3IW4A 2NO3A 4LOQA 3EMGA
chains in the Genus database with same CATH superfamily
2O5KA 4NM7A 4C3FA 4C35A 3O8TA 2XEZA 3P7CA 3KVXA 4DF3A 4H1MA 4BDJA 4BTJA 3NRMA 5DFPA 2UVZA 3OCSA 3ALOA 2BAQA 4CMOA 3CQWA 4R8QA 3QTXA 3JR1A 2W1EA 2EXEA 2IZTA 5L8LA 3QQFA 2YM4A 4YGAA 5HIBA 5HLPA 3V5QA 2BAJA 2QODA 3LJ1A 4CXAA 2A2AA 1IR3A 4CRLA 2UW9A 1UA2A 3KN6A 4S30A 5HO6A 3CKXA 5M57A 3IO7A 3ROCA 3UOLA 4F99A 4F7SA 3TNPC 1ERKA 3CD3A 4FKGA 4FV4A 2CNQA 4AUAA 5IH5A 3UQGA 3WBLA 4WUNA 3R9NA 5D7VA 2PTKA 3BRBA 2W4KA 2XMYA 3D5VA 4FKUA 2YDJA 3A99A 4O0RA 2XNNA 4LFIA 3GU7A 4E6QA 2I0YA 4NWMA 3IPHA 2OH4A 2UZWE 3W10A 5KMMA 2CNVA 3R00A 3S1HA 4G16A 3AG9A 4NM0A 4GV1A 4KS7A 3BYSA 1BUHA 2X6EA 3E3BX 4Z7HA 4P4CA 4QMSA 2WFYA 3QWKA 1H01A 1U54A 3QTQA 4K6ZA 3DAKA 4D4SA 5L3AA 1ZZ2A 1XKKA 3F3VA 3MY5A 4I41A 4QMVA 4ZSJA 1OKZA 4RIYB 1H1RA 3TXOA 4AAAA 5FEQA 4IANA 2O63A 2XVDA 3KEXA 4BJJB 4PMSA 1FBNA 4QMZA 4W4VA 4C7TA 1ZYSA 5E8SA 2OJJA 2QO7A 4MBIA 2VTOA 1WBTA 3TV6A 3U6HA 4WO5A 3R9DA 3CXWA 3ZLSA 5D1JA 1UKIA 3EIDA 3EQDA 4HNFA 4I23A 4CTBA 2Z2WA 3TTIA 4BYIA 3QXPA 3OG7A 2YABA 3UO4A 5JFXA 3VS2A 4RWKA 3QD2B 2GQSA 2VN9A 3VUMA 3MVHA 4DN5A 1JOWB 5BUJA 4M12A 4O2ZA 4FTQA 3FKOA 2G2FA 4F1OA 3VUGA 2I0HA 3R01A 4TYGA 4XMOA 3QA8A 2WMRA 3PVBA 4BBEA 4QQ5A 4KUJA 1G8JA 4DLJA 2I0VA 4HYIA 4DTKA 5L8JA 3LQ3A 3G6HA 3TKUA 4CQEA 2IO6A 2ZJWA 3F5XA 4W4WA 5HZNA 4MXAA 1XH8A 3Q3BA 4PDSA 4AXCA 4DEAA 3W0SA 5G6VA 4RVLA 4KBAA 1XJDA 3BHHA 4R5YA 3FV8A 4FKIA 4QYYA 4WG3A 2JEDA 4RC2A 3F3ZA 3EQCA 3HV6A 4UXQA 2OXYA 2QHMA 4AGWA 4J1RA 1PXPA 2EWAA 2WTVA 3VUIA 4MXXA 5JQ5A 3EQGA 1OL6A 5M51A 5M08A 1UU3A 4EOOA 1XH7A 2Z60A 3S2PA 3M42A 3P5KA 2GNLA 3R63A 3LAUA 3VW8A 1JLUE 2C3IB 4EUTA 1AGWA 3MFRA 5EDQA 4KAOA 2FUMA 1V0PA 4K0YA 3O50A 3W0QA 4FK3A 3NUSA 4C4JA 1J7IA 3A8XA 2C68A 1U5RA 2ZM4A 2E9UA 2RFDA 3UNKA 4MTAA 5ITAA 5CU6A 1AQ1A 4DC2A 4EOLA 5CSWA 3FAAA 4I24A 3ENMA 4ACHA 4QMNA 3ATSA 4RJ7A 4ITJA 2Z02A 4HGEA 1XO2B 4A06A 4O0WA 4G6NA 3JY9A 4UB7A 4G2FA 1OIYA 4UMQA 3ZEWA 1YOMA 4LGDA 5LMKA 4WIHA 1CTPE 2C3KA 1Q3WA 4KABA 3W32A 4A9SA 2X4ZA 5M53A 2OZAB 1K3AA 3LXPA 2R7IA 4LV5A 4ZTMA 1JWHA 2WMSA 3OEFX 4CFXA 3E88A 4K1BA 3ZO2A 4CZYB 5JT2A 3AKLA 4AW5A 3UE4A 3WZEA 4AA5A 4FV9A 4BCOA 4B4LA 1FVTA 2OK1A 2QOLA 2WTCA 1S9JA 3LZBA 4CMUA 3LFCA 5H9BA 3E7VA 5TOZA 3ZLXA 1F5QA 5I4NA 3PLSA 2WOUA 4YBKA 3BLAA 2HXQA 3AD4A 4L7SA 4CFMA 3SG9A 4PMMA 4WSQA 5ANGA 2BHEA 2RG6A 1L3RE 2IWIA 2R64A 4FKSA 1IRKA 4EONA 1BLXA 3GC7A 2YM8A 2OJGA 2UW7A 2R3NA 3PXRA 1KOBA 5J1WA 4WT6A 2OFUA 4F7NA 2WTJA 4YTCA 2WD1A 4USDA 2F4JA 4QYHA 3A7GA 3OS3A 3LLAA 3Q9WA 4JAJA 5LVOA 5FM2A 1AD5A 2PZPA 2CN8A 2VWIA 4HJOA 4RT7A 4EKLA 4N57A 3OY3A 3DLZA 4I21A 3T9TA 3QF9A 3IDCA 3MH2A 5ACBC 2X2LA 5IEVA 4FYNA 1QPCA 3GUBA 3A62A 4DEDA 1OPJA 3SHEA 3UNJA 4CV8A 4XUFA 2ZOQA 2XIRA 3Q6UA 4IVBA 4YLJA 2IF8A 3PY3A 3KA0A 5E92A 3HLLA 4YP8A 3VBVA 3IW5A 2NRYA 5IPJA 4C8BA 3PIXA 4AXAA 4O84A 1ZMVA 3C50A 3TNWA 2JKOA 3A4PA 4E20A 4NW6A 4C57A 2BRMA 4X0MA 1MP8A 2WZJA 3AC4A 4UALA 3MVJA 4HYUA 3RHKA 3UTOA 2GPHA 4RX9A 3MS9A 4DEEA 4E4XA 2BR1A 3NYOA 3Q5ZA 3HGKA 5C4KA 2QLQA 4OTQA 4K2RA 3LCOA 5AV4A 5JFVA 1H26A 2PMIA 4OTPA 5CT7A 3L9MA 5C9CA 5JGBA 3CKWA 4XLIA 5HG5A 3GC8A 5CSXA 4BTFA 3NFGB 2QLUA 2W4OA 4DG3E 2O8YA 2BFXA 3GCPA 2JLDA 4YZDA 1UNGA 4XBUA 2P3GX 3BLHA 1RDQE 2P2IA 2XA4A 3F7WA 4U6RA 5FD2A 5CNOA 4I5PA 4M13A 2VO0A 3OP5A 2HZ0A 3V6SA 4RPVA 3EOCA 1ST4A 2BUJA 3C9WA 5IUIA 3ACJA 5DOSA 5CXZA 1Q8YA 5KMJA 2C5OA 3U9CA 4A9TA 3MB7A 4J99A 3EQPA 2BCJA 4IIRA 4O0YA 1LP4A 2ZAZA 2XKFA 4GT3A 4QMOA 5JEBA 2GFCA 4BDCA 4R1YA 4DEHA 3BHVA 4WNOA 3PP0A 2JAMA 5HOAA 4Q9ZA 5DE2A 2NRUA 3NLBA 1Q4LA 2H8HA 3MH1A 5HG7A 4FBXA 3HV5A 3OTVA 3FWQA 4P5QA 4NM3A 4A9UA 2Y6MA 1FMOE 2A1AB 1RJBA 3WF5A 5C1QB 2IVTA 4WG4A 1A06A 4OUCA 4FIGA 3ZUTA 4C4HA 4E7WA 2PZRA 4AE6A 4HCUA 2C6OA 4USEA 4JX3A 4YNOA 2B52A 3GCUA 4J97A 4Z7GA 4KKGA 2E9VA 2W1GA 4P2KA 3W33A 5IQCA 1FOTA 3Q53A 4ANOA 2HW6A 3LFBA 3UPZA 4WRGA 3COHA 3VS1A 2R5TA 4IEBA 1H1QA 4EQMA 1Z5MA 3UG1A 4FSMA 4CCBA 5IA5A 4F6UA 4DCAA 4IH8A 4EQUA 1OMWA 4YPDA 5L4QA 5CU2A 3RPYA 4FNYA 5K5XA 3QD3A 2ZDTA 4I5MA 3GU5A 3JYAA 4LRKA 4YJUA 4C4IA 3S3IA 2CMWA 4AT4A 5C8MA 2BZJA 1OBGA 3GCVA 2QURA 3KK9A 3P23A 3CGFA 4HZRA 5AUVA 3OUKA 1PXJA 5GZ9A 1TQIA 5IKWA 4AX8A 3ACKA 2WTWA 3GOPA 5E8YA 3UBDA 4L9IA 3BL9A 1UNHA 2ITOA 2HENA 4MYGA 4LGHA 3Q52A 3D14A 3QX4A 3CIKA 3MPTA 4CT1A 3EZVA 5CALA 4BBMA 3VS0A 2VX0A 4EQCA 1DAWA 3THBA 4RJ4A 2XK7A 3PTGA 5CQUA 1OM1A 3PA3A 4IWQA 5AP1A 4GS6A 3SKCA 4ZLYA 3LKMA 4BR3A 4IZ5A 4ZTSA 4YUQA 4DHJA 3ORMA 1PXOA 4C33A 5AAFA 4FZDB 1BI7A 3VQHA 4NUSA 4U5JA 2FSTX 4D1SA 3FJQE 3MFSA 4IX5A 3PWDA 4NL0A 2QOKA 1V0OA 4D4YA 4IB5A 1FINA 3M2WA 4XX9A 2GNJA 5E8ZA 3TUCA 3CY2A 4NM5A 2P4IA 2G2HA 4BI2A 5IQAA 1OL5A 5L2QA 2QOIA 4RC4A 3BHTA 3OY1A 3MJ2A 3RZBA 2YIXA 4UV0A 4U44A 1KE6A 1Z57A 1PMUA 4RRVA 5JZJA 5GJDA 4FV5A 3AMAA 1M2QA 4NKSA 3ET7A 3MFUA 4APCA 4DFXE 2E9OA 2ITTA 4NTTA 1WZYA 2PVJA 4UMPA 3DQWA 4OAUC 4OTRA 4PTEA 4CFVA 1Y6AA 3G15A 3BV3A 4QP4A 1OKVA 4PMTA 3R8VA 2X7FA 1YOLA 2ZB1A 3UIBA 5CEQA 3I6WA 4F70A 2Y6OA 3FSFA 4TXCA 4FEXA 3CJFA 3TNHA 3QA0A 2YZAA 3H0YA 1CDKA 2WMVA 4QNAA 5FM3A 3K5VA 2UZNA 4PQNA 2FA2A 1BKXA 3FC2A 4AZFA 4HGSA 1WVXA 3CJGA 3Q5IA 1E1VA 4EOKA 4EWQA 3CTHA 3T9IA 5A54A 4NIFA 2V55A 4FR4A 1JKLA 4FVRA 4G5PA 5CNNA 5I9WA 2PULA 4ZTRA 2CCHA 5AMNA 3NMUF 3QCYA 4WNPA 4KKHA 1WBVA 5E8VA 5E8TA 2WIPA 2GQRA 3A7FA 3UJGA 5A14A 3LCSA 3WF8A 5AEPA 2W5BA 2X6DA 1PKGA 3RNIA 3VW6A 1KWPA 2FSLX 3R9RA 2X1NA 3TZ7A 4QEBA 3KXGA 5CVHA 3TZ8A 5GZAA 3I0QA 5ANKA 3HECA 4S32A 2YLFA 4HVGA 2Y9QA 3E8CA 3WF7A 1Q3DA 3BELA 4QP2A 4I93A 3EB0A 4DITA 5T3QA 3ZO1A 2XK8A 3QTSA 3VULA 5M09A 2J90A 4LOOA 4U97A 3POZA 5FDXA 3DB8A 2YCSA 4AXEA 3KXHA 2VTIA 3BYVA 3ZZEA 4IX4A 3HEGA 2PL0A 4MAOA 3C0IA 4BGQA 3T8OA 3DKOA 2PZYA 3BX5A 5AADA 3F61A 3VN9A 2UW3A 4QP7A 1SZMA 4XV9A 1Q41A 2EB3A 1RW8A 4IB0A 3NCZA 4J96A 1U4DA 2BTRA 4HCVA 1UKHA 2UV2A 4FEWA 4EH6A 2Y4PA 3C4WA 4OT6A 2J5FA 4XG4A 3ZC6A 5E7RA 3V5TA 4FTUA 2I7QA 2HOGA 3KF4A 5HVYA 4YZMA 3ROYA 4F0GA 5LMAA 5EYKA 2WAJA 4ZSAA 4IWDA 2IW9A 4J7BA 1MRYA 4EHEA 2VO3A 2JIUA 3QYWA 4O2PA 3I81A 4JDIA 4QQCA 4N4SA 3AKJA 1JPAA 4AT3A 3B2WA 3BWFA 3RAKA 4AQCA 1P5EA 5DMZA 4E5WA 4JMQA 3PSBA 3POOA 3QTIA 3UYSA 3QC4A 3MVMA 3FL5A 3NAYA 4X2GA 3O51A 5HU3A 5IQHA 2QOBA 3BE9A 2CGXA 4YJQA 5IG1A 3AC8A 2W96B 2BRNA 3C0GA 3I60A 3W0NA 1HOWA 3A7IA 4R3PA 5DA3A 5FUTA 4E4NA 1ZWSA 3U51A 4OAVB 5B7VA 3H4JA 4BKZA 1OL7A 2B53A 2X0GA 4O82A 3TN8A 4GJ3A 2WQBA 4FSUA 4OTDA 1XWSA 5HO8A 4C59A 4JRNA 1YRPA 4RA4A 5HQ0A 4ORKA 4J53A 2BALA 4FSRA 4IC7A 3G33A 4Y5QA 5KZ0A 4D5KA 1K2PA 2VWZA 3MB6A 2JFMA 4IVCA 5CF4A 4O7YA 2WQOA 4U79A 4LMNA 1WVYA 3KVWA 3OCBA 2JD5A 3LFEA 4D0XA 1O6KA 4QO9A 4X2FA 4AFJA 4GG7A 2XNPA 4RJ6A 3B8QA 4CLJA 3MY0A 3V8TA 2VD5A 2ZV2A 3R7UA 4EK5A 3BYOA 2QNJA 4ZIMA 4O7VA 1ZARA 5DN3A 4FT7A 3LVPA 4I6HA 5T68A 4JDJA 2XF0A 4JDKA 3SOAA 5DVRA 3RPRA 2W1HA 4E6CA 5KBQA 4QYFA 1WBPA 1YXXA 2PZ5A 2B9IA 3QBNA 5CXHA 4W8EA 2JKMA 2CSNA 3ORTA 4GFMA 4H3PA 1APME 2ZV9A 4N70A 2VNYA 1YXTA 3NYXA 5FG8A 2YN8A 4MXCA 4ARKA 5JZNA 2XJ0A 5BX0A 5ETIA 1G3NA 4ANQA 4F9AA 2BKKA 4MVFA 4DAWA 4JQ8A 3RWPA 3WZKA 5B2MA 4DEIA 4QRCA 3ALNA 3D5UA 3G6GA 2WTKB 3PLAE 3C4ZA 4Y46A 2PVKA 2HZ4A 2XS0A 5A6OA 4EH2A 1OZ1A 5CZHA 5B2KA 3IQ7A 4U81A 3ZLWA 3W2SA 3ID6C 1OKYA 3W2CA 4UXLA 1OBDA 2SRCA 3H9RA 4L3PA 4J52A 2QI8A 2XK6A 4OTFA 4TYHA 5H2UA 4O81A 2PYWA 1CKIA 2GHLA 2I6LA 3PSDA 4MKCA 2XH5A 2LGCA 2OXXA 5B2LA 1O6YA 4D2TA 4EC9A 4CGAA 4KIKA 1HCLA 3GCQA 4IAZA 3V51A 4FT5A 3RPOA 1QPJA 4FG9A 4JJRA 3ZBXA 4L42A 1Q8WA 2YCRA 2R3KA 5CY3A 4DINA 5A4EA 5HD4A 2BKZA 4F9YA 5A4TA 3AD6A 1YDRE 5JGDA 3ITZA 3HUCA 3RK5A 3KULA 4OBOA 4W4XA 2UZDA 1BMKA 4GT5A 4NCTA 2CPKE 4Q5HA 4M69A 4CD0A 4AF3A 2YM7A 2WMXA 5B0XA 1OGUA 5CLPA 4AG8A 4B8LA 5EH0A 3LCTA 3D5WA 5ANDA 2XAOA 4EBWA 5FXRA 5KMOA 3LJ0A 3DS6A 1OPKA 5BVWA 5F94A 5CEIA 3TNQB 1TQPA 3GEQA 4FIHA 4MBJA 2YACA 4ITHA 3UC4A 3ZO4A 4EC8A 2CLQA 2IZUA 4C3RA 3LXLA 2B9JA 4FSWA 1PXNA 4O21A 4OBQA 3DKGA 4BCMA 4BZOA 3FQEA 2X8DA 2ETRA 4FSZA 4PWNA 4ASZA 1TQMA 1P4FA 1YW2A 2WO6A 4H3BA 4M67A 4UYNA 1A48A 1W83A 4W9XA 2DS1A 3O96A 3UZPA 5LCKA 3IDPA 3UNZA 3GNIB 3NWWA 2BRGA 3WYYA 4HVSA 1BL7A 1VEBA 2XALA 5M06A 3R02A 3P9JA 3QFVA 2GTNA 3RAIA 3QQUA 2ITUA 4GSBA 4H39A 4L8MA 4I4FA 4QTAA 4S2ZA 3R8PA 4CFWA 2CLXA 5BVOA 2IW6A 5FRIA 3UMWA 4QTEA 3E62A 4QP1A 2OF4A 4FYOA 2VGOA 4YO6A 4PNIA 2VO6A 2UZOA 2WGJA 3QLGA 5M56A 3R1NA 5AV3A 3R0TA 4O91A 3RCJA 4FMQA 1H24A 3AD5A 1GZ8A 4JIKA 2XNEA 5C27A 3D4QA 1WFCA 4BDGA 5HLWA 3P5JC 4F63A 3W16A 4GKHA 5HVJA 5C01A 3ERKA 3DXPA 5F4NA 5A9UA 1OIRA 4HPUE 2C1AA 1L8TA 5J5TA 5BVFA 2JDRA 2YCFA 4WBBB 2QOHA 3ANQA 4EH4A 1CKJA 4R6VA 4G1WA 1OUKA 1JVPP 4JBQA 4WOVA 5CX9A 3PA4A 2PVFA 2O0UA 2W99B 3FZ1A 3Q60A 4BI0A 4E6AA 4FKVA 5D10A 1GY3A 2R2PA 4FICA 2IVUA 2BDFA 2PVLA 5DT4A 4CRSA 2C30A 4TNBA 4TKSA 5GZ8A 3O2MA 3U55A 1M2PA 4ZK5A 1J1CA 4IZAA 5C8NA 5JMSA 4LDTA 1Y8YA 1GJOA 4I1ZA 4APPA 3BU5A 4YJSA 3CTJA 4ALUA 5LVMA 2VV9A 2WKMA 3AXWA 4IM3A 4BCPA 3H9FA 2PUIA 2BPMA 3CSVA 1YVJA 4XV1A 5TR6A 4XJ0A 2WHBA 4K9YA 3BBTB 3W2QA 4L46A 3UO5A 3R21A 3E63A 4MD9E 1B38A 5L2SA 3FMJA 5JKGA 2UW8A 2VTMA 3VBTA 4F9CA 3IDBA 1URWA 2QU5A 2PZIA 3HZTA 4IAYA 3UQCA 3K3IA 2Q0BA 4XHKB 5E9EA 4GUEA 3W0RA 4IBMA 3ZC5A 3ZONA 3QKKA 3MGYA 4K8AA 2PUUA 1XQZA 2W5AA 2HWPA 3ZDUA 3NYNA 4QMLA 4MQ2A 3O7LB 5CZIA 3TMOA 3QXOA 5BUIA 4NFNA 3NNXA 4ZS0A 2XZSA 4O7WA 3W8QA 5DT3A 4FKJA 3NYVA 1XH6A 5HCZA 4F7JA 4DE4A 4XNEA 3RWQA 4YTIA 2LAVA 1J1BA 2Z7SA 2R3FA 4QPMA 2Z7QA 3PJ8A 2W5HA 3NUNA 5AP5A 5CEOA 4BWXA 4OLIA 4DBXA 3D83A 2CJMA 4YZ9A 4ACGA 1DS5A 2QCSA 3RTPA 4ACCA 4E5BA 4IB1A 3DB6A 4MK0A 4NSTA 5CSHA 3V5WA 4FTTA 2QO2A 3GQLA 2CN5A 3DXNA 2HW7A 1OB3A 3TKIA 4I6QA 3TUBA 2QOFA 2XK9A 2ETKA 2UVXA 3EL8A 4FK6A 1J7UA 3PY1A 2CKPA 3EQBA 3FDNA 4M0YA 5HIDA 4AZSA 4X21A 1ST0A 1XH9A 4JG7A 1SYKA 3WF9A 4RZVA 5EW8A 4ANLA 4F0IA 3D7ZA 4FV7A 5AR4A 4CG9A 4JG8A 4YHTA 4RJ8A 5AP3A 4F1TA 3ZTXA 4JOAA 4UX9A 2VTSA 5M44A 3BQCA 4Y85A 4KKEA 5G1XA 4ZLOA 5K0KA 4DFYA 3C7QA 3DAJA 3ZXTA 4ZY4A 3R7GA 3VRZA 4ACDA 4X3FC 2I1MA 4MNEA 5FXQA 3FL4A 3AT3A 3KC3A 3MDYA 4HCTA 4BCKA 2VWYA 2XYNA 4ZSGA 5I3OA 4N6YA 4B0GA 2R9SA 2VX1A 3DBFA 3G5DA 4BCQA 4D2WA 3ZSGA 1J7LA 3UVPA 2KULA 2IW8A 5BMMA 3R28A 4FSQA 2ITZA 2REIA 3GU8A 4LQMA 1UV5A 3FMDA 3L8VA 3ORXA 5ACKA 3GFEA 4AAYA 4IE9A 4ENYA 3P78A 2G15A 4QMPA 1ZXEA 2E9NA 2WU7A 2XK4A 4B99A 4TW9A 4P90A 4S33A 5A3XA 2CGVA 4AWIA 4Z16A 1H27A 2JFLA 4PDOA 1P2AA 1OIQA 1S9IA 4K33A 4V04A 2XAMA 2R3GA 2FVDA 3LW0A 5ANIA 4X6QC 3RAWA 3ULZA 2C1BA 4YMJA 5IEXA 1OIUA 3F2RA 3G90X 4O7TA 5CSPA 4IM0A 4HVHA 2OJ9A 1ZAOA 5DPVA 1Q62A 2C6EA 1GZOA 4FV6A 1H8FA 3R2BA 3PXYA 4AN9A 5IUHA 4IFGA 5AP6A 1RQQA 3VBXA 1H1PA 2F2UA 2ITXA 1MRVA 4XRLA 5K0XA 2YJSA 3WE4A 5M55A 2VWXA 3C4CA 4ITIA 5IQEA 3QZIA 2YM6A 4GIIA 4FEUA 2YIQA 2HY0A 2JDTA 1IA9A 2UZEA 4A4XA 3WZUA 3QKMA 1CKPA 3W55A 4FV1A 5D9HA 4YNEA 2CDZA 2J5EA 2VRXA 2W1IA 4GU9A 2H9VA 3CD8A 3D9VA 2RFNA 1K9AA 1LEZA 3COKA 4E5AX 4XG3A 4EOMA 1W0XC 4KIOA 2OIDA 1Q8UA 4G34A 4I0TA 1WVWA 4QT1A 5CI6A 4C2VA 3K54A 4D55A 3CQEA 1WBWA 5IQBA 4DFUA 4YJOA 2C3LA 4G9CA 3FZRA 4KRDA 5IQIA 3AC3A 5TKDA 3Q2MA 3R7YA 3REPA 1TFFA 2R4BA 4ASEA 2ACXA 3MY1A 3QCXA 4PL4A 4ERWA 5HEZA 4PP9A 2FGIA 1VZOA 1YHSA 3UVRA 1G8KA 4Y5HA 4BICA 1ZYCA 2ETMA 3R8ZA 3LMHA 4AS0A 3UG2A 3DA6A 4D0WA 3DU8A 3BLRA 5HVKA 4KBCA 2Q83A 3R30A 4IXPA 3DLSA 4IM2A 3R7IA 1YDSE 3QTZA 4RQVA 1XH5A 3V5JA 4FTIA 2C6TA 3FZTA 4CFUA 3VAPA 1TZDA 1WAKA 4AGUA 3OTUA 3QU0A 2HY81 4E4MA 3PG3A 2R3JA 4O0UA 5EFQA 3RVGA 4C58A 1U54B 2XCHA 4I4EA 5I0BA 4D2PA 5KMKA 4CG8A 3S95A 3C1XA 5CVGA 1OKWA 3RHXA 4M15A 2W17A 4ANSA 4FG7A 2X7OA 3DOGA 4Z55A 1R78A 3II5A 2NP8A 5IA4A 3CPCA 3UZTA 3EFWA 3QQHA 2XYUA 4IJ9A 3G0EA 3E93A 3NUYA 2QG7A 3KRXA 1FQ1B 5EI8A 2C5NA 3WOWA 4XCUA 4AQKA 5FP6A 4XH6A 4YO4A 1PXIA 3LFNA 3ZDIA 5GJFA 3KF7A 2QVSE 2X9FA 2XJ2A 2R3RA 1E1XA 1CM8A 2G9XA 1ZYLA 3ETAA 3D5XA 2Z8CA 3E64A 5AP2A 2VAGA 5BUEA 5DBXA 4QMUA 3QZGA 4O7SA 5AV1A 4O7RA 2ZYBA 5GINE 3BPRA 3BEAA 4YPSA 3LFQA 1W2FA 2WTDA 2CKEA 3RZFA 4FNWA 4F0FA 2V22A 5KX8A 2BMCA 3EJ1A 5CF5A 4FVQA 2QHNA 2NPQA 2UW6A 3EZRA 4TY1A 4O4DA 5J9LA 1GOLA 5J7BA 3FI3A 2JBPA 2OGVA 2ESMA 2YFXA 1CMKE 3MW1A 4MNEB 5L2WA 2E2BA 4BDEA 4G3CA 4YJVA 3VJNA 2XB7A 1VLRA 3ZU7A 4Y83A 3K2LA 3PP1A 1H1WA 4O4FA 3W0OA 2R3OA 4DFLA 2Y4IB 2FO0A 2ONLC 3FKLA 5JRSA 2X0PA 2Y7JA 3MI9A 3OWPA 4CV9A 2B9FA 3ZSIA 4BBFA 4BYJA 4J71A 4FIEA 5ETCA 3ZRLA 3A7HA 2HZNA 3E8EA 4XYFA 4BTMA 2OI4X 5DR6A 3QZHA 5L6OA 1NY3A 1YXVA 2WB8A 1SVHA 2WXVA 3FE3A 3CC6A 1W98A 5HU9A 2ITYA 5EHYA 4EJNA 1U5QA 5JFSA 3KXXA 3O71A 2QKWB 1G5SA 2J50A 4J98A 3ZSHA 1KV2A 3HMMA 3ZFYA 5CEKA 4IVAA 5FQDC 4H05A 4PMPA 4HGTA 5KMLA 5GNKA 3PY0A 5AM7A 3O17A 3RK7A 4EHGA 2GS7A 3U9NA 4EOSA 3EN9A 3VUDA 4QDEA 3KRRA 4TN6A 4P7EA 4BN1A 1GNGA 4KIPA 3GXLA 3NNUA 1ZOGA 3IGGA 4ANBA 3DY7A 2IJMA 4CFNA 4YHFA 5JH6A 1PW2A 1H08A 5E8XA 4AA4A 4FC0A 3FXXA 3NSZA 2O3PA 1ZMWA 2WIHA 2EXCX 3JUHA 3OWJA 4QPSA 5DGZA 3BU3A 3QCQA 4JLCA 5HG9A 5A6NA 5AUUA 3QD0A 5LOHA 2UW0A 3Q32A 3U6JA 1H4LA 2AC5A 1PRYA 3IONA 2VWWA 2PE1A 3FXWA 3LMIA 3LFFA 5I9XA 2ZV7A 4J8NA 2W05A 3A4OX 3DNEA 4V0GA 4EYJA 4HW7A 3D7TA 4MX9A 1I09A 4WRSA 4G3EA 4YZNA 3CBLA 3UGCA 4C02A 3EL7A 1WMKA 3MSSA 4HYSA 4FT0A 3U4WA 4GK3A 2XCKA 2J0IA 4NT4A 2OW3A 4UZHA 5AUTA 3TM0A 3UP2A 2RL5A 3C5IA 1R39A 3HVCA 2XIYA 4FIFA 2J0KA 4TNDA 4DGLC 3OCTA 3KB7A 5CAQA 1KOAA 1PYXA 4IVDA 1OPLA 2UZLA 1OL1A 4YSMA 4EI4A 2GU8A 1H07A 4RIWA 2YERA 2YITA 3P86A 4ZMEA 5C03A 2OIBA 4H3QA 2BZKB 4R5SA 4JS8A 4ZMFA 2XIKA 2RFEA 4KWPA 4CEGA 4R78A 2O65A 3DBDA 4XOYA 3SV0A 4H1JA 4ZP5A 4RBLA 1MQ4A 3Q6WA 2Y8OA 3BHUA 5M4IA 3GC0A 3GFWA 4PRJA 5ICPA 1W2DA 1IA8A 2R3IA 5EM5A 3VQUA 1O9UA 2WMTA 3UQFA 2J9MA 5A4LA 2AC3A 3NUPA 2XKCA 4NZWB 5F95A 3ENHA 1QMZA 4ZY6A 3I7CA 4LM5A 1LEWA 4EZ3A 2XP2A 3VF9A 2C5XA 2G2IA 3HDMA 3VS7A 5LXMA 4AXDA 5E1EA 4L68A 2WQMA 5DHJA 4GFGA 4RIXA 3WYXA 3RNYA 4S31A 5CSVA 3TTJA 3SXSA 5LVPA 4ZJJA 4FF8