4IX6A

Crystal structure of a stt7 homolog from micromonas algae soaked with atp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
346
structure length
346
Chain Sequence
LKARGGPKTLRRTPGVEPKDIRVLPGPLGSGNFGTVFRGVFKGDQDVVLKNAKADVMAAEELLECEMDVNYHVHANAKGTCARFMGCIELGAKDGGEIYNGTLTEGLWLMWANEGENTVEALMRRGTAPLATAMACADATELGVTKKAMRELLGSLARLHECGVVHRDVKPANLIAAEKDGGVLKLIDLGAAALCLPLPETLNYYPGDGPADPRYAKADELYLLPPGSPRPTKDNAAKLWEAHKPDRFDSWSAGCVMLQLAVVGLRTDAGLERFLADYKAVGYDVNAFRGEKSGEYGTMDFAALDANGGAGWDLCQRLMEAERDARASCEAALSHAFFDAAALEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the catalytic domain of a state transition kinase homolog from Micromonas algae
pubmed doi rcsb
source organism Micromonas
molecule tags Transferase
molecule keywords MsStt7d protein
total genus 106
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ix6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ix6A01
4CCUA 5L4QA 2PE1A 3FKOA 4QP9A 4YHJA 4DFYA 4HYIA 4M84A 4E1ZA 4OTRA 4QYFA 3P9JA 1ZMVA 4QYYA 2X7FA 3TNWA 4USEA 1YHSA 3MVLA 1KUTA 5TE0A 3FKNA 4PUZA 5HE1A 4E4MA 2ZV9A 4F1OA 3HVCA 4FK3A 3WE4A 3QXPA 5CAVA 1Y8GA 4F63A 1JNKA 4BTKA 1KSWA 2JAMA 3UG2A 2A1AB 4ANNA 1A9UA 4M0ZA 4XYFA 5E92A 1OKZA 1OZ1A 3O17A 5JMSA 2V55A 3I0QA 4FT0A 4AU8A 3PDTA 3ATSA 3RTPA 5BVNA 4XX9A 4ID7A 1L3RE 4D1XA 2YIYA 3DBEA 5AIKA 5LCKA 3ZM4A 2VN9A 2X7OA 4DYMA 5CXZA 4C57A 5HVKA 5A46A 4H1MA 4JVGA 4AT4A 3PWDA 1OM1A 2JLDA 3Q32A 4QYHA 4XBRA 4BKJA 3S0OA 1M7QA 2BFYA 2UZOA 4BICA 3TUDA 3QTIA 3VW6A 2PK9A 4WT6A 5HZNA 4Q9SA 4M14A 1I44A 3SXSA 4M0YA 2R7IA 2ETRA 2YLFA 4W9XA 4EOQA 3WF9A 3R7IA 2WU7A 3PG3A 2VWBA 3I79A 1BLXA 3QTSA 4X2KA 3QHRA 4DFBA 4FSRA 3GNIB 4IAZA 4MWHA 4OBPA 5BVEA 4N6ZA 2H9VA 5T6KA 5AIRA 4EOIA 3QQUA 4FTKA 1PKGA 5GZ8A 4FG8A 5FP6A 3EQBA 4DCEA 2JFLA 3DK7A 3T8OA 1PMVA 4BCOA 4RC2A 4Q9ZA 4FC0A 2W96B 3FI2A 5KMJA 4I6HA 5FEDA 1H8FA 4N70A 3O7LB 2JKQA 4O1PA 5EQEA 1OIRA 4OLIA 2W5AA 4O7NA 3POOA 5BUJA 3LKMA 4C38A 3M2WA 4TYIA 3HMMA 4FYNA 2FSOX 5CEIA 3U9CA 4OAUC 1LUFA 4FV2A 2WTKB 3AT4A 4PRJA 5H2UA 3FLSA 3MVHA 3V6SA 1AD5A 3LZBA 5L8KA 4YBKA 3RINA 3FPQA 4CEGA 4CFNA 4TNDA 4EBWA 4IB0A 3FHRA 3HA8A 4QNYA 1WVYA 3OOGA 4AQCA 4X2GA 3O23A 3PJ2A 5HIDA 4V01A 5F20A 3RNIA 4QMQA 4KB8A 2J4ZA 1J7IA 3CIKA 4AWIA 4C4HA 4DC2A 2FA2A 4E26A 4BBMA 2VZ6A 2WMTA 2HZIA 2ITUA 3FC2A 1LPUA 3AMYA 2QOHA 2BFXA 2VTAA 2W1FA 2Z7SA 3LIJA 4C37A 3C4XA 4X3FB 1NY3A 1QL6A 4L01A 3PYYA 2F2UA 3E8NA 1V0PA 2EB3A 3GCVA 4O84A 4W9WA 3GENA 4FE2A 3VBVA 5LVOA 4JXFA 4UWYA 4APPA 4IX3A 4R8QA 5I3RA 4LV5A 3P5KA 4JT3A 4O0WA 4AT5A 4II5A 3Q3BA 4H3BA 2OZAB 4LYNA 3R8LA 3UQCA 4BYJA 3PUPA 5ACKA 3UOJA 5LJJA 3MIAA 5KHWA 2WMSA 4GU9A 4YJRA 3ZRKA 5JK3A 3I6UA 4CLIA 4C4GA 2VTQA 5L2QA 2AC3A 2WTKC 4RMZA 2F7XE 1JOWB 4F7NA 4GVJA 2CSNA 2C4GA 4CMTA 4IJPA 1NW1A 2CDZA 5ANKA 3C51A 3QTUA 2WOUA 3SLSA 4XG4A 3VF9A 5TKDA 3DU8A 1XH4A 3BHTA 4FV0A 4ZOGA 4D2RA 2PZ5A 3ET7A 4FTJA 4FTRA 4PY1A 4NCTA 1OITA 1K9AA 3FUPA 3G6GA 3H4JA 4L3LA 5DR6A 4D2VA 2QD9A 3A7IA 1ZOHA 5FD2A 3DTCA 3E8EA 5FXQA 2J0IA 2RFDA 3VNTA 4B6LA 4RC4A 4GT4A 5B7VA 3A8XA 2PUIA 4U3ZA 1OIQA 4C58A 2VUWA 1P5EA 3KCFA 4OBQA 4ZJVA 4QMOA 3GCPA 1UWJA 3T9TA 2CGUA 3DJ7A 3NW5A 1NVRA 1AGWA 3DKOA 1ZMUA 3F7WA 3I7CA 2X6DA 4LI5A 4RIYA 4CZUA 2GMXA 2XA4A 2BMCA 2YN8A 3DBQA 5ANDA 5EFQA 2R3JA 2Y7JA 4R3PA 2BILB 5AR7A 4AUAA 5AUWA 3RPVA 1YWNA 2V5QA 2PVKA 4DH1A 1QMZA 5GZAA 1FINA 2PVMA 3U4WA 2VNYA 5CAQA 4O1OA 2PZRA 5J95A 4BZDA 3THBA 2J0LA 5AP7A 3U4UA 5FDPA 4QTEA 2Y0AA 3FLWA 3F3WA 4RA4A 2UZUE 2XK3A 2Y4IC 3OMVA 3V5WA 3ZHPC 4ZY5A 5F95A 4KIQA 1Q3DA 2ITOA 4A4OA 5CF4A 1YI4A 5EI2A 3JXWA 5CQWA 3KREA 3KN5A 1YRPA 1OECA 3KEXA 3IQ7A 3COHA 4U44A 4DGOA 2YM4A 4DEHA 3C7QA 4USDA 4G17A 4D1ZA 3QBNA 3WZKA 4GFOA 4XG8A 2R3KA 3FLYA 3I5NA 4XCUA 2VWZA 2PULA 3CCNA 2J0KA 1WMKA 4LL0A 4X2JA 3DXNA 3PP1A 4WNPA 4FT5A 4ZMEA 3BI6A 3C13A 2WHBA 3WF5A 3ZC6A 4FIEA 2UW5A 4J98A 3QZHA 4AZWA 1OBGA 3LXPA 5B0XA 3QRKA 4KS7A 4TY1A 3JS2A 5F4NA 2OXDA 1Q8TA 3H9RA 4ENYA 1PXKA 4BDAA 2C5OA 2PVLA 2PU8A 4GJ3A 2WTCA 3F2AA 3QLGA 4GT3A 4Y5HA 2QR7A 3BV2A 2YDJA 4C2WA 3OFMA 3LMGA 2PVRA 4DHFA 5KMKA 2QR8A 3UP2A 3HDNA 5CZHA 2Y4PA 5KMNA 5JGAA 3RZBA 4B0GA 3BGZA 4PDOA 2QQ7A 4QMMA 3F3VA 4RIOA 4ITJA 1W8CA 4JRVA 3A62A 3CP9A 4FG9A 4ZSEA 2GQGA 3OWJA 4YJTA 5IA3A 4LOPA 4RIWB 2JIVA 3UTOA 4FNYA 2R0IA 2XJ0A 3SRVA 1CKJA 2XVDA 4I92A 4QO9A 4FTCA 5AUZA 2P2HA 3FC1X 1R3CA 3RAWA 1SVGA 3GCUA 3H0ZA 2FSMX 3HV3A 5DH3A 4XLIA 4I0TA 1Y8YA 3Q9WA 5FRIA 4C61A 3P7BA 3ZH8A 5H8GA 2ZAZA 4QTAA 3CGFA 3UVPA 3ZFMA 3IDBA 4D5KA 4UMUA 3QUDA 2QODA 4RPVA 1JBPE 2QLQA 4TWCA 4YC6A 5AR2A 3MN3A 1NA7A 3FXXA 4I93A 4NSTA 3ENHA 3UNKA 1O6KA 4FICA 4NM0A 3TL8A 3C4ZA 4FTLA 3BBWA 3KRRA 3UVQA 4ALUA 4BCHA 4FBXA 4ANLA 4GMYA 4HZSA 5LMBA 4NIFB 4AGUA 3QA8A 4PMSA 3ETAA 5J5TA 5JZNA 3DDQA 1GAGA 4ALWA 2XNOA 1G8SA 4FKVA 5JN2A 3GU5A 5JGDA 4W8EA 4TKSA 3ZBFA 2GSFA 3TV6A 3DAJA 4ANQA 4AFEA 4IZAA 3CTHA 3IGOA 3WZEA 4AW0A 3MGYA 4AZFA 2OW3A 5EM5A 1WAKA 1YDSE 4RVTA 4MWIA 4I0SA 2CCIA 4Y83A 3QFVA 4WD5A 2YJRA 4DT9A 1PMEA 2WMWA 4XV3A 5HE3A 2YWVA 3VHKA 2VRXA 3QQFA 4JAIA 1YXUA 4QPSA 5B2KA 1GZKA 4DCAA 4FZDB 4DE4A 3A4OX 3Q4TA 3ZSGA 2VX3A 5HQ0A 2XJ2A 3R9DA 2B55A 3VUTA 3OROA 2EWAA 3Q2MA 4NIFA 2HXQA 4AGDA 4C59A 2X8IA 4XV1A 2CJMA 2W9ZB 1M2QA 3CJFA 3VJNA 1FGIA 3NR9A 5HCZA 4IZYA 4EQCA 3RZFA 3P0MA 1G3NA 3QLFA 4G3GA 2BRNA 4NW6A 4PP7A 3OCBA 4U79A 2W1HA 2IO6A 4FGBA 4R3RA 3V5LA 4U3YA 2GNGA 4FX3A 5BVWA 4RRVA 4CT2A 3AC1A 1MP8A 2AUHA 2BVAA 2XYUA 4J71A 4XUFA 3BYMA 5CASA 2BAQA 3F6XA 4OTHA 3FMMA 1M2PA 3VW8A 4B4LA 3OWLA 3IONA 3T3UA 4PNKA 2ERKA 4UMQA 3G5DA 3NZ0A 5CU2A 4E8AA 4UALA 1XBBA 4UZHA 4QYGA 4TYEA 3CEKA 4GUBA 3FI3A 5DEYA 3TKUA 1RQQA 2QOBA 4O81A 5IQHA 3RALA 4AF3A 4M8TA 5C03A 3SC1A 4C3FA 5J1VA 2WAJA 4N6YA 5ETAA 3F82A 3SKCA 3FPMA 5C8MA 1PXNA 1ZOEA 4EOSA 4ERKA 2PTKA 3PXRA 4RC3A 2CKOA 3ATTA 4J8MA 5HLNA 5FP5A 3MH3A 2WELA 5ANOA 1REJA 2JIUA 5A4TA 2CKQA 3IECA 1OVEA 3BU3A 3C0IA 2BAJA 2XS0A 5DPVA 4G31A 5B2MA 2JGZA 3E7OA 1ZAOA 4WRGA 2OG8A 3N4UA 2PE2A 5IQFA 3BRBA 3FSFA 2XK7A 3LFCA 2ITQA 2R3OA 3QA0A 3ORTA 5FDXA 1WVXA 4D2WA 1A06A 5IF1A 2FSTX 3UZTA 2YCQA 4TYJA 1J7LA 2ZM4A 2OFUA 2PMNX 4R5YA 3R8MA 4PMTA 4F65A 3O8PA 4I94A 4RVLA 3COIA 2C3IB 1YWVA 4HYHA 2O2UA 4MXXA 4QP7A 1VYZA 2G15A 4AAAA 4O27B 3VQHA 4U45A 3LFBA 3SHEA 3QD0A 5EQPA 4V0GB 5CLPA 1ZY4A 3QGYA 2ZDTA 5AV0A 4P2KA 4YZBA 3PLSA 2OIQA 1U46A 1KWPA 3VULA 4CFWA 1FQ1B 2UW6A 3FE3A 4KSPA 4AN2A 3LFNA 4ANMA 4C3RA 5AM7A 4EHEA 4ZIMA 3N4TA 3ROYA 4RT7A 3H9OA 4PV0A 3SVVA 2E9VA 2C6DA 2YLEA 3MPTA 4JLCA 3WYYA 2BZJA 2QU6A 4M7IA 5LARA 3R9OA 4BR3A 3QD3A 3D4QA 4I21A 4BHZA 3DA6A 4PTGA 4JBPA 3BWJA 5AUUA 3Q9YA 3SV0A 3OXTA 3AQVA 3FYJX 3W2PA 4L8MA 4NUSA 3EWHA 5LOHA 1XH7A 2BROA 4X3JA 2B54A 1Q61A 2AYPA 4IMYA 3NNXA 3NDMA 4KIKB 1KOBA 4OR5A 3D0EA 2UZNA 4FA2A 5ETCA 4AA0A 5BPYA 4YHTA 3CLYA 2JKKA 4FV9A 3RWPA 4HVSA 3VS2A 4UMTA 1V0OA 1U54A 1WBSA 3E62A 4QP1A 3CTQA 5FBNC 5FQDC 5AP5A 4AP7A 1YXXA 5FGKA 5GJFA 3RI1A 2BHHA 2J9MA 3NRMA 4LQMA 2NRYA 3D5WA 5HNBA 3TIYA 5CANA 4NJDA 5FXRA 5AUVA 3G0FA 5LXMA 3MPMA 3QX4A 4KIPA 2F2CB 3O7LD 4FV3A 5D1JA 5CTPA 4F7LA 1WBPA 4NTTA 4EK4A 4U42A 5IEXA 4U97A 2BIKB 4IAFA 5ICPA 4DGLC 2CNVA 3EN7A 4R7HA 3NUNA 3MFTA 4BCKA 3NWWA 2J51A 4RQKA 1KOAA 3G9LX 2PWLA 3ZLYA 5HD4A 5K4JA 2R2PA 2J0MB 3Q52A 4CSVA 2VTRA 4S31A 3PJCA 4BBFA 4MQ1A 3RK9A 1ND4A 2X9FA 3EN6A 3EH9A 2WMVA 3ACJA 3HDMA 5EYDA 1E9HA 4AOTA 3GVUA 1DM2A 1R0PA 5BVKA 4BCJA 2HCKA 4QQTA 3Q4CA 3LXNA 3TNQB 2WTDA 4CVAA 5GJDA 2W1IA 3WIGA 1LEZA 4NFMA 2HAKA 4M69B 3BWFA 5HU3A 4RJ6A 1WBNA 2B9JA 3HRCA 4FZFB 4DBNA 2R3GA 3DS6A 1NVSA 3HV6A 4L42A 5BYYA 2FH9A 3D5XA 3CY3A 2GNJA 4ZSLA 4XEYA 3BGPA 3DKCA 1OKYA 3PZEA 4O83A 1H07A 4IX4A 4UN0C 2V62A 3JPVA 3OTUA 2YM6A 4DTBA 4ZTRA 4OAVB 3UO6A 5I5ZA 4RSSA 5HE0A 4AOIA 2LGCA 3BQRA 4RIYB 4C4JA 1GZ8A 4J95A 4A06A 4JR7A 4DLJA 1PMNA 4S34A 2CLQA 4GIIA 5J7HA 4YZ9A 5ITAA 1JKTA 2VNWA 5IH6A 4BCMA 3HX4A 4OTDA 5L2WA 4E4NA 4NM5A 3CSVA 1Q3WA 3QRUA 1EH4A 3DY7A 4BDCA 2UW0A 3C0HA 3D2IA 3FXWA 1P4OA 3HMIA 3QXOA 4G1WA 4XS2A 3S1HA 2Z02A 1W98A 2ACXA 2XB7A 3KVWA 3NS9A 3TDVA 4FSMA 3IDPA 2YCSA 2HZNA 3MWUA 4HVDA 5HCYA 3NUAA 4RJ4A 4K6ZA 3TTIA 3WZJA 2ZB1A 3RP9A 4FIHA 5JFXA 3CPCA 1PY5A 4JX3A 5IH5A 3MTFA 3HMOA 2ITTA 4FTUA 2QOIA 4GK2A 4ZMFA 4M66A 1UU8A 5I9YA 3Q4ZA 4P5ZA 2RIOA 2VWWA 2F7EE 3R8ZA 4EJNA 2C1BA 2JEDA 2Y8OA 3N9XA 3BKBA 2OXXA 3DGKA 3BE2A 2WOTA 3DKGA 5CAPA 3QTRA 5DA3A 4LRJA 5JGBA 2XK8A 5M09A 4CZYB 5DMZA 5L8JA 1GJOA 3MTLA 4TXCA 4F9YA 4F09A 2XK6A 4MKCA 4IIRA 3UOKA 5D41A 1ERKA 2VTIA 4BIBA 5BVDA 5C1QB 4U81A 4Z16A 1J91A 2JD5A 4WG3A 5H9BA 4W4WA 3E3BX 5BYZA 2BZIB 3NYNA 3Q5ZA 3UMWA 3AC4A 3OVVA 5KBRA 5AA9A 4CKRA 3DNDA 3IK3A 3TI1A 3GU8A 4MK0A 4CXAA 4ZLOA 2XBAA 4JDKA 4K33A 5HVYA 4HW7A 1H1PA 4OT6A 4YTHA 4F08A 4EZ3A 4S2ZA 2QCSA 1W83A 2BRBA 3VBYA 3ZUUA 5HX6A 3NIEA 4C3PA 4E6QA 1M52A 2XBJA 5GIPE 3NPCA 4MNEB 4XV9A 3PY0A 2BR1A 3FY2A 3PRIA 4FKQA 4UYAA 5IUIA 4IC8A 2BPMA 3AD4A 4RVMA 4EBVA 1JQHA 5CQUA 3SRVB 4HCTA 3CC6A 4FT3A 4O0RA 2GFCA 3QTQA 1KE8A 3GC9A 4D2PA 1J7UA 1P14A 3DDPA 3MH1A 4BDBA 3G15A 2Z7QA 1YDTE 4FL2A 3OP5A 4FODA 4MH7A 5L2IA 3C9WA 4L6QA 3QTZA 3LQ3A 3KB7A 4C02A 5E8UA 4ZTMA 4BYIA 3FI4A 3II5A 3ZZEA 3D2KA 3HRBA 2CN5A 5ETIA 4QP2A 4XG2A 2C6LA 3FMDA 5EW8A 3IS5A 3MIYA 4J53A 3A7FA 3FMNA 2B53A 2YCRA 4FOCA 3BQCA 3ZO1A 5FM2A 4U6RA 3LFQA 2QURA 3VS4A 4BGQA 4F9AA 2QHMA 1YWRA 5IQDA 1WFCA 3EMGA 2ZV8A 1R78A 3PPKA 5HLPA 3FLZA 2XM8A 3JUHA 3E5AA 2QONA 3GC7A 3QKKA 5CS6A 3VUDA 4LOOA 5I4NA 5LVPA 1QPEA 2C5VA 5IU2A 3P23A 5HICA 3RHKA 4PWNA 4KWPA 4HGLA 1V0BA 3AC5A 4APCA 5DR9A 3R8PA 3DKFA 4RLLA 3PJ8A 5AMNA 2O65A 3PXQA 1OMWA 4JBVA 4MXYA 3E8CA 5AUTA 3H3CA 4TWOA 3BLRA 5EOLA 3JVSA 4CFXA 5BX0A 3UOHA 1PF8A 3MA3A 2X8EA 3V3VA 3SXRA 1U5QA 2ONLC 3F5PA 5D10A 4QMTA 4C62A 2VO7A 3FZRA 1Q99A 2XM9A 2VTOA 3DB8A 3CS9A 2Y6MA 2NPQA 2JFMA 2VWVA 3G9NA 3O8TA 4QTDA 2PL0A 3ALNA 4BDHA 2YAKA 2PZPA 3FZPA 4FF8A 5A6OA 1GZOA 4NEUA 1CDKA 5DLSA 4QQJA 4XH6A 3QCSA 5AV3A 2PVJA 3EHAA 3QKLA 2WTJA 3DB6A 4IFGA 4IM3A 5EW3A 4I6FA 1NVQA 3H0YA 5E8XA 3JY0A 4DG3E 3ZOSA 2W4KA 4YLLA 4H3QA 3LCTA 3ORNA 2OFVA 4BTJA 2NNWB 1H01A 1XBAA 2PZYA 3EOCA 4BZOA 3OS3A 4ZK5A 3VRYA 5EKOA 5LMKA 2UUEA 5IA4A 2WQEA 4NTSA 2FYSA 4BBEA 2OZOA 4FSYA 4XP0A 5BUIA 2OLCA 3RVGA 4YNEA 5GNKA 4D58A 3HA6A 5IA1A 4D2SA 4J99A 3IGGA 3PWYA 1O9UA 3PFQA 4O0SA 4TYHB 5BQ0A 3NW7A 5AR8A 4IB1A 4GEOA 3RPRA 3FY0A 3UZRA 4U9AA 3NMUF 4O38A 2RFEA 1IG1A 2B7AA 4AZEA 3F5UA 3WILA 3UZPA 2CKPA 4DH3A 2XNEA 3M42A 4IVCA 3I60A 5E7RA 4NZWB 4CMOA 3GBZA 4S30A 3OEZA 3E93A 2FO0A 3HAVA 2UZWE 3TZ8A 3LMIA 4WNMA 4FKSA 3TACA 4CFUA 4FNWA 3G33A 3QQGA 4BTFA 2Q0NA 5AV1A 2BCJA 5DG5A 2ZOQA 3HP2A 5HVJA 5F1ZA 4C4EA 1MRUA 1QCFA 1Q4LA 3D7TA 4ZAUA 3HUBA 5HTIA 4YO4A 4L9IA 4A7CA 5AP0A 3HYHA 3QUPA 2DUVA 4ASEA 3MI9A 4RJ5A 4FKGA 5M53A 3LAUA 3MH2A 3MFUA 5AR3A 2J50A 3W8QA 4BC6A 2J90A 5IUHA 3SG9A 4GK3A 4UZDA 2HK5A 1PJKA 2BIYA 2R9SA 3AOXA 2C47A 3R1YA 4A4LA 1MQBA 5DI1A 3UPZA 2R64A 2DYLA 4UWBA 3U8WA 2YEXA 3UE4A 3UC4A 2C68A 1H00A 2JDRA 1FOTA 4IQ6A 4ZTSA 5KBQA 5CSPA 4DTKA 1SMHA 3BU6A 2O5KA 2R3QA 4EL9A 3VC4A 1T46A 3PE2A 1KV1A 2WEVA 1XR1A 4FV6A 3UC3A 3BZ3A 4D1SA 3O2MA 2UZLA 3DZOA 3FWQA 5CSXA 4K18A 4YPSA 4L7FA 3KXGA 3ZO4A 4OTWA 4QMYA 2J0JA 1S9IA 3MDYA 4LM5A 5E8SA 5HOAA 5HBEA 2W17A 3QQKA 1VZOA 3TNPC 4QP8A 5BMMA 3D14A 3UNZA 4ASDA 1H1QA 5M07A 4ITHA 2GS6A 2PUUA 4U40A 3KRXA 5ACBC 2OI4X 4YR8A 3QRJA 3DJ6A 4IBMA 3KRWA 4DFNA 2EU9A 4C34A 3CR0A 3PSCA 3MPAA 4ZS4A 1P4FA 2BZKB 4FKTA 5EDPA 3KRJA 3UYSA 1YOMA 3V8TA 5CSWA 4EC8A 3V8WA 4EKKA 2XK9A 1S9JA 3NX8A 1QPDA 3O51A 1VEBA 5EOBA 3VWAA 4G16A 2R3RA 3JVRA 3PXZA 2XKCA 3JYAA 3PVBA 4IDVA 4WSQA 5HHWA 4L7SA 3WARA 4X6QC 1W0XC 4JX7A 3QC4A 3LCKA 3NAXA 1R0EA 4X21A 3LFSA 1L8TA 3PA5A 4QMZA 3F69A 4MAOA 2YACA 2QU5A 3MYGA 3FZTA 3FZOA 3QC9A 4O21A 2ETMA 4EH6A 3L1SA 1M14A 3UQGA 1T45A 2NP8A 3G2FA 4J1RA 3NEWA 4M13A 3UDBA 4F99A 4G5PA 4IM0A 1TQMA 4YJVA 1OPJA 4N4SA 2G2IA 4RIXA 1Z5MA 3A60A 4MXZA 4DFZE 4FK6A 4K9YA 4RX5A 2H6DA 3DXPA 1WBWA 4ACMA 2BHEA 3ZRLA 5E91A 3P4KA 4IWOA 3LJ1A 3QZFA 4F0GA 1Q8YA 2IW8A 4KNBA 4GS6A 3QCYA 4YURA 4MQ2A 1LP4A 3B8RA 4CQGA 4C33A 4M15A 1URWA 2HIWA 4FZAB 4O0UA 5DFPA 5C27A 4DGMA 3RBWA 1MRVA 1UA2A 4JJRA 2IVSA 2J2IB 4L00A 4DGNA 2YAAA 4MCVA 3MS9A 3R9RA 5AP1A 2PMLX 3LM5A 4O7TA 3L9LA 4FL1A 4JRNA 4PQNA 4R1YA 5CVGA 3S2PA 4ALVA 3TKHA 5M44A 4O7RA 3VVHA 4IWDA 4DT8A 2ITYA 4UMRA 3ZUTA 2W1GA 3UGCA 4O6EA 3GXLA 5DHJA 3TV7A 4DA5A 1U5RA 4BDEA 5IISA 5M56A 3D15A 4QOXA 1IRKA 2IVVA 3LJ2A 3N51A 3Q60A 4J52A 4RIXB 3OT8A 1XH9A 1IR3A 4FSQA 1E1VA 3KN6A 4PPCA 1IASA 5CSHA 2GU8A 3AMAA 5FTQA 4XP2A 3EQGA 4G6OA 2UZEA 3FQEA 3DQXA 4GFMA 4I3ZA 4G3CA 3P08A 4QQCA 4DGGA 4YU2A 3HECA 3IDCA 3U6JA 3R71A 5DIAA 4YJQA 3OC1A 2IW9A 1BYGA 4AA4A 4K0YA 5FEEA 3B8QA 3BYUA 3QTXA 4BDKA 3Q53A 4ZP5A 2C6IA 2P33A 4CD0A 3TDWA 4TZRA 3C50A 5BVFA 3MW1A 4TPTA 4F7SA 2YFXA 3IW8A 5BMSA 4IXPA 2IZUA 4FNZA 4IWQA 3M11A 2EB2A 3W18A 4F9CA 3QALE 2W05A 1M7NA 3R00A 4MX9A 2YM7A 1HCLA 4BB4A 5JRSA 4OW8A 4RQVA 1SVHA 2G01A 3JY9A 4I4EA 4F1TA 3VQUA 4IH8A 4BI1A 2YWPA 5IUGA 2QKRA 2GHGA 4C0TA 2RFSA 2OF4A 3TUCA 5AEPA 5L8LA 4FVPA 4UWCA 4RFMA 1FVVA 5IQCA 4HCUA 3NVKI 3MFSA 1DI9A 3QZGA 4GVAA 2BRHA 3QQJA 1J3HA 4FUYA 2YZAA 3LLTA 2PVNA 2YDIA 3TJCA 1U4DA 1XHAA 2BAKA 2HZ4A 4IVBA 5IEYA 4JAJA 3AT3A 3ULZA 1BL7A 2I0YA 4G34A 4KD1A 4TYHA 5JFWA 1RDQE 1RE8A 4UX9A 2IZSA 4S32A 3L9MA 4RA5A 3BCEA 2X81A 5J7BA 4IX5A 3I6WA 3WIKA 2ZVAA 4IE9A 3ZMMA 3ZLXA 4E5WA 1CKIA 4CGAA 2R3PA 2OXYA 3FSKA 3NUPA 4XG3A 1H26A 5EKNA 4DEIA 4AGWA 5F9EA 5J5SA 2ONLA 2X39A 3C4EA 3WI6A 3JR1A 2C5NA 5CU4A 4FKJA 3DV3A 1ZRZA 5LMAA 2X8DA 5KO1A 2QOOA 1OPLA 2G9XA 3NCZA 4JQ8A 4IW0A 3CQWA 2GTMA 4QMLA 3PA4A 3MA6A 4NYEA 2WGJA 1KV2A 4CRSA 2KTYA 5IQEA 5LMKC 4IAAA 2J5FA 4BI0A 3ANRA 3KVXA 3QQLA 1H4LA 4JS8A 4NU1A 3HZTA 3OZ6A 2W4JA 3TKIA 3ZSIA 4RWJA 2YDKA 1H0WA 2AC5A 4E4XA 2O64A 2OH0E 2Z7LA 4I5MA 2BDJA 4RBLA 3R8UA 3TEIA 3VS6A 3GT8A 3CTJA 3NYOA 2P0CA 2WD1A 4YHFA 5CEPA 4HJOA 2VTPA 2XK4A 4H1JA 1U54B 1YI6A 2X6EA 5HO6A 4FV7A 3P1AA 4JQEA 1B39A 4LUEA 3IKAA 5AADA 2HZ0A 1OI9A 2OICA 3PA3A 3EQIA 4WNOA 3NUSA 3S3IA 1Q97A 3EFJA 2X4ZA 4IVAA 2CKEA 5AUYA 3UNJA 4AE6A 4FT7A 2UW7A 1KE9A 1Y6BA 3TNHA 4EOKA 4QMUA 5DT4A 3W33A 4ACCA 5CT7A 3KC3A 2QC6A 1JSUA 4DF3A 5FEQA 3HV4A 3DK3A 1WVWA 4ACHA 3NUUA 4GJ2A 3U6IA 3CE3A 4OTFA 4EONA 3IW5A 2X1NA 3Q9ZA 4KKEA 2A0CX 4O22A 3QCQA 4E5BA 5AAFA 4YC3A 4G6LA 5E4HA 4GIHA 3LCDA 3BHUA 2WQNA 3KFAA 4I6QA 1UNHA 2A19B 4JL9A 3EFLA 5ANGA 2GHLA 4TWPA 3OBGA 2B9FA 2QOCA 3PG1A 4V05A 3VBTA 3ZSHA 3C5IA 2OIDA 4M68A 4MEDA 1Y6AA 3IOPA 5CI6A 4KRCA 4F0FA 1SZMA 5BYLA 5J9ZA 4XMOA 5K5NA 4QD6A 4L3PA 4IFCA 3KRLA 1JAMA 5LWMA 4J8NA 4JBOA 2PMIA 2OJJA 3BGQA 3LVPA 2H96A 2XIZA 4TRLA 4U41A 5HI2A 3LOKA 4RFZA 4KBKA 3BYSA 4I0RA 4HNFA 4OTQA 5AP3A 5E8ZA 4FTIA 4V04A 3ZXZA 1OBDA 3R22A 5D7AA 3F9NA 1PXJA 2C69A 2WMRA 3CD8A 3NYVA 4FTQA 3RJCA 1PRYA 3AC2A 3EB0A 5E90A 1ZYCA 3F3ZA 5M08A 3ULIA 1WBOA 1UU3A 3QQHA 4G6NA 3R1QA 2I1MA 4JOAA 3R9NA 4FIGA 4DH7A 4PMPA 5LQFA 4O2PA 3CJGA 4FT9A 3AGLA 4FKOA 4TWNA 4PL3A 3E87A 5IEVA 1Y57A 4BDGA 3U55A 3L8SA 3OCGA 5E1EA 3NCGA 1XH5A 1OB3A 3FEGA 4L43A 2PPQA 4FIJA 4P7EA 5L6PA 2XYNA 2E9PA 2OH4A 1ZY5A 4ORKA 1YOJA 4BWKA 4L46A 2R0UA 5K5XA 5HG8A 3PXKA 2QNJA 2XCKA 4RJ8A 1ZWSA 4FTNA 2OK1A 4YZCA 3DAEA 5H8BA 3UODA 4QMNA 5EQYA 4BGGA 4RFYA 2X2KA 4EQUA 4KBAA 4PX6A 4XG9A 2C6KA 4F6SA 4E6AA 4W4XA 2R4BA 3D7TB 3EYHA 4J96A 3KF7A 5C8NA 2VO0A 4DINA 3DQWA 1KE6A 4DG2E 4LV8A 3KGAA 4HGTA 4GYGA 2J5EA 2WTVA 3P78A 5KKRB 1ZYLA 3TIZA 3ZO2A 2V22A 3BX5A 4LG4A 2ERZE 4MNFA 4DEGA 4RWKA 4L68A 3CQUA 3HP5A 4XOYA 2XNMA 2W1DA 4UB7A 4JDIA 2CGXA 4WG5A 5EDRA 4U0IA 5HIBA 2JITA 2XNNA 3BEGA 3IPHA 4ZJIA 4E73A 2GDOA 2VX1A 3LM0A 4UY9A 3ID6C 3OG7A 2VTNA 1WBTA 1Q8UA 2VWYA 3KK8A 4FSNA 2YABA 4MD7E 4IACA 5J9YA 2UVZA 2C6OA 3DLZA 4JG6A 2XIXA 2NRUA 3R83A 4Z7GA 2GQSA 1TKIA 2EXCX 2XKEA 2JIIA 3R04A 4I20A 2A4LA 4GSBA 3DAKA 5AP2A 2P55A 4L44A 4QMXA 2BZHB 1O6YA 3CKXA 3Q04A 1ZZLA 4XJ0A 3E3PA 3PRFA 4W4VA 4D0WA 3SA0A 2YHVA 4IC7A 2PMOX 4JBQA 4MNEA 3PPJA 2WPAA 3K54A 1KE5A 1WZYA 4JIKA 4PDYA 4UXQA 1AQ1A 2CGWA 4O6LA 4J97A 5IQBA 3FV8A 5IKWA 1IA9A 4Z3VA 4DEBA 3LQ5A 5C4LA 1ZMWA 2CCHA 5M55A 5CU3A 4RWLA 2RG6A 1H1WA 3VF8A 2RKUA 4AE9A 3Q9XA 2R3HA 2FSLX 2VTJA 4IM2A 2OBJA 2Q83A 3WOWA 2ITVA 4NL0A 3EN4A 3A7GA 2WNTA 1YQJA 3FL4A 3FMHA 3PXFA 2XUUA 3KK9A 4OTGA 3FHIA 4PMMA 3RAIA 2Z2WA 4M97A 3TN8A 4I5HA 5CWZA 5G6VA 3TV4A 2C1AA 5DT0A 5EK7A 4BWXA 4EHGA 4TW9A 2XP2A 2IG7A 2QVSE 2XRUA 3ELJA 4AFJA 4X0MA 3FL5A 4FZ6A 1OL7A 4EYJA 1F5QA 3O0GA 1HCKA 2BTRA 2XIKA 5M57A 3K5UA 1ZLTA 2YITA 4FTTA 5EW9A 1I09A 3F61A 4ZTHA 5KZ0A 5J1WA 2BUJA 4F7JA 3OXZA 3R7GA 4WUNA 5IMXA 1A48A 4D9UA 2BALA 3PIXA 4ZS0A 4D55A 4CYJA 2C6EA 3C4WA 4CYIA 2Y9QA 4EK8A 3GOKA 4FV5A 1PKDA 5M4FA 4EOLA 3ORIA 5KHXA 3KMWA 3TT0A 1UV5A 2X4FA 4KAOA 3COMA 4ZZMA 3PSBA 3RHXA 2YIWA 3P86A 1YKRA 2ITPA 3F3TA 4I23A 4KS8A 4QRCA 1VYWA 3KXMA 5CEOA 3A7HA 5KMIA 5CAUA 3AG9A 3PLAE 2I0HA 4Q5EA 3F7ZA 3GGFA 4Y73A 5AWMA 2R3LA 3U6HA 4QP3A 1OL6A 4FV4A 2B1PA 4O86A 3SD0A 4ASZA 4R1VA 2V0DA 3SAYA 2OJ9A 3LCSA 2DS1A 2DQ7X 4O91A 2UVYA 4F6UA 5K9IA 2GS2A 5AAEA 3OWPA 4QP4A 4AW1A 4X6RA 3ZEPA 4KKHA 3EJ1A 5E1SA 4KSQA 5JRQA 3Q5IA 3OY1A 3UIXA 4TYGA 3RGFA 2HWPA 2ITZA 3Q4UA 4FKRA 3V5JA 4ZTLA 2XIRA 4GK4A 3DFAA 5G1XA 4DITA 5C01A 4FR4A 3T9IA 4WRSA 4H36A 4Y95A 2OIBA 2VGPA 4FV8A 5DR2A 4ZSAA 3PJ1A 3DJ5A 2JBPA 4XHKB 5J79A 4FEXA 2CPKE 2XMYA 4DTAA 5B2LA 4W4YA 5HCXA 5IPJA 4ZY6A 4O7VA 2X9EA 1FMOE 2E9OA 3AGMA 3ERKA 3N4VA 3V04A 4K2RA 4WBBB 2OWBA 4CKIA 4YC8A 5CALA 2YERA 3K2LA 3AC3A 5FTOA 4EKLA 1WBVA 3EQCA 5T3QA 1XO2B 4MBIA 3VAPA 4R77A 3W10A 3DBFA 2WQOA 2XNGA 3PPZA 3LCOA 4Q5HA 5A14A 1O6LA 5IDNA 1PYEA 2IN6A 1V1KA 5J9LA 3COKA 3PJ3A 4EUTA 5A54A 2BRMA 4FI1A 5GHVA 2VTHA 4FTOA 3BPRA 3RK5A 3EIDA 3T3VA 4UEUA 3R21A 3QX2A 4HVHA 3KU2A 5FM3A 2GQRA 1H27A 3GI3A 3K3IA 3PXYA 3GC0A 3R2YA 2QO2A 4EJ7A 3MBLA 4FVQA 4JQ7A 5GINE 2UZVA 4A07A 4BCNA 5IA2A 1ATPE 4FKLA 4A9SA 4X2NA 4BGHA 5IMEA 5M4CA 4QQ5A 5EM7A 4I22A 4FSZA 5L3AA 4X2FA 4FTMA 2F7ZE 3OW3A 4KINA 1YI3A 1ZZ2A 1W7HA 1PXIA 5L6OA 4KRDA 4FKIA 2GNFA 5KX8A 5GZ9A 3ZRMA 3MY0A 5CXHA 4GRBA 3UG1A 5C26A 2XJ1A 2E2BA 3EZRA 4RLKA 2HELA 4BCQA 5HKMA 2GS7A 5KE0A 1K3AA 3ODYX 4XLVA 3W55A 2OU7A 4GU6A 4CMUA 2HOGA 2PY3A 1MQ4A 3GU6A 4I5CA 4UMPA 4CT1A 2PHKA 3LFDA 4I1ZA 2WMAA 4EUUA 5CF8A 5DYJA 5CNNA 1CTPE 4IX6A 5E8WA 3ZDUA 3ZXTA 4ENXA 4LOQA 3EKKA 2CNUA 2CNQA 4KBCA 3E7VA 4EOMA 2RFNA 3NIZA 3L9PA 4BCFA 5L2SA 2PUPA 3SDJA 2YZLA 3ZEWA 3LXLA 2VWXA 4OT5A 2YIXA 4WBOA 2PVYA 5A6NA 3CQEA 4A9TA 5EI6A 1NXKA 3HKOA 3C0GA 5KMOA 4ARKA 3CPBA 3BEAA 4G2FA 4WIHA 3SW4A 3TTJA 5JSMA 5AFVA 3R73A 2WMQA 5M06A 3MY1A 1YOLA 1PMUA 4RZVA 3O8UA 4B8LA 5EHLA 2B9HA 3UP7A 4EWHA 2B0QA 4W8DA 3ENMA 5CY3A 2VTLA 2LAVA 5TR6A 3G0EA 4BDIA 5HIEA 4R7BA 3FMLA 2JDVA 5HG7A 4J7BA 3LHJA 2ZB0A 3GCQA 5CVFA 1FBNA 3WZUA 3W16A 5CF6A 3FMJA 3OCSA 5DEWA 3VBXA 3ZC5A 2C0TA 4GL9A 4JIAA 5HBJA 3SG8A 2F4JA 5JEBA 4QMVA 2I0EA 4NM3A 5AV2A 4YJSA 5KKRC 1H0VA 2CHLA 3A7JA 4FIIA 4BWPA 5AV4A 4DFLA 4I24A 4IB3A 2JDTA 3U51A 3O50A 5I9XA 2VWIA 1HOWA 3W8LA 4D2TA 1SNXA 3ZFYA 2I0VA 3KULA 4CRLA 5I9ZA 4XBUA 4L45A 3FLQA 2G2HA 4DEAA 3DPKA 1PXLA 4ZZOA 5JKGA 4YTIA 2R7BA 3QYZA 4PL4A 2CLXA 5FUTA 3POZA 3A99A 3Q2JA 2WQBA 2Y4IB 3B2WA 1Q5KA 4C7TA 4O7LA 3TZ9A 4D4YA 4NCTC 5M4IA 3EQRA 5A3XA 3GOPA 4IAYA 3KXZA 3GCSA 4FL3A 3UIUA 2UZBA 5H3QA 5CEMA 5T68A 1U59A 4XOZA 2GFSA 4GV1A 3W2OA 4E20A 3QAME 5HNGA 2GHMA 4RX8A 1M17A 5IA5A 3VS5A 2PYWA 3ZYAA 4RJ7A 5CI7A 2PZIA 2ITWA 4GG7A 3Q96A 3P79A 1UVRA 4FKUA 4CQEA 2IW6A 3ACKA 1GIJA 3FMKA 2G2FA 3MSSA 4TT7A 5HU9A 2QG5A 2VTTA 3BHHA 1G5SA 4NFNA 4WNKA 2CMWA 3E92A 5DGZA 4H05A 3CGOA 4GG5A 3RM6A 4WHZA 3VBQA 4D28A 5BNJA 3S00A 3FBVA 4YJPA 1UKIA 5IQIA 1CM8A 3NNVA 3ROCA 4BDFA 3WZDA 2EUFB 4GYIA 3AD5A 3FQSA 3KXXA 3R28A 4TN6A 4YJUA 2X0GA 3PIZA 4H3PA 5L2TA 4U80A 4MXCA 1IAJA 3BIZA 3KMMA 4LMUA 4MVFA 4QTBA 2DWBA 2WZJA 1VR2A 4YZDA 2F9GA 4O82A 4BTMA 4C35A 3VUMA 3ZO3A 3O71A 3DFCB 4RG0A 3DCVA 4XRJA 3V5QA 4HVIA 2XKFA 3QF9A 5CU0A 2H8HA 3DLSA 4M3QA 2ESMA 4CTCA 3QL8A 5LVMA 4CNHA 1B6CB 3HRFA 3RAHA 3W32A 4AZVA 4LGHA 5K4IA 3DT1A 3OTVA 2RG5A 3RPYA 4AW2A 1JKLA 1YXTA 1ZYSA 4XV2A 5IQAA 1X8BA 2RSVA 3MY5A 4IDTA 3QRIA 5BUEA 4EEVA 3I4BA 1FVRA 2B52A 2PE0A 3D7ZA 4CG9A 2BRGA 3MJ2A 2WB8A 5HX8A 4BKYA 5K0KA 4IANA 5E9EA 4LRKA 4EHVA 3OUKA 5FBOA 3PIYA 5DBXA 1RJBA 4CTBA 1G8AA 2O8YA 5H8EA 3V6RA 4EH8A 3KMUA 4YZMA 4GW8A 3I1AA 1YVJA 2ETKA 4CFFA 4MXOA 3QWKA 4HPTE 3A2CA 5CT0A 2XH5A 5AR5A 4EYMA 3KY2A 3TJDA 1E1XA 3R9HA 3LPBA 2HWOA 4EH7A 1NT2A 1Q24A 3F2RA 2WMXA 3ANQA 3HAMA 4E93A 3WF6A 2IPXA 2QI8A 2XNBA 1OIYA 1R39A 3GEQA 3CXWA 3O96A 3ORPA 3NAYA 3SQQA 2WQMA 3DBDA 4A9UA 3U54A 4HOKA 5LCJA 1ZARA 3F2NA 2WKMA 4K8AA 2J6MA 4NKSA 3MJ1A 4Y5QA 3CD3A 4AGCA 4QNAA 4WA9A 3ORZA 5EI8A 4AW5A 4IAKA 1OL5A 4OGRA 3VBWA 4D0XA 1F3MC 3V5TA 3KL8A 1PXMA 4Z55A 4CV8A 4GCJA 4YLJA 4AT3A 2VGOA 5LWNA 3S95A 4CFMA 5DE2A 4U8ZA 2ZV2A 3BBTB 4N57A 5AP6A 4L53A 4ZSGA 4QMSA 1ZYDA 2A27A 4JNWA 5DT3A 5AP4A 3WYXA 2PUNA 2UW3A 3ZFXA 1JKKA 2VTMA 1IA8A 4U7ZA 4WG4A 3GQIA 5HG5A 3R30A 3ZUVA 4EK3A 1BI8A 1TVOA 2C6MA 4HGEA 3TWJA 4MD9E 4AACA 2ZM3A 2NO3A 3FZ1A 3OT3A 4K77A 4DLIA 1Z57A 3IW4A 3E64A 4LGGA 3R7OA 1UNLA 3NGAA 4KUJA 4GUEA 2GNHA 2X2LA 1UKHA 4PF4A 3GU7A 3QGWA 1J1BA 3VRZA 2VWUA 3D9VA 4L52A 4FIFA 4NJ3A 2I7QA 4CKJA 2IZTA 4EI4A 2BKZA 4PL5A 3NNUA 3GP0A 2YIRA 3LFFA 3L8XA 4YZNA 4CCBA 5IDPA 2CN8A 4AS0A 1ZOGA 3NUYA 2C3JA 4ZXTA 4YNOA 1JLUE 5E8YA 4C8BA 2XNPA 4IZ7A 4R7IA 4FKWA 1WCCA 3B2TA 2EXMA 2QG7A 2ZDUA 3AC8A 3KXNA 2PSQA 3PVWA 4BZNA 3D5UA 2REIA 3HL7A 4R3CA 1QPJA 3TG1A 5A4CA 5GJGA 3ZM9A 4ZLZA 3VHEA 4MD8E 3HGKA 2ITXA 1PW2A 5D7VA 2VD5A 2I6LA 3NW6A 4EH9A 5IH4A 3VS3A 3DBCA 4FGRA 3ALOA 2HW6A 4BFMA 3TZMA 3VUKA 1LR4A 3RCDA 5KZIA 2VO6A 1M2RA 3HNGA 4PPBA 4LMNA 3FMEA 5GIOE 3HEGA 2OSCA 2VAGA 4AG8A 3GFWA 4JDHA 3EQDA 4RZWA 3LFAA 4EK6A 4JI9A 2C3KA 3UIMA 4BF2A 4F1MA 5D11A 4AN3A 3C4FA 2BKKA 3RPOA 4KIOA 2HENA 3QKMA 4EK5A 1XH8A 1UU9A 4Z7HA 3BLHA 4YMJA 5CEKA 3NYXA 5D9HA 3SOAA 4M67A 4FTAA 1JPAA 5I9UA 3ZDIA 4DN5A 1B38A 1APME 2OZAA 2QO7A 2V7AA 3F66A 5E8TA 4A9YA 1ZYJA 4O7ZA 2ZMDA 3MB6A 4EQMA 3V01A 1YW2A 3E88A 4UXLA 3NSZA 2ZYBA 3BE9A 3FKLA 1FPUA 2W06A 4BCPA 1KE7A 3KULB 3L9NA 4IEBA 2YIQA 2C3LA 3RAKA 2VX0A 4FG7A 3OBJA 1RW8A 2V7OA 4TNBA 1YHWA 4UV0A 3D83A 1STCE 3BHVA 3R1SA 4G3DA 4DH8A 5ANIA 3NLBA 5AX3A 1J1CA 3TM0A 3GB2A 3SOCA 4BI2A 5AUXA 4EZ7A 3R01A 4CLJA 4ZEGA 5C9CA 3VUHA 2VU3A 2P4IA 3NUXA 5TF9A 1ZXEA 3FAAA 2UV2A 4O0TA 3FLNC 4TL0A 2WIPA 4IWPA 3OOMA 1H1RA 3CBLA 4FSTA 3OHTA 4YPDA 4D4VA 3F88A 3WBLA 4KKGA 1YXVA 1PYXA 1XBCA 5KUPA 2Z7RA 4Q2AA 3UJGA 1GOLA 2W9FB 4BN1A 4FEQA 3DZQA 4NKAA 2GNLA 4Z9LA 2JC6A 1JVPP 4AXAA 5LVLA 5JQ8A 3K3JA 2OJFE 4EH5A 2UW4A 2EVAA 2O63A 2WMUA 4S33A 3IW7A 4YUQA 4F0IA 3L8PA 2QHNA 3CY2A 3OF0A 4QMPA 4EOPA 2RF9A 4DH5A 3R7EA 1DI8A 4FVRA 1JSTA 3V5PA 2W7XA 3VS7A 2BTSA 4X7QA 1PXPA 3OUNB 3PE1A 5ETFA 3IOKA 3DTWA 2YISA 4GKIA 3HMNA 4FV1A 4Y72A 3TUBA 1XQZA 4PPAA 3FI8A 4RVKA 3FZSA 2RL5A 4IVDA 3ZZWA 4FEVA 4ZTQA 3P7CA 3LE6A 3ITZA 4U43A 3W2SA 3ZLSA 3EZVA 3ORLA 3I81A 1IEPA 2IVUA 3G90X 5C8KA 1OL1A 4YLKA 3Q6UA 4BVUA 4RGJA 3UYTA 3W2CA 5IZFA 3QRTA 5A9UA 3W2RA 3BV3A 3AT2A 5HLWA 3KKVA 2WFYA 3R8VA 1BL6A 3VN9A 3UO5A 1OUYA 5KNJA 3R2BA 5EHYA 3QCXA 1OUKA 4O7SA 4R6VA 1R1WA 5HORA 3EQHA 1Q62A 4D9TA 5JT2A 3OCTA 2YA9A 4WKQA 3QZIA 4GT5A 4OTPA 3RM7A 4WOVA 4E4LA 3ZCLA 3BLQA 2BDFA 2C30A 3EL8A 2WTIA 5HEZA 4BIEA 4QPMA 1BUHA 2WU6A 5AAGA 4XRLA 5A4LA 5EH0A 5AJQA 4B8MA 2OJGA 5EYCA 5CSVA 5CU6A 2R3FA 1LEWA 2YCFA 3R7UA 3QD2B 4AN9A 4DEDA 3PP0A 4EZ5A 4P4CA 1CSNA 4BCGA 5JFVA 3WE8A 4ANSA 4MBLA 4P5QA 2Z8CA 5A4EA 1BKXA 4USFA 4UYNA 4DG0E 3BYOA 4HYSA 4YBJA 4L67A 1CMKE 3GUBA 1OKVA 3SXFA 4HPUE 2JAVA 4F6WA 1PHKA 4RIWA 1DAWA 5HO7A 3V51A 1Z9XA 2F57A 2R3IA 3DK6A 2XF0A 3VS1A 5I9VA 2PVHA 2ZMCA 3OWKA 4LRMA 5ANEA 3MVJA 2G1TA 4CG8A 4ERWA 3FXZA 5TO8A 2HYYA 2WEIA 2UW9A 4A9RA 5I0BA 4KA3A 5J87A 3OXIA 3IO7A 3ODZX 5F94A 4NM7A 4GKHA 4YSJA 2GNIA 1DAYA 4PP9A 3UVRA 5AX9A 4E3CA 1SVEA 3VUGA 3R1NA 4AX8A 3AXWA 4YJNA 2QOKA 5LVNA 3TZ7A 1CKPA 2VV9A 4JDJA 4TTHB 4FNXA 4RX9A 3UBDA 3LMHA 5J8IA 4PNIA 3RPSA 3FYKX 2XKDA 4MXAA 4UBAA 2WTWA 3BELA 4DFXE 5M51A 3R7YA 4LL5A 4PDSA 4MBJA 2ZJWA 4XG6A 2H34A 5HG9A 4FMQA 3D5VA 1H28A 4X3FA 1REKA 4BKZA 2UZDA 2W5BA 3GU4A 5DRBA 2PVFA 2JDSA 5CEQA 3OEFX 2P3GX 4G3FA 5HNIX 4Y85A 1PXOA 2VO3A 4HZRA 3E63A 5TOZA 3LLAA 3PVUA 3ORXA 4NH1A 3PZHA 3W2QA 3VS0A 4LFIA 4YO6A 4FKPA 1IAHA 1YHVA 4O0XA 5DRDA 4BL1A 4YP8A 5ANJA 2WMBA 2YM8A 3F5XA 3C5UA 3GC8A 3QTWA 1XJDA 2FVDA 3KQ7A 4HYUA 4D5HA 3VJOA 4BCIA 4EWQA 4X3FC 5CAOA 1H08A 2JKMA 2GCDA 4BIDA 2YJSA 5FXSA 3NNWA 2OGVA 4JG7A 2E9UA 4U5JA 5HBHA 4BRXA 4L3JA 3EQPA 2SRCA 4XNEA 3RCJA 5L6WL 1H25A 3HLLA 2OF2A 4CV9A 3FQHA 3UIBA 3UOLA 4AA5A 3WF7A 3KF4A 2JBOA 5DNRA 3R7VA 2W0JA 3RNYA 5EDQA 5C4KA 3PVGA 1BMKA 3R63A 4XG7A 3I0OA 3PY1A 2JDOA 4YGAA 2ITNA 1OKWA 5JZJA 1XKKA 5DOSA 3HMPA 5K0XA 4ZJJA 1XH6A 5FWKK 2C5YA 1OGUA 4FSUA 1OIUA 3F3UA 4O7YA 4JG8A 4IZ5A 5I3OA 4H58A 3KA0A 4BHNA 5AA8A 1JWHA 1TQPA 1MRYA 2WXVA 3OW4A 3ZS5A 4HCVA 1MUOA 5EM8A 3REPA 3UO4A 5CZIA 5FTGA 3G6HA 3KXHA 4MF1A 2HW7A 4G9CA 4ZSJA 4B7TA 3EN5A 1BX6A 1YDRE 2XIYA 3QD4A 1SYKA 1UNGA 2C6TA 4CZTA 2XEZA 4QMWA 2IVTA 2FGIA 2QLUA 3W1FA 5KMMA 2ZM1A 2EXEA 2Y6OA 4LUDA 4F4PA 5K3YA 1GIHA 3DNEA 4PTEA 4ONAA 5HTCA 4PTCA 4QPAA 5EG3A 4O96A 4YSMA 2WO6A 4EORA 3HV7A 3MESA 4CFVA 3FJQE 1JSVA 3MV5A 1GY3A 2KULA 1OPKA 3MVMA 2GPHA 4NW5A 4N0SA 4O0VA 3R02A 2BDWA 2O3PA 3DXQA 4FEWA 3LFEA 2UZTA 5BVOA 5IQGA 4G3EA 3D94A 4ZY4A 4QT1A 4I41A 3LQ8A 5CX9A 2W4OA 2X7GA 4M12A 3TXOA 5HESA 5HO8A 2UW8A 4FUXA 5FLFA 4GFGA 2XCHA 3VO3A 4OUCA 3NVMB 4QYEA 2QKWB 1Y91A 4I6BA 1K2PA 5CYIA 4Y8DA 4BDJA 5CVHA 4ZTNA 3E8DA 2IWIA 3QYWA 5HGIA 5CNOA 3UMXA 4K1BA 1JKSA 2E9NA 2XRWA 3MFRA 3WF8A 3PSDA 3GFEA 3LJ0A 1OL2A 4LGDA 4AZTA 4MF0A 4EH3A 4A4XA 1GZNA 3H10A 3V8SA 2HY0A 4V0GA 2GTNA 4D4SA 4DBXA 5E8VA 3GQLA 4MHAA 2YM5A 1Q8WA 2FUMA 5JFSA 4IJ9A 5EHOA 2W1CA 2HY81 1VJYA 2VTSA 3PY3A 4WO5A 3EL7A 3L8VA 4HGSA 4ANBA 5FG8A 1W82A 1GNGA 2X2MA 1DS5A 5A4QA 2R3MA 2B9IA 2IZRA 5HD7A 5TT7A 3A4PA 2C5XA 2OO8X 4EH4A 3ZU7A 4IB5A 4XP3A 5KMLA 3U9NA 3VUIA 3SGCA 4DFUA 4ZZNA 3LW0A 5CF5A 3EN9A 2A2AA 3QU0A 4ANOA 3SW7A 3F5GA 3RK7A 3EKNA 4ACDA 4NT4A 3KCKA 1FVTA 4KABA 3H30A 3IW6A 4C4IA 3K5VA 3A8WA 2W1ZA 2F49A 4E6CA 1H24A 2UVXA 4RX7A 5HE2A 3ZBXA 5EYMA 2C0IA 4NK9A 4QTCA 4KIKA 4BY9E 2IJMA 2QOQA 4O2ZA 3ZTXA 5EYKA 4C2VA 3QHWA 1FMKA 4DAWA 3H9FA 5M4UA 1W84A 2W1EA 4JR3A 2YM3A 2W99B 4ASXA 3BYVA 1Q8ZA 1UU7A 3ORKA 2WIHA 5EM6A 2XZSA 5CENA 4E7WA 4BDDA 3U87A 2O0UA 2OJIA 4I5PA 4D4RA 4ZLYA 2QOFA 4C36A 4F9BA 5DWRA 4B9DA 3PTGA 3VIDA 1QPCA 1URCA 4RWIA 4EH2A 4FYOA 3CKWA 4FEUA 4EOJA 2J7TA 2C0OA 2FB8A 4K11A 4PDPA 3RWQA 4R78A 2R3NA 3AMBA 3P7AA 1FGKA 4C4FA 4YTCA 5IA0A 5D12A 3UPXA 3R6XA 4NWMA 5IG1A 2QO9A 3TNIA 4DEEA 4AZSA 2B4SB 4EHZA 1SNUA 3HUCA 4YTFA 3QWJA 4HVGA 4F64A 3EYGA 3EFWA 3G51A 3MH0A 3S4QA 1F0QA 3UQFA 4IAIA 5HTBA 2QOLA 4GH2A 4MTAA 2JKOA 5AM6A 1SM2A 4QP6A 4HNIA 3Q6WA 3C1XA 4FSWA 3DOGA 1P2AA 3IG7A 4FOBA 3I7BA 3ORMA 3QUEA 4ACGA 5DN3A 4WUAA 3OD6X 5JQ5A 4FZ7A 4EC9A 3A61A 4IHPA 5I9WA 4H39A 4IADA 4M69A 4ITIA 4OTIA 2XEYA 4I4FA 1BI7A 1GIIA 3C4CA 4F9WA 1TQIA 5AR4A 5KCVA 2OKRA 4E6DA 2P2IA 2W5HA 4Y46A 1XWSA 2RGPA 3EFKA 2ZV7A 3EQFA 3ZONA 4EOOA 4G5JA 3R0TA 2CGVA 3TCPA 4R5SA 3M1SA 3MB7A 3OY3A 2R5TA 3FDNA 3I5ZA 3LXKA 2I40A 4MYGA 4P90A 4RJ3A 4F70A 5JH6A 3SX9A 1Q41A 4O0YA 2Z60A 1UWHA 3AD6A 4AOJA 3RMFA 3RKBA 3BHYA 1YXSA 5DVRA 4OBOA 4E5AX 3BU5A 3ZLWA 2Q0BA 4B99A 1H1SA 4WSYA 4G9RA 4YJOA 3HV5A 2HXLA 4O7WA
chains in the Genus database with same CATH superfamily
4CCUA 5L4QA 2PE1A 3FKOA 4QP9A 4YHJA 4DFYA 4HYIA 4M84A 4E1ZA 4OTRA 4QYFA 3P9JA 1ZMVA 4QYYA 2X7FA 3TNWA 4USEA 1YHSA 3MVLA 4O4BB 5TE0A 3FKNA 4PUZA 5HE1A 4E4MA 2ZV9A 1OGYA 4F1OA 3HVCA 4FK3A 3WE4A 3QXPA 5CAVA 1Y8GA 4F63A 1JNKA 4BTKA 1KSWA 2JAMA 3UG2A 2A1AB 4ANNA 1A9UA 4M0ZA 4XYFA 5E92A 1OKZA 1OZ1A 3O17A 5JMSA 2V55A 3I0QA 4FT0A 4AU8A 3PDTA 3ATSA 3RTPA 5BVNA 4XX9A 4ID7A 1L3RE 4D1XA 2YIYA 3DBEA 5AIKA 5LCKA 3ZM4A 2VN9A 2X7OA 4DYMA 5CXZA 4C57A 5HVKA 5A46A 4H1MA 4JVGA 4AT4A 3PWDA 1OM1A 2JLDA 3Q32A 4QYHA 4XBRA 4BKJA 3S0OA 1VLRA 1M7QA 2BFYA 2UZOA 4O4EA 4BICA 3QTIA 3TUDA 3VW6A 2PK9A 4WT6A 5HZNA 4Q9SA 4M14A 1I44A 3SXSA 4M0YA 2R7IA 2ETRA 2YLFA 4W9XA 4EOQA 3WF9A 3R7IA 2WU7A 3PG3A 2VWBA 3I79A 1BLXA 3QTSA 4X2KA 3QHRA 4DFBA 4FSRA 3GNIB 4IAZA 4MWHA 4OBPA 4AAYA 5BVEA 4N6ZA 2H9VA 5T6KA 5AIRA 4EOIA 3QQUA 4FTKA 1PKGA 5GZ8A 4FG8A 5FP6A 3EQBA 4DCEA 2JFLA 3DK7A 3T8OA 1PMVA 4BCOA 4RC2A 4Q9ZA 4FC0A 2W96B 3FI2A 5KMJA 4I6HA 5FEDA 1H8FA 4N70A 3O7LB 2JKQA 4O1PA 5EQEA 1OIRA 4OLIA 2W5AA 4O7NA 3POOA 5BUJA 3LKMA 4C38A 3M2WA 4TYIA 1XMLA 3HMMA 4FYNA 2FSOX 5CEIA 3U9CA 4OAUC 1LUFA 4FV2A 2WTKB 3AT4A 4PRJA 5H2UA 3FLSA 3MVHA 3V6SA 1AD5A 3LZBA 5L8KA 4YBKA 3RINA 3FPQA 4CEGA 4CFNA 4TNDA 4EBWA 4IB0A 3FHRA 3HA8A 4QNYA 1WVYA 3OOGA 4AQCA 4X2GA 3O23A 3PJ2A 5HIDA 4V01A 5F20A 3RNIA 4QMQA 4KB8A 2J4ZA 1J7IA 3CIKA 4AWIA 4C4HA 4DC2A 2FA2A 4E26A 4BBMA 2VZ6A 2WMTA 2HZIA 2ITUA 3FC2A 1LPUA 3AMYA 2QOHA 2BFXA 2VTAA 2W1FA 2Z7SA 3LIJA 4C37A 3C4XA 4X3FB 1NY3A 1QL6A 4L01A 3PYYA 2F2UA 3E8NA 1V0PA 2EB3A 3GCVA 4O84A 4W9WA 3GENA 4FE2A 3VBVA 5LVOA 4JXFA 4UWYA 4APPA 4IX3A 4R8QA 5I3RA 4LV5A 3P5KA 4JT3A 4O0WA 4AT5A 4II5A 3Q3BA 4H3BA 2OZAB 4LYNA 3R8LA 3UQCA 4BYJA 3PUPA 5ACKA 3UOJA 5LJJA 3MIAA 5KHWA 2WMSA 4GU9A 4YJRA 3ZRKA 5JK3A 3I6UA 4CLIA 4C4GA 2VTQA 5L2QA 2AC3A 2WTKC 4RMZA 2F7XE 1JOWB 4F7NA 4GVJA 2CSNA 2C4GA 4CMTA 4IJPA 1NW1A 2CDZA 5ANKA 3C51A 3QTUA 2WOUA 3SLSA 4XG4A 3VF9A 1W2DA 5TKDA 3BLAA 3DU8A 1XH4A 3BHTA 4FV0A 4ZOGA 4D2RA 2PZ5A 3ET7A 4FTJA 4FTRA 4PY1A 4NCTA 1OITA 1K9AA 3FUPA 3G6GA 3H4JA 4L3LA 5DR6A 4D2VA 2QD9A 2AEGA 3A7IA 4DDIA 1ZOHA 5FD2A 3DTCA 3E8EA 5FXQA 2J0IA 2RFDA 3VNTA 4B6LA 4RC4A 4GT4A 5B7VA 3A8XA 2PUIA 4U3ZA 1OIQA 4C58A 2VUWA 1P5EA 3KCFA 4OBQA 4ZJVA 4QMOA 3GCPA 1UWJA 3T9TA 2CGUA 3DJ7A 3NW5A 1NVRA 1AGWA 3DKOA 1ZMUA 3F7WA 3I7CA 2X6DA 4LI5A 4RIYA 4CZUA 2GMXA 2XA4A 2BMCA 2YN8A 3DBQA 4MUQA 5ANDA 5EFQA 2R3JA 2Y7JA 4R3PA 2BILB 5AR7A 4AUAA 5AUWA 3RPVA 1YWNA 2V5QA 2PVKA 4DH1A 1QMZA 5GZAA 1FINA 2PVMA 3U4WA 2VNYA 5CAQA 4O1OA 2PZRA 5J95A 4BZDA 3THBA 2J0LA 5AP7A 3U4UA 5FDPA 4QTEA 2Y0AA 3FLWA 3F3WA 4RA4A 2UZUE 2XK3A 2Y4IC 3OMVA 3V5WA 3ZHPC 4ZY5A 5F95A 4KIQA 1Q3DA 2ITOA 4A4OA 5CF4A 1YI4A 5EI2A 3JXWA 5CQWA 3KREA 3KN5A 1YRPA 1OECA 3KEXA 3IQ7A 3COHA 4U44A 4DGOA 2YM4A 4DEHA 3C7QA 4USDA 4G17A 4D1ZA 3QBNA 3WZKA 4GFOA 4XG8A 2R3KA 3FLYA 3I5NA 4XCUA 2VWZA 2PULA 3CCNA 2J0KA 1WMKA 4LL0A 4X2JA 3DXNA 3PP1A 4WNPA 4FT5A 4ZMEA 3BI6A 3C13A 2WHBA 3WF5A 3ZC6A 4FIEA 2UW5A 4J98A 3QZHA 4AZWA 1OBGA 3LXPA 5B0XA 3QRKA 4KS7A 4TY1A 3JS2A 5F4NA 2OXDA 1Q8TA 3H9RA 4ENYA 1PXKA 4BDAA 2C5OA 2PVLA 2PU8A 4GJ3A 2WTCA 3F2AA 3QLGA 4GT3A 4Y5HA 2QR7A 3BV2A 2YDJA 4C2WA 3OFMA 3LMGA 2PVRA 4DHFA 5KMKA 2QR8A 3UP2A 3HDNA 5CZHA 2Y4PA 5KMNA 5JGAA 3RZBA 4B0GA 3BGZA 4PDOA 2QQ7A 3AKJA 4QMMA 3F3VA 4RIOA 4ITJA 1W8CA 4JRVA 3A62A 3CP9A 4FG9A 4ZSEA 2GQGA 3OWJA 4AXDA 4YJTA 5IA3A 4LOPA 4RIWB 4AXFA 2JIVA 3UTOA 4FNYA 2R0IA 2XJ0A 3SRVA 1CKJA 2XVDA 4I92A 4QO9A 4FTCA 5AUZA 2P2HA 3FC1X 1R3CA 3RAWA 1SVGA 3GCUA 3H0ZA 2FSMX 3HV3A 5DH3A 4XLIA 4I0TA 1Y8YA 3Q9WA 5FRIA 4C61A 3P7BA 3ZH8A 5H8GA 2ZAZA 4QTAA 3CGFA 3UVPA 3ZFMA 3IDBA 4D5KA 4UMUA 3QUDA 2QODA 4RPVA 1JBPE 2QLQA 4TWCA 4YC6A 5AR2A 3MN3A 1NA7A 3FXXA 4I93A 4NSTA 3ENHA 3UNKA 1O6KA 4FICA 4NM0A 3TL8A 3C4ZA 4FTLA 3BBWA 3KRRA 3UVQA 4ALUA 4BCHA 4FBXA 4ANLA 4GMYA 4HZSA 5LMBA 4NIFB 2XANA 4AGUA 3QA8A 4PMSA 3ETAA 5J5TA 5JZNA 3DDQA 1GAGA 4ALWA 2XNOA 1G8SA 4FKVA 5JN2A 3GU5A 5JGDA 4W8EA 4TKSA 3ZBFA 2GSFA 3TV6A 3DAJA 4ANQA 4AFEA 4IZAA 3CTHA 3IGOA 3WZEA 4AW0A 3MGYA 4AZFA 2OW3A 5EM5A 1WAKA 1YDSE 4RVTA 4QEBA 4MWIA 4I0SA 2CCIA 4Y83A 3QFVA 4WD5A 2YJRA 4DT9A 1PMEA 2WMWA 4XV3A 5HE3A 2YWVA 3VHKA 2VRXA 3QQFA 4JAIA 1YXUA 4QPSA 5B2KA 1GZKA 4DCAA 4FZDB 4DE4A 3A4OX 3Q4TA 3ZSGA 2VX3A 5HQ0A 2XJ2A 3R9DA 2B55A 3VUTA 3OROA 2EWAA 3Q2MA 4NIFA 2HXQA 4AGDA 4C59A 2X8IA 4XV1A 2CJMA 2W9ZB 1M2QA 3CJFA 3VJNA 3UDTA 1FGIA 3NR9A 5HCZA 4IZYA 4EQCA 3RZFA 3P0MA 1G3NA 3QLFA 4G3GA 2BRNA 4NW6A 4PP7A 3OCBA 4U79A 2W1HA 2IO6A 4FGBA 4R3RA 3V5LA 4U3YA 3NFFB 2GNGA 4FX3A 5BVWA 4RRVA 4CT2A 3AC1A 1MP8A 2AUHA 2BVAA 2XYUA 4J71A 4XUFA 3BYMA 5CASA 2X0PA 2BAQA 3F6XA 4OTHA 3FMMA 1M2PA 3VW8A 4B4LA 3OWLA 3IONA 3T3UA 4PNKA 3TMOA 2ERKA 4UMQA 3G5DA 3NZ0A 5CU2A 4E8AA 4UALA 1XBBA 4UZHA 4QYGA 4TYEA 3CEKA 4GUBA 3FI3A 5DEYA 3TKUA 1RQQA 2QOBA 4O81A 5IQHA 3RALA 4AF3A 4M8TA 5C03A 3SC1A 4C3FA 5J1VA 2WAJA 4N6YA 5ETAA 3F82A 3SKCA 3FPMA 5C8MA 1PXNA 1ZOEA 4EOSA 4ERKA 2PTKA 3PXRA 4RC3A 2CKOA 3ATTA 4J8MA 4QDEA 5HLNA 5FP5A 3MH3A 2WELA 5ANOA 1REJA 2JIUA 5A4TA 2CKQA 3IECA 1OVEA 3BU3A 3C0IA 2BAJA 2XS0A 5DPVA 4G31A 5B2MA 2JGZA 3E7OA 1ZAOA 4WRGA 2OG8A 3N4UA 2PE2A 5IQFA 3BRBA 3FSFA 2XK7A 3LFCA 2ITQA 2R3OA 3QA0A 3ORTA 5FDXA 1WVXA 4D2WA 1A06A 5IF1A 2FSTX 3UZTA 2YCQA 4TYJA 1J7LA 2ZM4A 2OFUA 2PMNX 4R5YA 3R8MA 4PMTA 4F65A 3O8PA 4I94A 4RVLA 3COIA 2C3IB 1YWVA 4HYHA 2O2UA 4MXXA 4QP7A 1VYZA 2G15A 4AAAA 4O27B 3VQHA 4AQKA 4U45A 3LFBA 3SHEA 3QD0A 5EQPA 4V0GB 5CLPA 1ZY4A 3QGYA 2ZDTA 5AV0A 4P2KA 4YZBA 3PLSA 2OIQA 1U46A 1KWPA 4BJJB 3VULA 4CFWA 1FQ1B 2UW6A 3FE3A 4KSPA 4AN2A 3LFNA 4ANMA 4C3RA 5AM7A 4EHEA 4ZIMA 3N4TA 3ROYA 4RT7A 3H9OA 4PV0A 3SVVA 2E9VA 2C6DA 2YLEA 3MPTA 4JLCA 3WYYA 2BZJA 2QU6A 4M7IA 5LARA 3R9OA 2XAOA 4BR3A 3QD3A 3D4QA 4I21A 4BHZA 3DA6A 4PTGA 4JBPA 3BWJA 5AUUA 3Q9YA 3SV0A 3OXTA 3AQVA 3FYJX 3W2PA 4L8MA 4NUSA 3EWHA 5LOHA 1XH7A 2BROA 4X3JA 2B54A 1Q61A 2AYPA 4IMYA 3NNXA 3NDMA 4KIKB 1KOBA 4OR5A 3D0EA 2UZNA 4FA2A 5ETCA 4AA0A 5BPYA 4YHTA 3CLYA 2JKKA 4FV9A 3RWPA 4HVSA 3VS2A 4UMTA 1V0OA 1U54A 1WBSA 4BJJA 3E62A 4QP1A 3CTQA 5FBNC 5FQDC 5AP5A 4AP7A 1YXXA 5FGKA 5GJFA 3RI1A 2BHHA 2J9MA 3NRMA 4LQMA 2NRYA 3D5WA 5HNBA 3TIYA 5CANA 4NJDA 5FXRA 5AUVA 3G0FA 5LXMA 3MPMA 3QX4A 4KIPA 2F2CB 3O7LD 4FV3A 5D1JA 5CTPA 4F7LA 1WBPA 4NTTA 4EK4A 4U42A 5IEXA 4U97A 4LDTA 2BIKB 4IAFA 5ICPA 4DGLC 2CNVA 3EN7A 4AXEA 4R7HA 3NUNA 3MFTA 4BCKA 3NWWA 2J51A 4RQKA 1KOAA 3G9LX 2PWLA 3ZLYA 5HD4A 5K4JA 2R2PA 2J0MB 3Q52A 4CSVA 2VTRA 4S31A 3PJCA 4BBFA 4MQ1A 3RK9A 1ND4A 2X9FA 3EN6A 3EH9A 2WMVA 3ACJA 3HDMA 5EYDA 1E9HA 4AOTA 3GVUA 1DM2A 1R0PA 5BVKA 4BCJA 2HCKA 4QQTA 3Q4CA 3LXNA 3TNQB 2WTDA 4CVAA 5GJDA 2W1IA 3WIGA 1LEZA 4NFMA 2HAKA 4M69B 3BWFA 5HU3A 4RJ6A 1WBNA 2B9JA 3HRCA 4FZFB 4DBNA 2R3GA 3DS6A 1NVSA 3HV6A 4L42A 5BYYA 2FH9A 3D5XA 3CY3A 2GNJA 4ZSLA 4XEYA 3BGPA 3PFYA 3DKCA 1OKYA 3PZEA 4O83A 3BL9A 4F78A 1H07A 4IX4A 4UN0C 2V62A 3JPVA 3OTUA 2YM6A 4FRFA 4DTBA 4ZTRA 4OAVB 3UO6A 5I5ZA 4RSSA 5HE0A 4AOIA 2LGCA 3BQRA 4RIYB 4C4JA 1GZ8A 4J95A 4A06A 4JR7A 4DLJA 1PMNA 4S34A 2CLQA 4GIIA 5J7HA 4YZ9A 5ITAA 1JKTA 2VNWA 5IH6A 4BCMA 3HX4A 4OTDA 5L2WA 4E4NA 4NM5A 3CSVA 1Q3WA 3QRUA 1EH4A 3DY7A 4BDCA 2UW0A 3C0HA 3D2IA 3FXWA 1P4OA 3HMIA 3QXOA 4G1WA 4XS2A 3S1HA 2Z02A 1W98A 2ACXA 2XB7A 3KVWA 3NS9A 3TDVA 4FSMA 3IDPA 2YCSA 2HZNA 3MWUA 4HVDA 5HCYA 3NUAA 4RJ4A 4K6ZA 3TTIA 3WZJA 2ZB1A 3RP9A 4FIHA 5JFXA 3CPCA 1PY5A 4JX3A 5IH5A 3MTFA 3HMOA 2ITTA 4FTUA 2QOIA 4GK2A 4ZMFA 4M66A 1UU8A 5I9YA 3Q4ZA 4P5ZA 2RIOA 2VWWA 2F7EE 3R8ZA 4EJNA 2C1BA 2JEDA 2Y8OA 3N9XA 4AXCA 3BKBA 2OXXA 3DGKA 3BE2A 1XMMA 2WOTA 3DKGA 5CAPA 3QTRA 5DA3A 4LRJA 5JGBA 2XK8A 5M09A 4CZYB 5DMZA 5L8JA 1GJOA 3MTLA 4TXCA 4F9YA 4F09A 2XK6A 4MKCA 4IIRA 3UOKA 5D41A 1ERKA 2VTIA 4BIBA 5BVDA 5C1QB 4U81A 4Z16A 1J91A 2JD5A 4WG3A 5H9BA 4W4WA 3E3BX 5BYZA 2BZIB 3NYNA 3Q5ZA 3UMWA 3AC4A 3OVVA 5KBRA 5AA9A 4CKRA 3DNDA 3IK3A 3TI1A 3GU8A 4MK0A 4CXAA 4ZLOA 2XBAA 4JDKA 4K33A 5HVYA 4HW7A 1H1PA 4OT6A 4YTHA 4F08A 4EZ3A 4S2ZA 2QCSA 1W83A 2BRBA 3VBYA 3ZUUA 5HX6A 3NIEA 4C3PA 4E6QA 1M52A 2XBJA 5GIPE 3NPCA 4MNEB 4XV9A 3PY0A 2BR1A 3FY2A 3PRIA 4FKQA 4UYAA 5IUIA 4IC8A 2BPMA 3AD4A 4RVMA 4EBVA 1JQHA 5CQUA 3SRVB 4HCTA 3CC6A 4FT3A 4O0RA 2GFCA 3QTQA 1KE8A 3GC9A 4D2PA 1J7UA 1P14A 3DDPA 3MH1A 4BDBA 3G15A 2Z7QA 1YDTE 4FL2A 3OP5A 4FODA 4MH7A 5L2IA 3C9WA 4L6QA 3QTZA 3LQ3A 3KB7A 4C02A 5E8UA 4ZTMA 4BYIA 3FI4A 3II5A 3ZZEA 3D2KA 3HRBA 2CN5A 5ETIA 4QP2A 4XG2A 2C6LA 3FMDA 5EW8A 3IS5A 3MIYA 4J53A 3A7FA 3FMNA 2B53A 2YCRA 4FOCA 3BQCA 3ZO1A 5FM2A 4U6RA 3LFQA 2QURA 3VS4A 4BGQA 4F9AA 2QHMA 1YWRA 5IQDA 1WFCA 3EMGA 2ZV8A 1R78A 3PPKA 5HLPA 3FLZA 2XM8A 3JUHA 3E5AA 2QONA 3GC7A 3QKKA 5CS6A 3VUDA 4LOOA 5I4NA 5LVPA 1QPEA 2C5VA 5IU2A 3P23A 5HICA 3RHKA 4PWNA 4KWPA 4HGLA 1V0BA 3AC5A 4APCA 5DR9A 3R8PA 3ML1A 3DKFA 4RLLA 3PJ8A 5AMNA 2O65A 3PXQA 1OMWA 4JBVA 4MXYA 3E8CA 5AUTA 3H3CA 4TWOA 3BLRA 5EOLA 3JVSA 4CFXA 5BX0A 3UOHA 1PF8A 3MA3A 2X8EA 3V3VA 3SXRA 1U5QA 2ONLC 3F5PA 5D10A 4QMTA 4C62A 2VO7A 3FZRA 1Q99A 2XM9A 2VTOA 3DB8A 3CS9A 2Y6MA 2NPQA 2JFMA 2VWVA 3G9NA 3O8TA 4QTDA 2PL0A 3ALNA 4BDHA 2YAKA 2PZPA 3FZPA 4FF8A 5A6OA 1GZOA 4NEUA 1CDKA 5DLSA 4QQJA 4XH6A 3QCSA 5AV3A 3W0MA 2PVJA 3EHAA 3QKLA 2WTJA 3DB6A 4IFGA 4IM3A 5EW3A 4I6FA 1NVQA 3H0YA 5E8XA 3JY0A 4DG3E 3ZOSA 2W4KA 4YLLA 4H3QA 3LCTA 3ORNA 2OFVA 4BTJA 2NNWB 1H01A 1XBAA 2PZYA 3EOCA 4BZOA 3OS3A 4ZK5A 3VONA 3VRYA 5EKOA 5LMKA 2UUEA 5IA4A 2WQEA 4NTSA 2FYSA 4BBEA 2OZOA 4FSYA 4XP0A 5BUIA 2OLCA 3RVGA 4YNEA 5GNKA 4D58A 3HA6A 5IA1A 4D2SA 4J99A 3IGGA 3PWYA 1O9UA 3PFQA 4O0SA 4TYHB 5BQ0A 3NW7A 3W0OA 5AR8A 4IB1A 4GEOA 3RPRA 3FY0A 3UZRA 4U9AA 3NMUF 4O38A 2RFEA 1IG1A 2B7AA 4AZEA 3F5UA 3WILA 3UZPA 2CKPA 4DH3A 2XNEA 3M42A 4IVCA 3I60A 5E7RA 4NZWB 4CMOA 3GBZA 4S30A 3OEZA 3E93A 2FO0A 3HAVA 2UZWE 3TZ8A 3LMIA 4WNMA 4FKSA 3TACA 4CFUA 4FNWA 3G33A 3QQGA 4BTFA 2Q0NA 5AV1A 2BCJA 5DG5A 2ZOQA 3HP2A 5HVJA 5F1ZA 4C4EA 1MRUA 1QCFA 1Q4LA 3D7TA 4ZAUA 3HUBA 5HTIA 4YO4A 4L9IA 4A7CA 5AP0A 3HYHA 3QUPA 2DUVA 2X0QA 4ASEA 3MI9A 4RJ5A 4FKGA 5M53A 2X0OA 3LAUA 3MH2A 3MFUA 5AR3A 2J50A 3W8QA 4BC6A 2J90A 5IUHA 3SG9A 4GK3A 4UZDA 2HK5A 1PJKA 2BIYA 2R9SA 3AOXA 2C47A 3R1YA 4A4LA 1MQBA 5DI1A 3UPZA 2R64A 2DYLA 4UWBA 3U8WA 2YEXA 3UE4A 3UC4A 2C68A 1H00A 2JDRA 1FOTA 4IQ6A 4ZTSA 5KBQA 5CSPA 4DTKA 1SMHA 3BU6A 2O5KA 2R3QA 4EL9A 3VC4A 1T46A 3PE2A 1KV1A 2WEVA 1XR1A 4FV6A 3UC3A 3BZ3A 4D1SA 3O2MA 2UZLA 3DZOA 3FWQA 5CSXA 4K18A 4YPSA 4L7FA 3KXGA 3ZO4A 4OTWA 4QMYA 2J0JA 1S9IA 3MDYA 4LM5A 5E8SA 5HOAA 5HBEA 2W17A 3QQKA 1VZOA 3TNPC 4QP8A 5BMMA 3D14A 3UNZA 4ASDA 1H1QA 5M07A 4ITHA 2GS6A 2PUUA 4U40A 3KRXA 5ACBC 2OI4X 4YR8A 3QRJA 3DJ6A 4IBMA 3KRWA 4DFNA 2EU9A 4C34A 3CR0A 3PSCA 3MPAA 4ZS4A 1P4FA 2BZKB 4FKTA 5EDPA 3KRJA 3UYSA 1YOMA 3V8TA 5CSWA 4EC8A 3V8WA 4EKKA 2XK9A 1S9JA 3NX8A 1QPDA 3O51A 1VEBA 5EOBA 3VWAA 4G16A 2R3RA 3JVRA 3PXZA 2XKCA 3JYAA 3PVBA 4IDVA 4WSQA 5HHWA 4L7SA 3WARA 4X6QC 1W0XC 4JX7A 3QC4A 3LCKA 3NAXA 4JMQA 1R0EA 4X21A 3LFSA 1L8TA 3PA5A 4QMZA 3F69A 4MAOA 2YACA 2QU5A 3MYGA 3FZTA 3FZOA 3QC9A 4O21A 3KIOC 2ETMA 4EH6A 3L1SA 1M14A 3UQGA 1T45A 2NP8A 3G2FA 4J1RA 3NEWA 4M13A 3UDBA 4F99A 4G5PA 4IM0A 1TQMA 4YJVA 1OPJA 4N4SA 2G2IA 4RIXA 1Z5MA 3A60A 4MXZA 4DDGA 4DFZE 4FK6A 4K9YA 4RX5A 2XALA 2H6DA 3DXPA 1WBWA 4ACMA 2BHEA 3ZRLA 5E91A 3P4KA 4IWOA 3LJ1A 3QZFA 4F0GA 1Q8YA 2IW8A 4KNBA 4GS6A 3QCYA 4YURA 4MQ2A 1LP4A 3TYKA 3B8RA 4CQGA 4C33A 4M15A 1URWA 2HIWA 4FZAB 4O0UA 5DFPA 5C27A 4DGMA 3RBWA 1MRVA 1UA2A 4JJRA 2IVSA 2J2IB 4L00A 4DGNA 2YAAA 4MCVA 3MS9A 3R9RA 5AP1A 2PMLX 3LM5A 4O7TA 3L9LA 4FL1A 4JRNA 4PQNA 4R1YA 5CVGA 3S2PA 4ALVA 3TKHA 5M44A 4O7RA 3VVHA 4IWDA 4DT8A 2ITYA 4UMRA 3ZUTA 2W1GA 3UGCA 4O6EA 3GXLA 5DHJA 3TV7A 4DA5A 1U5RA 4BDEA 5IISA 5M56A 3D15A 4QOXA 1IRKA 2IVVA 3LJ2A 3N51A 3Q60A 4J52A 4RIXB 3OT8A 1XH9A 1IR3A 4FSQA 1E1VA 3KN6A 4PPCA 1IASA 5CSHA 2GU8A 3AMAA 5FTQA 4O4DA 4XP2A 3EQGA 4G6OA 2UZEA 3FQEA 3DQXA 4GFMA 4I3ZA 4G3CA 3P08A 3W0RA 4QQCA 4DGGA 4YU2A 3HECA 3IDCA 3U6JA 3R71A 5DIAA 4YJQA 3OC1A 2IW9A 1BYGA 4AA4A 4K0YA 5FEEA 3B8QA 3BYUA 3QTXA 4BDKA 3Q53A 4ZP5A 2C6IA 2P33A 4CD0A 3TDWA 4TZRA 3C50A 5BVFA 3MW1A 4TPTA 4F7SA 2YFXA 3IW8A 5BMSA 4IXPA 2IZUA 4FNZA 4IWQA 3M11A 2EB2A 3W18A 4F9CA 3QALE 2W05A 1M7NA 3R00A 4MX9A 2YM7A 1HCLA 4BB4A 5JRSA 4OW8A 4RQVA 1SVHA 2G01A 3JY9A 4I4EA 4F1TA 3VQUA 4IH8A 4BI1A 2YWPA 5IUGA 2QKRA 2GHGA 4C0TA 2RFSA 2OF4A 3TUCA 5AEPA 5L8LA 4FVPA 4UWCA 4RFMA 1FVVA 5IQCA 4HCUA 3NVKI 3MFSA 1DI9A 3QZGA 4GVAA 2BRHA 3QQJA 1J3HA 4FUYA 2YZAA 3LLTA 2PVNA 2YDIA 3TJCA 1U4DA 1XHAA 2BAKA 2HZ4A 4IVBA 5IEYA 4JAJA 3AT3A 3ULZA 1BL7A 2I0YA 4G34A 4KD1A 4TYHA 5JFWA 1RDQE 1RE8A 4UX9A 2IZSA 4S32A 3L9MA 4RA5A 3BCEA 2X81A 5J7BA 4IX5A 3I6WA 3WIKA 2ZVAA 4IE9A 3ZMMA 3ZLXA 4E5WA 1CKIA 4CGAA 2R3PA 2OXYA 3FSKA 3NUPA 4XG3A 1H26A 5EKNA 4DEIA 4AGWA 5F9EA 5J5SA 3W0SA 2ONLA 2X39A 3C4EA 3WI6A 3JR1A 2C5NA 5CU4A 4FKJA 3DV3A 1ZRZA 5LMAA 2X8DA 5KO1A 2QOOA 1OPLA 2G9XA 3NCZA 4JQ8A 4IW0A 3CQWA 2GTMA 4QMLA 3PA4A 3MA6A 4NYEA 2WGJA 1KV2A 4CRSA 2KTYA 4FJVA 5IQEA 5LMKC 4IAAA 2J5FA 4BI0A 3ANRA 3KVXA 3QQLA 1H4LA 4JS8A 4NU1A 3HZTA 3OZ6A 2W4JA 3TKIA 3ZSIA 4QDVA 4RWJA 2YDKA 1H0WA 2AC5A 4E4XA 2O64A 2OH0E 2Z7LA 4I5MA 2BDJA 4RBLA 3R8UA 3TEIA 3VS6A 3GT8A 3CTJA 3NYOA 2P0CA 2WD1A 4YHFA 5CEPA 4HJOA 1G8JA 2VTPA 2XK4A 4H1JA 1U54B 1YI6A 2X6EA 5HO6A 4FV7A 3P1AA 4JQEA 1B39A 4LUEA 3IKAA 5AADA 2HZ0A 1OI9A 2OICA 3PA3A 3EQIA 4WNOA 3NUSA 3S3IA 1Q97A 3EFJA 2X4ZA 4IVAA 2CKEA 5AUYA 3UNJA 4AE6A 4FT7A 2UW7A 1KE9A 1Y6BA 3TNHA 4EOKA 4QMUA 5DT4A 3W33A 4ACCA 5CT7A 3KC3A 2QC6A 1JSUA 4DF3A 5FEQA 3HV4A 3DK3A 1WVWA 4ACHA 3NUUA 4GJ2A 3U6IA 3CE3A 4OTFA 4EONA 3IW5A 2X1NA 3Q9ZA 4KKEA 2A0CX 4O22A 3QCQA 4E5BA 5AAFA 4YC3A 4G6LA 5E4HA 4GIHA 3LCDA 3BHUA 2WQNA 3KFAA 4I6QA 1UNHA 2A19B 4JL9A 3EFLA