4IX6A

Crystal structure of a stt7 homolog from micromonas algae soaked with atp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
346
structure length
346
Chain Sequence
LKARGGPKTLRRTPGVEPKDIRVLPGPLGSGNFGTVFRGVFKGDQDVVLKNAKADVMAAEELLECEMDVNYHVHANAKGTCARFMGCIELGAKDGGEIYNGTLTEGLWLMWANEGENTVEALMRRGTAPLATAMACADATELGVTKKAMRELLGSLARLHECGVVHRDVKPANLIAAEKDGGVLKLIDLGAAALCLPLPETLNYYPGDGPADPRYAKADELYLLPPGSPRPTKDNAAKLWEAHKPDRFDSWSAGCVMLQLAVVGLRTDAGLERFLADYKAVGYDVNAFRGEKSGEYGTMDFAALDANGGAGWDLCQRLMEAERDARASCEAALSHAFFDAAALEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MsStt7d protein
publication title Structure of the catalytic domain of a state transition kinase homolog from Micromonas algae
pubmed doi rcsb
source organism Micromonas
total genus 106
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ix6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ix6A01
5I9VA 1H08A 3FI2A 3MFSA 4HPUE 4O91A 4APPA 2X6DA 4FTCA 4PDOA 4Y5HA 3R63A 5CU4A 2BPMA 2R0UA 4RQVA 3VW8A 4BVUA 2B0QA 5GJDA 3A8WA 1UU9A 4RJ5A 4P7EA 3UZRA 3PJCA 3ZEWA 5F94A 4QMVA 3EQGA 5IA4A 1SYKA 2OH4A 1K9AA 5KMKA 4QNAA 4U43A 3UQFA 4F0FA 4TPTA 3UYSA 4CTBA 2C68A 2WFYA 4BHZA 1Q8YA 3ZDIA 3BHTA 4DT9A 4UN0C 3FMNA 2VTMA 3DCVA 4O84A 5EW9A 2WQOA 2B9JA 3NLBA 3UIUA 4HVDA 1NT2A 3MPTA 4FKOA 4D55A 3DNDA 5HVJA 4JIAA 1W82A 3ZBXA 3RMFA 4PY1A 5HU3A 2QVSE 3Q3BA 4PX6A 2OIDA 5JMSA 3MW1A 3FDNA 1U5RA 3JVSA 2P2HA 1U59A 3MS9A 4JRVA 4TWNA 2NRUA 3F5PA 3UQCA 4R7BA 3LQ5A 2FSLX 3KXMA 5AR5A 4EH5A 2V55A 4MNFA 2BAQA 4BWKA 4IM3A 1ZYJA 1WCCA 3C4XA 3RHXA 3ZSHA 4O96A 4CFMA 3U54A 1P5EA 4ZAUA 1RJBA 4GU9A 3SKCA 5IDPA 4IANA 4F6SA 2EU9A 4KS7A 4DITA 3G5DA 3H4JA 1J1BA 3DBQA 1KV1A 3MBLA 2GS2A 3NNXA 5HLPA 5KMJA 5L6PA 2QOIA 2REIA 4MF0A 3KCKA 3PVWA 1VYWA 4A9YA 4ZJJA 4BWPA 5FP5A 4OAUC 3BIZA 3P4KA 5HBEA 4HZRA 3NUSA 3R1SA 4I4EA 2AC3A 2CLXA 5CAVA 3LMHA 1YW2A 2HWPA 4ANQA 4Y5QA 4BIEA 4JQ7A 2VAGA 4R77A 4IVBA 4EWQA 5K0XA 3ULZA 4BCOA 3LFSA 4E4NA 1OIUA 4F0IA 2HIWA 4Z3VA 2XKEA 3TEIA 3R71A 4BCKA 4OTRA 5EHLA 3IS5A 5D10A 5T3QA 3FMHA 4HNIA 4I1ZA 4MNEA 4B4LA 3AT3A 2Z7RA 4J1RA 4M67A 4AF3A 4PQNA 2GHLA 2O3PA 1RW8A 2V22A 4CFVA 4O22A 4RIYA 4EC9A 4AN2A 5AMNA 3D5XA 5FEEA 2ZJWA 4JDKA 3GB2A 3NR9A 3U87A 1P4OA 1ERKA 3QUDA 3KN6A 4Q9ZA 2YABA 3NGAA 3WARA 3BQRA 5IQGA 3BZ3A 4N70A 4Z7GA 2WKMA 1OKZA 3IG7A 3FC2A 3HRFA 3NIZA 2YIQA 3V8SA 4UZDA 1KWPA 4L7SA 3UMXA 2R3MA 4DH8A 5FRIA 2F7EE 4R3RA 1B39A 4ZSGA 5L6OA 4I24A 3ZRMA 2QCSA 2QLQA 1OVEA 2Q0BA 3MTFA 4YJQA 4FV5A 5AM7A 4IZYA 1KSWA 4JAIA 3OWKA 5DWRA 4YGAA 4DH3A 3C5IA 3EKKA 4PWNA 2Z60A 2IZRA 4R7HA 5IQBA 4I0TA 3ZUVA 4GIHA 4OR5A 4AOTA 3OP5A 3OXZA 5KNJA 2ESMA 4RFYA 1UNLA 2J4ZA 4IVCA 4BI2A 4C4FA 1V0OA 2XEZA 2XIYA 4U80A 4YNEA 1E1VA 2X1NA 3QTUA 2GDOA 3PTGA 3ZC5A 5A46A 3U6JA 3GC9A 4LL0A 3K2LA 3UTOA 2UVZA 4MXXA 1OKVA 3VBXA 2C30A 3AC3A 3IW8A 3LLAA 3UGCA 2UZEA 1Q5KA 3FY0A 4B9DA 1XBCA 3N4UA 4FZAB 4F7JA 4QYEA 1X8BA 4D58A 3EH9A 4MHAA 4ZS0A 3R9DA 1UU3A 5AP5A 4ZSAA 4GIIA 4JIKA 2FO0A 4A9UA 4WHZA 2GPHA 3QCYA 3CC6A 3EMGA 5DBXA 1JNKA 4RG0A 5IUGA 4QMSA 4RZVA 5BUJA 4D28A 2C3LA 4JRNA 5AX3A 4S33A 1TQIA 4D9UA 4JDHA 4YJVA 4FT9A 3ZSGA 4F64A 3DJ6A 4MNEB 3A7HA 3PSBA 5CF6A 2WU7A 2FH9A 3MFUA 3V6RA 4ASXA 4TTHB 4GFMA 3F3TA 4RIYB 3FZPA 3FXXA 2A4LA 1PJKA 2E9NA 4QP7A 4DC2A 1REKA 4I93A 4PDSA 5CT7A 1LPUA 1KOBA 1A9UA 5GJFA 4YJRA 5D7VA 4DGOA 4CZUA 3IK3A 4QQCA 2ITUA 2CGVA 4FE2A 4FSRA 4XV1A 2HXQA 5HBHA 3G15A 1FINA 4MBIA 3F3VA 4AZTA 1OIQA 3V04A 3O8UA 3ZO2A 2GS7A 3IKAA 1NY3A 2B54A 3L8VA 3V5JA 4AFEA 4O7NA 4C37A 4MVFA 1FMKA 2W4JA 4J8MA 5FGKA 3ELJA 3VW6A 1PYEA 3EN6A 1YWVA 4HYHA 4UB7A 2BRHA 4JDIA 4JJRA 4QP6A 5HU9A 5I9YA 1PF8A 1OBGA 2VGOA 4G5PA 5LARA 3QTIA 3VUGA 3RBWA 1H01A 3F88A 1O9UA 5CI7A 3SC1A 3F5GA 4E5WA 3VBTA 4E7WA 3O71A 4I23A 5E9EA 2ZV2A 2W1GA 1BL7A 1OITA 3E8DA 4USDA 5DI1A 3VHKA 2VGPA 2VO7A 3D4QA 4A9SA 4EOMA 3MJ2A 3NZ0A 2W96B 1XJDA 2G2HA 3NCGA 3LFQA 3RGFA 3FZTA 1CDKA 2XZSA 1I09A 4GMYA 1WBTA 3L9MA 4O2ZA 3BX5A 4ZOGA 4BCIA 2CN8A 2GNGA 5DRDA 3HRCA 3QCSA 4X2JA 2ZV7A 4EHZA 3A7JA 3PE1A 4DFYA 4ZTQA 5DVRA 4D2VA 3OFMA 4QP8A 3JY9A 3RZBA 4QMUA 4Z55A 3EQHA 2ETMA 4FC0A 4D2RA 3EN7A 3NS9A 4E5AX 2X2MA 3LFDA 5JEBA 2F57A 4RMZA 2G01A 1DAWA 4YSMA 3QTQA 3QA8A 4F9BA 4BF2A 1UWHA 1GJOA 4JI9A 3WYXA 2X39A 3CCNA 3OC1A 1FGKA 2J2IB 3LFEA 4PTGA 4U3YA 5ETFA 4IHPA 3UNZA 4EOOA 2E9UA 4MD7E 2BZIB 3U8WA 4CCBA 2ITTA 2RKUA 2WMQA 4KSQA 5HO8A 4ALUA 4D2WA 3Q9WA 1HCLA 3PZEA 3ALOA 3O50A 4DFXE 4UWYA 1XH8A 4CKIA 4EUUA 3ITZA 3RPVA 4ANOA 3TV7A 3OCBA 3K5VA 1H4LA 2ACXA 5HORA 2QOKA 2IN6A 2VRXA 2W4KA 4BDKA 2HZ0A 3I1AA 5EM8A 1XR1A 3PJ2A 2UW0A 3R0TA 4RC4A 1YKRA 4UMTA 5CU0A 5E8XA 2XCKA 5DR2A 4I6BA 4I5MA 3LJ0A 3MA3A 5FDPA 2WMTA 3D7ZA 2E2BA 3M1SA 1ZZLA 4U6RA 4OBPA 3C0IA 4L44A 4ALVA 4AGCA 4ZMEA 3POZA 4A4OA 4ZMFA 2H96A 3JY0A 4L6QA 3DXPA 1NVSA 2IO6A 4I6FA 5A4CA 1JKKA 3NPCA 4O0SA 4ZZNA 4GUBA 5AR3A 4ZTSA 5EW8A 5HX8A 1YDTE 3DU8A 3EYHA 5J5SA 1PXNA 2VTJA 4EK3A 5G6VA 4DEIA 3FEGA 3FI8A 2Y8OA 1WVYA 2RSVA 3P5KA 4CYIA 2PZPA 4DYMA 4H1JA 4E26A 5JT2A 4KS8A 4W4WA 3JXWA 5FG8A 1DS5A 1DI9A 3ZEPA 3HV7A 2OK1A 5GHVA 3LFFA 4F9YA 1JKSA 4FSMA 5IEYA 2F2CB 1G3NA 2JLDA 4YZBA 4X6RA 5FWKK 4BBFA 4ZZMA 3HP5A 4FEXA 2VTSA 3V8WA 4WO5A 3PXKA 3Q5ZA 3KMWA 4IFCA 2PMNX 1SVHA 3SVVA 1TKIA 2I6LA 3BHYA 5L8LA 2IW6A 3DTWA 2VTOA 4NW6A 1JQHA 3TZ9A 3IDCA 4QOXA 4AOJA 1M7QA 4IDTA 4FTUA 4XG4A 1ZYLA 4AA5A 4XJ0A 2YACA 5EDPA 4F9CA 3HAMA 4CSVA 2PVJA 3SX9A 4F09A 4FNXA 4KRCA 4IJ9A 2P4IA 5E8YA 4BI1A 2I0HA 3PG3A 5KCVA 2IW9A 3FMDA 1U46A 4F9WA 2J0MB 1YDSE 3MGYA 4R5SA 4FYNA 4XP3A 5CSXA 5FTQA 2PE2A 4OLIA 3RCJA 3HECA 5KUPA 3UIBA 4X2FA 4D4RA 4UEUA 4NEUA 1Q8UA 2UZUE 4UXQA 4F7SA 2R3OA 3P1AA 4U40A 4E5BA 3FLYA 4KIQA 3ORKA 2DWBA 5DYJA 3PA3A 1H24A 2C6TA 3HA6A 3Q9YA 4O7TA 3ZBFA 4IW0A 3IW5A 5G1XA 3GU4A 2OI4X 4YC6A 4NL0A 4TWOA 3GFWA 2BTSA 4IC7A 2RG6A 2JKQA 5A9UA 4D0WA 2XRWA 4RFZA 5IH6A 1ZYDA 2CCHA 3D2KA 2YM3A 1MRYA 1IRKA 3L9NA 4HGEA 4M3QA 4QMLA 4JVGA 4GT5A 5EK7A 4F0GA 4E6DA 1KE9A 3FMMA 1Q3DA 4JBOA 5J7BA 3CTHA 3B8RA 4J52A 4O0UA 3R8ZA 3W8LA 5CI6A 4YTHA 3RALA 4D1XA 4LOPA 3QRKA 5J1VA 4G3CA 4QMPA 5EM5A 3COMA 3R7EA 4DTKA 3S95A 3TNIA 1UWJA 3WIGA 2WAJA 5IPJA 1Y6AA 3FZ1A 3PIXA 2XIRA 1Y8GA 2F2UA 3D94A 4AGWA 3KXHA 4RJ6A 4YNOA 3ZLXA 5I5ZA 2GS6A 2QG7A 2YWVA 4OW8A 2FSTX 4NH1A 3FI4A 4F65A 4MKCA 2H34A 4QO9A 3OG7A 4QYYA 5A3XA 3W33A 4D0XA 5ANEA 4EI4A 2XIKA 1XH6A 3RKBA 3COKA 3UMWA 3D2IA 1W0XC 2BR1A 3N51A 4JAJA 4BCFA 5JQ5A 1YRPA 3C4WA 4H36A 2PTKA 2WZJA 4NKSA 3TKHA 3W18A 4F63A 4FK6A 3U6HA 1J1CA 2B1PA 4F7LA 1OIYA 3IW6A 3LJ2A 2W1DA 4O0WA 3C0HA 1M52A 4DFNA 3JR1A 2Z2WA 5AP4A 4CNHA 4ZSLA 4BGHA 2YIYA 3EFKA 3CGOA 4JBQA 3C4ZA 4ONAA 5EKNA 1Q4LA 4FTTA 5EOBA 3ORIA 4B99A 3TM0A 1JVPP 2WD1A 3BU5A 4MK0A 3RTPA 5DH3A 3HMPA 3DV3A 1TVOA 1B6CB 4YHTA 3UOLA 2X6EA 3A4PA 2YM4A 4BCMA 5C4KA 5E8WA 3QKKA 3DZOA 3EZVA 4PMTA 2JFLA 2ZMDA 3Q2MA 3M2WA 1RE8A 3KXXA 1XHAA 2XNPA 4U79A 4PDYA 2KTYA 3R22A 4JDJA 3E93A 3ODYX 1OL5A 2JKMA 2XF0A 4X0MA 3V5PA 4MXOA 4BGGA 5KBRA 2PULA 2XNEA 2WEIA 2GNJA 3FV8A 4FF8A 1AD5A 2BAJA 2BRBA 3KFAA 4XG8A 4GFGA 3V3VA 5HGIA 3H9FA 4DA5A 2EXMA 5IA2A 4BKZA 5IA3A 1H1PA 3W2PA 3VUMA 2C3IB 5AAFA 3ZLWA 4XRJA 3I79A 5FEQA 3IW4A 3KY2A 2O0UA 4MXAA 3R7GA 5HI2A 4IFGA 4XUFA 3KC3A 2R64A 4GW8A 3G0FA 3QLFA 3DZQA 4UYAA 2JAVA 5HVYA 3DS6A 3LQ3A 3LXNA 3MDYA 4YJNA 4I5CA 2W05A 5J9LA 2FSOX 3IW7A 3AC5A 1OPJA 4GYIA 4KD1A 5KBQA 3PJ8A 4FTKA 4NZWB 3VRYA 4YHFA 3N9XA 1OUKA 3LAUA 4FTIA 3BHVA 4FL1A 5AP3A 2BMCA 5ANJA 1OI9A 3QXPA 5CEMA 1PMEA 2WMVA 4J7BA 4BFMA 2C4GA 2PWLA 3N4VA 3A4OX 2QO7A 2WTJA 2VTHA 3F7ZA 4FG9A 5CVFA 3K3JA 5CS6A 3MVJA 1YXXA 4MWIA 2R3LA 4YBKA 4FNWA 5CEQA 2UVXA 2VWIA 2ZMCA 3G90X 3IGOA 2CGXA 3GFEA 4RIWA 4DGMA 3LFBA 4F9AA 2IJMA 4U45A 2PE1A 4BCJA 4EQCA 3MY1A 4M84A 2WHBA 4TNDA 1GZNA 3GCUA 5FLFA 3G33A 4GH2A 4R1YA 5EM6A 5AR4A 4DFUA 5AR2A 3QUPA 3EQFA 3DK6A 2ZDUA 4FV0A 4E93A 3TTJA 2F9GA 2BDWA 2Z7SA 3E3PA 4BCPA 5AX9A 2XIXA 3H3CA 2C6IA 1P4FA 3ZRKA 3HVCA 5M56A 3WBLA 2ONLC 3U4WA 3NUXA 3PWDA 4RJ3A 5ANKA 4LV8A 3D5VA 4U8ZA 3E62A 4YMJA 5FTOA 3DB8A 5BQ0A 2JBPA 4FSUA 4UYNA 3RK5A 3ZM9A 2B4SB 4JX3A 4FBXA 5LMAA 3VUKA 1GOLA 3CLYA 4HOKA 3U55A 4RLLA 3PSDA 3Q9XA 3KRRA 3DA6A 4M0ZA 4GVJA 3TWJA 2JGZA 3HGKA 2QOQA 1Q41A 4YR8A 4PP7A 2UW7A 3A8XA 4NU1A 3ACKA 3Q4TA 3U51A 2EB2A 4ZJIA 4IVAA 4UMQA 4GU6A 1H07A 4L00A 4L01A 4Q2AA 1UU7A 2BRGA 2QKWB 3FL4A 4PDPA 3E3BX 4U9AA 1OECA 4IAIA 5CQUA 5GNKA 3ZHPC 3G9LX 3ID6C 3W1FA 1URCA 4FSYA 2YIWA 4NM0A 2YM7A 4C4EA 3DQWA 2NRYA 3I4BA 2JFMA 1F5QA 4RSSA 4FKQA 2I1MA 4CRSA 3ZFXA 1R1WA 5KMOA 2W1CA 5JN2A 2V62A 4ANSA 4BDEA 5HVKA 3NUPA 3VBYA 5FTGA 3A60A 4O86A 5IQEA 4N0SA 3TZMA 4UALA 3UO5A 3WILA 3I7CA 3R7UA 3LCKA 4FZDB 3OMVA 4MXYA 3FKOA 5DN3A 4AZVA 4C4GA 3U6IA 4BIBA 2ITPA 2OF4A 4XBUA 2X2LA 4L67A 5DNRA 4C33A 3RWQA 3NAXA 2OFUA 1G5SA 1QPEA 3SGCA 4L53A 4YPDA 1W8CA 4RIWB 1OKWA 3I0OA 5HD4A 2WOTA 4G3GA 2PVMA 4PNKA 1B38A 4TWPA 4KWPA 1Q8ZA 2V7OA 3NVMB 1KE8A 5E8UA 1ZOHA 3QQFA 4FT3A 2ZYBA 3OW3A 4FIEA 5CAUA 3R01A 2WMAA 3VN9A 5FXQA 3FMEA 4IH8A 5L6WL 1E9HA 1Q62A 2ZB1A 5IH4A 4J95A 4IM0A 4RWKA 4AA4A 3NW7A 3SOCA 4LGDA 3EQIA 3ZLYA 4EH7A 5ITAA 4V01A 4RQKA 3OCSA 5CZHA 3UC4A 4DG0E 4ENXA 5KHWA 3WI6A 4NM5A 3LHJA 3O7LD 2OWBA 4TT7A 5JKGA 4C3PA 3BWFA 3V8TA 2C69A 4IWDA 3PP0A 1GZKA 1SVEA 2WTKB 3KVWA 2UW5A 4AZWA 4RFMA 3VS7A 2YA9A 4E6QA 4XNEA 4BICA 4LG4A 3PY0A 3BWJA 2WELA 1L3RE 3KK8A 5I9UA 2XVDA 1DI8A 3L9LA 5LVOA 5EDQA 4OAVB 2VTTA 4P2KA 4YC3A 5E7RA 4FICA 5AA9A 3P7AA 2PMLX 4FVQA 1OKYA 5IQDA 1Z5MA 4RT7A 3R1QA 2XS0A 3O2MA 3KU2A 1Y6BA 4IB3A 3DOGA 3UZTA 1OBDA 4OTPA 5J1WA 4QTCA 1LR4A 3GT8A 4EOQA 4BDIA 2F4JA 3EKNA 3AD4A 3TL8A 1UA2A 3CP9A 3Q6WA 1V0PA 2EVAA 3R9OA 2C6DA 1JBPE 4CFUA 2YCFA 2VWXA 4EH3A 4JG8A 4G2FA 5KHXA 3ATSA 5LVLA 3NUYA 3UPZA 3ET7A 3KRXA 5BX0A 3OWPA 2ITQA 2X4ZA 3H0ZA 3T9TA 5GZAA 2WXVA 2I0VA 3GI3A 1YI6A 3OEFX 4MXCA 3C1XA 3EL8A 4FKRA 3QQHA 4D2TA 4KINA 2WMRA 4BC6A 4M69A 1OL7A 2P3GX 4XH6A 4EBWA 3PVUA 4WNPA 4M13A 2R0IA 5IISA 4II5A 3LVPA 1H0WA 2OH0E 3AC4A 1PKGA 4IXPA 2XBAA 2O2UA 3F82A 3FXZA 5CALA 5J79A 2OGVA 4XOYA 2W1ZA 2XYNA 3MI9A 5HOAA 5L3AA 4BWXA 3BYSA 4R5YA 1GAGA 4I6HA 3PJ1A 2RIOA 3ZLSA 3W32A 3TNQB 2OICA 2GFSA 3LZBA 4TYHA 3CSVA 3AGLA 1MRVA 3HAVA 3DB6A 3EYGA 4LRKA 5DEYA 4C02A 2ZVAA 4S34A 4UZHA 2XKCA 4QP4A 2VTPA 4EK8A 5HEZA 5LMBA 4XLIA 2R3KA 2UW4A 2W5AA 4WUAA 3RZFA 4RRVA 2Y9QA 3D0EA 3F3ZA 5A4TA 4MTAA 4BRXA 2JIIA 4N4SA 3RNIA 3Q6UA 4V0GA 3EL7A 5JQ8A 3HMOA 2UZWE 3DLZA 5JGBA 2JAMA 5FDXA 4OT5A 3BLHA 4FTOA 2A0CX 3KF4A 4MCVA 3PLSA 2GNFA 3C0GA 3RAKA 3CPCA 5KZ0A 1E1XA 4E4XA 2J50A 5CEIA 3RAHA 4N57A 4E4MA 2H8HA 4LMNA 3HMMA 3KRLA 5BVFA 5JH6A 4C61A 2XK9A 2UZLA 5C8MA 4A07A 3GC7A 3KQ7A 4PUZA 3BPRA 2OJIA 1CTPE 3TNWA 4DHFA 3QHWA 1VJYA 4B7TA 4AG8A 3VUDA 3QTSA 4M66A 3VQHA 1TQMA 3AT4A 3R73A 5TF9A 4LGGA 3JYAA 2WQBA 4BCQA 4DBNA 3LFAA 4EH2A 3BCEA 3FSKA 5HNGA 3MVLA 1Y91A 4KKHA 4KB8A 1ZRZA 3KXGA 4E6CA 5HO7A 4YTCA 3LPBA 3GC8A 4I41A 3VF8A 3HX4A 1J7IA 1IAHA 3VAPA 3R7IA 2RFSA 2XKDA 3FZSA 3OY1A 5M09A 2BTRA 1ZYCA 3MH0A 4O83A 4ITJA 4YPSA 5CEPA 4CMTA 4X2NA 4XG2A 4ZLOA 2XEYA 3VS1A 5L2WA 3MPAA 3UNJA 3G0EA 4YLLA 3DBEA 2YFXA 3WF5A 3W8QA 1KV2A 3ZO3A 1OGUA 4M69B 4YC8A 3C4FA 4BB4A 4DGNA 1KUTA 5E91A 2OG8A 4IZ7A 5ACKA 4XOZA 5DRBA 3FJQE 4HYIA 2CPKE 4RX9A 3NW5A 4ARKA 3FBVA 3IDPA 4BYJA 3I6UA 5TT7A 4OT6A 3CXWA 3TUCA 2YDKA 3AXWA 2IPXA 5ANDA 4RGJA 5LMKC 4W8DA 4QD6A 4QYFA 2VNWA 2PU8A 3ORZA 5HNBA 4CFXA 3QD3A 4TYHB 4GYGA 5FQDC 1EH4A 4LRMA 5A4EA 3MH1A 1BKXA 4TN6A 3PUPA 5LCKA 3VS6A 1XO2B 4MD9E 4NKAA 1Q8WA 3GU5A 2RG5A 3ZSIA 3LFCA 2JKKA 3CTQA 4WSYA 1GIHA 2PVFA 2XK3A 4DFBA 4C0TA 5B0XA 4DFZE 4V0GB 4ENYA 1H26A 4BTFA 2OF2A 2XJ2A 3GEQA 4L68A 3MSSA 3P7BA 4EH9A 5TO8A 5E90A 3NYNA 1SMHA 2HYYA 4OTGA 4HYSA 1MQBA 1WBWA 2GNLA 3CE3A 3SXSA 5C1QB 2ITNA 4KKEA 3ZO1A 4EYJA 4FSTA 4FIFA 4K1BA 5FM3A 3TDWA 5HCXA 4ZJVA 3NAYA 4G6OA 4HGLA 1M2RA 4FT5A 5C27A 4IX4A 4RX8A 4RC2A 3LMIA 4FTLA 4R6VA 5EHYA 2XK8A 3ALNA 4WIHA 4ACHA 4BDCA 2ITZA 5TE0A 3PIZA 3WF6A 5CAQA 3SHEA 1YVJA 3VJNA 4BKYA 2J6MA 2J0JA 3TXOA 3DXQA 2QKRA 5KMNA 4J53A 3PG1A 3UE4A 3AC2A 4FKTA 2BKKA 3NDMA 4RVLA 3QBNA 2ITYA 3UPXA 4BDHA 3ZONA 2QU5A 3FLNC 3Q4ZA 2IWIA 1QPJA 4EKKA 4XV9A 3UODA 4CLIA 3OS3A 3SRVA 4C3FA 5D1JA 3V5WA 4NM3A 4RVMA 2PPQA 1CMKE 4C2VA 3KXNA 1APME 4W8EA 3RK7A 2G1TA 4FT7A 4ACMA 4DEEA 3L1SA 3KXZA 2VWWA 3TJCA 1H1SA 5I3OA 2G15A 3TKIA 3F7WA 2R5TA 5HIEA 4BIDA 1HCKA 3E87A 4HVSA 4ZS4A 2J5FA 3AT2A 4FIIA 2JDSA 1QPDA 2G2IA 2OJGA 2VTAA 3LCSA 3BYOA 3C5UA 3Q52A 3QYWA 2OJ9A 5DT0A 2QD9A 3IQ7A 4WG4A 3LXKA 3G6GA 4FTMA 5EI2A 2R3RA 4RX7A 4X6QC 3VC4A 3AC1A 1J7UA 4JX7A 1V1KA 4RWIA 3TV4A 2ITXA 3ZXTA 4YO4A 5M4CA 2CKPA 4PTCA 1BX6A 3QALE 2PZRA 3IONA 3F9NA 4DF3A 3ATTA 2PUIA 1WVXA 2C6LA 3OROA 5K4JA 3EOCA 1W7HA 3CPBA 3LKMA 5BYLA 3ZTXA 1YHSA 3ANQA 3OUNB 2YCSA 3S4QA 4CZTA 3FI3A 4NM7A 4EH8A 5H3QA 5IA5A 4DH1A 3QGWA 1JLUE 3RVGA 1NXKA 3BKBA 1H27A 3EJ1A 2Z7LA 4K2RA 4NJDA 4ANNA 3EHAA 1M2PA 3EQBA 4AZSA 3C7QA 2W06A 3QCXA 3EN9A 3I60A 5EG3A 5BNJA 1R0PA 5DPVA 4FODA 5KKRB 3QZFA 4X3FA 3WOWA 2GHMA 3DNEA 4HYUA 4MF1A 3KKVA 4GK2A 5AP1A 3DBDA 4I21A 2QNJA 2R4BA 3QF9A 3ZMMA 5BMSA 2VUWA 3D5UA 4JBVA 2BUJA 5KE0A 3LCTA 4CLJA 3GXLA 2A1AB 3KULA 2BDFA 4JR7A 4HCVA 3DJ5A 5IDNA 5CT0A 3DBFA 4BDDA 5A4LA 5I3RA 3R7YA 4DG3E 5IQFA 5CF8A 3EZRA 3QX2A 3QZIA 3M42A 3MFTA 3F69A 3GCVA 4IB0A 5B2LA 4V04A 3SG9A 4MBJA 4DTAA 2NP8A 3DDPA 3GENA 4KBCA 2QO2A 3NUUA 4IVDA 4NYEA 2VTQA 1CKPA 1SM2A 1T45A 4K6ZA 4O1PA 2C1BA 2YERA 3SRVB 3OZ6A 3CQUA 3BEGA 2WTWA 5E8VA 4YJSA 3FC1X 4C34A 5HQ0A 3R8UA 3ACJA 2O63A 2R3HA 4JL9A 3PRFA 3QC9A 5K5XA 5IQCA 2R3QA 4AAAA 4XBRA 4QQTA 4P5ZA 4FK3A 4AW1A 1UKIA 2ZM3A 4BZDA 2EXCX 3AMBA 3IECA 3JUHA 5HTBA 3KCFA 5EI8A 4BHNA 5GIOE 4M15A 3FUPA 4I94A 5M4FA 2QODA 4CG8A 2PVHA 2Z8CA 4QTDA 5AUYA 5AR7A 4CV9A 2R3FA 3DFCB 1WFCA 3DAJA 3FAAA 5E8SA 4BY9E 2JEDA 4LFIA 4M68A 3SDJA 2UZBA 3NWWA 5M57A 4QMWA 1M7NA 4FVPA 2W99B 2CGWA 4FIJA 3QU0A 4DCEA 5A6NA 3BHHA 5CX9A 5IF1A 5ACBC 1JAMA 3BYVA 4DAWA 4O7RA 3EN4A 3TZ7A 4C4JA 4PL5A 5BYZA 5CVHA 4RWJA 3OCTA 1O6YA 4FOCA 5IQHA 3ZS5A 2XNOA 3FYKX 4L43A 2X81A 1H8FA 2PZ5A 4W9WA 2LAVA 1CKIA 3S00A 4MH7A 1UV5A 2PZIA 3R04A 3UVPA 2PUUA 4IZAA 3NIEA 4YZCA 4TW9A 3COIA 5T68A 3W2OA 5CEOA 3ORMA 4JQEA 3PXRA 4JQ8A 4I0SA 3PVBA 4L7FA 4X3FB 3W2QA 5CXZA 3A7FA 4O38A 4O7LA 3ODZX 2IZUA 2ZV8A 3LQ8A 3R2BA 2YN8A 4AT5A 3KULB 4BZOA 1L8TA 1LEZA 1NVRA 2J7TA 3MFRA 5AUVA 5CF4A 5J8IA 4CCUA 3OHTA 3LW0A 2OIBA 2R3JA 4KRDA 3RJCA 5AFVA 3R8PA 1CKJA 4FNZA 1PYXA 2VX1A 3MIYA 1LEWA 3UVRA 3R28A 3BRBA 5A54A 1YXUA 3EQRA 1PXKA 4FGBA 3FY2A 4FV9A 4EOSA 2ZM4A 2BROA 2J51A 4FG7A 4IIRA 5CLPA 3RPRA 4EONA 2WTKC 3KVXA 3FLQA 3IOPA 3ZFMA 1FBNA 5KMIA 2JDOA 2IW8A 1H1WA 1SZMA 3R7OA 5K0KA 2QU6A 4BN1A 5J9YA 3MIAA 4UX9A 2VN9A 2OBJA 3O96A 2YM6A 4BTJA 5DMZA 5EQEA 5EDRA 4O0RA 4DEDA 5L2QA 2VWVA 5FBNC 5F95A 3QTZA 4M12A 4F4PA 4QMQA 5CNOA 4USFA 4G6LA 1GZ8A 4CYJA 5JFWA 2WTVA 3R8LA 4ZZOA 3R30A 4D1ZA 2UV2A 4XLVA 1F3MC 5AA8A 2AYPA 1Y8YA 3VO3A 3R1NA 4HGSA 4EKLA 3O0GA 1QL6A 3L8SA 3VUTA 5CF5A 2DUVA 1TQPA 4XCUA 5CSWA 3A62A 2C0TA 5T6KA 4ACGA 5ICPA 4V05A 3KN5A 1BLXA 3HEGA 2HW7A 4LM5A 1DAYA 4J71A 3QZHA 4K33A 3PRIA 2W4OA 2PVRA 3SW4A 5HNIX 3AOXA 3KREA 4XG6A 3O17A 4AX8A 3KL8A 2GTNA 3TUBA 2X0GA 4F08A 4NCTA 3IGGA 2R7IA 3JVRA 4ANMA 5AUTA 4FYOA 4AFJA 4U41A 4FUXA 4FUYA 3AGMA 3F6XA 3TIYA 1NVQA 4FKSA 4KIPA 4U42A 4Y95A 3UIMA 2GU8A 4ASZA 2BDJA 3CKWA 1OPLA 4GG7A 4TRLA 5C9CA 2CJMA 3EFLA 4E1ZA 5J87A 5FBOA 4YJPA 4IX5A 3VRZA 2CGUA 2P2IA 4FTJA 4C8BA 3L8PA 3TZ8A 3K3IA 3OBJA 4TY1A 4E73A 3QAME 4FV4A 4BDBA 4P90A 2WMWA 4K77A 2OLCA 4LI5A 3L8XA 3ZH8A 1Z9XA 4HNFA 4TYEA 3ZUUA 3R02A 3VS3A 2R2PA 3QQKA 4FTQA 3UOHA 2B9IA 3K54A 5AIRA 5HHWA 5AUWA 2OFVA 3EFJA 5LQFA 4ZIMA 2Y0AA 3CS9A 3FMKA 4CFNA 2CCIA 2EB3A 2VWZA 3F2AA 1AQ1A 2WGJA 3ORNA 4X2KA 5ETAA 3QCQA 4FA2A 3UP7A 4DGGA 4D4YA 2QONA 2R7BA 1FVRA 1XKKA 3OT8A 4GRBA 5DG5A 5E8TA 2X7OA 2E9PA 2RFNA 4FVRA 1ND4A 5FP6A 3WF7A 4FX3A 4ZSJA 1BUHA 3VBQA 1OMWA 5CAPA 2QI8A 2XBJA 5BVWA 4F7NA 2Y6MA 4EYMA 1VR2A 2W0JA 2QLUA 5DLSA 2OXDA 1GIJA 1OUYA 1FQ1B 1ZMVA 2WO6A 4FKVA 5BVEA 4HVHA 4U81A 5AEPA 2GNIA 4GKHA 3P79A 4L3PA 3E5AA 4DE4A 5HE2A 4KUJA 1S9IA 4F1TA 4LMUA 5KMMA 3MB6A 3BBWA 2F7ZE 5M51A 4EZ3A 5AADA 4APCA 3ZUTA 2C47A 3K5UA 3PXYA 5JK3A 3P86A 2BFYA 2X2KA 2Z7QA 3D14A 2VTRA 1OZ1A 1WBVA 3CBLA 2CHLA 3HZTA 4H1MA 1VYZA 4U5JA 4Z9LA 3WF9A 3B8QA 2A2AA 2C0IA 3CJFA 4HPTE 4I92A 4L42A 4WNOA 4L8MA 3SW7A 3EWHA 4DBXA 4LUEA 3ULIA 3HP2A 4L46A 3AD5A 3OXIA 5AV4A 4AT3A 3PYYA 3FQEA 4XV3A 3Q4UA 1FOTA 4RIXA 2HENA 4I22A 3M11A 3SAYA 1Q99A 1Q8TA 3FWQA 3MVHA 2PYWA 1PXOA 3AC8A 3KEXA 2HW6A 3HYHA 4TZRA 3LOKA 4AOIA 1W84A 4M97A 1F0QA 4I3ZA 1BYGA 4I4FA 3UJGA 3GCQA 4X7QA 4FKUA 3A7IA 1YOLA 3I5NA 2VNYA 2X8EA 3VBVA 1HOWA 4BYIA 5B7VA 4R8QA 3EN5A 2XNNA 3QX4A 5CNNA 2YJSA 4FMQA 4ZY6A 4H58A 4TWCA 4QMMA 3TKUA 5IA0A 1J3HA 3W55A 4ACCA 1LP4A 1PXPA 3HL7A 3FMLA 2DQ7X 3QUEA 4BR3A 4GK4A 3U9NA 4C35A 1YHVA 2UZNA 2X7FA 2PY3A 4AZEA 3PLAE 3V5QA 3TJDA 3G9NA 4JT3A 2BFXA 2C5OA 1R78A 3RPOA 5HBJA 3ZZEA 4HVGA 2P33A 2BALA 1P2AA 3HNGA 4BDFA 3OT3A 2Q83A 4F70A 4S31A 5EYCA 3TTIA 2CNVA 4FL2A 3QKMA 3WIKA 4AQCA 3FXWA 4BCNA 4ORKA 1O6LA 4QP2A 5HX6A 2O64A 4XX9A 3BHUA 2F49A 5JZNA 2JDRA 4U97A 2PUNA 4PF4A 3H30A 2QOLA 2XNGA 3BI6A 5I0BA 2ZAZA 3GCPA 5E92A 3PA4A 2WIHA 1IA9A 3DT1A 4C36A 3RHKA 3DPKA 1O6KA 5BMMA 2J9MA 3E64A 2NO3A 3Q96A 3QD0A 4NJ3A 4A7CA 2C5YA 3DDQA 4NFMA 5HESA 2G2FA 2XA4A 2FSMX 1IR3A 1SNUA 3PXQA 4DINA 4ZTRA 2YDJA 3MWUA 4RA5A 4G9CA 3BEAA 2P55A 3FHIA 5BVDA 4O7WA 4GV1A 4B0GA 2QURA 2UZOA 5C26A 2ZM1A 4G16A 1VEBA 1JKTA 1QMZA 3PPKA 2RFEA 2QOCA 2GFCA 4IB5A 1M14A 4IC8A 4DH7A 1XH4A 3MESA 3P78A 4AA0A 4IM2A 3WZKA 5CQWA 2PVKA 1QCFA 1OM1A 5H8GA 4AT4A 1YOMA 4A4XA 2XP2A 3MPMA 4J8NA 1MUOA 5E8ZA 3PXFA 4RIXB 3S2PA 1ZY4A 3QFVA 3HLLA 4FG8A 1PXMA 5ANGA 4GEOA 1WBOA 4U0IA 3DK7A 2XM8A 2W9FB 3WZEA 2B9FA 3IPHA 3ZU7A 1CSNA 2CLQA 4NFNA 5EH0A 5H2UA 3SD0A 4A4LA 3FQHA 4GK3A 4N6ZA 2C6MA 2FA2A 4FV2A 4GCJA 5IEXA 3BE9A 2JDVA 4IWPA 1PY5A 3BYMA 4X21A 5BYYA 3QZGA 2H9VA 2Y4IB 4WT6A 3AG9A 2O65A 2VX3A 3TCPA 4CFWA 4M8TA 1A48A 4BBMA 3I81A 4QQ5A 5HG9A 5A14A 2I7QA 2YCRA 5CU6A 3BGZA 4AGDA 4LQMA 2HZ4A 3VS2A 1BL6A 3Q04A 4AW2A 3LXPA 3OWJA 3NYOA 3IOKA 3POOA 4G34A 3Q53A 2WMXA 4OTQA 5GIPE 3OXTA 2UZTA 2CKEA 3HDNA 5LVMA 5IEVA 4OTWA 2SRCA 3FMJA 4W4VA 3WZUA 4NSTA 5AUZA 2JC6A 4ZY4A 2JKOA 5KZIA 3A99A 3DBCA 2WU6A 2XM9A 3SA0A 1ATPE 3FL5A 5ETIA 3RWPA 4ZEGA 4FTRA 2YM5A 3VS0A 2OJFE 5ANIA 4R3CA 3EFWA 2C6EA 5DA3A 3E8EA 2JD5A 5HCYA 4EQMA 3SV0A 5KKRC 5CZIA 4B6LA 1MQ4A 5AUXA 3RM6A 2Y6OA 5HG8A 4G31A 4EK6A 5HE3A 2VU3A 4DEHA 2HOGA 3EQPA 3TACA 3UNKA 2QR8A 1YI3A 2GHGA 3QA0A 3QL8A 4ANLA 2R3IA 5HZNA 1FPUA 3S3IA 1URWA 3FZRA 1R39A 4ZXTA 5ANOA 3UQGA 1I44A 4QPAA 4EOKA 4GS6A 4IZ5A 4ACDA 5AIKA 4YZ9A 2WPAA 2B7AA 4AU8A 4IQ6A 1UNGA 1YXTA 3HKOA 3WZJA 5I9WA 3LM5A 5HIDA 4WSQA 5JFXA 2QOOA 2W7XA 4A9TA 3OWLA 3QGYA 4DCAA 3G2FA 1DM2A 2CMWA 2HZIA 4M7IA 3SQQA 4CGAA 4FKIA 4FZFB 2XIZA 2GSFA 3R6XA 4NK9A 3ZYAA 3L9PA 4MYGA 5JGAA 2YEXA 5CU2A 5K9IA 1ZOEA 4JNWA 1R3CA 5HO6A 4I20A 3CEKA 3BGQA 4IAYA 4FOBA 4GFOA 2WMSA 4KIOA 3PPZA 3WE8A 4DTBA 4BI0A 2Z02A 2UW3A 3VULA 4CT2A 4G1WA 4G6NA 3Q60A 4FZ6A 4QQJA 4K18A 3LLTA 2C6OA 3OTUA 3CTJA 4QTEA 3BU3A 2UW9A 4I0RA 3UG1A 4QPSA 5GZ9A 4PL3A 5K3YA 1Y57A 3OW4A 4KA3A 3LCDA 5LJJA 1ZARA 3CR0A 1FVVA 4FIGA 3REPA 3UIXA 3SG8A 4QTBA 2J90A 3O8TA 3VJOA 5AV2A 4D9TA 4B8LA 3PE2A 4TXCA 1ZLTA 1ZY5A 5TOZA 1KE6A 5ETCA 4EQUA 1J7LA 3ROCA 3RPSA 3S0OA 3PZHA 4FV8A 2XNMA 3LIJA 3MH3A 3UYTA 3R9RA 4HW7A 3PY1A 3EIDA 1Q97A 3NSZA 4FT0A 2OSCA 4EJNA 2YAKA 4RX5A 5IMEA 2FUMA 4IJPA 2XJ1A 1T46A 4AZFA 4YSJA 3GU7A 1H1RA 4UMUA 2Q0NA 3UP2A 1PMUA 3BBTB 2G9XA 5EHOA 4IDVA 4FV6A 2GTMA 3CY2A 3NNWA 4JLCA 4X3FC 5AV3A 3THBA 3EQDA 4S2ZA 4CV8A 4YBJA 4DFLA 4EWHA 2H6DA 1PXJA 4OUCA 3GU8A 3H9OA 5J9ZA 1H00A 3C50A 4WKQA 1YXVA 4OTDA 4PNIA 1PW2A 2XJ0A 2ONLA 3DFAA 4IEBA 3A7GA 1U54A 3GBZA 4XMOA 3Q4CA 4AACA 4UWBA 4ERKA 3BELA 1IG1A 3UZPA 5BPYA 3A61A 4KBKA 4G3FA 4QMZA 5LCJA 3QWKA 5LOHA 4FEWA 4KNBA 4C3RA 2W1HA 3T9IA 1MRUA 5AJQA 5IQAA 1ZAOA 1ZWSA 3VQUA 4GUEA 2XYUA 5JRSA 3NVKI 1YHWA 1CM8A 4L3JA 4ZLYA 4AXAA 4GVAA 4H39A 4PP9A 4D4SA 2W9ZB 2WB8A 3F5UA 4YJTA 4KSPA 4EL9A 2VD5A 5HLNA 3NX8A 4UMPA 5KX8A 5JFSA 4X3JA 4AW5A 3U9CA 5B2MA 5CVGA 3D83A 1P14A 4PMSA 1U4DA 2IG7A 2VWBA 2OXXA 5H8BA 4D1SA 1KOAA 4IX3A 5CYIA 5EI6A 4C57A 4CXAA 2WQNA 4FKWA 4ZSEA 1UU8A 3G6HA 1JOWB 4TKSA 4ZLZA 5IMXA 4ZP5A 1OL6A 1RQQA 3HMIA 5HE0A 4TYJA 2XH5A 5CTPA 4EZ7A 2QG5A 3NRMA 1J91A 3QTWA 2PK9A 3LCOA 3QQGA 3RP9A 4EUTA 5I9XA 3NYVA 1KE5A 3RK9A 3TV6A 4EOJA 3FLZA 3GVUA 3LMGA 2FYSA 3R00A 2JDTA 1H28A 3EQCA 5HIBA 4XP2A 4EK4A 5AAGA 2IZSA 2YLFA 3DQXA 4F6WA 3NNUA 2ERKA 4A9RA 1H25A 2YLEA 4AS0A 5EYKA 1IAJA 3PP1A 1FGIA 5TKDA 2FB8A 2B55A 2W5HA 2BKZA 5EFQA 3ZXZA 3RINA 4F1MA 4RPVA 3DTCA 1XH9A 4PPAA 4ERWA 1BMKA 3FKLA 5DR9A 4H3PA 4QPMA 4CMUA 4F99A 1PMNA 4FGRA 2VO0A 1JKLA 4XHKB 5L2TA 2C5NA 4IBMA 3FHRA 3KA0A 4L3LA 1IEPA 4OTFA 4EEVA 4G9RA 4O7YA 3BLRA 4CEGA 2X7GA 2XNBA 3P0MA 4O0XA 4IADA 4ITIA 2WTCA 3PPJA 4W4YA 3W2SA 4IMYA 1OPKA 3II5A 4XV2A 1U54B 3TG1A 1IASA 4U3ZA 1BI8A 5L8KA 5M08A 3RAWA 1U5QA 4JS8A 3GC0A 1REJA 2HCKA 3F5XA 5CY3A 3DK3A 4R3PA 4BTKA 3MVMA 4P4CA 3UO4A 3V01A 1R0EA 3MA6A 3IO7A 1ZOGA 3I7BA 2C1AA 4LV5A 4UV0A 5E1SA 3C51A 4GJ3A 2QR7A 4UBAA 4FEUA 4QRCA 1WVWA 4NWMA 3QD4A 4X2GA 5FXRA 4XEYA 3BV3A 5DE2A 3E8CA 5JFVA 3AMYA 4K9YA 3RM7A 2PL0A 2R9SA 2YIXA 3QKLA 4FKPA 2XKFA 4R7IA 2ITOA 3QC4A 4O7ZA 5CU3A 4RJ8A 5JSMA 4QT1A 3LM0A 3HV6A 3E88A 4G3EA 4RC3A 5HICA 4UMRA 4WBOA 2GMXA 2XCHA 5L4QA 3G51A 3PFQA 3D5WA 2J0IA 4XRLA 3V6SA 2Y4PA 3KK9A 2VV9A 3ORPA 5KMLA 2XK4A 3P9JA 2O5KA 2UW8A 4I6QA 3CJGA 1XWSA 1XBBA 4Y85A 3NUNA 5FM2A 2I0EA 3IDBA 3H0YA 1V0BA 4C58A 4E8AA 5IZFA 4EOIA 2W17A 1JPAA 5CSPA 3GQLA 4WUNA 4ANBA 4PMPA 3GU6A 1YWNA 3OF0A 2B53A 4AN3A 4ASDA 4HGTA 3E8NA 3I5ZA 4A06A 2RFDA 2GQRA 4AN9A 4NCTC 4QYGA 5AWMA 4CG9A 4RIOA 5D11A 2HY81 3I6WA 4FKGA 4DT8A 3FYJX 4CQGA 4PRJA 2YZLA 1JSVA 4R1VA 3A2CA 3LXLA 4EHGA 4ZK5A 4CMOA 3R83A 4USEA 5IQIA 3FPQA 3NEWA 4RJ7A 3ZRLA 4K8AA 4YUQA 3GUBA 5H8EA 3MY0A 1XH7A 4O6LA 4YLKA 5BUIA 3F61A 4FV1A 5AP6A 4JXFA 4ZTLA 4J98A 3QWJA 2WOUA 1Q61A 3JPVA 1W98A 3OOGA 5BVNA 3CGFA 4XYFA 2AUHA 5IG1A 3HDMA 1YXSA 3ANRA 3PA5A 2OXYA 1OL2A 2IVSA 4AE9A 3VVHA 2HWOA 3TT0A 5I4NA 2XRUA 3C4CA 3FLSA 5DGZA 3VUHA 4XG9A 5AM6A 1K2PA 5M4IA 1IA8A 4DEBA 4FR4A 2W5BA 2QC6A 4IWOA 3FKNA 3QD2B 5F1ZA 2BAKA 4C4IA 3DJ7A 4MWHA 4PV0A 4EHEA 4AGUA 2QOFA 4ZY5A 5FXSA 5E1EA 3GCSA 2ETRA 4C4HA 3UO6A 3WYYA 5BVOA 4J99A 5DT4A 2AC5A 4FSNA 2XB7A 3U4UA 3UDBA 1JSUA 3QQUA 4Q5EA 3SOAA 2W1FA 2RF9A 3CY3A 3ORXA 4IAKA 5J5TA 1QPCA 4F1OA 5EQYA 3NMUF 3HA8A 1GNGA 4IWQA 4LL5A 4YTIA 3V5TA 2VTLA 5C8NA 3S1HA 2A19B 3OUKA 2QHMA 3DXNA 2IZTA 4G5JA 2WQMA 3CQEA 3ZOSA 2CDZA 4MAOA 2C0OA 3BV2A 4O2PA 2X8DA 2ZOQA 5LWMA 4O82A 4WNKA 3DLSA 4QMNA 4YO6A 2KULA 2P0CA 3H10A 2ERZE 4NTTA 4QYHA 2NPQA 2WTDA 2ZB0A 2V5QA 4ZTNA 4O81A 2PSQA 3QRUA 2R3NA 3QRJA 3BLQA 2JITA 4CVAA 2EWAA 4K0YA 3TN8A 4L52A 3D7TA 4CKJA 2BZJA 4RVTA 5B2KA 3TNHA 3HUBA 3ZZWA 2BCJA 1Q3WA 5CASA 2OKRA 5BUEA 4FSZA 2UVYA 3P23A 2BZHB 3KRWA 1AGWA 5EYMA 2RGPA 4AP7A 4BTMA 4HCUA 3KGAA 4LOQA 2EUFB 3PY3A 4QP9A 4GJ2A 4NT4A 3R9NA 2HY0A 2WEVA 3PXZA 4FKLA 2YISA 1FVTA 1YOJA 1SNXA 2QOBA 3WF8A 4DH5A 4DN5A 4HZSA 3KF7A 4JG7A 4LRJA 5EW3A 5HG7A 4I5HA 4NUSA 4CD0A 4IE9A 2Y4IC 3UG2A 4ZTMA 5C03A 1LUFA 1STCE 5LMKA 5AP2A 3CIKA 4TYIA 5A4QA 3HV5A 2CKOA 4YTFA 4EZ5A 2R3PA 3F2NA 3VHEA 4BCHA 5M06A 3QQLA 3Q9ZA 3DGKA 4BKJA 4YZDA 4C7TA 5IUHA 4RVKA 4FL3A 3ORTA 2CKQA 3R8VA 4JG6A 3E92A 5M4UA 2B52A 3GNIB 3ZM4A 1G8AA 3FQSA 1JWHA 3HUCA 2WMUA 3DAKA 4IX6A 5FEDA 4C62A 2YITA 5HD7A 2DS1A 4J96A 3ZO4A 2VWYA 5IUIA 4YZMA 3QLGA 3B2WA 4W9XA 2VTNA 4AWIA 4WRSA 5BVKA 5LWNA 3TI1A 2DYLA 5M07A 5HKMA 3FSFA 3DY7A 2CSNA 5C4LA 1WBNA 3NNVA 4FTNA 4WA9A 4ALWA 4ASEA 4O0YA 1UKHA 4OGRA 4QMYA 2PZYA 5AP0A 3MTLA 4F6UA 3R9HA 2X9FA 2LGCA 2EXEA 4O1OA 1JSTA 3W10A 4B8MA 5J7HA 2UZDA 2X8IA 3HRBA 3TUDA 3OBGA 4MXZA 4BDAA 2J0KA 4FI1A 3PVGA 3MYGA 5J95A 3QTRA 3T3VA 2IVVA 4IB1A 3D7TB 4Y73A 5KO1A 5AV1A 5DFPA 2ETKA 3FPMA 3RCDA 4MQ2A 4EH4A 1WMKA 2VO6A 3JS2A 3QRIA 3LJ1A 4MQ1A 3F66A 5IU2A 5M44A 3MJ1A 3PJ3A 4D2PA 1WBPA 4D5HA 2ZDTA 5CENA 1PKDA 4DGLC 4O0TA 4BZNA 3OCGA 2IVTA 2OZOA 3NW6A 2X4FA 2BILB 4MD8E 4J97A 3VUIA 4Q9SA 1K3AA 2PVNA 3C9WA 3MB7A 3Q32A 2YM8A 2B9HA 5CXHA 3QYZA 3SXFA 3VBWA 3W2RA 3MV5A 5JZJA 3GOKA 5M53A 1WBSA 3SXRA 2UW6A 3OD6X 3ZCLA 2I40A 1PHKA 5EQPA 4EK5A 3CD3A 5GZ8A 2C5XA 3TIZA 2NNWB 2E9VA 3AMAA 3EB0A 3O23A 4S30A 5FUTA 4NIFA 1ZXEA 3W16A 1NA7A 3MN3A 4HVIA 4R78A 3ENMA 4L45A 1PXLA 3VNTA 4C2WA 4EC8A 3GGFA 2WIPA 3RI1A 3RPYA 3DAEA 1M2QA 2GQGA 4P5QA 1WAKA 3PIYA 3AQVA 3T3UA 4WG3A 5DR6A 4D4VA 2OIQA 3KRJA 4E4LA 3R1YA 2WNTA 2GCDA 4YZNA 5DT3A 4PPCA 4YURA 1XH5A 4O0VA 4H3QA 4S32A 3D9VA 3PDTA 5EKOA 1GY3A 4AW0A 2IVUA 3NYXA 5LVNA 2W1IA 1PMVA 5CSVA 3WZDA 3Q2JA 1Q24A 4U44A 3GP0A 2BZKB 3BU6A 3I0QA 1Z57A 1GIIA 2OJJA 2PVYA 1XBAA 4IAFA 4FEVA 4OTIA 3GOPA 4RZWA 3W2CA 1XQZA 1A06A 3F3WA 1UNHA 4ITHA 1YWRA 5DHJA 3CKXA 3E63A 2J5EA 1H0VA 4M14A 1YDRE 2QHNA 4H3BA 4Z16A 4EJ7A 3FE3A 1ZMWA 5AV0A 5C01A 5K5NA 2HK5A 4O27B 4W4XA 4FV7A 1WZYA 4RJ4A 5F20A 2C3KA 4EORA 4DEGA 3VWAA 3ERKA 4FTAA 2YCQA 4UWCA 3D15A 4GG5A 4H05A 2WQEA 2WTIA 3ORLA 4IACA 1SVGA 3V51A 3NUAA 5IA1A 4O7SA 1S9JA 1ZMUA 3R2YA 3OTVA 2ITVA 4QNYA 4LYNA 3UC3A 4RBLA 5H9BA 2PUPA 5AAEA 4TNBA 4GKIA 3GQIA 2OU7A 4WG5A 4D2SA 2QO9A 4OTHA 5GJGA 2BRMA 4PPBA 2A27A 2CNQA 2OZAA 2PE0A 4PMMA 3O51A 3NCZA 2E9OA 4G17A 4KIKA 4DG2E 2PVLA 4LUDA 4ZTHA 4YU2A 5CAOA 5CANA 2BIKB 3ETAA 3ROYA 3P08A 3VF9A 5DEWA 4DEAA 4MX9A 4I5PA 4YJOA 3VIDA 5AP7A 5AR8A 2BVAA 4FZ7A 4K11A 3KB7A 4E20A 1ZZ2A 3MH2A 2JIUA 4NIFB 4UXLA 5HE1A 1KE7A 4AE6A 5AUUA 4FV3A 3B2TA 2C6KA 2J0LA 1GZOA 4G3DA 3COHA 4BDJA 4CTCA 5CWZA 4CRLA 4CQEA 2I0YA 5HCZA 2BHHA 5JRQA 2GQSA 2XUUA 5JGDA 3ZDUA 4BDGA 4DLIA 2FVDA 3F3UA 4TYGA 4Y83A 4FKJA 1RDQE 5HTCA 2V7AA 3OOMA 2YWPA 3LFNA 3UOKA 1H1QA 5IKWA 3BE2A 3SLSA 2VZ6A 3VS4A 4XS2A 3C4EA 4L9IA 5EYDA 4CFFA 3R8MA 4FSWA 4JBPA 4QP1A 4O21A 3VS5A 3CD8A 4EOLA 5LVPA 4HJOA 4FIHA 4HCTA 2CNUA 2GNHA 3CQWA 2HELA 1ZYSA 2PMOX 1PXIA 3V5LA 4E3CA 3PWYA 5M55A 3BQCA 3TDVA 5D7AA 5D41A 2VO3A 2BIYA 3HV3A 2O8YA 4UY9A 4Y46A 4GL9A 2PHKA 4KBAA 1YI4A 5C8KA 4U7ZA 2PMIA 4QMTA 2C5VA 3AD6A 5CSHA 3HMNA 3MY5A 4FSQA 3TNPC 5EOLA 3R7VA 2YHVA 4DLJA 4QP3A 3RAIA 2CN5A 4RA4A 5FD2A 4EOPA 1PRYA 2ITWA 4QTAA 4RLKA 4Z7HA 5E4HA 4EH6A 2YDIA 4MBLA 2X9EA 4CZYB 4KABA 2UUEA 3BYUA 5IH5A 3QQJA 2VWUA 5CEKA 2HZNA 3R21A 4PTEA 2ZV9A 1OIRA 4IAAA 2XMYA 5L2SA 2OZAB 4LOOA 5F9EA 3H9RA 4KIKB 4EBVA 3UOJA 2WMBA 5GINE 2BHEA 3LE6A 4MEDA 3KMMA 5F4NA 1NW1A 5D9HA 5HLWA 4IAZA 4NW5A 4GT4A 3Q5IA 3BGPA 2OO8X 4RWLA 4WNMA 4FEQA 2R3GA 2F7XE 1UVRA 3OVVA 2HAKA 4NTSA 4XG7A 5D12A 5EM7A 3ZFYA 5HTIA 5LXMA 4OBQA 5DIAA 4AUAA 4CT1A 1FMOE 3FLWA 3QXOA 2OW3A 4M0YA 4LGHA 4Y72A 3OEZA 3C13A 4KAOA 4WRGA 5K4IA 3QTXA 5DOSA 3O8PA 3UBDA 2UZVA 2VTIA 4C38A 3N4TA 3F2RA 3QRTA 3P7CA 3RNYA 2C3JA 3FZOA 3KMUA 3E7OA 4Y8DA 5HG5A 3WE4A 4WBBB 2BRNA 2Y7JA 3OY3A 2YZAA 2VX0A 3QHRA 3T8OA 3DKOA 3DKGA 1OL1A 4FNYA 1YQJA 4TL0A 2YAAA 2QQ7A 2XK6A 4N6YA 4BL1A 2W1EA 4YJUA 5L8JA 4D5KA 1BI7A 3DKCA 3HV4A 5L2IA 2JIVA 5A6OA 1W83A 4GT3A 4JOAA 4JR3A 3PSCA 2V0DA 4OBOA 2YJRA 4XG3A 4E6AA 5I9ZA 4BGQA 3ZC6A 3ENHA 1OB3A 1MP8A 4YHJA 2RL5A 4Q5HA 4WD5A 4CKRA 4O6EA 2FGIA 4C59A 4YP8A 4QMXA 4GSBA 4BBEA 4XP0A 4QMOA 1VZOA 3E7VA 1M17A 2XK7A 4YLJA 2QOHA 4KKGA 5TR6A 3UVQA 2JBOA 4ID7A 4BCGA 3DKFA 4EHVA 4WOVA 2HXLA 4O7VA 3O7LB 2YIRA 1G8SA 4PL4A
chains in the Genus database with same CATH superfamily
5I9VA 1H08A 3FI2A 3MFSA 4HPUE 4O91A 4APPA 2X6DA 4FTCA 4PDOA 4Y5HA 3R63A 5CU4A 2BPMA 2R0UA 4RQVA 3VW8A 4BVUA 2B0QA 5GJDA 3A8WA 1UU9A 4RJ5A 4P7EA 3UZRA 3PJCA 3ZEWA 5F94A 4QMVA 3EQGA 5IA4A 1SYKA 2OH4A 1K9AA 5KMKA 4QNAA 4U43A 3UQFA 4F0FA 4TPTA 3UYSA 4CTBA 2C68A 2WFYA 4BHZA 1Q8YA 3ZDIA 3BHTA 4DT9A 4UN0C 3FMNA 2VTMA 3DCVA 4O84A 5EW9A 2WQOA 2B9JA 3NLBA 3UIUA 4HVDA 1NT2A 3MPTA 4FKOA 4D55A 3DNDA 5HVJA 4JIAA 1W82A 3ZBXA 3RMFA 4PY1A 5HU3A 1VLRA 2QVSE 3Q3BA 4PX6A 2OIDA 5JMSA 3MW1A 3FDNA 1U5RA 3JVSA 2P2HA 1U59A 3MS9A 4JRVA 4TWNA 2NRUA 3F5PA 3UQCA 4R7BA 3LQ5A 2FSLX 3KXMA 5AR5A 4EH5A 2V55A 4MNFA 2BAQA 4BWKA 4IM3A 1ZYJA 1WCCA 3C4XA 3RHXA 3ZSHA 4O96A 4CFMA 3U54A 1P5EA 4ZAUA 1RJBA 4GU9A 3SKCA 5IDPA 4IANA 4F6SA 2EU9A 4KS7A 4DITA 3G5DA 3H4JA 1J1BA 3DBQA 1KV1A 3MBLA 2GS2A 3NNXA 5HLPA 5KMJA 5L6PA 2QOIA 2REIA 4MF0A 3KCKA 3PVWA 1VYWA 4A9YA 4ZJJA 4BWPA 5FP5A 4OAUC 3BIZA 3P4KA 5HBEA 4HZRA 3NUSA 3R1SA 4I4EA 2AC3A 2CLXA 5CAVA 3LMHA 1YW2A 2HWPA 2XARA 4ANQA 4Y5QA 4BIEA 4JQ7A 2VAGA 4R77A 4IVBA 4EWQA 5K0XA 3ULZA 4BCOA 3LFSA 4E4NA 1OIUA 4F0IA 2HIWA 4Z3VA 3W0QA 2XKEA 3TEIA 3R71A 4BCKA 4OTRA 5EHLA 3IS5A 5D10A 5T3QA 3FMHA 4HNIA 4I1ZA 4MNEA 4B4LA 3AT3A 2Z7RA 4J1RA 4M67A 4AF3A 4PQNA 2GHLA 2O3PA 1RW8A 2V22A 4CFVA 4O22A 4RIYA 4EC9A 4AN2A 4AXEA 5AMNA 3D5XA 5FEEA 2ZJWA 4JDKA 3GB2A 3NR9A 3U87A 1P4OA 1ERKA 3QUDA 3KN6A 1XMMA 4Q9ZA 2YABA 3NGAA 3WARA 3BQRA 5IQGA 3BZ3A 4N70A 4Z7GA 2WKMA 1OKZA 3IG7A 3FC2A 3HRFA 3NIZA 2YIQA 3V8SA 4UZDA 1KWPA 4L7SA 3UMXA 2R3MA 4DH8A 5FRIA 2F7EE 4R3RA 2XANA 1B39A 4ZSGA 5L6OA 4I24A 3ZRMA 2QCSA 2QLQA 1OVEA 2Q0BA 3MTFA 4YJQA 4FV5A 5AM7A 4IZYA 1KSWA 4JAIA 3OWKA 5DWRA 3ML1A 4YGAA 4DH3A 3C5IA 3EKKA 4PWNA 2Z60A 2IZRA 4R7HA 5IQBA 4I0TA 3ZUVA 4GIHA 4OR5A 4AOTA 3OP5A 3OXZA 5KNJA 2ESMA 4RFYA 1UNLA 2J4ZA 4IVCA 4BI2A 4C4FA 1V0OA 2XEZA 2XIYA 4U80A 4YNEA 1E1VA 2X1NA 3QTUA 2GDOA 3PTGA 3ZC5A 5A46A 3U6JA 3GC9A 4LL0A 3K2LA 3UTOA 2UVZA 4MXXA 1OKVA 3VBXA 2C30A 3AC3A 3IW8A 3LLAA 3UGCA 2UZEA 1Q5KA 3FY0A 4B9DA 1XBCA 3N4UA 4FZAB 4F7JA 4QYEA 1X8BA 4D58A 3EH9A 4MHAA 4ZS0A 3R9DA 1UU3A 5AP5A 4ZSAA 4GIIA 4JIKA 2FO0A 4A9UA 4WHZA 2GPHA 3QCYA 3CC6A 3EMGA 5DBXA 1JNKA 4RG0A 5IUGA 4QMSA 4RZVA 5BUJA 4D28A 2C3LA 4JRNA 5AX3A 4S33A 1TQIA 4D9UA 4JDHA 4YJVA 4FT9A 3ZSGA 4F64A 3DJ6A 4MNEB 3A7HA 3PSBA 5CF6A 2WU7A 2FH9A 3MFUA 3V6RA 4ASXA 4TTHB 4GFMA 3F3TA 4RIYB 3FZPA 3FXXA 2A4LA 1PJKA 2E9NA 4QP7A 4DC2A 1REKA 2X0OA 4I93A 4PDSA 5CT7A 1LPUA 1KOBA 1A9UA 5GJFA 4YJRA 5D7VA 4DGOA 4CZUA 3IK3A 4QQCA 2ITUA 2CGVA 4FE2A 4FSRA 4XV1A 2HXQA 5HBHA 3G15A 1FINA 4MBIA 3F3VA 4AZTA 1OIQA 3V04A 3O8UA 3ZO2A 2GS7A 3IKAA 1NY3A 2B54A 3L8VA 3V5JA 4AFEA 4O7NA 4C37A 4MVFA 1FMKA 2W4JA 4J8MA 5FGKA 3ELJA 3VW6A 1PYEA 3EN6A 1YWVA 4HYHA 4UB7A 2BRHA 4JDIA 4JJRA 4QP6A 5HU9A 5I9YA 1PF8A 1OBGA 2VGOA 4G5PA 5LARA 3QTIA 3VUGA 3RBWA 1H01A 3F88A 1O9UA 5CI7A 3SC1A 3F5GA 4E5WA 3VBTA 4E7WA 3O71A 4I23A 5E9EA 4AXDA 2ZV2A 2W1GA 1BL7A 1OITA 3E8DA 4USDA 5DI1A 3VHKA 2VGPA 2VO7A 3D4QA 4A9SA 4EOMA 3MJ2A 3NZ0A 2W96B 1XJDA 2G2HA 3NCGA 3LFQA 3RGFA 3FZTA 1CDKA 2XZSA 1I09A 4GMYA 1WBTA 3L9MA 4O2ZA 3BX5A 4ZOGA 4BCIA 2CN8A 2GNGA 5DRDA 3HRCA 3QCSA 4X2JA 2ZV7A 4EHZA 3A7JA 3PE1A 4DFYA 4ZTQA 5DVRA 4D2VA 3NFGB 3OFMA 4QP8A 3JY9A 3RZBA 4QMUA 4Z55A 3EQHA 2ETMA 4FC0A 4D2RA 3EN7A 3NS9A 4E5AX 2X2MA 3LFDA 5JEBA 2F57A 4RMZA 2G01A 1DAWA 4YSMA 3QTQA 3QA8A 4F9BA 4BF2A 1UWHA 1GJOA 4JI9A 3WYXA 2X39A 3CCNA 3OC1A 1FGKA 2J2IB 3LFEA 4PTGA 4U3YA 5ETFA 4IHPA 3UNZA 4EOOA 2E9UA 4MD7E 2BZIB 3U8WA 4CCBA 2ITTA 2RKUA 2WMQA 4KSQA 5HO8A 4ALUA 4D2WA 3Q9WA 1HCLA 3PZEA 3ALOA 3O50A 4DFXE 4UWYA 1XH8A 4CKIA 4EUUA 3ITZA 3RPVA 4ANOA 3TMOA 3TV7A 3OCBA 4AXCA 3K5VA 1H4LA 2ACXA 5HORA 2QOKA 2IN6A 2VRXA 2W4KA 4BDKA 2HZ0A 3I1AA 5EM8A 1XR1A 3PJ2A 2UW0A 3R0TA 4RC4A 1YKRA 4UMTA 5CU0A 5E8XA 2XCKA 5DR2A 4I6BA 4I5MA 3LJ0A 3MA3A 5FDPA 2WMTA 3D7ZA 2E2BA 3M1SA 1ZZLA 4U6RA 4OBPA 3C0IA 4L44A 4ALVA 4AGCA 4ZMEA 3POZA 4AXFA 4A4OA 4ZMFA 2H96A 3JY0A 4L6QA 3DXPA 1NVSA 2IO6A 4I6FA 5A4CA 1JKKA 3NPCA 4O0SA 4ZZNA 4GUBA 5AR3A 4ZTSA 5EW8A 5HX8A 1YDTE 3DU8A 3EYHA 5J5SA 1PXNA 2VTJA 4EK3A 5G6VA 4DEIA 3FEGA 3FI8A 1W2FA 1WVYA 2Y8OA 2RSVA 3P5KA 4CYIA 2PZPA 4DYMA 4H1JA 4E26A 5JT2A 4KS8A 4W4WA 3JXWA 5FG8A 1DS5A 1DI9A 3ZEPA 3HV7A 2OK1A 5GHVA 3LFFA 4F9YA 1JKSA 4FSMA 5IEYA 2F2CB 1G3NA 2JLDA 4YZBA 4X6RA 5FWKK 4BBFA 4ZZMA 4DHIB 3HP5A 4FEXA 2VTSA 3V8WA 4WO5A 3PXKA 3Q5ZA 3KMWA 4IFCA 2PMNX 1SVHA 3SVVA 1TKIA 2I6LA 3BHYA 5L8LA 2IW6A 3DTWA 2VTOA 4NW6A 1JQHA 3TZ9A 3IDCA 4QOXA 4AOJA 1M7QA 1XMLA 4IDTA 4FTUA 4XG4A 1ZYLA 4AA5A 4XJ0A 2YACA 5EDPA 4F9CA 3HAMA 4CSVA 4JMQA 2PVJA 3SX9A 4F09A 4F78A 4FNXA 4KRCA 4IJ9A 2P4IA 5E8YA 4BI1A 2I0HA 3PG3A 5KCVA 2IW9A 3FMDA 1U46A 4F9WA 2J0MB 1YDSE 3MGYA 4R5SA 4FYNA 4XP3A 5CSXA 5FTQA 2PE2A 4OLIA 3RCJA 3HECA 5KUPA 3UIBA 4X2FA 4D4RA 4UEUA 4NEUA 1Q8UA 2UZUE 4UXQA 4F7SA 2R3OA 3P1AA 4U40A 4E5BA 3FLYA 4KIQA 3ORKA 2DWBA 5DYJA 3PA3A 1H24A 2C6TA 3HA6A 3Q9YA 4O7TA 3ZBFA 4IW0A 3IW5A 5G1XA 3GU4A 2OI4X 4YC6A 4NL0A 4TWOA 3GFWA 2BTSA 4IC7A 2RG6A 2JKQA 5A9UA 4D0WA 2XRWA 4RFZA 5IH6A 1ZYDA 2CCHA 3D2KA 2YM3A 1MRYA 1IRKA 3L9NA 4HGEA 4M3QA 4QMLA 3W0PA 4JVGA 4DHZA 4GT5A 5EK7A 4F0GA 4E6DA 1KE9A 3FMMA 1Q3DA 4JBOA 5J7BA 3CTHA 3B8RA 4J52A 4O0UA 3R8ZA 3W8LA 5CI6A 4YTHA 3RALA 4D1XA 4LOPA 3QRKA 5J1VA 4G3CA 4QMPA 5EM5A 3COMA 3R7EA 4DTKA 3S95A 3TNIA 1UWJA 3WIGA 2WAJA 5IPJA 1Y6AA 3FZ1A 3PIXA 2XIRA 1Y8GA 2F2UA 3D94A 4AGWA 3KXHA 4RJ6A 4YNOA 3ZLXA 5I5ZA 2GS6A 2QG7A 2YWVA 4OW8A 2FSTX 4NH1A 3FI4A 4F65A 4MKCA 2H34A 4QO9A 3OG7A 4QYYA 5A3XA 3W33A 4D0XA 5ANEA 4EI4A 2XIKA 1XH6A 3RKBA 3COKA 3UMWA 3D2IA 1W0XC 2BR1A 3N51A 4JAJA 4BCFA 5JQ5A 1YRPA 3C4WA 4H36A 2PTKA 2WZJA 4NKSA 3TKHA 3W18A 4F63A 4FK6A 3U6HA 1J1CA 2B1PA 4F7LA 1OIYA 3IW6A 3LJ2A 2W1DA 4O0WA 3C0HA 1M52A 4DFNA 3JR1A 2Z2WA 5AP4A 4CNHA 4ZSLA 4BGHA 2YIYA 3EFKA 3CGOA 4JBQA 3C4ZA 4ONAA 5EKNA 1Q4LA 4FTTA 5EOBA 3ORIA 4B99A 3TM0A 1JVPP 2WD1A 3BU5A 4MK0A 3RTPA 5DH3A 3HMPA 3DV3A 1TVOA 1B6CB 4YHTA 3UOLA 2X6EA 3A4PA 2YM4A 4BCMA 5C4KA 5E8WA 3QKKA 3DZOA 3EZVA 4PMTA 2JFLA 2ZMDA 3Q2MA 3M2WA 1RE8A 3KXXA 1XHAA 2XNPA 4U79A 3AKKA 4PDYA 2KTYA 3R22A 4JDJA 3E93A 3ODYX 1OL5A 2JKMA 2XF0A 4X0MA 3V5PA 4MXOA 4BGGA 5KBRA 2PULA 2XNEA 2WEIA 2GNJA 3FV8A 4FF8A 1AD5A 2BAJA 2BRBA 3KFAA 4XG8A 4GFGA 3V3VA 5HGIA 3H9FA 4LDTA 4DA5A 2EXMA 5IA2A 4BKZA 5IA3A 1H1PA 3W2PA 3VUMA 2C3IB 5AAFA 3ZLWA 4XRJA 3I79A 5FEQA 3IW4A 3KY2A 2O0UA 4MXAA 3R7GA 5HI2A 4IFGA 4XUFA 3KC3A 2R64A 4GW8A 3G0FA 3QLFA 3DZQA 4UYAA 2JAVA 5HVYA 3DS6A 3LQ3A 3LXNA 3MDYA 4YJNA 4I5CA 2W05A 5J9LA 2FSOX 3IW7A 3AC5A 1OPJA 4GYIA 4KD1A 5KBQA 3PJ8A 4FTKA 4NZWB 3VRYA 4YHFA 3N9XA 2XAMA 1OUKA 3LAUA 4FTIA 3BHVA 4FL1A 5AP3A 2BMCA 5ANJA 1OI9A 3QXPA 5CEMA 1PMEA 2WMVA 4J7BA 4BFMA 2C4GA 2PWLA 3N4VA 3A4OX 2QO7A 2WTJA 2VTHA 3F7ZA 4FG9A 5CVFA 3K3JA 5CS6A 3MVJA 1YXXA 4MWIA 4BJJA 2R3LA 4YBKA 4FNWA 5CEQA 1G8KA 2UVXA 2VWIA 2ZMCA 3G90X 3IGOA 2CGXA 3GFEA 4RIWA 4DGMA 3LFBA 4F9AA 2IJMA 4U45A 2PE1A 4BCJA 4EQCA 3MY1A 4M84A 2WHBA 4TNDA 1GZNA 3GCUA 5FLFA 3G33A 4GH2A 4R1YA 5EM6A 5AR4A 4DFUA 5AR2A 3QUPA 3EQFA 3DK6A 2ZDUA 4FV0A 4E93A 3TTJA 2F9GA 2BDWA 2Z7SA 3E3PA 4BCPA 5AX9A 2XIXA 3H3CA 2C6IA 1P4FA 3ZRKA 3HVCA 5M56A 3WBLA 2ONLC 3U4WA 3NUXA 3PWDA 4RJ3A 5ANKA 4LV8A 3D5VA 4U8ZA 3E62A 4YMJA 5FTOA 3DB8A 5BQ0A 2JBPA 4FSUA 4UYNA 3RK5A 3ZM9A 2B4SB 4JX3A 4FBXA 5LMAA 3VUKA 1GOLA 3CLYA 4HOKA 3U55A 4RLLA 3PSDA 3Q9XA 3KRRA 3DA6A 4M0ZA 4GVJA 3TWJA 2JGZA 3HGKA 2QOQA 1Q41A 4YR8A 4PP7A 2UW7A 3A8XA 4NU1A 3ACKA 3Q4TA 3U51A 2EB2A 4ZJIA 4IVAA 4UMQA 4GU6A 1H07A 4L00A 4L01A 4Q2AA 1UU7A 2BRGA 2QKWB 3FL4A 4PDPA 3E3BX 4U9AA 1OECA 4IAIA 5CQUA 5GNKA 3ZHPC 3G9LX 3ID6C 3W1FA 1URCA 4FSYA 2YIWA 4NM0A 4AQKA 2YM7A 4C4EA 3DQWA 2NRYA 3I4BA 2JFMA 1F5QA 4RSSA 4FKQA 2I1MA 4CRSA 3ZFXA 1R1WA 5KMOA 2W1CA 5JN2A 2V62A 4ANSA 4BDEA 5HVKA 3NUPA 3VBYA 5FTGA 3A60A 4O86A 5IQEA 4N0SA 3TZMA 4UALA 3UO5A 3WILA 3I7CA 3R7UA 3LCKA 4FZDB 3OMVA 4MXYA 3FKOA 5DN3A 4AZVA 4C4GA 3U6IA 4BIBA 3W0OA 2ITPA 2OF4A 4XBUA 2X2LA 4L67A 5DNRA 4C33A 3RWQA 3NAXA 2OFUA 1G5SA 1QPEA 3SGCA 4BJJB 4L53A 4YPDA 1W8CA 4RIWB 1OKWA 3I0OA 5HD4A 2WOTA 4G3GA 2PVMA 4PNKA 1B38A 4TWPA 4KWPA 1Q8ZA 2V7OA 3NVMB 1KE8A 5E8UA 1ZOHA 3QQFA 4FT3A 2ZYBA 3OW3A 4FIEA 5CAUA 3R01A 2WMAA 3VN9A 5FXQA 3FMEA 4IH8A 5L6WL 1E9HA 1Q62A 2ZB1A 5IH4A 4J95A 4IM0A 4RWKA 4AA4A 3NW7A 3SOCA 4LGDA 3EQIA 3ZLYA 4EH7A 5ITAA 4V01A 4RQKA 3OCSA 5CZHA 3UC4A 1ST4A 4DG0E 4ENXA 5KHWA 3WI6A 4NM5A 3LHJA 3O7LD 2OWBA 4TT7A 3P5JC 5JKGA 4C3PA 3BWFA 3V8TA 2C69A 4IWDA 3PP0A 1GZKA 1SVEA 2WTKB 3KVWA 2UW5A 4AZWA 4RFMA 3VS7A 2YA9A 4E6QA 4XNEA 4BICA 4LG4A 3PY0A 3BWJA 2WELA 1L3RE 3KK8A 5I9UA 2XVDA 3AKLA 1DI8A 3L9LA 5LVOA 5EDQA 3BL9A 4OAVB 2VTTA 4P2KA 4YC3A 5E7RA 4FICA 5AA9A 3P7AA 2PMLX 4FVQA 1OKYA 5IQDA 1Z5MA 4RT7A 3R1QA 2XS0A 3O2MA 3BL7A 3KU2A 1Y6BA 4IB3A 3DOGA 3UZTA 1OBDA 4OTPA 5J1WA 4QTCA 1LR4A 3GT8A 4EOQA 4BDIA 2F4JA 3EKNA 3AD4A 3TL8A 1UA2A 3CP9A 3Q6WA 1V0PA 2EVAA 3R9OA 2C6DA 1JBPE 4CFUA 2YCFA 2VWXA 4FRFA 4EH3A 4JG8A 4G2FA 5KHXA 3ATSA 5LVLA 3NUYA 3UPZA 3ET7A 3KRXA 3UDZA 5BX0A 3OWPA 2ITQA 2X4ZA 3H0ZA 3T9TA 5GZAA 2WXVA 2I0VA 3GI3A 1YI6A 3OEFX 4MXCA 3C1XA 3EL8A 4FKRA 3QQHA 4D2TA 4KINA 2WMRA 4BC6A 4M69A 1OL7A 2P3GX 4XH6A 4EBWA 3PVUA 4WNPA 4M13A 2R0IA 5IISA 4II5A 3LVPA 1H0WA 2OH0E 3AC4A 1PKGA 4IXPA 2XBAA 2O2UA 3F82A 3FXZA 5CALA 5J79A 2OGVA 4XOYA 1OGYA 2W1ZA 2XYNA 3MI9A 5HOAA 5L3AA 4BWXA 3BYSA 4R5YA 1GAGA 4I6HA 3PJ1A 2RIOA 3ZLSA 3W32A 2A98A 2OICA 3TNQB 2GFSA 3LZBA 4TYHA 3CSVA 3AGLA 1MRVA 3HAVA 3DB6A 3EYGA 4LRKA 5DEYA 4C02A 2ZVAA 4S34A 4UZHA 2XKCA 4QP4A 2VTPA 4EK8A 5HEZA 5LMBA 4XLIA 2R3KA 2UW4A 2W5AA 4WUAA 3RZFA 4RRVA 2Y9QA 3D0EA 3F3ZA 5A4TA 4MTAA 4BRXA 2JIIA 4N4SA 3RNIA 3Q6UA 4V0GA 3EL7A 5JQ8A 3HMOA 2UZWE 3DLZA 5JGBA 2JAMA 5FDXA 4OT5A 3BLHA 4FTOA 2A0CX 3KF4A 4MCVA 3PLSA 2GNFA 3C0GA 3RAKA 3CPCA 5KZ0A 1E1XA 4E4XA 2J50A 5CEIA 3RAHA 4N57A 4E4MA 2H8HA 4LMNA 3HMMA 3KRLA 5BVFA 5JH6A 4C61A 2XK9A 2UZLA 5C8MA 4A07A 3GC7A 3KQ7A 4PUZA 3BPRA 2OJIA 1CTPE 3TNWA 4DHFA 3QHWA 1VJYA 4B7TA 4AG8A 3VUDA 3QTSA 4M66A 3VQHA 1TQMA 3AT4A 3R73A 5TF9A 4LGGA 3JYAA 2WQBA 4BCQA 4DBNA 3LFAA 4EH2A 3BCEA 3FSKA 5HNGA 3MVLA 1Y91A 4KKHA 4KB8A 1ZRZA 3KXGA 4E6CA 5HO7A 4YTCA 3LPBA 3GC8A 4I41A 3VF8A 3HX4A 1J7IA 1IAHA 3VAPA 3R7IA 2AQXA 2RFSA 2XKDA 3FZSA 3OY1A 5M09A 2BTRA 1ZYCA 3MH0A 4O83A 4ITJA 4YPSA 5CEPA 4CMTA 4X2NA 4XG2A 4ZLOA 2XEYA 3VS1A 5L2WA 3MPAA 3UNJA 3G0EA 2ZFYA 4YLLA 3DBEA 2YFXA 3WF5A 3W8QA 1KV2A 3ZO3A 1OGUA 4M69B 4YC8A 3C4FA 4BB4A 4DGNA 1KUTA 5E91A 2OG8A 4IZ7A 5ACKA 4XOZA 5DRBA 3FJQE 4HYIA 2CPKE 4RX9A 3NW5A 4ARKA 3FBVA 3IDPA 4BYJA 3I6UA 5TT7A 4OT6A 3CXWA 3TUCA 2YDKA 2X0QA 3AXWA 2IPXA 5ANDA 4RGJA 5LMKC 4W8DA 4QD6A 4QYFA 2VNWA 2PU8A 3ORZA 5HNBA 4CFXA 3QD3A 4TYHB 4GYGA 5FQDC 1EH4A 4LRMA 5A4EA 3MH1A 1BKXA 4TN6A 3PUPA 5LCKA 3VS6A 1XO2B 4MD9E 4NKAA 1Q8WA 3GU5A 2RG5A 3ZSIA 3LFCA 1TFFA 2JKKA 3CTQA 4WSYA 1GIHA 2PVFA 2XK3A 4DFBA 4C0TA 5B0XA 4DFZE 4V0GB 4ENYA 1H26A 4BTFA 2OF2A 2XJ2A 3GEQA 4L68A 3MSSA 3P7BA 3W0RA 4EH9A 5TO8A 5E90A 3NYNA 1SMHA 2HYYA 4OTGA 4HYSA 1MQBA 1WBWA 2GNLA 3CE3A 3SXSA 5C1QB 2ITNA 4KKEA 3ZO1A 4EYJA 4FSTA 4FIFA 4K1BA 5FM3A 3TDWA 5HCXA 4ZJVA 3NAYA 4G6OA 4HGLA 1M2RA 4FT5A 5C27A 4IX4A 4RX8A 4RC2A 3LMIA 4FTLA 4R6VA 5EHYA 2XK8A 3ALNA 4WIHA 4ACHA 4BDCA 2ITZA 5TE0A 3PIZA 3WF6A 5CAQA 3SHEA 2NYAA 1YVJA 3VJNA 4BKYA 2J6MA 2J0JA 3TXOA 3DXQA 2QKRA 5KMNA 4J53A 3PG1A 3UE4A 3AC2A 4FKTA 2BKKA 3NDMA 4RVLA 3QBNA 2ITYA 3UPXA 4BDHA 3ZONA 2QU5A 3FLNC 3Q4ZA 2IWIA 1QPJA 4EKKA 4XV9A 3UODA 4CLIA 3OS3A 3SRVA 4C3FA 5D1JA 3V5WA 4NM3A 4RVMA 2PPQA 1CMKE 4C2VA 3KXNA 1APME 4W8EA 3RK7A 2G1TA 4FT7A 4ACMA 4DEEA 3L1SA 3KXZA 2VWWA 3TJCA 1H1SA 5I3OA 2G15A 3TKIA 3F7WA 2R5TA 5HIEA 4BIDA 1HCKA 3E87A 4HVSA 4ZS4A 2J5FA 3AT2A 4FIIA 2JDSA 1QPDA 2G2IA 2OJGA 2VTAA 3LCSA 3BYOA 3C5UA 3Q52A 3QYWA 2OJ9A 5DT0A 2QD9A 3IQ7A 4WG4A 3LXKA 3G6GA 4FTMA 5EI2A 2R3RA 4RX7A 4X6QC 3VC4A 3AC1A 1J7UA 4JX7A 1V1KA 4RWIA 3TV4A 2ITXA 3ZXTA 4YO4A 5M4CA 2CKPA 4PTCA 1BX6A 3QALE 2PZRA 3IONA 3F9NA 4DF3A 3ATTA 2PUIA 1WVXA 2C6LA 3OROA 5K4JA 3EOCA 1W7HA 3CPBA 3LKMA 5BYLA 3ZTXA 1YHSA 3ANQA 3OUNB 2YCSA 3S4QA 4CZTA 3FI3A 4NM7A 4EH8A 5H3QA 5IA5A 4DH1A 3QGWA 1JLUE 3RVGA 1NXKA 3BKBA 1H27A 3EJ1A 2Z7LA 4K2RA 4NJDA 3UDTA 4ANNA 3EHAA 1M2PA 3EQBA 4AZSA 3C7QA 2XALA 2W06A 3QCXA 3EN9A 3I60A 5EG3A 5BNJA 1R0PA 5DPVA 4FODA 5KKRB 3QZFA 4X3FA 3WOWA 2GHMA 3DNEA 4HYUA 4MF1A 3KKVA 4GK2A 5AP1A 3DBDA 4I21A 2QNJA 2R4BA 3QF9A 3ZMMA 5BMSA 2VUWA 3D5UA 4JBVA 2BUJA 5KE0A 3LCTA 4CLJA 3GXLA 2A1AB 3KULA 2BDFA 4JR7A 4HCVA 3DJ5A 5IDNA 1G8JA 5CT0A 3DBFA 4BDDA 5A4LA 5I3RA 3R7YA 4DG3E 5IQFA 5CF8A 3EZRA 3QX2A 3QZIA 3M42A 3MFTA 3F69A 3GCVA 4IB0A 5B2LA 4V04A 3SG9A 4MBJA 4DTAA 2NP8A 3DDPA 3GENA 4KBCA 2QO2A 3NUUA 4IVDA 4NYEA 2VTQA 1CKPA 1SM2A 1T45A 4K6ZA 4O1PA 2C1BA 2YERA 3SRVB 3OZ6A 3CQUA 3BEGA 2WTWA 5E8VA 4YJSA 3FC1X 4C34A 5HQ0A 3R8UA 3ACJA 2O63A 2R3HA 4JL9A 3PRFA 3QC9A 5K5XA 5IQCA 2R3QA 4AAAA 4XBRA 4QQTA 4P5ZA 4FK3A 4AW1A 1UKIA 2ZM3A 4BZDA 2EXCX 3AMBA 3IECA 3JUHA 5HTBA 3KCFA 5EI8A 4BHNA 5GIOE 4M15A 3FUPA 4I94A 5M4FA 2QODA 4CG8A 2PVHA 2Z8CA 4QTDA 5AUYA 5AR7A 4CV9A 2R3FA 3DFCB 1WFCA 3DAJA 3FAAA 5E8SA 4DDGA 2JEDA 4LFIA 4M68A 3SDJA 4BY9E 2UZBA 3NWWA 5M57A 4QMWA 1M7NA 4FVPA 2W99B 2CGWA 4FIJA 3QU0A 4DCEA 5A6NA 3BHHA 5CX9A 5IF1A 5ACBC 1JAMA 3BYVA 4DAWA 4O7RA 3EN4A 3TZ7A 4C4JA 4PL5A 5BYZA 5CVHA 4RWJA 3OCTA 1O6YA 4FOCA 5IQHA 3ZS5A 2XNOA 3FYKX 4L43A 2X81A 1H8FA 2PZ5A 4W9WA 2LAVA 1CKIA 3S00A 4MH7A 1UV5A 2PZIA 3R04A 3UVPA 2PUUA 4IZAA 3NIEA 4YZCA 4TW9A 3COIA 5T68A 3W2OA 5CEOA 3W0SA 3ORMA 4JQEA 3PXRA 4JQ8A 4I0SA 3PVBA 4L7FA 4X3FB 3W2QA 5CXZA 3A7FA 4O38A 4O7LA 3ODZX 2IZUA 2ZV8A 3LQ8A 3R2BA 2YN8A 4AT5A 3KULB 4BZOA 1L8TA 1LEZA 1NVRA 2J7TA 3MFRA 5AUVA 5CF4A 5J8IA 4CCUA 3OHTA 3LW0A 2OIBA