4IX6A

Crystal structure of a stt7 homolog from micromonas algae soaked with atp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
346
structure length
346
Chain Sequence
LKARGGPKTLRRTPGVEPKDIRVLPGPLGSGNFGTVFRGVFKGDQDVVLKNAKADVMAAEELLECEMDVNYHVHANAKGTCARFMGCIELGAKDGGEIYNGTLTEGLWLMWANEGENTVEALMRRGTAPLATAMACADATELGVTKKAMRELLGSLARLHECGVVHRDVKPANLIAAEKDGGVLKLIDLGAAALCLPLPETLNYYPGDGPADPRYAKADELYLLPPGSPRPTKDNAAKLWEAHKPDRFDSWSAGCVMLQLAVVGLRTDAGLERFLADYKAVGYDVNAFRGEKSGEYGTMDFAALDANGGAGWDLCQRLMEAERDARASCEAALSHAFFDAAALEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MsStt7d protein
publication title Structure of the catalytic domain of a state transition kinase homolog from Micromonas algae
pubmed doi rcsb
source organism Micromonas
molecule tags Transferase
total genus 106
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ix6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ix6A01
4KRCA 2R7BA 4W8DA 2KTYA 2OWBA 2CKPA 4KIOA 4I6HA 3RP9A 4W4WA 4E3CA 1BL7A 2YIYA 3QUPA 4H36A 2IWIA 4MWIA 2IVVA 3MPMA 4M66A 3L9PA 1HCKA 3JPVA 4JVGA 4XG2A 3DOGA 4L46A 3QXPA 4QMLA 4AZEA 2GU8A 3FLYA 4LMUA 3H10A 1Q3DA 2OFVA 4M14A 4Y5QA 4DEBA 4YSJA 3DV3A 2XRUA 1KWPA 3FKNA 4FNWA 3DAKA 4IFCA 4WT6A 5LMKC 3QCQA 4I5HA 3TDWA 4U6RA 1FPUA 2ESMA 4DITA 1NVRA 1YQJA 2HOGA 3UO5A 4FTKA 5HO8A 5KUPA 2XM9A 2JLDA 3LM5A 4YZCA 3UPZA 2QVSE 5HICA 5E8ZA 5M4CA 2VX0A 3GVUA 4I1ZA 4RJ6A 4QQ5A 3QZIA 4NFMA 4OTHA 4MBIA 2RIOA 4O1OA 4OTFA 1Q8ZA 3BI6A 2W17A 5JN2A 1EH4A 3MBLA 1XR1A 3E92A 3BYSA 4QYEA 2E9OA 4C7TA 1ZXEA 5DVRA 5E90A 5LWNA 4TNDA 3AMBA 3RK7A 3IW4A 3W8QA 2QHNA 4RA5A 1H08A 3NYVA 4F1MA 2OIDA 3FMNA 3TKHA 3DK6A 3RAWA 3RZFA 4F63A 5KX8A 4YHJA 2ZDUA 3ZZEA 4D2WA 4JI9A 1STCE 2GNHA 4FKIA 2YAAA 3V8SA 4S2ZA 3ZMMA 2YERA 4DEEA 4I4EA 4QMYA 4BDKA 2UZWE 4MNFA 3HA8A 4BZOA 3PIYA 1OB3A 2YCSA 3P5KA 4FIFA 3HKOA 3NW6A 4K1BA 3QBNA 1BLXA 3QTUA 5J7BA 1FVRA 2CNUA 5LVPA 3Q60A 4BZNA 4QTEA 2IZSA 3JVSA 4NZWB 2YWPA 3FL4A 3OC1A 4JBPA 4GS6A 3EQIA 2A1AB 1RJBA 2H8HA 3F61A 3G0FA 4O0UA 4Y83A 2VTTA 1UNGA 3RPVA 3VIDA 3E87A 2I6LA 3C0GA 1ZLTA 3MI9A 2OJ9A 2B9JA 3FMEA 5JGAA 4RIXA 4ERKA 3W1FA 3AGMA 4YBKA 2QQ7A 2YLFA 3BLHA 3TEIA 4EHZA 4MNEB 4WSYA 5I3RA 2UZLA 4FIGA 4M84A 1UNLA 2I40A 3A61A 4S30A 2EXMA 2E9NA 3R00A 4U81A 3EKKA 4J8NA 1BKXA 4S34A 2YN8A 4JJRA 5CI7A 3HAMA 4FEUA 2OU7A 4E5WA 4EOIA 2W4OA 2XJ0A 4O0VA 5FGKA 5E1EA 4DF3A 2XS0A 4PMMA 3TG1A 4DGGA 2I7QA 2QOBA 4OR5A 3W2SA 4FL3A 2WMSA 2XNEA 4A4XA 4BCFA 3LCDA 4KBKA 3KF7A 4NM7A 3TJDA 1VZOA 4BCNA 4BFMA 5J79A 3FZTA 4O27B 4R3PA 2QOHA 1WBTA 4FTRA 2GFCA 3ELJA 3OW4A 1AGWA 3BX5A 3DBDA 4L45A 4QP1A 4RC2A 5JKGA 2YIXA 4MXYA 5ANIA 5J5TA 4YZ9A 1UVRA 5CNOA 4ZZMA 3FAAA 2XNGA 4HOKA 2ERKA 4EI4A 2UZUE 3CPBA 3M2WA 5C27A 3R01A 4LV5A 4FSQA 4HYHA 5FEEA 3MESA 4ZSAA 1OIYA 1OUYA 3V01A 1RQQA 4JBQA 3RAIA 1PYXA 2XBAA 2CJMA 3UNZA 3ZLXA 5KMMA 5LXMA 4YZBA 5DGZA 2H34A 3NEWA 2X6EA 2ZB0A 3E8DA 3Q6WA 4GCJA 3TTJA 4KRDA 4A06A 1U46A 5G6VA 1KE7A 3IONA 3U54A 3DTCA 3BHHA 4FOCA 1JWHA 1KOBA 2NNWB 4CQEA 2BZJA 4EH3A 1E1VA 2BDFA 4QYYA 3ITZA 5DRDA 3GCSA 2IVUA 5AMNA 5IA4A 4G17A 3CPCA 4RVTA 4IVDA 3PJ3A 5AUXA 2A0CX 3KFAA 1ZZLA 2VZ6A 4MXZA 1OKWA 2I0YA 1JBPE 3QLFA 3A62A 4XP2A 4Z7GA 5GZ9A 4ASEA 3F9NA 2W05A 3UNKA 1JSUA 1JOWB 4EOMA 5M53A 2OJIA 4L8MA 1H01A 2RFDA 5AJQA 5H9BA 3D94A 2VGOA 4AXAA 4CVAA 3QC4A 1Q8UA 3LQ3A 5A4TA 3ACKA 4A9UA 3AC4A 2DS1A 4FV0A 2W1CA 3O50A 1CDKA 2UZVA 5HO6A 3EB0A 4C0TA 3DLZA 5D10A 4ACDA 3TV4A 2Z7QA 4NIFB 4CLIA 4K33A 1YXXA 4DE4A 4NW6A 4NCTA 4QNAA 4R5YA 3ULIA 3NUPA 4HNIA 5CY3A 3R7YA 2XNOA 2BKZA 3RBWA 3VBWA 2Q0NA 4C4HA 3R83A 4PNKA 2XK9A 4I20A 4L00A 2C6DA 3Q9ZA 4A9TA 2BIKB 2Z7RA 4QMMA 2C3JA 4KAOA 4V0GA 4X3FB 3F6XA 4IJPA 4RIYA 3VUMA 2OH0E 4MF1A 4RFZA 4HYUA 3R8UA 4E4XA 5CLPA 5CU0A 5A14A 3DJ6A 3ZZWA 1PYEA 1Q3WA 4BDJA 4NM0A 4WIHA 4QP7A 4L7SA 4E8AA 4FV1A 5D12A 3GC8A 3F3VA 4OTGA 4FIEA 4DHFA 3D0EA 3QZHA 3CTHA 4NL0A 5BYLA 2YA9A 2GFSA 2YIWA 3L8SA 4L01A 4U8ZA 5D1JA 3TXOA 5GJGA 3LFSA 3GC9A 3P7BA 4U3YA 2W4KA 1ZWSA 5C8MA 4NKSA 5CF5A 5FDPA 1BL6A 4ALUA 4YC3A 4EQCA 2ZV8A 4RA4A 4JS8A 3C1XA 4RLLA 2PVKA 2R3RA 3I5ZA 3QQHA 2FH9A 1R0PA 1P4FA 3DBEA 2CGUA 2JIVA 4MEDA 4ZSJA 3VQUA 3VN9A 2W4JA 3UTOA 1OM1A 4EZ7A 5JT2A 5KBQA 2JD5A 2JKOA 3FYKX 4TL0A 5DRBA 2UVZA 3POOA 4DGOA 5DR6A 4DLJA 4F1OA 1WBWA 1MQBA 3CJFA 3UOHA 3UOJA 1XWSA 1OPLA 3ETAA 1PW2A 4IX6A 4N0SA 5CS6A 5JRQA 2W1FA 2F2CB 2VO3A 1E1XA 5AUUA 3GU5A 3MIAA 3MPTA 1J7IA 3R7EA 4IBMA 4RVMA 4OAUC 4FTCA 1Y57A 3QTQA 3BZ3A 2VTNA 2GPHA 5E8VA 2QR8A 3FLZA 1GZOA 3VQHA 4YGAA 3W10A 4ZTQA 4AZVA 3UBDA 1GZNA 4IHPA 4TYHB 4M12A 3GGFA 4IQ6A 2YM8A 4FTIA 2QD9A 2XF0A 4ACMA 5K3YA 4U79A 4CKJA 1YI6A 3ZUVA 4FV7A 4MXXA 3R9NA 5EKNA 5CQWA 3FI3A 1J7LA 3PXRA 3OROA 5C03A 5ETCA 1OKVA 2X9EA 2XIKA 3FLNC 3TNWA 3M42A 3PZEA 4KKGA 4C2WA 4GK2A 4M15A 2C6IA 5DR2A 4S32A 2W1DA 4HGEA 3I60A 4D9UA 3WIGA 3AC2A 1OMWA 4J98A 5FP6A 3WI6A 1AD5A 4XP3A 5K0KA 2E9PA 2BRNA 3IOKA 4FE2A 2UZTA 1UKIA 5E1SA 5HI2A 1MRUA 2R7IA 2BZKB 2CCHA 3GT8A 3C4ZA 4YSMA 3QA8A 3NX8A 4FTJA 3DT1A 3S0OA 3ZONA 4O38A 1S9JA 4C38A 5BVEA 3ZSHA 3QYWA 4PV0A 3Q4ZA 1SZMA 3OF0A 3PG3A 4JQ8A 3QZFA 5HKMA 3ID6C 5GHVA 4IW0A 4I41A 3OWLA 2WQNA 4GJ3A 4O1PA 2W06A 4YJNA 3QCSA 3D5WA 1CTPE 1CSNA 3QTWA 4B99A 4E7WA 3DZOA 2W99B 4FTLA 4GVJA 4KSQA 5AV1A 4MVFA 2WNTA 3LFQA 4OBOA 5M44A 5FTGA 4L43A 4PX6A 5TKDA 4YUQA 5BMSA 4ZJJA 3FMJA 3NZ0A 1V1KA 4A9YA 1Q41A 4EH7A 5CANA 5H8EA 3QQLA 4EHEA 3FEGA 2O2UA 2OF2A 3KCKA 3NUYA 3BHYA 4S31A 4I0TA 3SAYA 2XJ1A 2ETRA 4X6QC 3L9NA 2Y4IC 4HCVA 1QMZA 2UVYA 3MVJA 4ZY4A 2XNNA 4PWNA 3MY5A 1G5SA 3AGLA 3MFRA 3Q4TA 5HG8A 4QT1A 2J0JA 2ETKA 4HZRA 4BBEA 1OL1A 2HWPA 5F9EA 3FDNA 5DT0A 5IQCA 4L44A 5GINE 3FLSA 5IQFA 3K3IA 5IA0A 3LHJA 3F69A 3EQBA 3PXZA 4FTOA 4F6WA 2O8YA 2RFEA 3A4OX 3RZBA 4KWPA 2P3GX 2X0GA 1SVHA 4RJ5A 3T3VA 3FY0A 4CFVA 4C02A 2UW8A 3HUBA 4I6FA 4UXQA 4W9XA 1PKGA 3OMVA 4KIQA 3QHRA 3V5WA 2YACA 3R9OA 2QOLA 5DI1A 1K3AA 3F3UA 3F5UA 3NNUA 3QRKA 4D4SA 3NRMA 2VWYA 3EIDA 3P23A 2O65A 1BYGA 4C3FA 5AR5A 3E93A 5F4NA 4QMNA 4ONAA 1CKPA 5IMEA 3HVCA 2J5FA 2WTWA 3MH3A 4ZOGA 2VWUA 5E8YA 1PJKA 1YWVA 4XLIA 4D5HA 2AUHA 2IJMA 3M1SA 4FIHA 4RIWB 4BF2A 4DINA 5HIEA 3LFBA 2WTKC 3KEXA 2PVHA 3SOAA 2R9SA 2B9FA 4WRGA 5J7HA 5HVKA 3MIYA 2QU6A 2WMAA 3F2NA 1JSTA 4XV2A 4ACCA 2ITUA 3CQEA 3LFAA 3A7HA 2X8IA 5JFWA 3OCBA 4TYIA 2F2UA 2X8EA 4MAOA 3AOXA 5BMMA 5TR6A 3W55A 4BVUA 4ZJVA 4OTWA 2O64A 4E20A 4ZZNA 4LFIA 2OJGA 2GQRA 4BCJA 4MNEA 3TL8A 3VHEA 4FX3A 4H1JA 3UOLA 4GYGA 2HAKA 4YLKA 4JOAA 5A4LA 2P0CA 2R2PA 3HDNA 5M06A 4QQJA 2W5BA 2BFYA 3O8UA 3VBYA 1CM8A 4FSUA 4FTTA 2WGJA 4L68A 4A9RA 2A27A 1SNUA 4D0WA 4YLLA 4ZS4A 1R3CA 3ALOA 2VTLA 5EYMA 3S95A 5EFQA 1WBVA 4QP2A 5ICPA 4R6VA 5JFXA 2UZOA 3D9VA 3LLAA 3TNHA 5BPYA 2C6KA 3K3JA 4NH1A 1BX6A 3EFJA 3GFEA 1R78A 4DGMA 4B4LA 2OG8A 1WMKA 1Y91A 2EB3A 2BDWA 3PVUA 4FTAA 1VYWA 3EQCA 3EHAA 3SRVB 1VJYA 4XYFA 5DMZA 3LXKA 3QTSA 4O7YA 3HZTA 3CR0A 2IW6A 2CGWA 4CFFA 2PUPA 4PDYA 3HEGA 5IUGA 5CX9A 4BYJA 3N4VA 4TWPA 5JFVA 5LQFA 3BQCA 5CQUA 3T3UA 1PXPA 2BAKA 5EHYA 2QU5A 1DS5A 5BX0A 5HLPA 4YZNA 5CU2A 4O7WA 5J5SA 3DNDA 5FM3A 2WTVA 4RPVA 4HVGA 4HGTA 3G90X 4M3QA 2VTHA 4IH8A 2QONA 4CD0A 4DBXA 3VS2A 3GCUA 5IH6A 5DWRA 4GV1A 1JVPP 2ZYBA 4FIIA 4RIOA 4OBQA 4BDHA 4C4EA 5BUJA 3VRYA 4YTCA 4CXAA 2WTDA 3GXLA 1X8BA 3BEGA 4E1ZA 2G1TA 2ONLA 2A2AA 3UODA 4AE6A 2JDVA 3R6XA 3D5UA 4XG4A 4KIKB 4CT2A 3FWQA 2WAJA 4E73A 3C7QA 4DFXE 3F3WA 4HW7A 4BGQA 3FLQA 3EN6A 4FSMA 4RLKA 2ERZE 3OWKA 1UWHA 2C0TA 4AUAA 2PMLX 4Q5EA 4EJ7A 4DFLA 3TZ7A 3HMPA 4DC2A 2FO0A 3QAME 3W2CA 3UVPA 1XO2B 2QLQA 2X4ZA 3HYHA 4AW2A 3DTWA 4KUJA 4XJ0A 3ET7A 3UGCA 3P86A 3IG7A 3OHTA 2QO9A 3CD3A 1JQHA 4FT5A 5I9ZA 5IH5A 4HGLA 3TZ9A 2PUUA 4OW8A 5DIAA 3BQRA 2C6EA 2XKEA 4JIAA 4NIFA 5EQYA 3BRBA 4W9WA 3RPSA 4DH8A 4O2ZA 1YOLA 4GL9A 4K8AA 3PLAE 4CNHA 4LUEA 4EONA 2JBPA 4DFBA 3RNIA 5I9VA 3HGKA 2WHBA 4F9BA 4FSNA 3OEFX 4U44A 1T45A 4FL1A 1I09A 4X3FA 2B53A 4TY1A 1Q62A 5TO8A 4FZAB 2RKUA 1H25A 2IG7A 1R0EA 1WAKA 2QHMA 2GQSA 3FXZA 3GFWA 3O23A 4EYMA 5KZ0A 4BC6A 2VNYA 2XIRA 3D7ZA 4TW9A 3PVBA 2J0LA 3QZGA 3MJ2A 2W0JA 4BICA 4GUBA 4ZSLA 5T68A 3FPQA 4MXCA 3QD3A 5H8GA 2W1ZA 3KCFA 1FBNA 4R3CA 2B54A 3AT2A 4HVHA 1YHSA 4JAIA 3NGAA 4JLCA 4FKQA 5AIKA 3T9TA 2OGVA 4U43A 2Y0AA 4BIEA 1YDTE 3ENHA 3QTIA 4IB3A 4D2SA 5IA1A 1O6KA 3C5IA 1OGUA 5CYIA 4F65A 3TDVA 3R9DA 1LUFA 4ZK5A 4F0IA 3BGQA 3SV0A 4TN6A 4II5A 3MVMA 3R22A 2Z8CA 3D7TB 3HUCA 5AAFA 3KXXA 2HENA 3F88A 2BRHA 2XB7A 4GT3A 3R7UA 3TZ8A 3R8PA 3UE4A 4HCTA 5FTQA 4YC8A 3BLRA 3KULB 5F94A 4ANSA 4RJ3A 1U59A 4DAWA 4TTHB 3FXXA 1NA7A 5A46A 3ORXA 5EHOA 3GU7A 4OAVB 2PZYA 3JYAA 4GFMA 3LXNA 5E8UA 3RPRA 1ZYCA 4CZTA 2V7AA 1JSVA 2GTMA 3Q5IA 4TYHA 4C33A 4FKJA 4N4SA 2XNPA 3CY2A 1UA2A 4PPBA 3QTRA 4RBLA 4BDCA 5A4EA 2QO2A 4HVSA 1XQZA 5DBXA 4D1SA 1YRPA 3KB7A 3KVXA 4BDEA 1OKYA 3AMYA 3LJ2A 2V0DA 4QMXA 3VS4A 1FINA 4FZDB 3GI3A 3MH1A 1PXIA 2BALA 3OEZA 4LYNA 1O9UA 5AV3A 4AA5A 2PVNA 5K4IA 3ZHPC 5J8IA 5IQIA 1VYZA 4ENXA 3NUUA 4AW0A 3QQGA 2EUFB 4C4GA 2C5OA 4EKKA 3Q96A 3ZDUA 2WQBA 2PVJA 3UZRA 4B8LA 2XNBA 4P4CA 1NVSA 4EH6A 3LE6A 3JY0A 4I93A 1PY5A 4OT5A 3RTPA 4BDFA 3U9CA 3D15A 4IADA 4M68A 3ROCA 2BRGA 4F09A 3A4PA 3MA6A 3SD0A 3Q6UA 2Y6OA 1PHKA 2HCKA 3W2QA 3CGFA 4ZSEA 3ZLWA 4GG7A 2VTSA 1RE8A 3QWKA 4QRCA 5GNKA 2P55A 3T8OA 3FYJX 3T9IA 1H1QA 3IW8A 3MB7A 1U4DA 4U80A 2ITOA 3AD6A 3UYTA 4TWOA 4R8QA 3D2IA 3OG7A 4GYIA 2YJRA 4BY9E 1Y6BA 4IX3A 1OL7A 4XV9A 4HYSA 5LCKA 4E6AA 4X21A 4GK4A 2OK1A 1YHVA 4BGGA 1ZYSA 5HNBA 3QALE 3RINA 3LVPA 5B2LA 3R71A 3PIXA 4N70A 4CMTA 3KQ7A 2UW4A 3LFFA 3NNWA 5FXQA 2VO0A 2OLCA 4C37A 4ZJIA 4QMVA 4JG6A 1U5QA 4QYHA 5CSHA 3DU8A 3SW7A 5BVDA 4BHZA 4Z55A 4LOOA 1T46A 4ZEGA 3JS2A 2W5HA 4RJ4A 1S9IA 4ASDA 3R9RA 4FKTA 4FSWA 4I5CA 3AC8A 2XKDA 3ZRMA 1OUKA 4F7JA 5JEBA 4APPA 3WF7A 4FV2A 3FXWA 5IDPA 3VUGA 1SM2A 5IQHA 3E63A 3EN9A 4I6BA 2CLXA 3BEAA 2ITXA 3SHEA 4EBWA 3DBQA 4RQVA 5A6NA 2XM8A 3MS9A 5AM7A 2R64A 3V51A 4O0RA 5CNNA 3RHKA 3DDPA 4EK6A 2YDIA 2OF4A 3DLSA 4LM5A 4C61A 3UZTA 3OS3A 5CT7A 3QD2B 1YI4A 3NR9A 3O71A 2GS2A 2CHLA 4FYNA 2XIZA 5CEPA 4GEOA 4X2GA 4AA0A 2G15A 1TVOA 3TI1A 2NRYA 4N6YA 3QUDA 3H0ZA 1H8FA 1OBDA 2C6OA 5LWMA 4MH7A 2YM7A 2RG5A 2GS6A 3DFAA 3PDTA 2OW3A 4WNKA 3I7CA 3AD5A 4RIWA 1DM2A 2J0KA 5KKRC 5M4IA 2C5NA 3TKUA 2HXLA 2EB2A 3GBZA 5AP3A 5DEWA 4F9AA 2FUMA 5K9IA 3PA4A 3E5AA 4DGLC 5K5XA 2YDJA 4LUDA 3U6JA 5FBOA 2B52A 4MBLA 3PJ8A 1H27A 1WVWA 2O63A 2CNVA 3MFUA 1TKIA 4AW5A 4EJNA 5K0XA 3QQFA 2WTCA 4FOBA 1NW1A 4BBFA 5ETFA 2BROA 3KRRA 2J50A 3VO3A 2CN8A 1ZRZA 3F7WA 5HZNA 2IO6A 4XOZA 3SQQA 3MB6A 1M2RA 3O51A 3O96A 3R28A 3OOGA 4D28A 2CNQA 3DKCA 4LOQA 5HLWA 3C0HA 2VWWA 4P7EA 3U6HA 4I5PA 1GIIA 2QOQA 1SMHA 2WOTA 3NDMA 4FNZA 2I1MA 3DKOA 3L8XA 3PJCA 1J1CA 5DOSA 5EQEA 4CCUA 3VF8A 3Q2JA 3V6SA 1PXLA 4KS8A 4CG8A 2G2FA 1OIQA 1OL2A 2ITTA 3G5DA 3NYOA 4EH8A 5IQAA 4G3EA 5F20A 2YAKA 5D9HA 5ETAA 3RK5A 3SRVA 4AG8A 4EH4A 1XH7A 4LRKA 4FSTA 4CSVA 3FZRA 3DBCA 3S1HA 3NYNA 3C4WA 2PE2A 4GVAA 5AAGA 4UX9A 4GMYA 4BN1A 3EN5A 3V8TA 5J9ZA 3QLGA 3TJCA 5CTPA 5M57A 3KK9A 3F5GA 4GSBA 3SXFA 4APCA 3PRIA 3IKAA 3OW3A 2NO3A 4R78A 4O7TA 4RWLA 5LMAA 4RZWA 3E88A 3ATSA 4U40A 3ZRKA 4J7BA 2PZIA 5DYJA 5HG7A 1Q97A 2UZEA 3WZJA 5KNJA 2OI4X 2YIRA 3E8EA 2YCFA 1H1RA 4OUCA 4CFXA 3SGCA 3RVGA 1M17A 1U54B 3FSKA 4H3PA 4W8EA 2XZSA 4J52A 3RWPA 2R3FA 3TUDA 1FVTA 2IZTA 4IAZA 5ANKA 5AR2A 4ZLYA 3PA3A 5CEMA 2PZRA 2WKMA 4CYJA 3W2PA 3PSBA 3I1AA 2XIYA 2XYNA 5JGBA 5HX6A 1QPDA 4G34A 4Z9LA 5EHLA 4HVDA 4KIKA 3E62A 4MD8E 4NK9A 3WF5A 4DG2E 4EOKA 1W84A 4AOIA 4YNOA 5HEZA 3RI1A 4FEXA 2R3IA 3DAEA 3Q4UA 3U51A 3LJ0A 3G0EA 3I0OA 1LEZA 4JX7A 3P4KA 5L2IA 3PY0A 4ZS0A 3L8VA 3O8PA 1JNKA 3A7IA 3EOCA 4PL3A 3U8WA 4PMSA 3BYUA 4USFA 3BGPA 2Z7SA 5AEPA 1DI9A 5FEDA 4C3RA 4EK4A 2W1IA 4I23A 1M52A 3GCVA 2C5YA 3EL8A 3MY0A 5K4JA 3KXMA 3OTUA 1WFCA 4AT5A 2R0UA 4CT1A 2B1PA 3BYVA 4AZTA 4QPMA 4OTDA 5EM8A 4IDVA 2HZIA 2XBJA 2VTPA 2YM5A 3MW1A 3AD4A 1TQIA 3DDQA 4U9AA 3ORLA 3PWYA 2XCHA 4HNFA 3WZDA 1PXNA 3DPKA 5L6OA 3IGOA 4J97A 3FZPA 4JXFA 3L9LA 4IZ7A 5A3XA 2BRBA 2NP8A 4M67A 4JX3A 3FBVA 4A4LA 4G6LA 3C5UA 3KU2A 4PL4A 4UZHA 3TT0A 4BI0A 1YXSA 2JAVA 3FQSA 3EWHA 4CMUA 4TRLA 5J9YA 4ANNA 4KKHA 4G5PA 5E91A 5BVKA 1ZYDA 3H4JA 5HE0A 3SW4A 2GNGA 4FKRA 2XK3A 5KBRA 4EYJA 4R1YA 4J96A 5HIBA 4R3RA 4RFMA 1URWA 3BBTB 4OTRA 4ANOA 3DQWA 1XH5A 3H30A 3KVWA 3A2CA 2CSNA 5L2SA 5FP5A 4NTTA 4JR7A 4JQ7A 3Q3BA 2ZMDA 3ORIA 5CEQA 3NVMB 4MWHA 5TF9A 1GIHA 3DB8A 4FA2A 5L6WL 5IU2A 3D7TA 2XJ2A 1Q5KA 2UW6A 3OBJA 4EK3A 3DKGA 2WMQA 1H00A 4HVIA 2ITYA 4FK6A 5E7RA 4O21A 2JITA 4K9YA 1ZYLA 2R3LA 3KULA 5AUWA 4WNOA 4D5KA 3WILA 4G9RA 3NUAA 3GP0A 3EN4A 1ZMWA 2C5XA 3TACA 4UXLA 4Z3VA 2VRXA 2JKKA 4C35A 4XG9A 2HK5A 3W33A 1ZYJA 2H6DA 3R2YA 3QCXA 3EFLA 2GTNA 4KNBA 2PVFA 4EORA 5DFPA 1MRYA 3MWUA 5AADA 5GZAA 1XJDA 2P2HA 4LGDA 2IZRA 4EOOA 3FMDA 4RVLA 3AC1A 4QMUA 3RM7A 4Y8DA 3UZPA 1SVGA 5EG3A 4I22A 3H9OA 1YOMA 3QCYA 5GIOE 4YJQA 2VTQA 3ODYX 4L7FA 4Y73A 3WIKA 5AX3A 3BHUA 4RQKA 5AR7A 3E3PA 2WOUA 2WTJA 3COHA 1B6CB 1L3RE 1PMVA 3A7JA 1PMNA 4FEQA 2VTIA 3DNEA 3KMMA 4H05A 1GJOA 3UG1A 4ID7A 4BTJA 4M7IA 5HQ0A 3FHIA 1Q61A 2FYSA 4FKLA 4EOLA 2R3HA 5IEXA 3LCOA 4RT7A 4YHFA 1YVJA 5EDQA 5LARA 2B7AA 2HIWA 2RF9A 3UO6A 4TWCA 4AP7A 4E26A 2X81A 1F3MC 3AXWA 4DFYA 3PJ2A 4IJ9A 2BMCA 5D7AA 2HZ0A 5DHJA 3GNIB 3R21A 3VF9A 3H9RA 1B38A 1H4LA 5CWZA 5DA3A 3QXOA 4Q2AA 3PA5A 3QKKA 4Q5HA 4LRJA 1YW2A 4MCVA 5EW8A 3W8LA 3ZFMA 4DEAA 5AV4A 3FI8A 2ZB1A 1ZOGA 4GG5A 3F82A 4U7ZA 4AA4A 4MKCA 5HE1A 3LMGA 3SLSA 5BQ0A 3VAPA 4JAJA 5GJDA 2VO6A 2F49A 4ZTHA 4RFYA 4YJPA 2JGZA 4MD7E 4TKSA 4YJTA 2VTMA 4UMRA 3PPZA 1FMKA 2J5EA 2PY3A 4RX9A 4FV5A 3A8WA 4IXPA 4WG3A 5EDRA 4BCMA 3CP9A 4LQMA 1XBCA 2QOCA 1OPJA 3QX4A 5CU4A 3VUTA 4YLJA 4E4NA 3ZUTA 3O7LB 3HAVA 1QPEA 3IK3A 2FSMX 3VC4A 4BCGA 4FMQA 3VS3A 3KN5A 3EJ1A 5JRSA 5DNRA 4GW8A 4X0MA 1UKHA 4O22A 3VJNA 5FLFA 4MQ2A 4QTDA 3HMIA 3R1NA 3KKVA 4FG7A 3PRFA 2R3PA 3AC5A 3IDPA 1H26A 1P14A 4QO9A 4YZMA 5AP6A 3V3VA 5H3QA 3ZYAA 4D4YA 2C1BA 2JDOA 4DH7A 3P1AA 3UMWA 4QP6A 3MN3A 5L2QA 4O7VA 1ZY4A 4LL5A 2C6MA 4BI1A 3DGKA 3BHVA 1GIJA 4AFJA 4PF4A 4AZFA 4ERWA 3SX9A 3LCTA 4CRLA 1O6LA 5CSXA 1IR3A 4RX5A 1R1WA 4S33A 4IWQA 3R7VA 4O7LA 3ZBFA 1W8CA 2FA2A 3AMAA 5CSWA 2OIBA 3ANRA 5KMJA 3PVWA 2WIPA 5H8BA 4FKVA 5FRIA 3WYXA 4H39A 2QOOA 2OXDA 3SDJA 3UJGA 5AA8A 5GZ8A 4DH5A 4BI2A 1MRVA 4H3BA 1OL5A 2ITQA 4USEA 2UZNA 4FF8A 5I9UA 3DB6A 5HO7A 4L3LA 3NVKI 2R3MA 4GKIA 4HCUA 1QPCA 4MTAA 3PPJA 5HORA 2PUIA 4FV9A 1BMKA 3HV5A 2W5AA 5CF6A 2XUUA 5HU3A 4PTCA 5CEKA 3Q53A 4XG3A 5EM5A 5I9YA 2RFNA 1M2PA 4CZUA 3H3CA 4ANMA 4CFWA 2XCKA 4PNIA 2QOIA 3QRTA 1FQ1B 4RRVA 4AN9A 4AT3A 4ALWA 2WMVA 1ZARA 3ZO4A 4BTFA 4IC7A 5A9UA 3F2RA 5E4HA 5ACBC 4NCTC 3TV6A 1KE5A 2AC3A 3PZHA 3LAUA 3QGYA 5EYDA 3LPBA 3D4QA 3PY3A 3VWAA 4XBUA 3UC4A 4R7BA 4AT4A 4FEVA 4BCPA 5IA3A 2Y8OA 3QD0A 4CMOA 4PMPA 3E7OA 4NJDA 3DXPA 1FMOE 5EI8A 4F1TA 2G9XA 4O7NA 3EL7A 4E93A 3R63A 3QTXA 4BL1A 2YABA 3SC1A 3E7VA 3DY7A 4XHKB 3QHWA 4FVPA 3TKIA 4F64A 3HV6A 4IAAA 5HCZA 1ND4A 3MH0A 2V5QA 2E9VA 3GOPA 4O0WA 4JQEA 5CAPA 3WZKA 1RW8A 2UW0A 2WU6A 3AT3A 5IQEA 5EYKA 4BRXA 1OI9A 4ZLOA 4DT9A 3AG9A 3OCSA 3VW6A 5LVNA 2W1HA 3O7LD 3PXYA 3VUHA 3LOKA 3RJCA 4FZFB 4AGCA 4QMTA 3FHRA 4IE9A 4OT6A 4AN3A 5LJJA 4JDKA 3JUHA 2FB8A 3P7AA 4P5QA 4CG9A 2OIQA 5GIPE 4RWKA 1MUOA 5HLNA 2VO7A 1PXMA 1U54A 1M2QA 2Q0BA 5HNGA 2CMWA 4G6OA 5FBNC 4EUTA 1Y8GA 3IS5A 4FT0A 3PUPA 3PP0A 4GFOA 1WVXA 3PG1A 4OLIA 4WUAA 5FTOA 3FL5A 3ZDIA 4BKYA 2ITZA 3PE1A 4ZSGA 3QTZA 4BCQA 4I21A 3QC9A 4F9CA 5IH4A 2WZJA 4LL0A 4FZ6A 5LVMA 2PHKA 3HLLA 5EI6A 3F5PA 3Q9WA 3W18A 3MJ1A 3Q04A 3V5PA 3MTFA 3LZBA 4G3DA 5FEQA 4WG4A 5LCJA 4EOJA 4DG3E 3R8MA 2YITA 3LCSA 5IF1A 4FKPA 5LVOA 4NT4A 5ANGA 2W1EA 4QPSA 2E9UA 2V55A 5M55A 2WQOA 5AP0A 3OVVA 4USDA 2JDSA 2YM4A 3ZCLA 2X1NA 1YDSE 4DFUA 2YISA 1KV1A 3P7CA 4UV0A 4MBJA 4BWKA 3VUIA 3KL8A 4FEWA 2R4BA 2VWIA 4JDJA 3Q2MA 2OH4A 2P2IA 4K6ZA 4BZDA 5HESA 3MGYA 2YDKA 3LJ1A 3LFDA 2BIYA 2P33A 3NYXA 4ZTRA 1H0WA 1MQ4A 4FYOA 1IA9A 5IPJA 5CENA 3UDBA 3EQPA 2WMTA 4N57A 5EM7A 2G01A 5BVWA 3ZRLA 1REKA 4U0IA 4AOJA 2V22A 5AUVA 2IVTA 4F7LA 2WO6A 4QTCA 3R2BA 2QLUA 4I92A 4AW1A 2VTAA 3HV4A 5A4QA 2PMNX 2QCSA 4FV3A 3E8NA 4M0ZA 4QYFA 3RCJA 1K9AA 4F9YA 3FY2A 4IB0A 2FSLX 3S2PA 4FSYA 5CI6A 4QNYA 1PXJA 3BYMA 2KULA 4R7IA 4WG5A 2W1GA 5AWMA 4ZXTA 5IEYA 1L8TA 1VR2A 2JEDA 3CBLA 5CT0A 3Q4CA 3IW6A 1HOWA 2AC5A 3IGGA 4BDAA 5BYYA 1YHWA 3EYHA 2CKEA 4D4VA 2BKKA 3C9WA 4GT5A 4UYNA 2C1AA 2Y4IB 3QUEA 5A54A 3G9LX 5LMKA 3PSDA 3QQJA 3CLYA 1OZ1A 4Y72A 1XBAA 3ERKA 3BCEA 2W96B 2ZDTA 4ITHA 1YXUA 4QP3A 2QO7A 3ZOSA 5JQ5A 4EEVA 3FE3A 2VN9A 4IDTA 3TUBA 3O2MA 4EOPA 2WMRA 3VRZA 4F0GA 1XKKA 3D14A 5AR3A 4C57A 4ZY5A 2XH5A 1G8SA 2GSFA 2JFMA 3FJQE 3KY2A 4DN5A 4DGNA 4L9IA 1QPJA 3DCVA 4QP8A 5J1WA 5AP2A 4XG7A 3W32A 1W0XC 5ANDA 4NWMA 2C6LA 5FXRA 1SVEA 3VS5A 3OXTA 2HWOA 2H96A 3JY9A 3HX4A 4EHGA 3BGZA 5K5NA 1YDRE 3KXNA 5KCVA 5F95A 4KINA 4F6SA 4X2KA 3TN8A 2BZIB 2ITNA 3GC0A 5HD4A 4TT7A 2JDTA 3GB2A 4FGRA 2Z7LA 3UIUA 3LW0A 4WHZA 2WTKB 5FXSA 2VWBA 1UU3A 3EKNA 3FMHA 4J71A 4PP9A 4BWXA 3KA0A 4QD6A 5L2TA 4ITIA 4O0SA 2QOFA 4KIPA 3C4EA 2GDOA 2BHEA 2C6TA 4DEHA 4F99A 4O86A 2WMXA 3GU8A 5FDXA 4YMJA 2PTKA 3HV3A 4QMQA 4TYJA 3WE8A 3BWJA 3K5VA 3CSVA 2F57A 2XEYA 4O84A 4L3JA 2BAJA 1KE6A 4XRLA 4CCBA 4IAFA 3LQ8A 4BR3A 2X2LA 5HIDA 4ACHA 3DKFA 3HRBA 3WE4A 3CE3A 4ANQA 3KRJA 1XH4A 2ZM1A 3H9FA 5HCYA 4W4XA 4HYIA 4J1RA 4BKJA 3HNGA 5CU3A 4YO6A 2CLQA 5B2MA 3ORKA 3W2RA 2PVMA 3O0GA 4IVCA 4TNBA 5HD7A 4GKHA 4HPUE 2YFXA 3A7GA 1UU7A 1WBOA 2PMOX 3II5A 4IAIA 3IW5A 3CC6A 3GU6A 1CKJA 3I6UA 4R77A 4FT3A 4EK8A 4NSTA 5HU9A 4G3CA 4F7SA 3DK7A 4G31A 4R7HA 4EL9A 4RX8A 5B0XA 4E6QA 1GNGA 4C2VA 5CAUA 5CF8A 4N6ZA 2VTRA 3R8VA 3U87A 3QYZA 4LI5A 4DTBA 4WA9A 4KD1A 1TQPA 4A9SA 5CVGA 3RCDA 4K2RA 2C69A 4D0XA 3HP2A 4R5SA 2XP2A 3HV7A 1RDQE 4EH2A 2WU7A 1KSWA 4GH2A 2X6DA 1R39A 4V05A 3FKOA 3EQRA 3Q5ZA 5CZHA 4DBNA 4JNWA 4PY1A 1UWJA 3VVHA 4DFZE 3ZO2A 4EUUA 3Q9YA 4Y85A 4P90A 4M0YA 5AP1A 3G33A 4YJOA 2ITPA 3ODZX 3R8LA 2XA4A 3RNYA 3MFTA 2SRCA 5M09A 5IMXA 2VX3A 2FSOX 5BVNA 3SG8A 5AP4A 4YO4A 3C13A 5CXHA 3RM6A 4YHTA 3QL8A 2WQMA 2UZDA 2X7OA 3EMGA 5IA5A 2XRWA 4KB8A 3THBA 3KGAA 3LQ5A 3QGWA 5KHXA 4ANBA 3B8QA 3E64A 1KUTA 4RWJA 4NM5A 3BWFA 4G9CA 2OKRA 2X4FA 4XS2A 1KE9A 2YWVA 5EOBA 4YBJA 2JBOA 3MDYA 1Z57A 5HG5A 2HY0A 5T3QA 3WZUA 2YCQA 5IDNA 4FBXA 4MX9A 4IZYA 2ONLC 2ZOQA 3FMKA 4W4VA 3EH9A 4IM2A 2CKOA 3NAYA 3WARA 4PP7A 4TPTA 4QPAA 4B8MA 3ANQA 1Q4LA 3NS9A 5HGIA 2YEXA 3BIZA 3D83A 1O6YA 3LIJA 3POZA 4U45A 1A9UA 1J1BA 5D7VA 4FGBA 4NW5A 2H9VA 3VW8A 4ZY6A 3U55A 4G2FA 3P0MA 3FUPA 2YLEA 5IZFA 4B7TA 4X2JA 5JZNA 3ULZA 2UV2A 4UEUA 5TT7A 4M97A 1HCLA 3ZSIA 4W4YA 3HL7A 4IM3A 3IDCA 4FV8A 2WEVA 2P4IA 2RSVA 5L3AA 4Y5HA 1G8AA 3CKXA 2OXYA 4UZDA 5J87A 1PXKA 4JRNA 3RAKA 3UIMA 3G6GA 3WZEA 5IG1A 2J6MA 2GHLA 3OTVA 2F7XE 4M13A 4PMTA 3VBXA 3R9HA 3LMHA 2VAGA 3ZXZA 3LMIA 5FM2A 2Y9QA 2WQEA 3VJOA 2R3OA 3SVVA 3EQGA 2PL0A 1XH8A 3VBVA 4J95A 3E8CA 2YJSA 3ORMA 3R1YA 3LLTA 4BCHA 5AV2A 4BDGA 1PRYA 4FNYA 1U5RA 5CU6A 4JG8A 5EK7A 4X3FC 2HXQA 4IWPA 2BHHA 4RC3A 4WO5A 5M4FA 1KOAA 1PMUA 4XX9A 3OXZA 5J95A 3UMXA 3NWWA 3VS7A 4XG8A 2J90A 4NKAA 4JL9A 4AAAA 5IUHA 1FGKA 1J91A 4L67A 2VUWA 2QR7A 4RX7A 4WBOA 1XH6A 2CGXA 5CSVA 4YP8A 5A4CA 5DE2A 2UW7A 4EBVA 4IX5A 4X7QA 4FG9A 4UMQA 5DH3A 2DWBA 3NUNA 3FPMA 4CKIA 3O8TA 4Z16A 1YWRA 4F70A 3MTLA 4CV9A 3OUKA 4BCIA 4X3JA 3WF6A 1MP8A 4YTIA 4UWCA 2X7FA 5DG5A 3LFCA 4QTBA 5L8JA 2PSQA 4I6QA 3HDMA 1NXKA 2O3PA 1OL6A 3ZFXA 3TWJA 5I9WA 4TYEA 4MD9E 4FODA 4YPDA 2JKMA 3QQKA 2GCDA 4K11A 4IVBA 5EH0A 4CZYB 5JSMA 3GUBA 1LPUA 1IASA 3BE2A 1JLUE 5HE3A 4DG0E 3SA0A 4O7RA 2XEZA 3RPOA 4RJ8A 2DUVA 2QKWB 4IWDA 4DT8A 3R7IA 3GEQA 4QOXA 4FKSA 4FSRA 2CDZA 4WD5A 4AX8A 1URCA 2WB8A 4PDPA 4KS7A 1PXOA 2BZHB 2PE1A 1J7UA 3FKLA 3ZFYA 2O0UA 4JT3A 3GQIA 4K77A 5CAVA 4IB1A 5A6OA 3QU0A 4B9DA 3F3TA 4KABA 2QOKA 3CQUA 4M8TA 1CMKE 4IFGA 2FVDA 3IW7A 3HMNA 3QA0A 2HW6A 5JK3A 5KHWA 2J0IA 2BTSA 3ZLSA 2IZUA 4Q9ZA 5E8WA 3BV3A 5CVHA 5AR4A 4CGAA 3NNVA 4EZ5A 3QKMA 3REPA 4GT4A 2EWAA 4TXCA 1KV2A 4X6RA 1KE8A 4WNMA 4DEIA 5CVFA 5BUIA 3C4FA 3VUKA 4NEUA 4F6UA 3BHTA 3WF9A 3KXZA 4IZAA 4KBCA 4ZP5A 3K54A 2OJJA 1WCCA 2QC6A 2PE0A 3AC3A 2PK9A 2QI8A 3G6HA 4ARKA 3FV8A 4FTMA 3G2FA 2C4GA 2XMYA 2OXXA 2GNIA 4I4FA 3PPKA 3JXWA 4PPAA 4H58A 4JRVA 2O5KA 2PPQA 4EH9A 3DXQA 1WBPA 4GFGA 3QWJA 3IDBA 5HTBA 2GMXA 1ZMUA 3ZC5A 4J8MA 4FKWA 3OWPA 4ASXA 4I0SA 4FV4A 2PULA 4IZ5A 4FTQA 4NUSA 3N4TA 3MSSA 2YHVA 3UVQA 3DJ5A 3L8PA 3MH2A 5BUEA 2BVAA 4DH3A 1NY3A 2A4LA 1YWNA 5M51A 4K0YA 1P4OA 3MPAA 4OTQA 4RMZA 5HTCA 3UQCA 4AACA 4C4FA 3FMLA 5ACKA 2GNFA 2WEIA 3TNPC 3BLQA 2GHMA 3CTQA 2A19B 2F9GA 4FKGA 4Y95A 5HCXA 5L8KA 2LAVA 2VGPA 2ZV2A 3FC2A 3FQEA 3PIZA 4EOSA 2GNLA 4ORKA 4G6NA 5CAQA 3HRCA 4FV6A 4RGJA 4YR8A 1A48A 2RFSA 5HVJA 4D2RA 2CN5A 4FR4A 4UMUA 1V0OA 1ZY5A 4YTFA 2J4ZA 2UZBA 4AZWA 3ZBXA 4IC8A 4EH5A 3MY1A 3WOWA 3AT4A 3FZ1A 1LP4A 2RG6A 3DA6A 3GCQA 4IEBA 5AX9A 5HVYA 3SOCA 3OY3A 4AN2A 2PVYA 4EC8A 4I3ZA 1H1SA 5AIRA 1A06A 2BR1A 4PUZA 1P2AA 3EFKA 2QODA 4C3PA 3R7OA 1F5QA 2PMIA 2VU3A 3OD6X 5KE0A 5I9XA 3SXRA 3ZEWA 5AFVA 2QG7A 2X7GA 3TCPA 3LFNA 2OZOA 4TWNA 2XK7A 2BUJA 5L8LA 2YZLA 5KKRB 3QKLA 2WD1A 3WYYA 3BU3A 3IOPA 4ANLA 4UY9A 3DZQA 2J7TA 2QG5A 4H1MA 2X8DA 1G3NA 3V6RA 2OZAB 5M08A 3VUDA 5C9CA 2HY81 2XYUA 3I7BA 4YPSA 3R0TA 5HE2A 3TIZA 3GC7A 4AWIA 4CFUA 3OOMA 1LR4A 3MYGA 5ANOA 5LMBA 5HBJA 2E2BA 4L6QA 4BTKA 1H1PA 5HOAA 2B9HA 2GS7A 3LM0A 2XK6A 3IECA 3OCTA 4AE9A 4QQCA 3N51A 3ZO3A 2ZMCA 4BIBA 3BBWA 3R02A 4JDIA 3ZC6A 2B0QA 2JIUA 5EDPA 2XK4A 1DAWA 2I0EA 2VTJA 3K2LA 1NT2A 5CALA 3A60A 1ZOEA 4LMNA 4EHVA 1ZZ2A 5I4NA 1IRKA 3FC1X 2GHGA 4LRMA 2WIHA 3ZSGA 3RGFA 4XP0A 5J1VA 2R5TA 5AA9A 1OBGA 5DR9A 2PZ5A 4BBMA 5KMNA 3I4BA 4RG0A 2WPAA 4KSPA 5JMSA 1TQMA 2W9FB 4MF0A 3RALA 4OGRA 3KC3A 4KA3A 5DEYA 3O17A 3RPYA 3EQFA 4IB5A 2QURA 3ZXTA 5ANJA 4BGHA 1NVQA 2RL5A 3PVGA 2X2MA 1APME 3ATTA 3MVHA 1M14A 4DEGA 1H24A 3NLBA 3CJGA 3BV2A 3PYYA 3EYGA 2ZV9A 4JBVA 4OTIA 5EW3A 1YOJA 3NPCA 3UP7A 3UYSA 3VULA 3TTIA 1VEBA 4C8BA 4G3GA 4O0YA 3NCZA 5L6PA 5J9LA 3C51A 4FG8A 4C59A 4FL2A 3TM0A 3TIYA 2Y6MA 5CASA 4XH6A 4R1VA 3BU6A 4FT7A 4BCOA 4DEDA 4P5ZA 1I44A 4FKOA 4HZSA 4J53A 2X9FA 5AUYA 1M7NA 5TE0A 3ZEPA 3ZLYA 4D1XA 4ZZOA 5D11A 3ORTA 4C4JA 2BILB 4GU9A 4O91A 4WRSA 4XMOA 3R8ZA 4BIDA 3I6WA 3UP2A 2HYYA 4A07A 4E5BA 2R3GA 2C30A 3Q9XA 2R3NA 4M69B 4YC6A 4D55A 3ZU7A 3OXIA 4G16A 1JKSA 2DQ7X 3IPHA 2PUNA 4ZIMA 4U42A 4ENYA 2YCRA 4Y46A 1PF8A 5FWKK 4UALA 4IX4A 2IVSA 4RSSA 4IAYA 2CPKE 4IM0A 2FSTX 1JKLA 4AU8A 3PLSA 5IQGA 3TNQB 1WBNA 3QF9A 5EI2A 3OUNB 3ZUUA 4EWHA 2C0IA 4EQMA 4XNEA 3UO4A 4QYGA 5CEOA 4NTSA 4WUNA 5JFSA 4QP9A 3U6IA 4PL5A 2CCIA 2Z2WA 3PWDA 4UYAA 3CIKA 1Q24A 4FT9A 5CAOA 3UOKA 5KMIA 2G2IA 1ZMVA 5AP7A 2WFYA 2GNJA 4NU1A 4JG7A 3PJ1A 3LKMA 2F7ZE 3E3BX 4DH1A 5IISA 1Z5MA 2BDJA 3N9XA 3ORPA 3SXSA 1YXVA 5I3OA 5HX8A 3UQFA 3MFSA 2I0HA 4E4MA 3UPXA 4A7CA 5L4QA 1OIUA 2ETMA 1GY3A 2XVDA 3G51A 4LOPA 4CYIA 4FUXA 4EWQA 5FG8A 4K18A 5B7VA 2C3KA 4D2PA 5C1QB 3R7GA 4ZMFA 3F7ZA 4YJSA 3CQWA 3F5XA 3OP5A 4X2NA 2ACXA 5FQDC 3ZM9A 4H3QA 2ZV7A 1UV5A 4LV8A 3OFMA 3TV7A 3UQGA 1PKDA 3FMMA 3FSFA 3JVRA 3LXLA 4GU6A 3W2OA 3JR1A 1IA8A 4BKZA 3CEKA 4MXOA 3VS6A 4QP4A 2ZM4A 2J9MA 4JBOA 3V04A 5KMLA 4JIKA 4F08A 5HHWA 3ALNA 4AS0A 1UNHA 1W83A 4YTHA 2Y7JA 3BU5A 1Q99A 3R1SA 4V01A 5HNIX 3FQHA 4QMSA 3B2WA 3Q52A 2C5VA 3L9MA 3LFEA 4FICA 4XV1A 4E4LA 4I24A 1YXTA 4YU2A 3KF4A 2WTIA 2WXVA 3B8RA 4B0GA 3RMFA 3ZM4A 5KO1A 3EZRA 3G9NA 3R73A 4EC9A 3BKBA 5I5ZA 4IVAA 4MK0A 4DA5A 3V5LA 2PVRA 3VS1A 4LGHA 5IA2A 4AGWA 3GU4A 2JIIA 4E5AX 1Q8YA 4FVRA 4CRSA 1H28A 3UNJA 4V04A 4I0RA 3KXHA 5JQ8A 3MVLA 1DAYA 4YNEA 2XK8A 1W98A 4C58A 3DBFA 4D2VA 5CEIA 2XKCA 1BI8A 3ZH8A 5G1XA 4CEGA 2WMBA 3R30A 5IKWA 3U4WA 4QQTA 4ZLZA 4IIRA 4LG4A 4L3PA 5C01A 3RHXA 4E6CA 1IEPA 1Q8TA 3KRXA 1Y8YA 3IQ7A 4FTUA 1JKKA 2RGPA 5TOZA 2ZJWA 4D1ZA 2QKRA 4IAKA 4BYIA 1K2PA 1P5EA 3KN6A 3QQUA 5JH6A 5EOLA 4O96A 2IN6A 3RK9A 2UW3A 2W7XA 5HBHA 1XHAA 3F2AA 4FKUA 3QFVA 4WKQA 1OPKA 3NW7A 5HBEA 4J99A 2JFLA 2J51A 2V7OA 4DFNA 4LGGA 3DXNA 3RKBA 4C36A 3CY3A 4RJ7A 1OECA 3DS6A 3OT8A 4BDIA 4F7NA 5C4KA 5BVFA 3F3ZA 5AV0A 4JDHA 3C4CA 2VTOA 2IW9A 4O7SA 1UU9A 4Z7HA 5IQBA 2BRMA 5FD2A 2R3QA 2VNWA 3OWJA 5B2KA 4DCEA 5KMOA 3HP5A 4XRJA 4FTNA 4CLJA 2F7EE 2IW8A 1ERKA 3A8XA 3I5NA 4NYEA 4U97A 4P2KA 5M56A 1OKZA 3NCGA 4CKRA 2R3KA 4O6LA 2HELA 2REIA 3W16A 5LVLA 4GUEA 3SKCA 5IEVA 1AQ1A 3NUSA 3OY1A 3FZOA 4RIXB 2B55A 3P78A 2F4JA 4CFNA 5KZIA 1JKTA 4EQUA 2C0OA 3HMOA 4PDSA 4YZDA 5AAEA 3L1SA 2OSCA 4AFEA 3ORNA 3QD4A 4U5JA 1H07A 5D41A 5AUTA 3RWQA 4NJ3A 3HRFA 2VWVA 4G1WA 5C8KA 3NW5A 2YIQA 5HTIA 2C3LA 1OVEA 2OBJA 4IWOA 4GRBA 4BDDA 5JZJA 4YURA 3AQVA 5E9EA 3FI2A 4MHAA 3KK8A 1UU8A 3I81A 4OTPA 2R3JA 3NSZA 3OCGA 3DFCB 4XUFA 5DT3A 3V5JA 1QL6A 4QMWA 3QRIA 4HPTE 2OFUA 2IPXA 3GOKA 4D2TA 5CF4A 1OIRA 2VV9A 4DCAA 3PTGA 2UW5A 1WZYA 4UMTA 5BNJA 3OT3A 3V8WA 1ZOHA 3A7FA 3CCNA 2I0VA 4CTCA 4C4IA 5DT4A 4ZTSA 4ALVA 3NUXA 5EM6A 3S00A 4ITJA 4XBRA 4YJVA 3RAHA 3QX2A 3EQDA 5M07A 3GCPA 2NPQA 4PDOA 3OBGA 3BYOA 4B6LA 4PPCA 2GQGA 5AP5A 4NM3A 3U9NA 2R0IA 2V62A 4O0TA 3ZTXA 1OITA 4A4OA 4BB4A 5LOHA 5EQPA 5AR8A 4GIHA 3MV5A 1Z9XA 1LEWA 4C62A 4EOQA 5KMKA 4AGUA 3V5TA 3ZO1A 2ITVA 3CS9A 3P08A 4F4PA 3UC3A 2YZAA 3DAJA 4UWBA 1E9HA 4UWYA 3U4UA 2HZNA 3IO7A 4UMPA 5JGDA 1YI3A 1WVYA 4O83A 4FSZA 2EXCX 1SNXA 3COIA 4X2FA 4U41A 3CKWA 3R1QA 3KRWA 4XG6A 3VHKA 4ASZA 4AGDA 3A99A 5E8XA 4C34A 4CQGA 3S4QA 4I5MA 4WSQA 2HW7A 5DLSA 4QTAA 3R04A 5T6KA 4L42A 1GZ8A 4AOTA 1ATPE 2OZAA 3C0IA 2PYWA 5AM6A 4GIIA 4DTKA 1SYKA 3F66A 4WOVA 3D5XA 5E8TA 3TZMA 3WBLA 2X39A 4UN0C 3G15A 4D58A 4HJOA 4QMPA 2G2HA 3ZS5A 2WMWA 3FI4A 2EXEA 5CSPA 5ITAA 4F9WA 4FZ7A 3K5UA 1JAMA 1GAGA 3TNIA 1JPAA 2CGVA 3DJ7A 4HGSA 3LCKA 4NFNA 1GOLA 2W9ZB 4AZSA 3COMA 3UIXA 1J3HA 2VX1A 2C3IB 3NIEA 3N4UA 3I0QA 4O0XA 4DYMA 3PY1A 4O2PA 3PXQA 3HMMA 5E92A 1F0QA 3GQLA 4ZMEA 4FI1A 4XEYA 4L53A 4E6DA 5BVOA 4FNXA 4IACA 4L52A 1FVVA 3HA6A 5C4LA 2J0MB 4QMZA 3DQXA 4BTMA 3P9JA 4V0GB 2BPMA 3FZSA 4GK3A 3BE9A 4RIYB 4YJRA 3VNTA 3WF8A 5L2WA 5C8NA 4MYGA 5H2UA 4Q9SA 3UG2A 5I0BA 3P79A 3PXKA 2UW9A 1FGIA 2JKQA 4WBBB 4ZTLA 3UVRA 3PE2A 4BHNA 4IMYA 4ZAUA 3KMWA 1IAJA 3Q32A 2Z60A 4CFMA 1PMEA 2UVXA 1Q8WA 2PVLA 3SG9A 4PTEA 4RWIA 3OZ6A 3S3IA 4RC4A 4O81A 3EZVA 2VWZA 3NIZA 4WNPA 1H0VA 1REJA 3ROYA 3C4XA 4BDBA 2YM3A 1W7HA 3PP1A 4CTBA 3QRUA 2B9IA 4D4RA 4XCUA 2BTRA 4EZ3A 2XNMA 1W82A 2OO8X 4O7ZA 2JC6A 1DI8A 2Y4PA 5E8SA 2XIXA 2JAMA 2VWXA 1B39A 3VBTA 2UUEA 4DTAA 3KMUA 4EK5A 1H1WA 1V0PA 4TZRA 5DN3A 3PFQA 2EVAA 4BWPA 3EN7A 4KBAA 4ZTNA 1XBBA 2AYPA 2C47A 3B2TA 4GJ2A 1FOTA 3D2KA 5AUZA 5HG9A 5IUIA 2ITWA 4RVKA 2Q83A 4XV3A 4CV8A 2PZPA 3HECA 4MXAA 4FVQA 4JR3A 2OICA 4M69A 2VD5A 1V0BA 3NAXA 3KRLA 3COKA 3TUCA 4F0FA 3QRJA 1YKRA 5C26A 2CKQA 4O6EA 4UBAA 4XOYA 5EYCA 3KXGA 3V5QA 3BPRA 5CXZA 3NMUF 4YJUA 3CTJA 2DYLA 4EKLA 2X2KA 1GZKA 3PSCA 3D5VA 1CKIA 4TYGA 4UB7A 4DLIA 3ENMA 4ZTMA 1M7QA 3M11A 4BCKA 5F1ZA 2ZM3A 4IANA 4PQNA 3ORZA 4ACGA 5EW9A 3H0YA 5IQDA 4RZVA 2BFXA 2C68A 1BI7A 2QNJA 4O82A 3MA3A 3I79A 4PRJA 4AQCA 5BYZA 2BAQA 1ZAOA 4D9TA 2ZAZA 4FK3A 1Y6AA 3UIBA 4AF3A 2OJFE 5ETIA 2WMUA 3ACJA 3VS0A 1IAHA 3VBQA 3NNXA 2HZ4A 2NRUA 3C50A 4I94A 3DK3A 3CXWA 4PTGA 3CGOA 2FGIA 4U3ZA 1IG1A 4FC0A 3LXPA 4FUYA 5CZIA 2B4SB 3CD8A 4G5JA 3FLWA 2ZVAA 2XKFA 2YM6A 5M4UA 3BELA 2WELA 5ANEA 2LGCA 4XLVA 2Z02A 4QMOA 1WBSA 4MQ1A 4KKEA 4OBPA 1XH9A 2JDRA 4FIJA 3PXFA 2PU8A 5FUTA 1QCFA 2EU9A 4G3FA 1BUHA 3GENA 5DPVA 3KREA 3EQHA 2J2IB 5EKOA 2PWLA 2BCJA 5GJFA 3EFWA
chains in the Genus database with same CATH superfamily
4KRCA 2R7BA 4W8DA 2KTYA 2OWBA 2CKPA 4KIOA 4I6HA 3RP9A 4W4WA 4E3CA 1BL7A 2YIYA 3QUPA 4H36A 2IWIA 4MWIA 2IVVA 3MPMA 4M66A 3L9PA 1HCKA 3JPVA 4JVGA 4XG2A 3DOGA 4L46A 3QXPA 4QMLA 5L2IA 4AZEA 2GU8A 3FLYA 4LMUA 3H10A 1Q3DA 2OFVA 4M14A 4Y5QA 4DEBA 4YSJA 3DV3A 2XRUA 1KWPA 3FKNA 4FNWA 4DHJA 3DAKA 4IFCA 4WT6A 5LMKC 3QCQA 4I5HA 3TDWA 4U6RA 1FPUA 2ESMA 4DITA 1NVRA 1YQJA 2HOGA 3UO5A 4FTKA 5HO8A 5KUPA 2XM9A 2JLDA 3LM5A 4YZCA 3UPZA 2QVSE 5HICA 5E8ZA 5M4CA 2VX0A 1TFFA 3GVUA 4I1ZA 4RJ6A 4QQ5A 3QZIA 4NFMA 4OTHA 4MBIA 2RIOA 4O1OA 4OTFA 1Q8ZA 3BI6A 2W17A 5JN2A 1EH4A 3MBLA 1XR1A 3E92A 3BYSA 1TZDA 2E9OA 4QYEA 1ZXEA 5DVRA 5E90A 4C7TA 5LWNA 4TNDA 3AMBA 3RK7A 3IW4A 3W8QA 2QHNA 4RA5A 1H08A 3NYVA 4F1MA 2OIDA 3FMNA 3TKHA 3DK6A 3RAWA 3RZFA 4F63A 5KX8A 4YHJA 2ZDUA 3ZZEA 4D2WA 4JI9A 1STCE 2GNHA 4FKIA 2YAAA 3V8SA 4S2ZA 3ZMMA 3BLAA 2YERA 4DEEA 4I4EA 4QMYA 4BDKA 2UZWE 3P5JC 4MNFA 3HA8A 4BZOA 3PIYA 1OB3A 2YCSA 3P5KA 4FIFA 3HKOA 3NW6A 4K1BA 3QBNA 1BLXA 3QTUA 5J7BA 1FVRA 2CNUA 5LVPA 3Q60A 4BZNA 4QTEA 2IZSA 3JVSA 4NZWB 2YWPA 3FL4A 3OC1A 4JBPA 4GS6A 3EQIA 2A1AB 1RJBA 2H8HA 3F61A 3G0FA 4O0UA 4Y83A 2VTTA 1UNGA 3RPVA 3VIDA 4DHZA 3E87A 2I6LA 3C0GA 1ZLTA 3MI9A 2OJ9A 2B9JA 3FMEA 5JGAA 4RIXA 4ERKA 3W1FA 3AGMA 4YBKA 2QQ7A 2YLFA 3BLHA 3TEIA 4EHZA 4MNEB 4WSYA 5I3RA 2UZLA 4FIGA 4M84A 1UNLA 2I40A 3A61A 4S30A 2EXMA 2E9NA 3R00A 4U81A 3EKKA 4J8NA 1BKXA 4S34A 2YN8A 4JJRA 5CI7A 3HAMA 4FEUA 2OU7A 4E5WA 4EOIA 2W4OA 2XJ0A 4O0VA 5FGKA 5E1EA 4DF3A 2XS0A 4PMMA 3TG1A 4DGGA 2I7QA 2QOBA 4OR5A 3W2SA 4FL3A 2WMSA 2XNEA 4A4XA 4BCFA 1XMLA 3LCDA 4KBKA 3KF7A 4NM7A 3TJDA 1VZOA 4BCNA 4BFMA 5J79A 3FZTA 4O27B 4R3PA 2QOHA 1WBTA 4FTRA 2GFCA 3ELJA 3OW4A 1AGWA 3BX5A 3DBDA 4L45A 4QP1A 4RC2A 5JKGA 2YIXA 4MXYA 5ANIA 5J5TA 4YZ9A 1UVRA 5CNOA 4ZZMA 3FAAA 2XNGA 4HOKA 2ERKA 4EI4A 2UZUE 3CPBA 3M2WA 5C27A 3R01A 4LV5A 4FSQA 4HYHA 5FEEA 3MESA 4ZSAA 1OIYA 1OUYA 3V01A 1RQQA 4JBQA 3RAIA 1PYXA 2XBAA 2CJMA 3UNZA 3ZLXA 5KMMA 5LXMA 4YZBA 5DGZA 2H34A 3NEWA 2X6EA 2ZB0A 3E8DA 3Q6WA 4GCJA 3TTJA 4KRDA 4A06A 1U46A 5G6VA 1KE7A 3IONA 3U54A 3DTCA 3BHHA 4FOCA 1JWHA 1KOBA 2NNWB 4CQEA 2BZJA 4EH3A 1E1VA 2BDFA 4QYYA 3ITZA 5DRDA 3GCSA 2IVUA 5AMNA 5IA4A 4G17A 3CPCA 4RVTA 4IVDA 3AKKA 3PJ3A 5AUXA 2A0CX 3KFAA 1ZZLA 2VZ6A 4MXZA 1OKWA 2I0YA 1JBPE 3QLFA 3A62A 4XP2A 4Z7GA 5GZ9A 4ASEA 3F9NA 2W05A 3UNKA 1JSUA 1JOWB 4EOMA 5M53A 2OJIA 4L8MA 1H01A 2RFDA 5AJQA 5H9BA 3D94A 2VGOA 4AXAA 4CVAA 3QC4A 1Q8UA 3LQ3A 5A4TA 3ACKA 4A9UA 3AC4A 2DS1A 4FV0A 2W1CA 3O50A 1CDKA 2UZVA 5HO6A 3EB0A 4C0TA 3DLZA 5D10A 4ACDA 3TV4A 2Z7QA 4NIFB 4CLIA 4K33A 1YXXA 4DE4A 4NW6A 4NCTA 4QNAA 4R5YA 3ULIA 3NUPA 4HNIA 5CY3A 3R7YA 2XNOA 2BKZA 3RBWA 3VBWA 2Q0NA 4C4HA 3R83A 4PNKA 2XK9A 4I20A 4L00A 2C6DA 3Q9ZA 4A9TA 2BIKB 2Z7RA 4QMMA 2C3JA 4KAOA 4V0GA 4X3FB 3F6XA 4IJPA 4RIYA 3VUMA 2OH0E 4MF1A 4RFZA 4HYUA 3R8UA 4E4XA 5CLPA 5CU0A 5A14A 3DJ6A 3ZZWA 1PYEA 1Q3WA 4BDJA 4NM0A 4WIHA 4QP7A 4L7SA 4E8AA 4FV1A 5D12A 3GC8A 3F3VA 4OTGA 4FIEA 4DHFA 3D0EA 3QZHA 3CTHA 4NL0A 5BYLA 2YA9A 2GFSA 2YIWA 3L8SA 4L01A 4U8ZA 5D1JA 3TXOA 1OGYA 5GJGA 3LFSA 3GC9A 3P7BA 4U3YA 2W4KA 1ZWSA 5C8MA 4NKSA 5CF5A 5FDPA 1BL6A 4ALUA 4YC3A 4EQCA 2ZV8A 4RA4A 4JS8A 3C1XA 4RLLA 2PVKA 3UDSA 2R3RA 3I5ZA 3QQHA 2FH9A 1R0PA 1P4FA 3DBEA 2CGUA 2JIVA 4MEDA 4ZSJA 3VQUA 3VN9A 2W4JA 3UTOA 1OM1A 4EZ7A 5JT2A 5KBQA 2JD5A 2JKOA 3FYKX 4TL0A 5DRBA 2UVZA 3POOA 4DGOA 5DR6A 4DLJA 4F1OA 1WBWA 1MQBA 3CJFA 3UOHA 3UOJA 2AQXA 1XWSA 1OPLA 3ETAA 1PW2A 4IX6A 4N0SA 5CS6A 5JRQA 2W1FA 2F2CB 2VO3A 1E1XA 5AUUA 3GU5A 3MIAA 3MPTA 1J7IA 3R7EA 4IBMA 4RVMA 4OAUC 4FTCA 1Y57A 3QTQA 3BZ3A 2VTNA 2GPHA 5E8VA 2QR8A 3FLZA 1GZOA 3VQHA 4YGAA 3W10A 4ZTQA 4AZVA 3UBDA 1GZNA 4IHPA 4TYHB 4M12A 3GGFA 4IQ6A 2YM8A 4FTIA 2QD9A 2XF0A 4ACMA 5K3YA 4U79A 4CKJA 1YI6A 3ZUVA 4FV7A 4MXXA 3R9NA 5EKNA 5CQWA 3FI3A 1J7LA 3PXRA 3OROA 5C03A 5ETCA 1OKVA 2X9EA 2XIKA 3FLNC 3TNWA 3M42A 3PZEA 4KKGA 4C2WA 4GK2A 4M15A 2C6IA 5DR2A 4S32A 2W1DA 4HGEA 3I60A 4D9UA 3WIGA 3AC2A 1OMWA 3BL9A 4J98A 5FP6A 3WI6A 1AD5A 4XP3A 5K0KA 2E9PA 2BRNA 3IOKA 4FE2A 2UZTA 1UKIA 5E1SA 5HI2A 1MRUA 2R7IA 2BZKB 2CCHA 3GT8A 3C4ZA 4YSMA 3QA8A 3NX8A 4FTJA 3DT1A 3S0OA 3ZONA 4O38A 1S9JA 4C38A 4AAYA 5BVEA 3ZSHA 3QYWA 4PV0A 3Q4ZA 1SZMA 3OF0A 3PG3A 4JQ8A 3QZFA 5HKMA 3ID6C 5GHVA 4IW0A 4I41A 3OWLA 2WQNA 4GJ3A 4O1PA 2W06A 4YJNA 3QCSA 3D5WA 1CTPE 1CSNA 3QTWA 4B99A 4E7WA 3DZOA 2W99B 4FTLA 4GVJA 4KSQA 5AV1A 4MVFA 2WNTA 3LFQA 4OBOA 5M44A 5FTGA 4L43A 4PX6A 5TKDA 4YUQA 5BMSA 4ZJJA 3FMJA 3NZ0A 1V1KA 4A9YA 1Q41A 4EH7A 5CANA 5H8EA 3QQLA 4EHEA 3FEGA 2O2UA 2OF2A 3KCKA 3NUYA 3BHYA 4S31A 4I0TA 3SAYA 2XJ1A 2ETRA 4FRFA 4X6QC 3L9NA 2Y4IC 4HCVA 1QMZA 2UVYA 3MVJA 4ZY4A 2XNNA 4PWNA 3MY5A 1G5SA 3AGLA 3MFRA 3Q4TA 5HG8A 4QT1A 2J0JA 2ETKA 4HZRA 4BBEA 1OL1A 2HWPA 5F9EA 3FDNA 5DT0A 5IQCA 4L44A 5GINE 3FLSA 5IQFA 3K3IA 5IA0A 3LHJA 3F69A 3EQBA 3PXZA 4FTOA 4F6WA 2O8YA 2RFEA 3A4OX 3RZBA 4KWPA 2P3GX 2X0GA 1SVHA 4RJ5A 3T3VA 3FY0A 4CFVA 4C02A 2UW8A 3HUBA 4I6FA 4UXQA 4W9XA 1PKGA 3OMVA 4KIQA 3QHRA 3V5WA 2YACA 3R9OA 2QOLA 5DI1A 1K3AA 3F3UA 3F5UA 3NNUA 3QRKA 4D4SA 3NRMA 2VWYA 3EIDA 3P23A 2O65A 1BYGA 4C3FA 5AR5A 3E93A 5F4NA 4QMNA 4ONAA 1CKPA 5IMEA 3HVCA 2J5FA 2WTWA 3MH3A 4ZOGA 2VWUA 5E8YA 1PJKA 1YWVA 4XLIA 4D5HA 2AUHA 2IJMA 3M1SA 4FIHA 4RIWB 4BF2A 4DINA 5HIEA 3LFBA 2WTKC 3KEXA 2PVHA 3SOAA 2R9SA 2B9FA 4WRGA 5J7HA 5HVKA 3MIYA 2QU6A 2WMAA 3F2NA 1JSTA 4XV2A 4ACCA 2ITUA 3CQEA 3LFAA 4O4DA 3A7HA 2X8IA 5JFWA 3OCBA 4TYIA 2F2UA 2X8EA 4MAOA 3AOXA 5BMMA 5TR6A 3W55A 4BVUA 4ZJVA 4OTWA 2O64A 4E20A 4ZZNA 4LFIA 2OJGA 2GQRA 4BCJA 4MNEA 3TL8A 3VHEA 4FX3A 4H1JA 3UOLA 4GYGA 2HAKA 4YLKA 4JOAA 5A4LA 2P0CA 2R2PA 3HDNA 5M06A 4QQJA 2W5BA 2BFYA 3O8UA 3VBYA 1CM8A 4FSUA 4FTTA 1G8JA 2WGJA 4L68A 2IF8A 4A9RA 2A27A 1SNUA 4D0WA 4YLLA 4ZS4A 1R3CA 3ALOA 2VTLA 5EYMA 3S95A 2XAMA 5EFQA 1WBVA 4QP2A 5ICPA 4R6VA 5JFXA 2UZOA 3D9VA 3LLAA 3TNHA 5BPYA 2C6KA 3K3JA 4NH1A 1BX6A 3EFJA 3GFEA 1R78A 4DGMA 4B4LA 2OG8A 1WMKA 1Y91A 2EB3A 2BDWA 3PVUA 4FTAA 1VYWA 3EQCA 3EHAA 3SRVB 1VJYA 4XYFA 5DMZA 3LXKA 3QTSA 2XALA 3HZTA 3CR0A 2IW6A 2XAOA 4O7YA 2CGWA 4CFFA 2PUPA 4PDYA 3HEGA 5IUGA 5CX9A 4BYJA 3N4VA 4TWPA 5JFVA 5LQFA 3BQCA 5CQUA 3T3UA 1PXPA 2BAKA 5EHYA 2QU5A 1DS5A 5BX0A 5HLPA 4YZNA 5CU2A 4O7WA 3ML1A 5J5SA 3DNDA 5FM3A 2WTVA 4RPVA 4HVGA 4HGTA 3G90X 4M3QA 2VTHA 4IH8A 2QONA 4CD0A 4DBXA 3VS2A 3GCUA 5IH6A 5DWRA 4GV1A 1JVPP 2ZYBA 4FIIA 4RIOA 4OBQA 4BDHA 4C4EA 5BUJA 3VRYA 4YTCA 4CXAA 2WTDA 3GXLA 1X8BA 3BEGA 4E1ZA 2G1TA 2ONLA 2A2AA 3UODA 4AE6A 2JDVA 3R6XA 3D5UA 4XG4A 4KIKB 4CT2A 3FWQA 2WAJA 4E73A 3C7QA 4DFXE 3F3WA 4HW7A 4BGQA 3FLQA 3EN6A 4FSMA 4RLKA 2ERZE 3OWKA 1UWHA 3AKLA 2C0TA 4AUAA 2PMLX 4Q5EA 4EJ7A 4DFLA 3TZ7A 3HMPA 4DC2A 2FO0A 3QAME 3W2CA 3UVPA 1XO2B 2QLQA 2X4ZA 3HYHA 4AW2A 3DTWA 4KUJA 4XJ0A 3ET7A 3UGCA 3P86A 3IG7A 3OHTA 2QO9A 3CD3A 1JQHA 4FT5A 5I9ZA 5IH5A 4HGLA 3TZ9A 2PUUA 4OW8A 5DIAA 3BQRA 2C6EA 2XKEA 4JIAA 4NIFA 5EQYA 3BRBA 4W9WA 3RPSA 4DH8A 4O2ZA 1YOLA 4GL9A 4K8AA 3PLAE 4CNHA 4LUEA 4EONA 2JBPA 4DFBA 3RNIA 5I9VA 3HGKA 2WHBA 4F9BA 4FSNA 3OEFX 4U44A 1T45A 4FL1A 1I09A 4X3FA 2B53A 4TY1A 1Q62A 5TO8A 4FZAB 2RKUA 1H25A 2IG7A 1R0EA 1WAKA 2QHMA 2GQSA 3FXZA 3GFWA 3O23A 4EYMA 5KZ0A 4BC6A 2VNYA 2XIRA 3D7ZA 4TW9A 3PVBA 2J0LA 3QZGA 3MJ2A 2W0JA 4BICA 4GUBA 4ZSLA 5T68A 3FPQA 4MXCA 3QD3A 2X0OA 5H8GA 2W1ZA 3KCFA 1FBNA 4R3CA 2B54A 3W0PA 3AT2A 4HVHA 1YHSA 4JAIA 3NGAA 4JLCA 4FKQA 5AIKA 3T9TA 2OGVA 4U43A 2Y0AA 4BIEA 1YDTE 3ENHA 3QTIA 4IB3A 4D2SA 5IA1A 1O6KA 3C5IA 1OGUA 5CYIA 4F65A 3TDVA 3R9DA 1LUFA 4ZK5A 4F0IA 3BGQA 3SV0A 4TN6A 4II5A 3MVMA 3R22A 2Z8CA 3D7TB 3HUCA 5AAFA 3KXXA 2HENA 3F88A 2BRHA 2XB7A 4GT3A 3R7UA 3TZ8A 3R8PA 3UE4A 3W0QA 4HCTA 5FTQA 4YC8A 3BLRA 3KULB 5F94A 4ANSA 4RJ3A 1U59A 4DAWA 4TTHB 3FXXA 1NA7A 5A46A 3ORXA 5EHOA 3GU7A 4OAVB 2PZYA 3JYAA 4GFMA 3LXNA 5E8UA 3RPRA 1ZYCA 4CZTA 2V7AA 1JSVA 2GTMA 3Q5IA 4TYHA 4C33A 4FKJA 4N4SA 2XARA 2XNPA 3CY2A 1UA2A 4PPBA 3QTRA 4RBLA 4BDCA 5A4EA 2QO2A 4HVSA 1XQZA 5DBXA 4D1SA 1YRPA 3KB7A 3KVXA 4BDEA 1OKYA 3AMYA 3LJ2A 2V0DA 4QMXA 3VS4A 1FINA 4FZDB 3GI3A 3MH1A 1PXIA 2BALA 3OEZA 4LYNA 1O9UA 5AV3A 4AA5A 2PVNA 5K4IA 3ZHPC 5J8IA 5IQIA 1VYZA 4ENXA 3NUUA 4AW0A 3QQGA 2EUFB 4C4GA 2C5OA 4EKKA 3Q96A 3ZDUA 2WQBA 4BJJB 2PVJA 3UZRA 4B8LA 2XNBA 4P4CA 1NVSA 4EH6A 3LE6A 3JY0A 4I93A 1PY5A 4OT5A 3RTPA 4BDFA 3U9CA 3BL7A 3D15A 4IADA 4M68A 3ROCA 2BRGA 4F09A 3A4PA 3MA6A 3SD0A 3Q6UA 2Y6OA 1PHKA 2HCKA 3W2QA 3CGFA 4ZSEA 3ZLWA 4GG7A 2VTSA 1RE8A 3QWKA 4QRCA 5GNKA 2P55A 3T8OA 3FYJX 3T9IA 1H1QA 3IW8A 3MB7A 1U4DA 4U80A 2ITOA 3AD6A 3UYTA 4TWOA 4R8QA 3D2IA 3OG7A 4GYIA 2YJRA 4BY9E 1Y6BA 4IX3A 1OL7A 4XV9A 4HYSA 5LCKA 4E6AA 4X21A 4GK4A 2OK1A 1YHVA 4BGGA 2ZFYA 1ZYSA 5HNBA 3QALE 3RINA 3LVPA 5B2LA 3R71A 3PIXA 4N70A 4CMTA 3KQ7A 2UW4A 3LFFA 3NNWA 5FXQA 2VO0A 2OLCA 4C37A 4ZJIA 4QMVA 4JG6A 1U5QA 4QYHA 5CSHA 3DU8A 3SW7A 5BVDA 4BHZA 4Z55A 4LOOA 1T46A 4FJVA 4ZEGA 3JS2A 2W5HA 4RJ4A 1S9IA 4ASDA 3R9RA 4FKTA 4FSWA 4I5CA 3AC8A 2XKDA 3ZRMA 1OUKA 4F7JA 5JEBA 4APPA 3WF7A 4FV2A 3FXWA 5IDPA 3VUGA 1SM2A 5IQHA 3E63A 3EN9A 4I6BA 2CLXA 3BEAA 2ITXA 3SHEA 4EBWA 3DBQA 4RQVA 5A6NA 2XM8A 3MS9A 5AM7A 2R64A 3V51A 4O0RA 5CNNA 3RHKA 3DDPA 4EK6A 2YDIA 2OF4A 3DLSA 4LM5A 4C61A 3UZTA 3OS3A 5CT7A 3QD2B 1YI4A 3NR9A 3O71A 2GS2A 2CHLA 4FYNA 2XIZA 5CEPA 4GEOA 4X2GA 4AA0A 2G15A 1TVOA 3TI1A 2NRYA 4N6YA 3QUDA 3H0ZA 1H8FA 1OBDA 2C6OA 5LWMA 4MH7A 2YM7A 3TYKA 2RG5A 2GS6A 3DFAA 3PDTA 2OW3A 4WNKA 3I7CA 3AD5A 4RIWA 1DM2A 2J0KA 5KKRC 5M4IA 2C5NA 3TKUA 2HXLA 1W2DA 2EB2A 3GBZA 5AP3A 5DEWA 4F9AA 2FUMA 5K9IA 3PA4A 3E5AA 4DGLC 5K5XA 2YDJA 4LUDA 3U6JA 5FBOA 2B52A 4MBLA 3PJ8A 1H27A 1WVWA 2O63A 2CNVA 3MFUA 1TKIA 4AW5A 4EJNA 5K0XA 3QQFA 2WTCA 4FOBA 1NW1A 4BBFA 5ETFA 2BROA 3KRRA 2J50A 3VO3A 2CN8A 1ZRZA 3F7WA 5HZNA 2IO6A 4XOZA 3SQQA 3MB6A 1M2RA 3O51A 3O96A 3R28A 3OOGA 4D28A 2CNQA 3DKCA 4LOQA 5HLWA 3C0HA 2VWWA 4P7EA 3U6HA 4I5PA 1GIIA 2QOQA 1SMHA 2WOTA 3NDMA 4FNZA 2I1MA 3DKOA 3L8XA 3PJCA 1J1CA 5DOSA 2IEWA 5EQEA 4CCUA 3VF8A 3Q2JA 3V6SA 1PXLA 4KS8A 4CG8A 2G2FA 1OIQA 1OL2A 2ITTA 3G5DA 3NYOA 4EH8A 5IQAA 4G3EA 5F20A 2YAKA 5D9HA 5ETAA 3RK5A 3SRVA 4AG8A 4EH4A 1XH7A 4LRKA 4FSTA 4CSVA 3FZRA 3DBCA 3S1HA 3NYNA 3C4WA 2PE2A 4GVAA 5AAGA 4UX9A 4GMYA 4BN1A 3EN5A 3V8TA 5J9ZA 3QLGA 3TJCA 5CTPA 5M57A 3KK9A 3F5GA 4GSBA 3SXFA 4APCA 3PRIA 3IKAA 3OW3A 2NO3A 4R78A 4O7TA 4RWLA 5LMAA 4RZWA 3E88A 3ATSA 4U40A 3ZRKA 4J7BA 2PZIA 5DYJA 5HG7A 1Q97A 2UZEA 3WZJA 5KNJA 2OI4X 2YIRA 3E8EA 2YCFA 1H1RA 4OUCA 4CFXA 3SGCA 3RVGA 1M17A 1U54B 3FSKA 4H3PA 4W8EA 2XZSA 4J52A 3RWPA 2R3FA 3TUDA 1FVTA 2IZTA 4IAZA 5ANKA 5AR2A 4ZLYA 3PA3A 5CEMA 2PZRA 2WKMA 4CYJA 3W2PA 3PSBA 3I1AA 2XIYA 2XYNA 5JGBA 5HX6A 1QPDA 4G34A 4Z9LA 5EHLA 4HVDA 4KIKA 3E62A 4MD8E 4NK9A 3WF5A 4DG2E 4EOKA 1W84A 4AOIA 4YNOA 5HEZA 3RI1A 4FEXA 2R3IA 3DAEA 3Q4UA 3U51A 3LJ0A 3G0EA 3I0OA 1LEZA 4JX7A 3P4KA 4O4CA 3PY0A 4ZS0A 3L8VA 3O8PA 1JNKA 3A7IA 3EOCA 4PL3A 3U8WA 4PMSA 3BYUA 4USFA 3BGPA 2Z7SA 5AEPA 1DI9A 5FEDA 4C3RA 4EK4A 2W1IA 4I23A 1M52A 3GCVA 2C5YA 3EL8A 3MY0A 5K4JA 3KXMA 3OTUA 1WFCA 4AT5A 2R0UA 4CT1A 2B1PA 3BYVA 4AZTA 4QPMA 4OTDA 5EM8A 4IDVA 2HZIA 2XBJA 2VTPA 2YM5A 3MW1A 3AD4A 1TQIA 3DDQA 4U9AA 3ORLA 3PWYA 2XCHA 4HNFA 3WZDA 1PXNA 3DPKA 5L6OA 3IGOA 4J97A 3FZPA 4JXFA 4DDGA 3L9LA 4IZ7A 5A3XA 2BRBA 2NP8A 4M67A 4JX3A 3FBVA 4A4LA 4G6LA 3C5UA 3KU2A 4PL4A 4UZHA 3TT0A 4BI0A 1YXSA 4LV7A 2JAVA 3FQSA 3EWHA 4CMUA 4TRLA 5J9YA 4ANNA 4KKHA 4G5PA 5E91A 5BVKA 1ZYDA 3H4JA 5HE0A 3SW4A 2GNGA 4FKRA 2XK3A 5KBRA 4EYJA 4R1YA 4J96A 5HIBA 4R3RA 4RFMA 1URWA 2AEGA 3BBTB 4OTRA 4ANOA 3DQWA 1XH5A 3H30A 3KVWA 3A2CA 2CSNA 5L2SA 5FP5A 4NTTA 4JR7A 4JQ7A 3Q3BA 3PFYA 2ZMDA 3ORIA 5CEQA 3NVMB 4MWHA 5TF9A 1GIHA 3DB8A 4FA2A 5L6WL 5IU2A 3D7TA 2XJ2A 1Q5KA 2UW6A 3OBJA 4EK3A 3DKGA 2WMQA 1H00A 4HVIA 2ITYA 4FK6A 5E7RA 4O21A 2JITA 4K9YA 1ZYLA 2R3LA 3KULA 5AUWA 4WNOA 4D5KA 3WILA 4G9RA 3NUAA 3GP0A 3EN4A 1ZMWA 2C5XA 3TACA 4UXLA 4Z3VA 2VRXA 2JKKA 4C35A 4XG9A 2HK5A 3W33A 1ZYJA 2H6DA 3R2YA 3QCXA 3EFLA 2GTNA 4KNBA 2PVFA 4EORA 5DFPA 1MRYA 3MWUA 5AADA 5GZAA 1XJDA 2P2HA 4LGDA 2IZRA 4EOOA 3FMDA 4RVLA 3AC1A 4QMUA 3RM7A 4Y8DA 3UZPA 1SVGA 5EG3A 4LDTA 4I22A 3H9OA 1YOMA 3QCYA 5GIOE 4YJQA 2VTQA 3ODYX 4L7FA 4Y73A 3WIKA 5AX3A 3BHUA 4RQKA 5AR7A 3E3PA 2WOUA 2WTJA 3COHA 1B6CB 1L3RE 1PMVA 3A7JA 1PMNA 4FEQA 4BJJA 2VTIA 3DNEA 3KMMA 4H05A 1GJOA 3UDTA 3UG1A 4ID7A 4BTJA 4M7IA 5HQ0A 3FHIA 1Q61A 2FYSA 4FKLA 4EOLA 2R3HA 5IEXA 3LCOA 4RT7A 4YHFA 1YVJA 5D7VA 5EDQA 5LARA 2B7AA 2HIWA 2RF9A 3UO6A 4TWCA 4AP7A 4E26A 2X81A 1F3MC 3AXWA 4DFYA 3PJ2A 4IJ9A 2BMCA 5D7AA 2HZ0A 5DHJA 3GNIB 3R21A 3VF9A 3H9RA 1B38A 1H4LA 5CWZA 3W0SA 5DA3A 3QXOA 4Q2AA 3PA5A 3QKKA 4Q5HA 4LRJA 1YW2A 4MCVA 5EW8A 3W8LA 3ZFMA 4DEAA 5AV4A 3FI8A 2ZB1A 1ZOGA 4GG5A 3F82A 4U7ZA 4AA4A 4MKCA 5HE1A 3LMGA 3SLSA 5BQ0A 3VAPA 4JAJA 5GJDA 2VO6A 2F49A 4ZTHA 4RFYA 4YJPA 2JGZA 4MD7E 4TKSA 4YJTA 2VTMA 4UMRA 3PPZA 1FMKA 2J5EA 2PY3A 4RX9A 4FV5A 3A8WA 4IXPA 4WG3A 5EDRA 4BCMA 3CP9A 4LQMA 1XBCA 2QOCA 1OPJA 3QX4A 5CU4A 3VUTA 3PUFC 4YLJA 4E4NA 3ZUTA 3O7LB 3HAVA 1QPEA 3IK3A 2FSMX 3VC4A 4BCGA 4FMQA 3VS3A 3KN5A 3EJ1A 5JRSA 5DNRA 4QDVA 4GW8A 4X0MA 1UKHA 4O22A 3VJNA 5FLFA 4MQ2A 4QTDA 3HMIA 3R1NA 3KKVA 4FG7A 3O5AA 3PRFA 2R3PA 3AC5A 3IDPA 1H26A 1P14A 1W2FA 4QO9A 4YZMA 5AP6A 3V3VA 5H3QA 3ZYAA 4D4YA 2C1BA 2JDOA 4DH7A 3P1AA 3UMWA 4QP6A 3MN3A 5L2QA 4O7VA 1ZY4A 4LL5A 2C6MA 4BI1A 3DGKA 3BHVA 1GIJA 4AFJA 4PF4A 4AZFA 4ERWA 3SX9A 3LCTA 4CRLA 1O6LA 5CSXA 1IR3A 4RX5A 1R1WA 4S33A 4IWQA 3R7VA 4O7LA 3ZBFA 1W8CA 2FA2A 3AMAA 5CSWA 2OIBA 3ANRA 5KMJA 3PVWA 2WIPA 5H8BA 4FKVA 5FRIA 3WYXA 4H39A 2QOOA 2OXDA 3SDJA 3UJGA 5AA8A 5GZ8A 4DH5A 4BI2A 1MRVA 4H3BA 1OL5A 2ITQA 4USEA 2UZNA 4FF8A 5I9UA 3DB6A 5HO7A 4L3LA 4AXEA 3NVKI 2R3MA 4GKIA 4HCUA 1QPCA 4MTAA 3PPJA 5HORA