3HDNA

Crystal structure of serum and glucocorticoid-regulated kinase 1 in complex with compound 2
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
293
structure length
280
Chain Sequence
QINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and synthesis of orally bioavailable serum and glucocorticoid-regulated kinase 1 (SGK1) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase Sgk1
total genus 80
structure length 280
sequence length 293
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hdnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hdnA01
5EH0A 3TUCA 4CFVA 3BU3A 4ITIA 3ZBXA 5EM8A 5CAVA 3CP9A 5HG8A 2GNGA 3LXLA 2IPXA 4EH7A 2X7OA 1XH6A 3GP0A 1G8AA 3R7EA 4AE9A 5BNJA 3PG3A 3LFQA 3WI6A 4XG2A 4AAAA 5LVLA 3FKNA 3ORXA 4IE9A 1NW1A 3RPOA 4NK9A 2C4GA 3FMKA 2HY81 4Y5HA 4DGLC 4QQTA 3GU8A 4XOYA 3RINA 4FT7A 4PUZA 2VTRA 4NM7A 4IAFA 2XK9A 5BVFA 5M09A 4MYGA 4EYJA 4FTCA 3R8LA 1YXSA 5AFVA 2B53A 1YWRA 3Q2MA 4QP3A 4XOZA 3F66A 2QG7A 2RSVA 3SA0A 1IG1A 4U97A 3HMIA 4Q2AA 4AFEA 4TWOA 5JGBA 4NTSA 1OM1A 2HCKA 3ALOA 1YQJA 4PDYA 3T3VA 5LMAA 1XBCA 3CTQA 5CVFA 5JFWA 2DUVA 5AP3A 4DHFA 4FV3A 2OF4A 2E9VA 3TTIA 4F08A 4I93A 4ZMEA 3PFQA 3SD0A 5J7BA 4EC8A 4EC9A 3NPCA 2W1HA 3DB6A 4RIYB 3DGKA 2A27A 5C9CA 2GQGA 1ZYSA 2VD5A 4G9CA 1OKYA 4FSZA 5KMKA 3LLAA 2ZV2A 2OI4X 4OTPA 3KXHA 2RFSA 1FGKA 2Y4PA 3F2NA 4L7SA 5DE2A 5ETAA 3DS6A 5DT0A 3EYHA 3MFRA 2J5FA 3MJ2A 5EI6A 3K3JA 1H01A 4MD8E 5CF6A 2VUWA 4BICA 2XCHA 2BZJA 2XIKA 3FL5A 3JY9A 3PPKA 3R7OA 1KV2A 4J8NA 5AAFA 3AMYA 3F2AA 2B9HA 3QGYA 4TWPA 4B4LA 2PUUA 4JOAA 3TNIA 3O17A 4IAAA 4I92A 3QCQA 4B8LA 2DWBA 2QOKA 4I4FA 3NVKI 5IKWA 2IVVA 4PPBA 4O7WA 3FUPA 2PMIA 2WMXA 4YC8A 2PY3A 2C3LA 2O3PA 1APME 3KF4A 4N70A 4EKKA 3IGOA 4ASDA 1YOMA 4X3JA 2VTSA 4D0WA 5HG9A 3GCPA 4C62A 2R0UA 3TV6A 1AGWA 5GJGA 2YWVA 2R3IA 2BALA 1GOLA 5H8GA 3Q4TA 4WNKA 5JMSA 4AOJA 2WMWA 2QOBA 2X4ZA 3Q4CA 4JRVA 4AGWA 5IH5A 3OOMA 3PTGA 4FE2A 1J1CA 1Y91A 4MD9E 5HU9A 2YEXA 3BLRA 3DBFA 4AZSA 4PY1A 4XLIA 1SM2A 4AA0A 4GSBA 2JDTA 5CSVA 4QQCA 1Q41A 3ZDUA 4GYGA 4FV8A 4LUDA 2BILB 3ZZWA 2PZYA 2ZM3A 3V01A 1UV5A 5L6OA 2EUFB 4QRCA 3NMUF 3OVVA 2BRNA 3FZPA 3WZEA 1ZMUA 4YNEA 4K1BA 4RIOA 4Q5EA 3D7ZA 4E5BA 5K0KA 4GFMA 3Q60A 3FPMA 2GCDA 2R3JA 2OK1A 4NKSA 4QPSA 2VNYA 4FG9A 3OWPA 4XP0A 4RVKA 3HVCA 3QHWA 4DTKA 4RG0A 5DI1A 1H07A 4UWBA 3TNHA 1RE8A 4G9RA 1OITA 5IA2A 2F7ZE 5CU6A 3PJCA 4JI9A 3Q4ZA 1H4LA 3MY0A 3G51A 1XH9A 1YXTA 4ALUA 5IQAA 1URWA 1ZYLA 4XV2A 1OPJA 2G2IA 5EQYA 2PSQA 4AE6A 5E8YA 1SVGA 4MXZA 3SQQA 3LKMA 4FIJA 3ODZX 4KUJA 4HGSA 3LQ5A 3VS5A 4A4XA 2VO7A 1AQ1A 4TKSA 4LRMA 4S33A 5TT7A 4BDGA 1UWJA 4S2ZA 4FEVA 3TT0A 3R21A 2VTTA 3F3WA 4DEIA 1OL5A 5DN3A 5HI2A 4M3QA 3T9TA 4FKWA 3NS9A 3R1YA 1GZOA 2YLEA 1MP8A 2W1GA 3LFCA 2VWUA 5BYYA 3NNUA 3GXLA 3KXZA 4F64A 4FVQA 1FVTA 4O7YA 3ENHA 2QU6A 5E8UA 2BROA 4FA2A 3GOPA 5HG5A 4UWYA 4ZTLA 1H1PA 1SYKA 1J91A 2R7IA 4GFOA 4QOXA 5I9ZA 4QMYA 3LXPA 3UPZA 3ZFYA 3VWAA 3HMMA 3EN5A 3L1SA 4ANLA 4D2PA 3GVUA 5IUHA 2QC6A 4MBLA 3TG1A 3QU0A 5M57A 3R1QA 4O2PA 2WU7A 2C6EA 3UE4A 2WTVA 5JGAA 2X9EA 1ZYJA 3BRBA 4RX7A 3V3VA 4DEDA 2C1AA 4FEWA 2CLXA 3R00A 5DPVA 2WB8A 2YZLA 4OW8A 4UALA 5F1ZA 4CYJA 2VO6A 4CFXA 3FLNC 2X39A 2CGXA 3R9RA 2RKUA 5FWKK 3IK3A 3N51A 4Y8DA 2GS2A 3D5VA 4FTRA 3UC3A 5B7VA 3AOXA 4GT3A 1VZOA 5J5TA 2VWBA 1WAKA 3RTPA 2OICA 2F49A 3H9RA 3D4QA 4B0GA 4J98A 5B2LA 4ZJJA 4EOQA 3F9NA 2C3JA 4JDJA 4R8QA 2ITOA 1J7LA 4O83A 5CEQA 3FZSA 2BR1A 2C6TA 3R9NA 4JX3A 4RQKA 3L8SA 5A4LA 4RLKA 3PXKA 4AWIA 4ZSAA 4Z55A 2Z7SA 4IC7A 4KSPA 4HNFA 1Y6BA 3GUBA 5AUXA 2CNUA 3VULA 4R3PA 4QMNA 4GJ2A 2Z7LA 1Y8YA 4KIKA 5HEZA 3S1HA 5M4UA 5DVRA 4M14A 4Q5HA 3ZO4A 4AU8A 3ZXTA 1OL2A 4LGDA 4IC8A 3FMLA 3LMIA 2WNTA 3A4OX 2R4BA 1GZNA 1YXXA 5CS6A 3PA4A 2Y6MA 4ACCA 4RX5A 5JFVA 3DKGA 3LJ2A 4DTBA 4GUEA 4KBAA 3FXZA 3V51A 4R3CA 2CSNA 3ZU7A 3T9IA 3F5GA 1YHWA 4FK6A 4O27B 2YDJA 4BBFA 4O82A 3ZLWA 3FDNA 3GFWA 3U4WA 5KBRA 3QTSA 4IMYA 2FH9A 3MGYA 3NAXA 3D7TA 4M0YA 4I0TA 3M42A 1KSWA 4XLVA 4WSYA 3O7LD 3NUAA 3HP2A 4HYUA 5E7RA 5EHOA 5M55A 1CSNA 3UOLA 1Q8TA 2NRYA 4IB5A 3LXKA 4LL5A 4C4FA 3DK3A 5K5XA 5I9YA 1MQBA 2UZDA 4O0TA 3QD0A 5HESA 2BRGA 4PTEA 2W9ZB 3BHYA 4ZZOA 4OBPA 5GIPE 2QO2A 3HV7A 5CZHA 3HV4A 3GCUA 3GC0A 3G9LX 3MH0A 5KCVA 3HL7A 3TZ9A 3LZBA 5AUZA 4FV7A 3C4ZA 1QL6A 4HYIA 3KN6A 2ITNA 2R9SA 3PP1A 4I5PA 4M7IA 4GKIA 2ETKA 4UEUA 3BU6A 3R02A 4RJ5A 3AMBA 3R6XA 3LQ8A 4G3EA 2BRMA 2JDVA 4V01A 4J8MA 5AA9A 2JGZA 2Q0NA 3DLSA 5C26A 3PWDA 5F9EA 3SKCA 4O7VA 2FSTX 3PZEA 4QTEA 2GSFA 4EOSA 4RMZA 5JZNA 4GEOA 4FYNA 3AGLA 3E93A 4F4PA 2ETRA 2QLUA 1K2PA 3BE9A 4ZJIA 4BCNA 1PXPA 4E4NA 1KE6A 2XM8A 4IM0A 4F99A 3KFAA 3KVWA 4V0GA 3IW4A 2WMSA 1G3NA 4TYHA 4ZP5A 3TNQB 3OZ6A 1W8CA 3QCYA 4S30A 3CS9A 3W16A 3FQSA 4G3FA 3L8PA 4ZLZA 3GU5A 1NVQA 2WTKC 4EHVA 4RVMA 1CMKE 4PDPA 4YNOA 5IDPA 3WF8A 3DU8A 2WO6A 5IF1A 3BHVA 5KO1A 3RVGA 4FTNA 1J7UA 4D5HA 2YAKA 1OZ1A 3FJQE 4XUFA 3KULB 1YDSE 1OI9A 2B1PA 4I6QA 5AX9A 2WELA 3IDPA 4HOKA 4ACGA 1PF8A 2C30A 3NEWA 3G90X 3UDBA 3UNJA 3O51A 4DCAA 3TM0A 3PE1A 1W98A 3TV7A 1M17A 2WQOA 4RVTA 3KK8A 2VTQA 4LMNA 4B7TA 1M2RA 4YGAA 3LE6A 5EOLA 3TZ7A 3WOWA 2VX0A 4FV0A 5AUVA 3RAKA 2O2UA 5ETIA 5M53A 4I0RA 3OMVA 2OZAB 4FODA 2F57A 3DQWA 4U80A 4EI4A 3P5KA 1ZARA 3NUPA 3QZFA 5CASA 5HE2A 1JSTA 1L8TA 1R3CA 1NVSA 4EHZA 3V5QA 5KMMA 1JWHA 3PSBA 2ZM1A 3LFSA 5J79A 2C5OA 1Q97A 4ZJVA 3FSFA 5C4KA 4FTQA 4J52A 4CTCA 5J9YA 4QP6A 4BB4A 4WKQA 1PXMA 3ORTA 3QRUA 2J0IA 3HEGA 4F7SA 3GC7A 5DT3A 5TE0A 1ZOEA 3CR0A 3GC9A 5J87A 1F5QA 2QVSE 3P4KA 2OJ9A 2GPHA 5JT2A 5BVEA 5GNKA 3P7BA 5FM2A 2A1AB 3MBLA 3NNXA 5CU4A 3VNTA 3P7AA 2QR7A 2OJGA 3I0QA 4AT4A 5CAUA 1BKXA 2XJ1A 4IJPA 4XG8A 4UX9A 3MWUA 5L2IA 4L45A 4PP7A 5ANEA 4JBVA 5L2SA 3E7OA 3QZHA 5L6PA 2IZRA 2XNEA 3I81A 3JY0A 4L3JA 1KE7A 2J7TA 3FMMA 3LJ1A 3OCTA 4W9WA 2E9NA 4YBKA 4BCHA 2PUNA 1DI8A 5ETFA 2XBJA 2X2LA 2GDOA 4AOIA 3FL4A 4RQVA 4E6DA 1OKWA 4FSYA 4DFUA 2GU8A 3D2KA 5H3QA 3F5PA 4A4LA 5ANKA 4MKCA 4KS8A 3KVXA 4O1OA 4W4XA 3O8TA 5TO8A 5IEVA 3C4FA 4J7BA 4WHZA 3KRXA 5CQWA 4RT7A 4DBNA 3I60A 4K6ZA 3F3VA 3ZH8A 3R83A 2GS6A 5JQ5A 3DK7A 2J0LA 2WQEA 3QZIA 2WQBA 4JXFA 3IW6A 1M7QA 4S32A 4BKJA 5M08A 4QMZA 3RCJA 5GZAA 2QR8A 3FLQA 4C58A 5EM6A 4U7ZA 3ZFXA 2BAJA 3BV2A 4ERKA 3NX8A 1KOBA 3JYAA 5H8EA 5AP7A 3WYXA 3OD6X 4ACMA 3PVBA 3DBQA 3GCQA 2VTLA 3R1NA 3RKBA 3BYVA 3AC3A 1JAMA 2PVLA 1PXOA 2Y6OA 2O63A 2XK3A 4GIHA 3U9NA 2XBAA 3Q9YA 2X8EA 4WIHA 2WAJA 2OJFE 4HW7A 2QURA 3S95A 3RNIA 5K3YA 4ALVA 2FA2A 4UB7A 3QQFA 1ZOHA 3ACJA 2ITPA 4EHGA 3GU6A 4J99A 4F0FA 4EZ5A 4DFLA 4IB0A 4C4IA 4GMYA 1PRYA 2XK8A 2EWAA 3E62A 4L43A 3ZYAA 1WBVA 5IH4A 3BPRA 3OFMA 3RM6A 3EWHA 3KY2A 4OTDA 4I4EA 4N4SA 4OTQA 5AUTA 4FEUA 2WIPA 3LXNA 4II5A 5CI6A 4UXQA 5JFXA 2V0DA 4JQ8A 2W06A 3SW7A 3KRJA 4HPTE 4MXYA 1JNKA 4DCEA 4MTAA 4CFNA 3SLSA 3EFJA 5FD2A 2XNOA 3GU7A 2ITYA 3LW0A 4M12A 4IX6A 3N4TA 3VVHA 4BF2A 2OF2A 4FR4A 1SVHA 3RPRA 4ANNA 4JG7A 4MBIA 4L68A 1WVXA 5I9UA 2UZOA 5M07A 1JOWB 4A9UA 3F82A 3TIZA 2GMXA 2W99B 3PVGA 3FWQA 4J53A 4BDBA 5EQEA 4EOLA 2V7AA 3FZRA 3G5DA 4O0SA 2HZIA 5M44A 4BWXA 1OIRA 3HYHA 4WG3A 5HHWA 2HELA 4BDAA 5T6KA 5JZJA 1LP4A 2QONA 3LOKA 4NM0A 5TF9A 2ZJWA 2O0UA 4USEA 4HCUA 1FOTA 4N57A 5FBOA 4GVAA 4R78A 4ZTSA 3R28A 2BFYA 5J5SA 3KRWA 1IR3A 2BMCA 2IZUA 3LAUA 4E5AX 3ZSGA 2JFLA 4C37A 3FLSA 5IA0A 3QUPA 2B9JA 4FZFB 4F9AA 5M56A 2A2AA 1PXKA 3Q9WA 3R7GA 4OT5A 4DEGA 3BEAA 4O86A 2R3OA 5DR6A 3PZHA 2BZKB 3DAKA 2WQMA 3LCKA 5HG7A 1KE5A 5GHVA 1JLUE 2JIVA 4O0UA 3Q5IA 2JKKA 4FKPA 5TOZA 3ZDIA 3HX4A 5CEMA 4JQ7A 5BVKA 4O7SA 5IEXA 4IWPA 3MTFA 4EORA 4UBAA 4AW0A 2DYLA 2UV2A 4G17A 4DFXE 3W1FA 4A4OA 4FMQA 3HV3A 5K9IA 2ETMA 2YHVA 4ZLYA 1PKGA 1WVYA 4XG3A 1XJDA 3WZDA 4IX3A 2HWPA 4TZRA 5A4CA 4ZOGA 4DH1A 4QYHA 1TQMA 4WSQA 1RDQE 3W2RA 3TI1A 3ZSHA 1L3RE 3JS2A 2X8DA 1KE9A 4YURA 4X3FC 4IADA 2CGWA 3BLHA 4NW5A 4W4WA 4CZUA 5EKNA 5DA3A 1MUOA 4QTAA 1VYWA 1Q62A 3MYGA 2XYNA 2PZRA 4RFZA 4PMSA 4U5JA 4KS7A 2WTDA 5EDRA 1CM8A 2HK5A 2YDIA 5AV2A 4YHJA 3BGQA 4F7LA 5LOHA 4AOTA 4FV5A 3A7JA 3FEGA 1DS5A 2CCIA 3IS5A 4D5KA 3CIKA 3F69A 1WMKA 2PVMA 5CQUA 2ZV9A 4FT3A 4Y95A 5AIKA 1OPLA 4IDVA 4CFWA 3A62A 2GQSA 2ESMA 4I21A 2BHEA 5CVGA 4FBXA 3QF9A 5L8JA 1Q4LA 5ICPA 4AS0A 3LMHA 1YHSA 2E9PA 4J96A 5AUYA 3WARA 4LV5A 4O7RA 5FDPA 5KUPA 4C4JA 1FQ1B 3CD8A 3LFDA 4FOBA 4RWIA 1FMKA 3LMGA 4DEBA 5KHWA 3Q5ZA 2GFCA 2UZTA 1Y57A 4FNYA 4QPMA 4M84A 4A06A 3DPKA 3QTIA 2F9GA 3DNDA 4FTUA 3I7CA 3D9VA 4AZVA 2PUPA 3E8CA 5JEBA 2YIRA 1B39A 2ERZE 4FL3A 3IOPA 5FGKA 3CTJA 1CTPE 4K2RA 2XNMA 2J4ZA 3C5UA 4G2FA 2BKZA 3QFVA 5ETCA 5JRQA 3MJ1A 1S9IA 3ANRA 3FZOA 4FSTA 4DFZE 1BX6A 2RFDA 3RGFA 1WBOA 3QHRA 2J51A 5J7HA 3QTXA 2UZLA 3FHIA 3EQFA 5EOBA 4I5MA 1FMOE 2WEVA 1E1XA 5J1WA 4Y85A 4Z9LA 2PMNX 3NNVA 1ATPE 2X81A 3ZONA 4D1ZA 2W1ZA 2ZM4A 2VTNA 2X2KA 3K5VA 2YM7A 2UZNA 4FGBA 4JDKA 4BCFA 4R5YA 5CU3A 3N4VA 3ZO1A 4BGQA 3W8QA 3SXFA 4NKAA 4AA4A 4LRKA 2J6MA 3JVRA 4ITJA 4AGCA 1OKZA 4AUAA 3DZQA 3NUYA 4QMSA 1NT2A 5E4HA 4OR5A 5HE3A 1ZMVA 1GIIA 3DOGA 1WBNA 3WZUA 1G5SA 3POZA 4CKIA 2YDKA 2I0YA 4ZLOA 5BUJA 3U6JA 3HECA 1PXNA 5HTIA 5KMLA 3SRVB 3PP0A 3HDMA 4LL0A 1A9UA 4IWQA 2WPAA 5E90A 5EYMA 3V04A 3EN4A 4HCTA 4GK2A 2JBPA 4PDOA 5CTPA 4CYIA 4L53A 2XK7A 4DFYA 4BBEA 3C4EA 2Y4IC 3GBZA 3W33A 2RGPA 3ORPA 3ZO3A 1WBTA 4H05A 1Z9XA 2RFEA 5KKRC 3N4UA 3N9XA 4FK3A 4IFGA 4G5PA 4OTIA 2ITZA 2RG5A 1GIHA 4U42A 2Z2WA 4XH6A 1BYGA 3D7TB 2Z02A 2OO8X 1IAHA 5IQBA 4D58A 3TWJA 2XK6A 4HZRA 2IO6A 4U6RA 4DGOA 1P14A 3ID6C 4YP8A 4C4GA 4IFCA 3GENA 1U54A 3FC2A 4CRSA 3KCFA 3MB7A 2Q0BA 4L6QA 3UYSA 4F9CA 3CPBA 2GNIA 5AR4A 3RK7A 3T3UA 4RIXB 5HTCA 4XBUA 4K11A 3RHXA 4C33A 2QOHA 5AADA 4U40A 4E5WA 5E8WA 4QO9A 5BMMA 4DFBA 2O5KA 3BYMA 5CT7A 5FUTA 3F3ZA 2O64A 2QOCA 4DF3A 3OCBA 4JNWA 3AGMA 4UYNA 3G33A 3C50A 3O7LB 3NW7A 3TCPA 3UP2A 4XYFA 3MS9A 4DA5A 5KMIA 3BYUA 2CHLA 2WTIA 5DEWA 5HNBA 1PY5A 2XKDA 4BDEA 2XNPA 3EQBA 3ZO2A 2IW9A 1V1KA 4U3ZA 1KE8A 4YTIA 1IEPA 5CU0A 3DQXA 5FRIA 4BR3A 2PWLA 4CKRA 1PXIA 4K9YA 4BDHA 3BQCA 4RGJA 4ANQA 3F5UA 4FSRA 5B2MA 4JAIA 1G8SA 4BZDA 4IAZA 5KNJA 2F7EE 2R7BA 3MIYA 3GNIB 4PX6A 2W17A 4R77A 3CQEA 2CPKE 2IWIA 1UA2A 3S4QA 2C5NA 4BY9E 4DH7A 2QG5A 4CZTA 5C4LA 5DEYA 2B9IA 4JRNA 2BVAA 2OFVA 5HO8A 4QMXA 5HE1A 4BC6A 3UOJA 2XNNA 1H1SA 4FT9A 3QUDA 5CLPA 4HGEA 1CKJA 1XH8A 1F3MC 1E9HA 2ITXA 2BDFA 4MWIA 2E2BA 4PP9A 3UTOA 3WE8A 4G1WA 3V6RA 1REKA 3RCDA 2ONLC 4ZAUA 2XUUA 2XNGA 5AJQA 3ZEPA 3K2LA 4L67A 3CQUA 5IUGA 1WCCA 2WEIA 3UO4A 3NNWA 2YIYA 3OBJA 4QQJA 1YDTE 4ZMFA 3UG1A 2YCQA 1O6YA 3PRIA 3KXGA 3VJNA 1YI6A 4CXAA 1H28A 3DLZA 4UMPA 4BCMA 4YMJA 1JSVA 4FKJA 3IG7A 5HICA 4EOKA 2FB8A 4FNZA 4CKJA 3LIJA 1PYXA 4GU9A 4X21A 3A60A 3ZRLA 3IQ7A 3H30A 1FPUA 5HKMA 4UYAA 3UZPA 2VNWA 3BV3A 1S9JA 4FC0A 4NFMA 4J1RA 2Z7QA 4FSMA 4C8BA 4DGNA 3TACA 5HNIX 1JKLA 3VO3A 3QTRA 4C02A 1GZ8A 4V04A 4WOVA 2OXDA 5EHLA 5GJDA 1Q8ZA 1A48A 2CDZA 2QHMA 5T68A 3QBNA 1PXLA 4BI2A 1ZYDA 3QTWA 2HENA 3EQCA 4FV9A 4JBQA 4R6VA 3MTLA 2V22A 4IZ7A 3OUNB 3VUTA 1JVPP 3UIUA 4DN5A 5IQGA 2F2UA 4EH5A 5JK3A 1H27A 1HCKA 3EJ1A 4TN6A 2R3FA 3I4BA 2JDSA 1XKKA 3KA0A 3QA8A 4IM2A 5IQEA 4ASEA 4WBOA 3RK9A 4C35A 5AM6A 2CLQA 3C0IA 4ZXTA 4F1TA 2J0MB 2OG8A 5EDQA 3WF5A 2XKCA 2B9FA 2HIWA 3GOKA 4WO5A 5AEPA 1XBBA 5EYDA 1FVVA 5TR6A 1BL7A 3SC1A 3VRZA 3QKMA 4H1MA 4KKGA 4DITA 5KMNA 3D5XA 4ZS0A 5I0BA 2CCHA 3VS0A 2Y4IB 5I3OA 2PYWA 4BCJA 2C5VA 3E8EA 4IW0A 3VF8A 4XP2A 4FTMA 4BCIA 4JVGA 4TYGA 1R39A 1T45A 4LGGA 2EXMA 1KUTA 2X7FA 4DTAA 3ZUTA 4GK3A 4GRBA 4C3RA 4G34A 5FXQA 4ZY6A 3A61A 3TIYA 4IIRA 4O21A 3ATTA 3HRCA 2JDRA 1PMUA 3PY1A 3CY2A 2WOTA 3E92A 3PY3A 2G1TA 2R3HA 1ND4A 2PHKA 4FVRA 3E8DA 4P2KA 1U5QA 2JC6A 2WMTA 2CJMA 2HWOA 1OL1A 3DTWA 4KRDA 5LVOA 4BTFA 2X8IA 4DYMA 2UW0A 5AWMA 3SW4A 3I1AA 3U54A 2X1NA 4FIIA 3OHTA 3UIXA 3IDBA 4DLJA 4RZVA 3DBCA 4Y46A 5HORA 5IPJA 2W96B 1CDKA 2YM4A 4IZYA 4FL2A 4YJQA 5BQ0A 3NIZA 2FYSA 2XEYA 4MXAA 2HXLA 2VRXA 4M15A 3V8SA 2HZ0A 3O71A 4RC4A 4UY9A 1YDRE 4GKHA 2Q83A 5I4NA 3D5WA 2H8HA 3Q2JA 1BL6A 2AC3A 3PY0A 4QMWA 5ANIA 4W8DA 2Y0AA 1K3AA 3UO6A 5HCZA 2PTKA 3CXWA 4RX9A 2I0VA 2HYYA 3UQCA 4FV6A 3GT8A 2J9MA 3P0MA 4M69A 3QYWA 4HCVA 1BI7A 2R5TA 4QMVA 2WMQA 3OS3A 1ZOGA 3F7ZA 4U0IA 5BVWA 5LWNA 2E9UA 5IQCA 2JD5A 3HAMA 1XH4A 4RWLA 3FHRA 3KC3A 4S31A 4WD5A 5FTQA 5AIRA 1J1BA 2W1FA 4EQMA 2FSOX 1GIJA 4L7FA 1Q61A 2QI8A 4NTTA 5C03A 4EJ7A 3LM0A 3BGZA 4EH6A 1IRKA 3EKNA 4UXLA 4RIWB 5CNNA 1WVWA 1ZY4A 2R3KA 4FZDB 4QMOA 3VBXA 4KKHA 2PZPA 4C3FA 4MAOA 3BQRA 4M68A 4AW5A 2WIHA 1T46A 4P5QA 4MNFA 1F0QA 4YZNA 1OMWA 3QCXA 4G3DA 2XIXA 3H10A 3VUKA 5DH3A 1YWVA 4R7IA 2IW6A 3D15A 3UNKA 2CNQA 5HIDA 3EFKA 2W9FB 2PVYA 3D14A 3HGKA 3U55A 5HU3A 3C7QA 3LM5A 2WD1A 2H34A 1GNGA 5AV0A 4DT9A 5L6WL 2CN5A 4DAWA 3RPSA 3I5ZA 3ZSIA 5CALA 4RFYA 4D2WA 3VW8A 2RG6A 4BDJA 2OZAA 3OY3A 4GT5A 5HIBA 1LUFA 4KIPA 5E8XA 3KKVA 4PTCA 3ZC6A 2OIQA 3M1SA 4XHKB 4C4EA 2VTPA 4YUQA 3ZLSA 4UN0C 2CKPA 1WBPA 2R3QA 4UWCA 2UW9A 3EN7A 2YACA 2GHLA 2JIIA 1OECA 5E1SA 5HLPA 2Y7JA 5J95A 2VTAA 2UW3A 4KABA 3DKCA 2UZVA 3ZEWA 2X2MA 4EBWA 3PVUA 3BYSA 4PL4A 3A2CA 4I24A 1JKKA 5LVNA 5C8MA 1VYZA 4NCTA 3C9WA 2BRBA 4OGRA 4MNEB 5DYJA 3PWYA 3FQEA 4UMRA 4BZNA 3PYYA 1H00A 1ZRZA 2GTNA 4EOMA 4B99A 4XG6A 3UGCA 3E3PA 4ITHA 2EB3A 2WMRA 3O23A 4IXPA 4IM3A 3VS4A 5L2TA 3EQHA 5FG8A 3MESA 3DT1A 3UQGA 4CFMA 4U81A 2QNJA 2DQ7X 3BHTA 2VV9A 4X2GA 3LFAA 3EH9A 4RLLA 5ANGA 3HV5A 5DR9A 4NSTA 3DK6A 3RALA 4KBCA 2REIA 4IQ6A 3SOAA 2OJIA 1E1VA 5CSXA 3R30A 5B2KA 2OSCA 3C13A 5GJFA 2VWWA 3EN6A 4ID7A 4C59A 4QTCA 3C4WA 3VUMA 2YIQA 1MQ4A 4O0RA 3WF6A 2YM5A 4F9WA 4D2TA 1Y6AA 2R3GA 4C36A 4W4VA 3TL8A 3MN3A 3Q9ZA 4K77A 5A54A 3Q6UA 2I7QA 1U59A 3AT4A 2YCFA 1WBSA 4I23A 3OY1A 4I6HA 4EH2A 3FI4A 4P90A 4AZFA 1JSUA 4Z7GA 3QLFA 3FI3A 4JIKA 4AG8A 2XKFA 2QOOA 2XS0A 4X2NA 2ITWA 4EK6A 4L42A 4FKTA 4YZDA 5CYIA 5HQ0A 2C3IB 4F9YA 1OB3A 2CMWA 2OWBA 2Z7RA 3OWJA 5IH6A 3HMOA 4P5ZA 2ZMCA 3A7FA 4H3PA 4GU6A 1B38A 2BPMA 3F6XA 4H39A 1M52A 3GC8A 3L9PA 4ZSEA 4JDIA 3HRBA 2B54A 2VTJA 2JITA 1OIQA 3R04A 4KRCA 4MD7E 4QT1A 1KWPA 2H9VA 2V5QA 3E87A 2PE1A 4HZSA 4YJPA 3WBLA 4XRLA 4U9AA 5DNRA 4DH5A 5L2WA 1AD5A 3QTUA 2OJJA 2R3LA 2C68A 4I5HA 3UVPA 4RJ8A 4HYHA 4F63A 3DBEA 4K33A 4L52A 4EQCA 4NM3A 2UZWE 4OAVB 2CKQA 3TDWA 3PJ2A 4D1SA 4PQNA 4O81A 3RHKA 2BDJA 1NY3A 1O6LA 1TQIA 3HNGA 3MIAA 4X2JA 5HOAA 5ACKA 4CZYB 4F0IA 5BMSA 4O96A 1OUYA 3CKXA 3D83A 2LAVA 5D12A 3TEIA 3TN8A 3KXXA 3ZCLA 4BZOA 2BTSA 3QD4A 4UZHA 4YPSA 4EK5A 4D4SA 2UZEA 2UZUE 4WG4A 4IANA 5L2QA 2YWPA 5LMBA 3R8ZA 2GS7A 3IOKA 5BUEA 2QU5A 2B0QA 4O7TA 3JPVA 5CAPA 5GINE 2GHMA 3RI1A 3ATSA 4PL5A 3C0GA 4BDDA 5E8ZA 3AT3A 3ZFMA 4IAKA 3Q53A 2EXCX 4DEHA 4YTCA 1JQHA 4M66A 4F0GA 5EW9A 5AP0A 3OWKA 4O84A 5ANJA 3PXRA 2O8YA 3DXPA 3R2BA 4QYEA 4OBOA 5FP6A 4BRXA 1XHAA 4IAYA 2YA9A 1H1RA 2P2IA 4HGTA 5LWMA 3HRFA 5IUIA 3H4JA 3R9DA 4PDSA 3DZOA 3AC2A 2OLCA 1ZWSA 4QMLA 3OEFX 4YZCA 2XB7A 4U3YA 2C69A 3FKOA 3KULA 4L46A 3MI9A 3EQPA 5K5NA 3U6HA 3PIXA 4QMQA 1FVRA 3G6HA 3QGWA 3UQFA 3ZM4A 2NRUA 4QYGA 3CBLA 5CVHA 4CSVA 5AAEA 4BIBA 5CXZA 3PSCA 4BYIA 4XV3A 4ZY4A 4PV0A 3AD4A 1ZZ2A 2H6DA 4E7WA 3SXSA 4NYEA 3E7VA 1YHVA 3R9HA 4E6QA 5AP6A 4DG3E 1UNGA 4XG4A 5A46A 3NCZA 1Q3WA 2X9FA 1GJOA 4QP1A 5EI2A 4D2VA 3UZTA 3QYZA 1LEZA 1H1WA 2EB2A 5DBXA 3H0YA 3II5A 3KREA 3QWKA 3OOGA 4XMOA 5BPYA 5HBJA 2B4SB 2I1MA 1SMHA 5BVDA 5FM3A 2RIOA 2W5BA 3EQRA 3AC5A 1VR2A 3NUSA 3F2RA 3SX9A 4E93A 2W4JA 4JX7A 2UUEA 1SNXA 4MQ1A 4ACHA 3TKHA 5H2UA 5KHXA 1IAJA 1BLXA 1JPAA 2ZDUA 5J9LA 2GHGA 3QCSA 4V0GB 2C47A 2FSMX 3OBGA 3HA8A 4MVFA 5FDXA 4AX8A 2FO0A 1Q5KA 4YTFA 5HZNA 5HCXA 3ORNA 2VTIA 3V8WA 4NW6A 1H24A 3OF0A 2HAKA 3Q52A 4N0SA 3VUGA 4ZTNA 3VBYA 2PVHA 2ZDTA 2HZNA 3W2OA 5HX8A 3KK9A 3A7HA 3PG1A 4YJTA 3VBQA 3ORIA 4BWKA 5LMKC 4RBLA 3PLSA 4YJUA 2YISA 5AR5A 2JKMA 3VBWA 4B6LA 4KA3A 2B55A 3GFEA 2C6MA 4N6YA 4DE4A 3I7BA 4FTKA 4FSWA 3MFTA 4QP2A 4FTAA 3EB0A 4C57A 1TKIA 1PMEA 4FZAB 4EUUA 4ZSLA 2PUIA 2YLFA 4JS8A 3U8WA 1YW2A 1UU7A 2XA4A 3F88A 4YBJA 2QCSA 3LFNA 4E20A 4ZTQA 5H9BA 3UNZA 3SVVA 2ITUA 3A8XA 3WE4A 4HVHA 4MXXA 4USFA 3WZJA 4P7EA 3PSDA 5HCYA 1WZYA 2BIYA 4DFNA 5E8VA 4R1VA 1OKVA 2YABA 1I44A 5LARA 4FIHA 4TYIA 4YLLA 2VWVA 4I6FA 4O2ZA 1PMVA 2R3MA 3SG8A 5LVPA 2ZAZA 3KXNA 5JFSA 3GQIA 3TKUA 1GAGA 3V5JA 2C6LA 2VWZA 3FMNA 4MF1A 4QP4A 4QTDA 4D9UA 5CEIA 4EWHA 3W55A 4YLJA 3DJ5A 3PIYA 5FEDA 4JQEA 4XG9A 4ENYA 4FSQA 4I0SA 4QTBA 5DWRA 5ANOA 2CKEA 4EH8A 5HO7A 4FKSA 3KXMA 3PPZA 4X3FA 1PMNA 5FLFA 3QRIA 4MNEA 5EYKA 3L9LA 2JDOA 4O7LA 4FZ7A 3AD6A 4OTWA 5E8TA 5DLSA 3OG7A 1OGUA 4NFNA 3VRYA 3DXNA 4HPUE 3OXZA 4LOOA 2XVDA 2XNBA 3NYVA 4OLIA 1SZMA 1PKDA 2HOGA 3BYOA 3PXFA 3DV3A 3MH2A 4ENXA 3TZ8A 2Z8CA 2QOFA 4AFJA 3QLGA 4YC3A 4FTLA 4IB3A 2GNLA 5E1EA 3UOKA 5LMKA 5AV3A 4E8AA 3SG9A 5DT4A 3LFBA 4IHPA 3P08A 3PXZA 5HBEA 3IECA 3VUHA 4YJVA 2J0JA 3FYJX 1J7IA 5CZIA 2P0CA 1XR1A 1W84A 2W4OA 4YJOA 1R0PA 3KB7A 3OWLA 4QMUA 2UVYA 2YIWA 4K8AA 2C3KA 3QTQA 4I5CA 5B0XA 3RZBA 2WTJA 4X0MA 3QX2A 4DG0E 5LXMA 2ZYBA 4I3ZA 1UKHA 5F20A 4BCQA 4C7TA 4LV8A 5L8LA 1YOJA 4EYMA 4BCGA 4YLKA 3QKKA 4NL0A 3AMAA 1Q8WA 2VU3A 3UOHA 4DEEA 2VX3A 3QQKA 2JBOA 2WFYA 2ZOQA 2UW8A 4NCTC 3E64A 4GH2A 4QMTA 4Z16A 4F65A 2XIRA 2OGVA 4CMUA 3BGPA 5JKGA 4RSSA 3NSZA 3UG2A 3MA6A 2ZB1A 5T3QA 3ULIA 3RP9A 3RWQA 1RQQA 1NXKA 4A9TA 4WA9A 3LFEA 4CTBA 4GCJA 1IASA 1PHKA 4AT5A 3EMGA 3FSKA 4FNXA 3U6IA 2V62A 4LUEA 3NDMA 2ZV7A 4APPA 3VUIA 5HX6A 1YXUA 5AUWA 1Q3DA 3HZTA 3R22A 5CF8A 3KGAA 3JVSA 3CLYA 2BIKB 3HP5A 3O96A 3M2WA 4USDA 3V8TA 5C1QB 4C2WA 1LPUA 2WGJA 1H0VA 4Y83A 3H3CA 3L8VA 5AP4A 4BGGA 1ZMWA 4G3GA 1LR4A 2PVKA 3DKOA 4RX8A 3BKBA 5DG5A 3ZRKA 5DMZA 3REPA 3VQHA 3E88A 3QXPA 4O0YA 1U54B 3BEGA 3DY7A 3UJGA 4TTHB 4ASZA 2ITVA 3ROYA 4E4LA 3FXWA 1MRUA 3MA3A 2UZBA 3LPBA 3NR9A 3QA0A 5EK7A 5F94A 2G15A 5K4JA 4KIOA 4KKEA 5IMXA 3OEZA 3Q96A 5EW3A 3SHEA 3B8RA 4D4RA 2J90A 3KF7A 4EQUA 2FGIA 3F7WA 3MVJA 4GG5A 4ANMA 4RRVA 5CSHA 4IX4A 3DNEA 3ZUUA 2RFNA 1R0EA 1OIYA 4JL9A 2PVNA 4W9XA 1ERKA 4JBPA 5IEYA 5BVOA 4KIKB 4AF3A 4D9TA 3QX4A 3PA5A 3QQGA 4TYHB 4E1ZA 1BMKA 3DAEA 2QKRA 2VAGA 2XJ2A 3COHA 3C0HA 4JR7A 4KIQA 4ZTHA 4NM5A 2PE0A 2VTMA 4PMTA 3F5XA 2NNWB 5JRSA 4OAUC 4H1JA 4RIWA 3QUEA 3BWJA 1YKRA 2R3RA 3ZM9A 4ORKA 3QC9A 5D7VA 4HGLA 4O7NA 5D9HA 4LI5A 2IVUA 4G5JA 4JR3A 3POOA 2P4IA 3FLYA 4QD6A 2VN9A 3RBWA 2WMVA 4BYJA 5ITAA 3HMNA 3S00A 1O9UA 4U44A 4AA5A 1OL7A 4MH7A 4E3CA 2YCSA 4FZ6A 4YZ9A 4P4CA 1RW8A 3HA6A 4FTOA 4BBMA 4M97A 4DH8A 4BI0A 4HVGA 4BI1A 4EONA 4CG8A 3D0EA 4B8MA 2OIBA 4IVBA 4EWQA 2VTOA 5DGZA 2VZ6A 4AN9A 4R5SA 1I09A 1MRYA 4I20A 4FEXA 3ALNA 1K9AA 3GCVA 1O6KA 3Q32A 3MPTA 3MVHA 4NZWB 4LMUA 3TV4A 3W10A 4CMTA 4HVDA 3FLWA 3PRFA 4YU2A 5BVNA 5JQ8A 4XS2A 2PMLX 3R71A 5IA5A 4TPTA 2I6LA 5TKDA 2IG7A 2X6DA 1H08A 2ITQA 3PPJA 4FKLA 3BIZA 5DRBA 3QQJA 2ITTA 4JG8A 3T8OA 2WMBA 2ZMDA 3HDNA 2ZB0A 1STCE 4MCVA 2AC5A 4YZBA 3BWFA 3UBDA 3FPQA 2GNHA 3V5LA 4E26A 4WUNA 3RNYA 2YM3A 4LOPA 4XG7A 4EH3A 3IGGA 4ZSGA 4GIIA 3I79A 4RWKA 2KULA 2C6OA 3QRKA 4O7ZA 4QYYA 4DINA 2B52A 3S3IA 3EQGA 4EOOA 3RPVA 3I0OA 1VEBA 4TW9A 3DDPA 4UZDA 3O8PA 4RZWA 4XX9A 3SDJA 4U45A 3R1SA 2QOLA 3COKA 4A9YA 4MXOA 3PVWA 4IACA 1GZKA 1PW2A 3U87A 3BLQA 3KRLA 3CE3A 3FXXA 2QLQA 2WTCA 3Q6WA 4TY1A 3CJGA 5AP5A 3UVQA 3ACKA 3PLAE 3BI6A 4Y73A 5CSWA 2R3NA 5LVMA 5ANDA 1P5EA 5HVJA 4W4YA 1LEWA 3WF7A 5M51A 4H3BA 3WIGA 3QQUA 3CTHA 3V6SA 2G2HA 4ALWA 2BCJA 4WNMA 4YTHA 3LQ3A 4PNIA 1URCA 5KMOA 2NPQA 3OT3A 4AQCA 5A4QA 2PPQA 4KD1A 3VQUA 3EIDA 4AW2A 2J5EA 4BTMA 3ORKA 5CY3A 4EK8A 1QPEA 4YO4A 5C8KA 3UMWA 3VJOA 2BKKA 4IH8A 4F1OA 2PE2A 4KB8A 3R7UA 3B2WA 3F3UA 2C6IA 4WRGA 3OP5A 4RIYA 4MEDA 4XRJA 4YSMA 2XMYA 2PULA 1PJKA 4MK0A 3RAHA 2W1EA 5IMEA 3THBA 3I6UA 4C0TA 5JGDA 3KEXA 3OT8A 2XP2A 1RJBA 4G31A 3ET7A 3MFSA 5IG1A 4QMMA 2C5YA 3EN9A 4D4YA 4B9DA 3UP7A 3DBDA 2OXYA 4FV1A 3K5UA 2BFXA 4WBBB 5K4IA 4FKQA 5D1JA 2I40A 3W32A 2C1BA 3E3BX 4BL1A 3SAYA 3W2QA 3NUUA 4FT5A 3CKWA 4L8MA 1YWNA 4O6LA 4AZTA 4BCOA 2WKMA 3PE2A 4QNAA 4E73A 3QRJA 4WNOA 4K18A 3D2IA 4XJ0A 4XV9A 4C34A 3GI3A 4FICA 2PVJA 2XKEA 5L4QA 2J50A 3BX5A 2PU8A 5C8NA 3G2FA 3ITZA 4PNKA 5I5ZA 3SXRA 5ACBC 5G6VA 4EK3A 4FT0A 2WZJA 3UC4A 4CD0A 4KINA 4A07A 4MQ2A 1DAYA 2YITA 4UMUA 2G2FA 5EW8A 2EU9A 3FV8A 4IBMA 1UU9A 3DCVA 4MBJA 5BYZA 3VIDA 2XK4A 4DH3A 3EFWA 3KMUA 2WQNA 1XBAA 3H0ZA 3M11A 3HKOA 4RJ4A 2OFUA 4NIFB 4BN1A 3FZTA 3UVRA 3PJ1A 1SVEA 4FOCA 3QRTA 2HZ4A 5J1VA 4YHTA 4APCA 3TKIA 3ZTXA 4PWNA 4E6AA 3AC1A 1FBNA 3CGFA 3PIZA 3CY3A 1ZYCA 2UW7A 3Q4UA 3IPHA 1DM2A 2W7XA 3KN5A 2GTMA 3WILA 3E8NA 4EUTA 4PPCA 3FAAA 3MV5A 4JJRA 4WG5A 3GEQA 3TJCA 3LHJA 5HD4A 4MF0A 3IONA 2YAAA 2JIUA 3OW3A 4JDHA 3U9CA 4CNHA 4PL3A 5HIEA 1OUKA 2WOUA 3LVPA 3R63A 3R7VA 1UU8A 3HMPA 4YPDA 2GNFA 3DB8A 4XCUA 2IJMA 4XP3A 3TJDA 4BWPA 3GB2A 4K0YA 4RC3A 2V7OA 5HE0A 4AXAA 3GCSA 4QYFA 2UW4A 5EFQA 2QODA 4M13A 5L8KA 3U4UA 4F7NA 2W1CA 4ZTMA 4MHAA 2CN8A 4IZ5A 5FTGA 5CENA 1XH5A 4X2KA 1QMZA 3AG9A 3MW1A 4GV1A 4KBKA 4NUSA 2WXVA 4ZIMA 4YJRA 3NUXA 3ZRMA 4CRLA 4J97A 4D1XA 5GZ8A 3W2CA 2ZV8A 4F1MA 2X6EA 3A7GA 3E5AA 5AAGA 1QPJA 3E63A 4D28A 5CSPA 4JG6A 2FUMA 3CCNA 3FYKX 1R78A 2YIXA 4GFGA 3WF9A 4BDCA 5IQFA 4FIFA 1Q8YA 3DTCA 4MXCA 4AGDA 3RK5A 3R01A 3W2SA 4NWMA 4A9RA 4QMPA 5IISA 4BIEA 2IVSA 3L8XA 4JAJA 4LM5A 3CSVA 1BI8A 3NYNA 3VS1A 3P9JA 4FSNA 3ZLYA 4BTJA 4FX3A 2XCKA 3WZKA 4OTGA 3DXQA 5D11A 3FE3A 3ELJA 3LCOA 5AR2A 3QD2B 3KMMA 4R1YA 4I22A 5IU2A 3G0EA 4AGUA 2KTYA 1UNLA 2OBJA 4EHEA 3UZRA 4IJ9A 4IEBA 4GK4A 3KCKA 4RFMA 1YRPA 3CQWA 4NEUA 4WUAA 4F6SA 4D2RA 5FXSA 4IX5A 5AR7A 1Y8GA 5E92A 3DKFA 4FIGA 2RL5A 3TTJA 3D94A 3QC4A 2X4FA 3L9MA 4UMQA 3ZOSA 3SRVA 3ORMA 4XBRA 2OH0E 4OTFA 4CT2A 2XM9A 3HUBA 4FKVA 4DG2E 4ERWA 5I3RA 4JBOA 2G9XA 3EKKA 4AACA 4EL9A 1OIUA 5FQDC 1UVRA 3HV6A 2E9OA 4AT3A 2A0CX 2YN8A 4Z7HA 2XZSA 4BHZA 3DAJA 2A4LA 3NW6A 3OW4A 5M4CA 3TUDA 3UO5A 4MX9A 4C38A 4FF8A 4YHFA 4ZEGA 4CFFA 3ZS5A 3FQHA 3QXOA 1V0PA 3TXOA 3OTUA 4IVCA 1Q24A 5AR8A 2QO9A 2CKOA 3FMJA 3BELA 2R2PA 5DR2A 3FI8A 3MVLA 3FBVA 3B8QA 3P78A 5I9VA 2YFXA 5JH6A 3LCSA 3VUDA 3B2TA 2BAKA 3VHKA 3UYTA 3ZLXA 3JR1A 3IW8A 2JFMA 3OTVA 4IVDA 4WRSA 4CLJA 4TWCA 2XF0A 4O6EA 3C4XA 4LYNA 4D2SA 2XRUA 4FNWA 4TWNA 1UU3A 4FSUA 2CGVA 2BHHA 5CEKA 3QD3A 3ZHPC 3MPMA 2YZAA 3R8PA 2PMOX 3R73A 4Y5QA 3AT2A 3R9OA 2P33A 1NA7A 4TT7A 4X3FB 3HLLA 3K3IA 4FKGA 1QCFA 4D4VA 3MPAA 5AV1A 2WMUA 3P7CA 2ERKA 3UIBA 4YZMA 3CC6A 4FI1A 4FV4A 4Y72A 4FIEA 4BKZA 4EBVA 3GGFA 4HJOA 4N6ZA 1W83A 2O65A 2X0GA 3EOCA 5EI8A 1YXVA 3RJCA 5AMNA 1V0BA 3EQIA 3O8UA 4RPVA 4C4HA 3FZ1A 4GG7A 5IA4A 5I9XA 2ZVAA 4H3QA 4AN3A 4L44A 4E6CA 4YSJA 2W1DA 1NVRA 2Z60A 4NU1A 4F09A 2P2HA 5CAQA 1JKSA 2XH5A 5D7AA 5EYCA 4G16A 4CCUA 4FYOA 5CAOA 1EH4A 3FY0A 5EM7A 2R0IA 5EKOA 2F4JA 1Q99A 4FKIA 3G0FA 4E4MA 4FKOA 3LCTA 3VN9A 4C61A 4DC2A 5BX0A 4RIXA 2VWIA 3HAVA 1H26A 2Y9QA 4ZZNA 4GVJA 4QP7A 3W18A 3V5WA 4PPAA 4IWOA 4ANOA 3TDVA 4YJSA 3ODYX 2EXEA 5G1XA 3DFCB 3W8LA 1UKIA 3KL8A 2NO3A 1SNUA 2VX1A 4AP7A 4A9SA 4YR8A 1H25A 4OBQA 3JXWA 3IDCA 3D5UA 3BE2A 5CNOA 4QQ5A 3BU5A 4PRJA 4XNEA 4S34A 5EM5A 5AA8A 1M2QA 1UWHA 2BRHA 4HYSA 5D41A 3FC1X 5H8BA 4RJ7A 4BDIA 1MRVA 2I0EA 4FVPA 3QZGA 3R0TA 5AP2A 3MVMA 1ZY5A 2DS1A 5AV4A 2BZIB 5K0XA 3BBWA 4X7QA 2C0TA 3NUNA 2C0IA 4O0XA 4QPAA 3ZZEA 5CF4A 3MFUA 3OROA 5C01A 4EK4A 5FP5A 2WHBA 2W5HA 3ETAA 2OZOA 1P2AA 3KQ7A 4FG8A 4M8TA 4RA4A 2C0OA 2JLDA 3NYOA 4XV1A 3V5TA 2PL0A 2YCRA 2W4KA 4GUBA 5EHYA 3S2PA 3FKLA 3VS6A 1XH7A 4C2VA 5AUUA 4X6RA 1QPCA 2QO7A 2XIZA 1OBDA 4FKUA 2B7AA 5CT0A 1V0OA 3ZUVA 4EZ3A 5FEEA 1OL6A 3NLBA 4FTJA 2IZTA 2YJRA 2C6KA 3FY2A 4NT4A 1KV1A 4FG7A 1J3HA 2EVAA 3VW6A 3RM7A 1A06A 2PZIA 3R7IA 3P86A 5FXRA 4BCPA 4FGRA 4G3CA 5EDPA 5KBQA 5AP1A 4AZWA 3MY5A 5CU2A 3KRRA 1WFCA 1OPKA 3DFAA 4L9IA 3QQLA 3O50A 4LRJA 3IW7A 4FTIA 3BZ3A 4BGHA 2BZHB 4IVAA 2VO3A 4U8ZA 3A4PA 1R1WA 4R7BA 1DAWA 4ZY5A 3COIA 3G15A 3RZFA 2BTRA 1CKIA 5CI7A 2W05A 4CVAA 2BAQA 4O22A 3VHEA 3FI2A 3C1XA 4NH1A 3KU2A 3OC1A 2F2CB 4LFIA 2J2IB 3PXYA 3OXIA 4HVSA 2FVDA 3BBTB 2IVTA 1WBWA 2OH4A 4BTKA 2WTWA 4WT6A 4BKYA 5IZFA 3OXTA 3W2PA 3QQHA 4U43A 3JUHA 4I94A 2YM6A 4ACDA 3TUBA 3VBVA 5HLWA 5KZIA 2SRCA 2WU6A 3EQDA 1Z5MA 5HO6A 3SV0A 5GIOE 3RPYA 3NGAA 1H0WA 3BHUA 2VGPA 2HW6A 5J9ZA 3A8WA 2UVXA 4YO6A 2XJ0A 2RF9A 3K54A 3QWJA 4FV2A 3RAWA 4EOPA 2QHNA 3VS7A 4AN2A 2C6DA 3FMHA 3Q9XA 4CQGA 5IA1A 3MH3A 4O0WA 4HVIA 4IWDA 3R8MA 5A9UA 5IQDA 3AXWA 2AUHA 2J0KA 5CWZA 1H8FA 1H1QA 5KE0A 4FKRA 3TZMA 4EJNA 5LJJA 5AM7A 3WIKA 3GQLA 4EZ7A 4L3PA 4BFMA 4D55A 3LFFA 2IZSA 4PF4A 4GS6A 4U41A 4I41A 5C27A 5M06A 3LCDA 4GW8A 1M7NA 3NVMB 2QQ7A 1U46A 3AD5A 3Q04A 3F3TA 3CD3A 5EG3A 1TVOA 3FLZA 3G9NA 1W82A 1XO2B 1OVEA 3AQVA 4KWPA 2IW8A 2JAMA 3TNPC 3QTZA 4Q9ZA 3PXQA 1PXJA 4EEVA 3QALE 3ORLA 4FUYA 4NIFA 3O0GA 4A7CA 4TYJA 3MB6A 5HVYA 1IA9A 3PA3A 4EH9A 5E9EA 4R3RA 4DBXA 2F7XE 3C4CA 3EZRA 4ONAA 1W7HA 2VGOA 4RA5A 4RWJA 1X8BA 1U4DA 5AR3A 4CMOA 4DEAA 3PUPA 3A7IA 4CV9A 4QP9A 1ZLTA 2PK9A 4ARKA 2P55A 4LG4A 4DLIA 5J8IA 5KZ0A 3F61A 5CEPA 3P23A 1VJYA 1Z57A 4FTTA 4MWHA 2OXXA 3UPXA 4TNDA 3CEKA 3PJ3A 4AZEA 4OT6A 2AYPA 2FSLX 3VF9A 4Q9SA 2HY0A 3I6WA 4XEYA 5DRDA 3NAYA 3ZXZA 5CX9A 5I9WA 4ZS4A 5M4IA 4G6LA 5BUIA 4IZAA 3SGCA 4RJ6A 2OU7A 1YVJA 5GZ9A 1XQZA 2GFSA 4TYEA 2XEZA 4CLIA 4F6WA 2X7GA 5HLNA 2A19B 2VWYA 4IAIA 5IQHA 3H9FA 1FINA 5LCKA 4G6NA 3AC8A 4LQMA 1UNHA 5FTOA 4PTGA 5DFPA 2PVRA 5E91A 5AX3A 4ASXA 2W5AA 4I6BA 4BIDA 4CCBA 1P4OA 1PYEA 4CT1A 5CF5A 2YJSA 3PDTA 3MSSA 5KMJA 2JKQA 1CKPA 3VS2A 5FBNC 4BVUA 2OIDA 4PMMA 3QKLA 3WYYA 2CGUA 2QOIA 2W1IA 4M69B 3ANQA 1TQPA 3NCGA 5L3AA 4CG9A 1B6CB 4IB1A 5A6OA 3ERKA 4D0XA 3EFLA 3NW5A 1HOWA 1W0XC 3VBTA 4F6UA 4WNPA 4O91A 3AC4A 4OUCA 3C5IA 4TL0A 5IA3A 4YJNA 4H58A 3UODA 3FMEA 4O1PA 2XYUA 5IQIA 4F70A 4U79A 3V5PA 5FEQA 5EQPA 1M2PA 3LLTA 2JEDA 4CFUA 3NWWA 4GL9A 5DHJA 5HGIA 3H9OA 4GT4A 5CXHA 3EZVA 4X6QC 2GQRA 4IDTA 3ORZA 2OW3A 1HCLA 4RJ3A 2ONLA 4H36A 4F7JA 5A6NA 4OTRA 2HXQA 1YI4A 3EYGA 3MH1A 1BUHA 3GU4A 3NRMA 4JT3A 3ZMMA 3VAPA 4QNYA 3SOCA 5DOSA 3O2MA 3R8UA 1JKTA 1U5RA 2LGCA 5KKRB 5F4NA 3IW5A 2OKRA 3IKAA 3I5NA 4CEGA 4E4XA 2WTKB 4FEQA 2HW7A 4CQEA 3CPCA 3EL8A 2VWXA 3OUKA 4LGHA 4FL1A 3VC4A 2Y8OA 4I1ZA 1P4FA 4M0ZA 4OTHA 1QPDA 3ZC5A 4EOJA 3UMXA 5LCJA 5LQFA 4TRLA 4C3PA 4EKLA 1XWSA 5HD7A 1M14A 4RVLA 5HBHA 4CGAA 3DDQA 2P3GX 4YC6A 1ZZLA 3C51A 3R7YA 4O0VA 2G01A 4M67A 4GYIA 3U51A 1IA8A 3ULZA 5A4TA 2QKWB 2C5XA 2VO0A 3CJFA 3S0OA 2XIYA 3Q3BA 3EL7A 1KOAA 3QAME 4X2FA 5HVKA 3ZBFA 4ZK5A 3RWPA 4QP8A 3OCSA 4FUXA 2R64A 4DGGA 2UW5A 3FMDA 3PJ8A 4TXCA 1GY3A 2PVFA 3UIMA 4BCKA 5D10A 2R3PA 2W0JA 4KNBA 4ANSA 2YERA 2XRWA 3R2YA 4AW1A 4ZZMA 3BHHA 2GNJA 3TNWA 2BUJA 4DGMA 2YM8A 3IO7A 3MDYA 3ROCA 3A99A 4DT8A 5BYLA 4F9BA 5JN2A 3DJ6A 3CGOA 4BDKA 4GJ3A 3KMWA 4NJDA 4UMTA 4O38A 2JAVA 5JSMA 2CNVA 3BCEA 5HTBA 2QOQA 2BDWA 4JIAA 1YOLA 1FGIA 4UV0A 1Q8UA 3R8VA 4J71A 3NYXA 3ENMA 4L3LA 3P79A 1DI9A 3LJ0A 5IDNA 3COMA 5A3XA 5HNGA 4BHNA 2QD9A 4J95A 4NJ3A 3RMFA 4EOIA 4TNBA 3HUCA 2UVZA 3NZ0A 3NIEA 4V05A 4LOQA 3L9NA 4PMPA 5CANA 3QL8A 3VS3A 3OCGA 5A14A 1ZAOA 2JKOA 2UW6A 5F95A 5M4FA 4ZTRA 4R7HA 2V55A 5E8SA 4CV8A 3G6GA 2VTHA 2PZ5A 3MY1A 4Z3VA 5A4EA 4RC2A 4L01A 1OBGA 2ACXA 1JBPE 4KSQA 1REJA 4ZSJA 5KX8A 3RAIA 4L00A 4G6OA 1ZXEA 4ANBA 2IN6A 4HNIA 2H96A 4W8EA 2I0HA 3DJ7A 2WMAA 3EHAA 3P1AA 4JLCA 5CEOA 4BDFA 3DA6A 2NP8A 4KAOA 5DIAA 1YI3A 4EH4A
chains in the Genus database with same CATH superfamily
5EH0A 3TUCA 4CFVA 3BU3A 4ITIA 3ZBXA 5EM8A 5CAVA 3CP9A 5HG8A 2GNGA 3LXLA 2IPXA 4EH7A 2X7OA 1XH6A 3GP0A 1G8AA 3R7EA 4AE9A 5BNJA 3PG3A 3LFQA 3WI6A 4XG2A 4AAAA 5LVLA 3FKNA 3ORXA 4IE9A 1NW1A 3RPOA 4NK9A 2C4GA 3FMKA 2HY81 4Y5HA 4DGLC 4QQTA 3GU8A 4XOYA 3RINA 4FT7A 4PUZA 2VTRA 4NM7A 4IAFA 2XK9A 5BVFA 5M09A 3TMOA 4MYGA 4EYJA 4FTCA 3R8LA 1YXSA 5AFVA 2B53A 1YWRA 3Q2MA 4QP3A 4XOZA 3F66A 2QG7A 2RSVA 3SA0A 1IG1A 4U97A 3HMIA 4Q2AA 4AFEA 4TWOA 5JGBA 4NTSA 1OM1A 2HCKA 3ALOA 1YQJA 4PDYA 4DHIB 3T3VA 5LMAA 1XBCA 3CTQA 5CVFA 5JFWA 2DUVA 5AP3A 4DHFA 4FV3A 2OF4A 2E9VA 3TTIA 4F08A 4I93A 4ZMEA 3PFQA 3SD0A 5J7BA 4EC8A 4EC9A 3NPCA 2W1HA 3DB6A 4RIYB 3DGKA 2A27A 5C9CA 2GQGA 1ZYSA 2VD5A 4G9CA 1OKYA 4FSZA 5KMKA 3LLAA 2ZV2A 2OI4X 4OTPA 3KXHA 2RFSA 1FGKA 2Y4PA 3F2NA 4L7SA 5DE2A 5ETAA 3DS6A 5DT0A 3EYHA 3MFRA 2J5FA 3MJ2A 5EI6A 3K3JA 1H01A 4MD8E 5CF6A 2VUWA 4BICA 2XCHA 2BZJA 2XIKA 3FL5A 3JY9A 3PPKA 3R7OA 1KV2A 4J8NA 5AAFA 3AMYA 3F2AA 2B9HA 3QGYA 4TWPA 4B4LA 2PUUA 4JOAA 3TNIA 3O17A 4IAAA 4I92A 3QCQA 4B8LA 2DWBA 2QOKA 4I4FA 3NVKI 5IKWA 2IVVA 4PPBA 4O7WA 3FUPA 2PMIA 2WMXA 4YC8A 2PY3A 2C3LA 2O3PA 1APME 3KF4A 4N70A 4EKKA 3IGOA 4ASDA 1YOMA 4X3JA 2VTSA 4D0WA 5HG9A 3GCPA 4C62A 2R0UA 3TV6A 1AGWA 5GJGA 2YWVA 2R3IA 2BALA 1GOLA 5H8GA 3Q4TA 4WNKA 5JMSA 4AOJA 2WMWA 2QOBA 2X4ZA 3Q4CA 4JRVA 4AGWA 5IH5A 5BV3A 3OOMA 3PTGA 4FE2A 1J1CA 1Y91A 4MD9E 5HU9A 2YEXA 3BLRA 3DBFA 4AZSA 4PY1A 4XLIA 1SM2A 4AA0A 4GSBA 2JDTA 5CSVA 4QQCA 1Q41A 3ZDUA 4GYGA 4FV8A 4LUDA 2BILB 3ZZWA 2PZYA 2ZM3A 3V01A 1UV5A 5L6OA 2EUFB 4QRCA 3NMUF 3OVVA 2BRNA 3FZPA 3WZEA 1ZMUA 4YNEA 4K1BA 4RIOA 4Q5EA 3D7ZA 4E5BA 5K0KA 4GFMA 3Q60A 3FPMA 2GCDA 2R3JA 2OK1A 4NKSA 4QPSA 2VNYA 4FG9A 3OWPA 4XP0A 4RVKA 3HVCA 3QHWA 4DTKA 4RG0A 5DI1A 1H07A 4UWBA 3TNHA 1RE8A 4G9RA 1OITA 5IA2A 2AEGA 2F7ZE 5CU6A 3PJCA 4JI9A 3Q4ZA 1H4LA 3MY0A 3G51A 1XH9A 1YXTA 4ALUA 5IQAA 1URWA 1ZYLA 4XV2A 1OPJA 2G2IA 5EQYA 2PSQA 4AE6A 5E8YA 1SVGA 1ST0A 4MXZA 3SQQA 3LKMA 4FIJA 3ODZX 4KUJA 4HGSA 3LQ5A 3VS5A 4A4XA 2VO7A 1AQ1A 4TKSA 4LRMA 4S33A 5TT7A 4BDGA 1UWJA 4S2ZA 4FEVA 3TT0A 3R21A 2VTTA 3F3WA 4DEIA 1OL5A 5DN3A 5HI2A 4M3QA 3T9TA 4FKWA 3NFGB 3NS9A 3R1YA 1GZOA 2YLEA 1MP8A 2W1GA 3LFCA 2VWUA 5BYYA 3NNUA 3VONA 3GXLA 3KXZA 2XAOA 4F64A 4FVQA 1FVTA 4O7YA 3ENHA 2QU6A 5E8UA 2BROA 4FA2A 3GOPA 5HG5A 4UWYA 4ZTLA 1H1PA 1SYKA 1J91A 2R7IA 4GFOA 4QOXA 5I9ZA 4QMYA 3LXPA 3UPZA 3ZFYA 3VWAA 3HMMA 3W0NA 3EN5A 3L1SA 4ANLA 4D2PA 3GVUA 5IUHA 2QC6A 4MBLA 3TG1A 3QU0A 5M57A 3R1QA 4O2PA 2WU7A 2C6EA 3UE4A 2WTVA 5JGAA 2X9EA 1ZYJA 3BRBA 4RX7A 3V3VA 4DEDA 2C1AA 4FEWA 2CLXA 3R00A 5DPVA 2WB8A 2YZLA 4OW8A 4UALA 5F1ZA 4CYJA 2VO6A 4CFXA 3FLNC 2X39A 2CGXA 3R9RA 2RKUA 5FWKK 3IK3A 2XALA 3N51A 4Y8DA 2GS2A 3D5VA 4FTRA 3UC3A 5B7VA 3AOXA 4GT3A 1VZOA 5J5TA 2VWBA 1WAKA 3RTPA 2OICA 2F49A 3H9RA 3D4QA 4B0GA 4J98A 5B2LA 4ZJJA 4EOQA 3F9NA 2C3JA 4JDJA 4R8QA 2ITOA 1J7LA 4O83A 5CEQA 3FZSA 2BR1A 2C6TA 3R9NA 4JX3A 4RQKA 3L8SA 5A4LA 4RLKA 3PXKA 4AWIA 4ZSAA 4Z55A 2Z7SA 4IC7A 4KSPA 4HNFA 1Y6BA 3GUBA 5AUXA 2CNUA 3VULA 4R3PA 4QMNA 4GJ2A 1VLRA 2Z7LA 1Y8YA 4KIKA 5HEZA 3S1HA 5M4UA 5DVRA 4DDIA 4M14A 4Q5HA 3ZO4A 4AU8A 3ZXTA 1OL2A 4LGDA 4IC8A 3FMLA 3LMIA 2WNTA 3A4OX 2R4BA 1GZNA 1YXXA 5CS6A 3PA4A 2Y6MA 4ACCA 4RX5A 5JFVA 3DKGA 3LJ2A 4DTBA 4GUEA 4KBAA 3FXZA 3V51A 4R3CA 2CSNA 3ZU7A 3T9IA 3F5GA 1YHWA 4FK6A 4O27B 4FRFA 2YDJA 4BBFA 4O82A 3ZLWA 3FDNA 3GFWA 3U4WA 5KBRA 3QTSA 4IMYA 2FH9A 3MGYA 3NAXA 3D7TA 4M0YA 4I0TA 3M42A 1KSWA 4XLVA 4WSYA 3O7LD 3NUAA 3HP2A 4HYUA 5E7RA 5EHOA 5M55A 1CSNA 3UOLA 1Q8TA 2NRYA 4IB5A 3LXKA 4LL5A 4C4FA 3DK3A 5K5XA 4QEBA 3W0RA 5I9YA 1MQBA 2UZDA 4O0TA 3QD0A 5HESA 2BRGA 4PTEA 2W9ZB 3BHYA 4ZZOA 4OBPA 5GIPE 2QO2A 3HV7A 5CZHA 3HV4A 3GCUA 3GC0A 3G9LX 3MH0A 5KCVA 3HL7A 3TZ9A 3LZBA 5AUZA 4FV7A 3C4ZA 1QL6A 4HYIA 3KN6A 2ITNA 2R9SA 3PP1A 4I5PA 4M7IA 4GKIA 2ETKA 4UEUA 3BU6A 3R02A 4RJ5A 3AMBA 3R6XA 3LQ8A 4G3EA 2BRMA 2JDVA 4V01A 4J8MA 5AA9A 2JGZA 2Q0NA 3DLSA 5C26A 3PWDA 5F9EA 3SKCA 4O7VA 2FSTX 3PZEA 4QTEA 2GSFA 4EOSA 4RMZA 5JZNA 4GEOA 4FYNA 3AGLA 3E93A 4F4PA 2ETRA 2QLUA 1K2PA 3BE9A 4ZJIA 4BCNA 1PXPA 4E4NA 1KE6A 2XM8A 4IM0A 4F99A 3KFAA 3KVWA 4V0GA 3IW4A 2WMSA 1G3NA 4TYHA 4ZP5A 3TNQB 3OZ6A 1W8CA 3QCYA 4S30A 3CS9A 3W16A 3FQSA 4G3FA 3L8PA 4ZLZA 3GU5A 1NVQA 2WTKC 4EHVA 4RVMA 1CMKE 4PDPA 4YNOA 5IDPA 3WF8A 3DU8A 2WO6A 5IF1A 3BHVA 5KO1A 4LV7A 3RVGA 4FTNA 1J7UA 1W2FA 4D5HA 2YAKA 1OZ1A 3FJQE 4XUFA 3KULB 1YDSE 1OI9A 2B1PA 4I6QA 5AX9A 2WELA 3IDPA 4HOKA 4ACGA 1PF8A 2C30A 3NEWA 1TZDA 3G90X 3UDBA 3O51A 3UNJA 4DCAA 3TM0A 3PE1A 1W98A 3TV7A 1M17A 2WQOA 4RVTA 3KK8A 2VTQA 4LMNA 4B7TA 1M2RA 4YGAA 3LE6A 5EOLA 3TZ7A 3WOWA 2VX0A 4FV0A 5AUVA 3RAKA 2O2UA 5ETIA 5M53A 4I0RA 3OMVA 2OZAB 4FODA 2F57A 3DQWA 4U80A 4EI4A 3P5KA 1ZARA 3NUPA 3QZFA 5CASA 5HE2A 1JSTA 1L8TA 1R3CA 1NVSA 4EHZA 3V5QA 5KMMA 1JWHA 3PSBA 2ZM1A 3LFSA 5J79A 2C5OA 1Q97A 4ZJVA 3FSFA 5C4KA 4FTQA 4J52A 4CTCA 5J9YA 4QP6A 4BB4A 4WKQA 1PXMA 3ORTA 3QRUA 2J0IA 3HEGA 4F7SA 3GC7A 5DT3A 5TE0A 1ZOEA 3CR0A 3GC9A 5J87A 1F5QA 2QVSE 3P4KA 2OJ9A 2GPHA 5JT2A 5BVEA 5GNKA 3P7BA 5FM2A 2A1AB 3MBLA 3NNXA 5CU4A 3VNTA 3P7AA 2QR7A 2OJGA 3I0QA 4AT4A 5CAUA 1BKXA 2XJ1A 4IJPA 4XG8A 4UX9A 3MWUA 5L2IA 4L45A 4PP7A 5ANEA 4JBVA 5L2SA 3E7OA 3QZHA 5L6PA 2IZRA 2XNEA 3I81A 3JY0A 4L3JA 1KE7A 2J7TA 3FMMA 3LJ1A 3OCTA 4W9WA 2E9NA 4YBKA 4BCHA 2PUNA 1DI8A 5ETFA 2XBJA 2X2LA 2GDOA 4AOIA 3FL4A 4RQVA 4E6DA 1OKWA 4FSYA 4F78A 4DFUA 2GU8A 3D2KA 5H3QA 3F5PA 4A4LA 5ANKA 4MKCA 4KS8A 3KVXA 4O1OA 4W4XA 3O8TA 5TO8A 5IEVA 3C4FA 4J7BA 4WHZA 3KRXA 5CQWA 4RT7A 4DBNA 3W0OA 3I60A 4K6ZA 3F3VA 3ZH8A 1OGYA 3R83A 2GS6A 5JQ5A 3DK7A 2J0LA 2WQEA 3QZIA 2WQBA 4JXFA 3IW6A 1M7QA 4S32A 4BKJA 5M08A 4QMZA 3RCJA 5GZAA 2QR8A 3FLQA 4C58A 5EM6A 4U7ZA 3ZFXA 2BAJA 3BV2A 4ERKA 3NX8A 1KOBA 3JYAA 5H8EA 5AP7A 3WYXA 3OD6X 4ACMA 3PVBA 3DBQA 3GCQA 2VTLA 3R1NA 3RKBA 3BYVA 3AC3A 1JAMA 2PVLA 1PXOA 2Y6OA 2O63A 2XK3A 4GIHA 3U9NA 2XBAA 3Q9YA 2X8EA 4WIHA 4BJJB 2WAJA 2OJFE 4HW7A 2QURA 3S95A 3RNIA 5K3YA 4ALVA 2FA2A 4UB7A 3QQFA 1ZOHA 3ACJA 2ITPA 4EHGA 3GU6A 4J99A 4F0FA 4EZ5A 4DFLA 4IB0A 4C4IA 4GMYA 1PRYA 2XK8A 2EWAA 3E62A 4L43A 3ZYAA 1WBVA 5IH4A 3BPRA 3OFMA 3RM6A 3EWHA 3KY2A 4OTDA 4I4EA 4N4SA 4OTQA 5AUTA 4FEUA 2WIPA 3LXNA 4II5A 5CI6A 4UXQA 5JFXA 2V0DA 4JQ8A 2W06A 3SW7A 3KRJA 4HPTE 4MXYA 1JNKA 4DCEA 4MTAA 4CFNA 3SLSA 4FJVA 3EFJA 5FD2A 2XNOA 3GU7A 2ITYA 3LW0A 4M12A 4IX6A 3N4TA 3VVHA 4BF2A 2OF2A 4FR4A 1SVHA 3RPRA 4ANNA 4JG7A 4MBIA 3W0SA 4L68A 1WVXA 5I9UA 2UZOA 5M07A 1JOWB 4A9UA 3F82A 3TIZA 2GMXA 2W99B 3PVGA 3FWQA 4J53A 4BDBA 5EQEA 4AXFA 4EOLA 2V7AA 3FZRA 3G5DA 4O0SA 2HZIA 5M44A 4BWXA 1OIRA 3HYHA 4WG3A 4DDGA 5HHWA 2HELA 4BDAA 5T6KA 5JZJA 1LP4A 2QONA 3LOKA 4NM0A 5TF9A 2ZJWA 2O0UA 4USEA 4HCUA 1FOTA 4N57A 5FBOA 4GVAA 4R78A 4ZTSA 3R28A 2BFYA 5J5SA 3KRWA 1IR3A 2BMCA 2IZUA 3LAUA 4E5AX 3ZSGA 2JFLA 4C37A 3FLSA 5IA0A 3QUPA 2B9JA 4FZFB 4F9AA 5M56A 2A2AA 1PXKA 3Q9WA 3R7GA 4OT5A 4DEGA 3BEAA 4O86A 2R3OA 5DR6A 3PZHA 2BZKB 3DAKA 2WQMA 3LCKA 5HG7A 1KE5A 5GHVA 1JLUE 2JIVA 4O0UA 3Q5IA 2JKKA 4FKPA 5TOZA 3ZDIA 3HX4A 5CEMA 4JQ7A 5BVKA 4O7SA 5IEXA 4IWPA 3MTFA 4EORA 4UBAA 4AW0A 2DYLA 2UV2A 4G17A 4DFXE 3W1FA 4A4OA 4FMQA 3HV3A 5K9IA 2ETMA 2YHVA 4ZLYA 1PKGA 1WVYA 4XG3A 1XJDA 3WZDA 4IX3A 2HWPA 4TZRA 5A4CA 4ZOGA 4DH1A 4QYHA 1TQMA 4WSQA 1RDQE 3W2RA 3TI1A 3ZSHA 1L3RE 3JS2A 2X8DA 1KE9A 4YURA 4X3FC 4IADA 2CGWA 3BLHA 4NW5A 4W4WA 4CZUA 5EKNA 5DA3A 3P5JC 1MUOA 4QTAA 1VYWA 1Q62A 3MYGA 2XYNA 2PZRA 4RFZA 4PMSA 4U5JA 4KS7A 2WTDA 5EDRA 1CM8A 2HK5A 2YDIA 5AV2A 4YHJA 3BGQA 4F7LA 5LOHA 4AOTA 4FV5A 3A7JA 3FEGA 1DS5A 2CCIA 3IS5A 4D5KA 3CIKA 3F69A 1WMKA 2PVMA 5CQUA 2ZV9A 4FT3A 4Y95A 5AIKA 1OPLA 4IDVA 4CFWA 3A62A 2GQSA 2ESMA 4I21A 2BHEA 5CVGA 4FBXA 3QF9A 5L8JA 1Q4LA 5ICPA 4AS0A 3LMHA 1YHSA 2E9PA 4J96A 5AUYA 1W2DA 4LV5A 3WARA 5FDPA 5KUPA 4C4JA 1FQ1B 4O7RA 3CD8A 3LFDA 4FOBA 4RWIA 1FMKA 3LMGA 4DEBA 5KHWA 3Q5ZA 2GFCA 2UZTA 1Y57A 4FNYA 4QPMA 4M84A 4A06A 3DPKA 3QTIA 2F9GA 3DNDA 4FTUA 3I7CA 3D9VA 4AZVA 2PUPA 3E8CA 5JEBA 2YIRA 1B39A 2ERZE 4FL3A 3IOPA 5FGKA 3CTJA 1CTPE 4K2RA 2XNMA 2J4ZA 3C5UA 4G2FA 2BKZA 3QFVA 5ETCA 5JRQA 3MJ1A 1S9IA 3ANRA 3FZOA 4FSTA 4DFZE 1BX6A 2RFDA 3RGFA 1WBOA 3QHRA 2J51A 5J7HA 3QTXA 2UZLA 3FHIA 3EQFA 5EOBA 3ML1A 4I5MA 1FMOE 2WEVA 1E1XA 5J1WA 4Y85A 4Z9LA 2PMNX 3NNVA 1ATPE 2X81A 3ZONA 4D1ZA 2W1ZA 2ZM4A 2VTNA 2X2KA 3K5VA 2YM7A 2UZNA 4FGBA 4JDKA 4BCFA 4R5YA 5CU3A 3N4VA 3ZO1A 4BGQA 3W8QA 3SXFA 4NKAA 4AA4A 4LRKA 2J6MA 3JVRA 4ITJA 4AGCA 1OKZA 4AUAA 3DZQA 3NUYA 4QMSA 1NT2A 5E4HA 4OR5A 5HE3A 1ZMVA 1GIIA 3DOGA 1WBNA 3WZUA 1ST4A 1G5SA 3POZA 4CKIA 2YDKA 2I0YA 4ZLOA 5BUJA 3U6JA 3HECA 1PXNA 5HTIA 5KMLA 3SRVB 3PP0A 3HDMA 4LL0A 1A9UA 4IWQA 2WPAA 5E90A 5EYMA 3V04A 3EN4A 4HCTA 4GK2A 2JBPA 4PDOA 5CTPA 4CYIA 4L53A 2XK7A 4DFYA 4BBEA 3C4EA 2Y4IC 3GBZA 3W33A 2RGPA 3ORPA 3ZO3A 1WBTA 4H05A 1Z9XA 2RFEA 5KKRC 3N4UA 3N9XA 4FK3A 4IFGA 4G5PA 4OTIA 2ITZA 2RG5A 1GIHA 4U42A 2Z2WA 4XH6A 1BYGA 3D7TB 2Z02A 2OO8X 1IAHA 5IQBA 4D58A 3TWJA 2XK6A 4HZRA 2IO6A 4U6RA 4DGOA 1P14A 3ID6C 4YP8A 4C4GA 4IFCA 3GENA 1U54A 3FC2A 4CRSA 3KCFA 3MB7A 2Q0BA 4L6QA 3UYSA 4F9CA 3CPBA 2GNIA 5AR4A 3RK7A 4DHZA 3T3UA 4RIXB 5HTCA 4XBUA 4K11A 3RHXA 4C33A 2QOHA 5AADA 4U40A 4E5WA 5E8WA 4QO9A 5BMMA 4DFBA 2O5KA 3BYMA 5CT7A 5FUTA 3F3ZA 2O64A 2QOCA 4DF3A 3OCBA 4JNWA 3AGMA 4UYNA 3G33A 3C50A 3O7LB 3NW7A 3TCPA 3UP2A 4XYFA 3MS9A 4DA5A 5KMIA 3BYUA 2CHLA 2WTIA 5DEWA 5HNBA 1PY5A 2XKDA 4BDEA 2XNPA 3EQBA 3ZO2A 2IW9A 1V1KA 4U3ZA 1KE8A 4YTIA 1IEPA 5CU0A 3DQXA 5FRIA 4BR3A 2PWLA 4CKRA 1PXIA 4K9YA 4BDHA 3BQCA 4AXDA 4RGJA 4ANQA 3F5UA 4FSRA 5B2MA 4JAIA 1G8SA 4BZDA 4IAZA 5KNJA 2F7EE 2R7BA 3MIYA 3GNIB 4PX6A 2W17A 4R77A 3CQEA 2CPKE 2IWIA 1UA2A 3S4QA 2C5NA 4BY9E 4DH7A 2QG5A 4CZTA 5C4LA 3W0QA 5DEYA 2B9IA 4JRNA 2BVAA 2OFVA 5HO8A 4QMXA 5HE1A 4AQKA 4BC6A 3UOJA 2XNNA 1H1SA 4FT9A 3QUDA 5CLPA 4HGEA 1CKJA 1XH8A 1F3MC 1E9HA 2IEWA 2BDFA 2ITXA 2E2BA 4MWIA 4PP9A 3UTOA 3WE8A 4G1WA 3V6RA 1REKA 3RCDA 2ONLC 4ZAUA 2XUUA 2XNGA 5AJQA 3ZEPA 3K2LA 4L67A 3CQUA 5IUGA 1WCCA 2WEIA 3UO4A 3NNWA 2YIYA 3OBJA 4QQJA 1YDTE 4ZMFA 3UG1A 2YCQA 1O6YA 4I6LA 3PRIA 3KXGA 3VJNA 1YI6A 4CXAA 1H28A 2X0PA 3DLZA 4UMPA 4BCMA 4YMJA 1JSVA 4FKJA 3IG7A 5HICA 4EOKA 2FB8A 4FNZA 4CKJA 3NFFB 3LIJA 1PYXA 4GU9A 4X21A 3A60A 3ZRLA 3IQ7A 3H30A 1FPUA 5HKMA 4UYAA 3UZPA 2VNWA 3BV3A 1S9JA 4FC0A 4NFMA 4J1RA 2Z7QA 4FSMA 4C8BA 4DGNA 3TACA 5HNIX 1JKLA 3VO3A 3QTRA 4C02A 1GZ8A 4V04A 4WOVA 2OXDA 5EHLA 5GJDA 1Q8ZA 1A48A 2CDZA 2QHMA 5T68A 3QBNA 1PXLA 4BI2A 1ZYDA 3QTWA 2HENA 3EQCA 4FV9A 4JBQA 4R6VA 3MTLA 2V22A 4IZ7A 3OUNB 3VUTA 1JVPP 3UIUA 4DN5A 3AKLA 5IQGA 2F2UA 4EH5A 5JK3A 1H27A 1HCKA 3EJ1A 4TN6A 2R3FA 3I4BA 2JDSA 1XKKA 3KA0A 3QA8A 4IM2A 5IQEA 4ASEA 4WBOA 4O4CA 3RK9A 4C35A 5AM6A 2CLQA 3C0IA 4ZXTA 4F1TA 2J0MB 2OG8A 5EDQA 3WF5A 2XKCA 2B9FA 2HIWA 3GOKA 4WO5A 5AEPA 1XBBA 5EYDA 1FVVA 5TR6A 1BL7A 3SC1A 3VRZA 3QKMA 4H1MA 4KKGA 4DITA 5KMNA 3D5XA 4ZS0A 5I0BA 2CCHA 3VS0A 2Y4IB 5I3OA 2PYWA 4BCJA 2C5VA 3E8EA 4IW0A 3VF8A 4XP2A 4FTMA 4BCIA 4JVGA 4TYGA 1R39A 1T45A 4LGGA 2EXMA 1KUTA 2X7FA 4DTAA 3ZUTA 4GK3A 4GRBA 4C3RA 4G34A 5FXQA 4ZY6A 3A61A 3TIYA 4IIRA 4O21A 3ATTA 3HRCA 2JDRA 1PMUA 3PY1A 3CY2A 2WOTA 3E92A 3PY3A 2G1TA 2R3HA 1ND4A 2PHKA 4FVRA 3E8DA 4P2KA 1U5QA 2JC6A 2WMTA 2CJMA 2A98A 2HWOA 3DTWA 1OL1A 4KRDA 5LVOA 4BTFA 2X8IA 4DYMA 2UW0A 5AWMA 3SW4A 3I1AA 3U54A 2X1NA 4FIIA 3OHTA 3UIXA 3IDBA 4DLJA 4RZVA 3DBCA 4Y46A 5HORA 5IPJA 2W96B 1CDKA 2YM4A 4IZYA 4FL2A 4YJQA 5BQ0A 3NIZA 2FYSA 2XEYA 4MXAA 2HXLA 2VRXA 4M15A 3V8SA 2HZ0A 3O71A 4RC4A 4UY9A 1YDRE 4GKHA 2Q83A 5I4NA 3UDTA 3D5WA 2H8HA 3Q2JA 1BL6A 2AC3A 3PY0A 4QMWA 5ANIA 4W8DA 2Y0AA 1K3AA 3UO6A 5HCZA 2PTKA 3CXWA 4RX9A 2I0VA 2HYYA 3UQCA 4FV6A 3GT8A 2J9MA 3P0MA 4M69A 3QYWA 4HCVA 1BI7A 2R5TA 4QMVA 2WMQA 3OS3A 1ZOGA 3F7ZA 4U0IA 5BVWA 5LWNA 2E9UA 5IQCA 2JD5A 3HAMA 1XH4A 4RWLA 3FHRA 3KC3A 4S31A 4WD5A 5FTQA 5AIRA 1J1BA 2W1FA 4EQMA 2FSOX 1GIJA 4L7FA 1Q61A 2QI8A 4NTTA 5C03A 4EJ7A 3LM0A 3BGZA 4EH6A 1IRKA 3EKNA 3UDZA 4UXLA 4RIWB 5CNNA 1WVWA 1ZY4A 2R3KA 4FZDB 4QMOA 3VBXA 4KKHA 2PZPA 4C3FA 4MAOA 3BQRA 2XARA 4M68A 4AW5A 2WIHA 1T46A 4P5QA 4MNFA 1F0QA 4YZNA 1OMWA 3QCXA 4G3DA 2XIXA 3H10A 3VUKA 5DH3A 1YWVA 4R7IA 2IW6A 3D15A 3UNKA 2CNQA 5HIDA 3EFKA 2W9FB 2PVYA 3D14A 3HGKA 3U55A 5HU3A 3C7QA 3LM5A 2WD1A 2H34A 1GNGA 5AV0A 4DT9A 5L6WL 4O4BB 2ZFYA 2CN5A 4DAWA 3RPSA 3I5ZA 3ZSIA 5CALA 4RFYA 4D2WA 3VW8A 2RG6A 4BDJA 2OZAA 3OY3A 4GT5A 5HIBA 1LUFA 4KIPA 5E8XA 3KKVA 4PTCA 3ZC6A 2OIQA 3M1SA 4XHKB 4C4EA 2VTPA 4YUQA 3ZLSA 4UN0C 2CKPA 1WBPA 2R3QA 4UWCA 2UW9A 3EN7A 2YACA 2GHLA 2JIIA 1OECA 5E1SA 5HLPA 2Y7JA 5J95A 2VTAA 2UW3A 4KABA 3DKCA 2UZVA 3ZEWA 2X2MA 4EBWA 3PVUA 3BYSA 4PL4A 3A2CA 4I24A 1JKKA 5LVNA 5C8MA 1VYZA 4NCTA 3C9WA 2BRBA 4OGRA 4MNEB 5DYJA 3PWYA 3FQEA 4UMRA 4BZNA 3PYYA 1H00A 1ZRZA 2GTNA 4EOMA 4B99A 4XG6A 3UGCA 3E3PA 4ITHA 2EB3A 2WMRA 3O23A 4IXPA 4IM3A 3VS4A 5L2TA 3EQHA 5FG8A 3MESA 3DT1A 3UQGA 4CFMA 4U81A 2QNJA 2DQ7X 3BHTA 2VV9A 4X2GA 3LFAA 3EH9A 4RLLA 5ANGA 3HV5A 5DR9A 4NSTA 3DK6A 3RALA 4KBCA 2REIA 4IQ6A 3SOAA 2OJIA 1E1VA 5CSXA 3R30A 5B2KA 2OSCA 3C13A 5GJFA 2VWWA 3EN6A 4ID7A 4C59A 4QTCA 3C4WA 3VUMA 2YIQA 1MQ4A 4O0RA 3WF6A 2YM5A 4F9WA 4D2TA 1Y6AA 2R3GA 4C36A 4W4VA 3TL8A 3MN3A 3Q9ZA 4K77A 5A54A 3Q6UA 2I7QA 1U59A 3AT4A 2YCFA 1WBSA 4I23A 3OY1A 4I6HA 4EH2A 4BJJA 3FI4A 4P90A 4AZFA 1JSUA 4Z7GA 3QLFA 3FI3A 4JIKA 4AG8A 2XKFA 2QOOA 2XS0A 4X2NA 2ITWA 2IF8A 4L42A 4FKTA 4YZDA 5CYIA 4EK6A 2C3IB 4F9YA 1OB3A 2CMWA 2OWBA 2Z7RA 3OWJA 5HQ0A 5IH6A 3HMOA 4P5ZA 2ZMCA 3A7FA 4H3PA 4GU6A 1B38A 2BPMA 3F6XA 4H39A 1M52A 3GC8A 3L9PA 4ZSEA 4JDIA 3HRBA 2B54A 2VTJA 2JITA 1OIQA 3R04A 4KRCA 4MD7E 4QT1A 1KWPA 2H9VA 2V5QA 3E87A 2PE1A 4HZSA 4YJPA 3WBLA 4XRLA 4U9AA 5DNRA 4DH5A 5L2WA 1AD5A 3QTUA