3SV0A

Crystal structure of casein kinase-1 like protein in plant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
294
structure length
294
Chain Sequence
EPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQGGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVHSKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTGTARYASVNTHLGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYEKISEKKVATSIEALCRGYPTEFASYFHYCRSLRFDDKPDYSYLKRLFRDLFIREGFQFDYVFDWTILKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Casein kinase I-like
publication title Structural and functional studies of casein kinase I-like protein from rice
pubmed doi rcsb
source organism Oryza sativa japonica group
total genus 96
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3sv0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3sv0A01
2W1GA 4UMQA 3KULA 5J95A 3LJ2A 3IPHA 1CKIA 4PMMA 1OKZA 5CAPA 3S3IA 4Y73A 3OTVA 4H58A 4G16A 2ETMA 4GK3A 5M06A 5IA5A 1MRUA 4YLKA 1LR4A 3LFEA 4C8BA 3R6XA 3OW4A 4UEUA 5BYZA 5DI1A 2P33A 1W82A 4B0GA 4UMTA 3ANQA 3H10A 3HMNA 3NUNA 2JIIA 3KU2A 4JR3A 4RIWB 4NM0A 2V62A 5EDPA 4BDKA 1REKA 3AC4A 4XP3A 3N4VA 2O2UA 2W1EA 1I44A 3R28A 5ICPA 4JOAA 4KNBA 3FKNA 4UWCA 3UO6A 2XJ0A 1XWSA 3OP5A 3EQPA 3LFSA 5IA4A 4QP7A 4QMYA 3VUGA 1RJBA 2GTNA 3GVUA 2R3MA 3V8SA 2PMIA 3OT8A 3ZRKA 3OF0A 2WQBA 4IX3A 4F0FA 4IZYA 3PUPA 3KREA 2WO6A 5T6KA 4IVDA 3SG9A 2XUUA 3QQLA 1TKIA 3G6GA 1YWNA 4HNIA 3O2MA 4BWXA 5HE0A 4IFCA 1WBTA 3E7VA 4RZVA 4JQ8A 3ULZA 3VW6A 3IOKA 4I5PA 2XZSA 4PMTA 4QYFA 4UV0A 3RVGA 2PVKA 5HGIA 4DG0E 2BMCA 2IW6A 3EH9A 1XR1A 3DV3A 2CCIA 4MF1A 4RA5A 2GNHA 4C0TA 3E87A 2P2HA 3QZHA 4AWIA 4GKIA 4FVRA 1RQQA 2OJFE 4N0SA 5H8GA 4F9BA 4XS2A 5GIPE 3RTPA 2Y6MA 4HVDA 5I5ZA 4I21A 1VZOA 2ITTA 3PSDA 4XYFA 3PA5A 2OG8A 5A6OA 3FL5A 5HTBA 4Y72A 2VO0A 4OUCA 4QMWA 4RLKA 4LGHA 2XK4A 3LMGA 2UW0A 4H1JA 3LMIA 4D2PA 3TDVA 4B4LA 3FDNA 3WIKA 4EZ3A 2X0GA 3GENA 3HMOA 5AEPA 5IEVA 4D1SA 2WHBA 3K5VA 4AGDA 3PZEA 1LP4A 3P78A 5HO6A 4AP7A 2X6DA 2OLCA 3DK3A 4FG9A 2J6MA 3IW8A 3WE4A 3WF9A 1JVPP 3D2IA 4WG5A 5H8BA 4CMUA 5IEXA 2XKDA 4O86A 2QC6A 5EYMA 2HY81 4LL0A 4M68A 4FV0A 2P2IA 2ITPA 3SV0A 2XP2A 2XNEA 3EYHA 4U8ZA 1CKJA 4YJOA 3UNJA 3ZLYA 4CFNA 3S1HA 4DH7A 2ETRA 3F5XA 2ZYBA 3MH2A 4DE4A 5L2IA 3UE4A 4FV1A 4CGAA 5GIOE 4DINA 5B7VA 3TNHA 4DEIA 2Z7SA 3BV2A 3OCBA 5J1VA 4BR3A 3FV8A 1OPJA 3BGPA 3MJ1A 3ORIA 4FL2A 3G5DA 4I4FA 3T8OA 1GZNA 4C36A 4D4VA 4FT9A 4IXPA 3W8LA 1J3HA 2HAKA 3POZA 2BFXA 4F99A 4FBXA 5CNOA 3SOAA 3ORMA 1XBCA 3DNDA 4FT5A 4YLLA 3CQEA 5K9IA 4DGMA 5DYJA 3DLSA 4FEQA 1UA2A 1OBDA 2XK7A 1XBAA 4FIHA 2W5HA 4RJ4A 4RJ8A 4FK6A 4TWOA 4C4EA 4MBLA 3NYNA 3KMUA 5DRDA 4DITA 3FMJA 4RWJA 5CEKA 2WTVA 3PPZA 4G31A 2R0UA 3VO3A 5BNJA 3DFAA 4C4JA 3L8PA 2PMOX 4BZNA 3V5TA 3QU0A 1PXIA 4WT6A 4RFMA 4ZTMA 3QTSA 3CC6A 3RK9A 3HVCA 4MWHA 4R3RA 5CT7A 4TZRA 3V8TA 2C5VA 5IQCA 2UW9A 3KMWA 5FM2A 4DBXA 4FTIA 4F0IA 4Z16A 1YI6A 4EOJA 2QNJA 2I0HA 4FNWA 2E9UA 2RG6A 2ZMDA 3NUXA 3VJOA 2ZV8A 4FIGA 5LMKA 3VUIA 4BDAA 3NAXA 1CSNA 4EH2A 4TNDA 4R6VA 1JKKA 3GOPA 3BKBA 2UW6A 1JKTA 3IS5A 4YPSA 3BHTA 2XH5A 5DH3A 1KE8A 2GSFA 4OTQA 2WEIA 2OZAB 2EUFB 5AV4A 4DFBA 4KIPA 1RDQE 1U54B 1W98A 4BCJA 3OOGA 4HGSA 2VRXA 3IECA 3GU7A 4NCTC 1IRKA 2PZYA 3PIZA 2VTNA 4FYNA 3F3VA 4TWPA 3VS5A 2ERKA 3TWJA 4R5SA 2VWVA 3QWJA 3SXSA 3ZUUA 4FKTA 4EQUA 4YMJA 4GUBA 4M14A 3RKBA 5F4NA 3TV4A 4LI5A 3PJ3A 4GYGA 4MEDA 3UG1A 2DQ7X 4ARKA 5DFPA 4EONA 2ZV9A 5AUWA 4E4XA 3DY7A 3EN7A 3D5WA 5AV3A 1TQIA 4RJ6A 4GU6A 2X2LA 4D4SA 4D2RA 5GJDA 2WZJA 3KK8A 1QMZA 4EJ7A 2FO0A 2UZBA 4ZTQA 2BR1A 4D5HA 4AS0A 4EBVA 1H4LA 4A4XA 3QCQA 4LOPA 1M7QA 3FHIA 3LPBA 4WKQA 3ZC6A 4O7NA 3VUDA 1REJA 2VGPA 4BN1A 2GNFA 4JBVA 2YDJA 2ITWA 4MKCA 3QTRA 4FEXA 4FL3A 3HZTA 4UZHA 5HD4A 2WU7A 4MXOA 3EQBA 5CEOA 3BYOA 5EHLA 2ZDTA 3M11A 3W33A 1OL7A 5DE2A 1FOTA 4FVPA 2OIQA 4HYUA 4DEBA 4C3PA 2ZM3A 4IAKA 4O0SA 5CI7A 2W0JA 2PVJA 3U6IA 4HOKA 5AA9A 2J0KA 4BCMA 4DA5A 3E7OA 4V0GA 4IADA 4QMPA 2RKUA 5JN2A 1YI4A 2HENA 2WD1A 4FSRA 5LVOA 4RSSA 3I1AA 4YC3A 2CLXA 4IANA 4OTWA 3MVHA 3R7YA 5BVKA 4FSTA 3E8DA 4QP2A 5GNKA 3HAVA 5I9VA 2EWAA 1HCLA 1OL6A 2RL5A 3WYXA 3R9NA 4Z7GA 2FSTX 3BGZA 2XEZA 3NNVA 4MD7E 3QZGA 3AD5A 4FV8A 4RIOA 5CSVA 4KKEA 4IC7A 2R3HA 3KN5A 2B9HA 3KVXA 5E8XA 3DKOA 3R1NA 3SVVA 2C30A 3H9RA 2X7FA 4L9IA 1IR3A 3ET7A 3OY1A 4UWYA 3UBDA 1ZOGA 3CY3A 3SX9A 3WF8A 4QMQA 3ORXA 2IPXA 5CYIA 2C1BA 4LG4A 2J5FA 3P5KA 5TR6A 1JPAA 4TWNA 2WMVA 4G3GA 5I9ZA 4TW9A 3JVSA 1H8FA 2BFYA 5HIBA 2AUHA 2HWPA 4PDSA 4FNXA 2WELA 4G9CA 3FXXA 4IW0A 4IX6A 2XIYA 1MP8A 5DG5A 5C8MA 2IVTA 4HYSA 3Q4CA 4XNEA 4XOZA 5H9BA 4DH8A 3GC7A 1WVWA 1KV2A 4QO9A 4FKUA 4YJNA 2F7EE 3UG2A 4CYJA 3QD3A 1KOBA 3A7GA 3ZDUA 4QQTA 4TY1A 3R8ZA 3U4WA 1YWVA 2B9IA 3IDBA 5KMOA 1OUYA 2OJJA 1HOWA 4HZSA 4YHTA 1KE9A 3EFKA 1PXMA 5AR8A 5E4HA 2A1AB 2OIDA 4FF8A 2VV9A 2F9GA 3FQSA 2JKMA 4ZOGA 3ZFMA 5AP6A 3E63A 5DR9A 5E1EA 4C4FA 2VTJA 4DEHA 4U0IA 3GCSA 3NYOA 3R73A 4J71A 4JG7A 4KS8A 4OBOA 5HG8A 2Q0BA 4BY9E 5HORA 5A9UA 4MK0A 2HIWA 4QYYA 3ULIA 4BCFA 5DR6A 2X8DA 4ZMFA 4N6YA 2C1AA 4BVUA 1DAYA 2ZAZA 4C35A 4D4RA 2SRCA 3EOCA 5K4IA 5K0KA 1MQBA 1V0PA 5EOBA 4YHJA 4YZCA 3N4TA 4ANLA 4IX5A 3EQRA 1YHSA 4O2PA 4BRXA 3EJ1A 1WVYA 3CEKA 1KE6A 3AC3A 4QMVA 4ZY6A 3MFRA 2JKQA 3WZDA 1MRYA 1WBWA 3LVPA 3AG9A 2Y9QA 3QRIA 3POOA 4UYNA 5LOHA 2PE2A 2E9VA 4HYHA 4CFFA 4G17A 3BLQA 1YHVA 3I6WA 5M08A 4J8NA 1H01A 4NUSA 4O7TA 2J50A 5CSPA 1SNUA 4R7HA 2JKOA 5D1JA 3KVWA 3DDPA 2BRHA 1HCKA 3UP7A 3PIYA 3RPVA 3KEXA 3ORZA 1F5QA 2UVZA 3T9IA 3UVPA 4YNOA 3HGKA 3HV4A 3VF9A 5LXMA 2XNNA 5E9EA 2JD5A 5CWZA 2R3NA 3AT3A 3BRBA 3NIEA 5FM3A 2CNQA 3PXQA 5FXQA 3DK6A 4FKQA 3ZSIA 4O0UA 3ZO3A 4TYJA 3HP5A 3LLTA 2R4BA 3ORKA 4EL9A 4GK4A 5JSMA 5IUIA 3F2AA 3WARA 4FSYA 4CLJA 5C8KA 2IVVA 1GAGA 3FMMA 3F69A 2VTHA 3BZ3A 1FGIA 3CS9A 3FAAA 3OWPA 4D5KA 1ZWSA 2C3LA 4FTKA 2BAKA 4KWPA 3TG1A 3KRXA 5AP0A 4PWNA 4EC9A 3KF4A 4BDHA 4EH3A 3CGFA 4MCVA 4TXCA 3PXRA 5AP3A 5I9XA 5H8EA 3CJGA 3WOWA 3I7BA 2WOUA 1WBSA 1Z9XA 4WNOA 3FBVA 4FV2A 3AXWA 5E8VA 4NJ3A 3BLRA 2CNUA 1BL7A 4RIYA 1PF8A 3AMYA 3JPVA 4QNAA 4AN3A 4XV3A 3TIYA 3CD3A 2ZB1A 3BQRA 5C1QB 4D9TA 4D1XA 1SYKA 4MVFA 2CKOA 3DB6A 3EN9A 3Q9ZA 3NCGA 3VN9A 4I5HA 5AM7A 2IN6A 3BEAA 2W1CA 4BYIA 5LQFA 4BGQA 5J5SA 4AOJA 1YOMA 5CVGA 4DF3A 3IW6A 4XJ0A 2FVDA 3UC3A 3HV7A 4ANMA 4LL5A 4FSMA 4RQKA 4GFMA 4YR8A 4IQ6A 3EWHA 1ZMUA 4RIXB 5AV0A 2OZOA 4CG8A 4L44A 4U79A 4I3ZA 2YERA 1XJDA 1LPUA 2CDZA 2F7ZE 4XP2A 2CMWA 1DAWA 3KCFA 2OXYA 3VS0A 3EL7A 3R0TA 3OROA 3VIDA 5E8YA 4BBMA 4IB3A 4GW8A 4DC2A 5ANJA 2PE1A 2C5NA 4JQEA 4ZSAA 1IAHA 3OFMA 4X3FB 3GCPA 4IAZA 2PU8A 3PRFA 1I09A 3HA8A 4O6LA 2HCKA 2YACA 3FY0A 1M14A 2I6LA 2YIXA 3ELJA 4M97A 4FNYA 4XG6A 1GNGA 3B2TA 3ORTA 4X2KA 3HL7A 4J96A 4AF3A 2HELA 4CFXA 4YTFA 2C6DA 4YC8A 2VTMA 4ORKA 1U5QA 3EQIA 3S00A 2F7XE 4EK4A 4D58A 1MUOA 5HEZA 5TO8A 4ASEA 4H39A 4RGJA 3F82A 4DFLA 2Z7RA 4WHZA 4FUXA 5E8WA 5FTGA 3OW3A 3QQKA 2W05A 3SDJA 3QF9A 4IJ9A 5AJQA 2OI4X 2VN9A 2BILB 3JVRA 2P55A 2XA4A 3KXHA 5BVOA 4RVMA 3VQUA 3PYYA 3W55A 2JFMA 2C3JA 2R7BA 2HOGA 3NNWA 5TF9A 3LQ5A 3VUTA 2EB2A 4USEA 5IEYA 3TM0A 5AA8A 3PG3A 4USFA 5CEPA 5LMBA 3GI3A 3AMAA 3HRBA 4QMUA 4O7WA 3RP9A 1STCE 4C02A 4BBEA 4XBRA 3OEFX 4HGLA 1XH6A 4YTCA 5A4CA 5CSHA 4U7ZA 2OICA 5AX3A 3MS9A 4KABA 4ZP5A 5CXHA 3UIUA 3LQ3A 4QYEA 3PY3A 5KHWA 3JXWA 4BL1A 4YTIA 2LAVA 3IW5A 3KB7A 3QKLA 3BU6A 1UU3A 2I40A 4BGGA 4DFNA 3OTUA 1SVHA 4ZIMA 4AE6A 5AUZA 4CYIA 2C3KA 3FKLA 3G9LX 3MW1A 2C3IB 3RAIA 2AC5A 3RWPA 5L4QA 2OJIA 4F4PA 3R01A 2VTPA 2J4ZA 2EU9A 2QR8A 2B52A 3KFAA 3QGYA 5DBXA 2VWYA 3NW6A 2ZM1A 3BE2A 2WIHA 4DN5A 2JAVA 1H00A 4J95A 3MBLA 1M2QA 2QOFA 3OBJA 4CMTA 2W4KA 3RAWA 4CFUA 1RE8A 2GMXA 3GCVA 4ACDA 3FYJX 5CLPA 4Y46A 2ZM4A 3DJ5A 4K18A 5HHWA 1UWJA 4G2FA 1ZOEA 2QHMA 5E8SA 2JBPA 3SD0A 3ATSA 4DH5A 2V0DA 2PVYA 4F6SA 4YTHA 3ZZWA 4RMZA 4M0ZA 4UMUA 4L3JA 4CD0A 5I3OA 3BI6A 4PL3A 5TT7A 4GG7A 3NUAA 4HGEA 3CTHA 1GZOA 4G1WA 5LWMA 4Z9LA 3Q2JA 2X2MA 2OJ9A 4L3PA 4Y83A 1XH4A 2G2IA 3TL8A 5JGDA 1OZ1A 4FKLA 4FIJA 4F65A 2DUVA 1MRVA 3W2PA 4O0XA 2W1FA 5FD2A 3UMWA 5KO1A 2G01A 3FQEA 2HWOA 4FTOA 3RINA 5LVPA 4F1MA 3RPSA 3F9NA 4FTAA 4WSQA 5CF6A 3EIDA 3F6XA 4QD6A 4ZSEA 4WRSA 2GS6A 2PZPA 4JXFA 5GJFA 2VO7A 2UZWE 3DK7A 1OGUA 3Q6WA 5EFQA 5IQHA 2R7IA 3PE1A 5LMKC 4E6QA 4JX3A 3R71A 4FG7A 2PK9A 2WFYA 1WBOA 3CPBA 1XHAA 4S32A 4FIFA 4CXAA 3LFCA 1L8TA 4GRBA 2ONLC 5IG1A 3BYSA 4EHGA 2QO7A 3KRWA 3MB7A 5E92A 3AGMA 4BDBA 1PYEA 3MY0A 3GQLA 3CR0A 3ZC5A 2UZNA 4EZ7A 3G33A 2VUWA 2R3QA 1G8AA 3NUPA 1M2RA 3DT1A 2W4OA 4ZEGA 2EXMA 3RNIA 2A27A 4QPMA 2DYLA 3DBFA 3II5A 3LFAA 4U40A 4A9SA 3FC2A 4QPSA 5B0XA 3L9NA 5AP2A 4B8LA 5HG9A 3N4UA 1W8CA 3CCNA 4NM5A 4ALWA 1CDKA 5HTCA 3QTZA 3D7TB 4F1OA 4IHPA 3V51A 4N6ZA 4ASDA 3MPMA 3GU4A 3FY2A 5DHJA 3U9CA 4NW5A 2G9XA 5L2TA 2CNVA 3UNZA 4UXLA 2WXVA 4FV4A 2O3PA 1FQ1B 2R3GA 3HA6A 3RHXA 1PMNA 2BZHB 3PFQA 5CEQA 2WIPA 4M8TA 4P2KA 4G6LA 3Q4ZA 4ZTRA 3UQFA 2W1ZA 3CE3A 3QYZA 1O9UA 3IW4A 3BQCA 5HLWA 2QHNA 4XHKB 3BWFA 4GL9A 3P08A 1YQJA 4JX7A 4YJUA 5AAGA 3R8MA 2CSNA 4IJPA 1ZY5A 2VZ6A 2YFXA 4GSBA 4NU1A 5CZHA 2GNGA 5HE1A 3A4OX 2H8HA 5GINE 4M69A 1Y6BA 5CVHA 4MQ1A 5EM8A 1CMKE 4ALUA 2BHEA 4F1TA 3QYWA 5IH6A 3S0OA 1QPEA 3HECA 3VW8A 4HVHA 2J90A 3I5ZA 4FZ6A 1YHWA 3MVLA 1R0PA 4RWLA 3T3VA 5HNIX 4I23A 1K9AA 4DGNA 3P86A 5EI8A 1K3AA 4FSZA 3FEGA 1PW2A 4ZZOA 2KULA 2BPMA 2C0TA 2R64A 1IA9A 3WZJA 2J7TA 1GIJA 3M2WA 4UWBA 4PDYA 4X2JA 2Z8CA 4S33A 4JNWA 5EW9A 3VBVA 1E1XA 2W06A 3ZHPC 4PPAA 2C5XA 4DEEA 2NPQA 3KRLA 3DBDA 3ZCLA 3UZTA 4GJ3A 3AOXA 4TYHA 1OKYA 2YJSA 4M3QA 3AC1A 4JBOA 2I0YA 1T46A 5IF1A 3D94A 4M67A 2YCRA 3A62A 5HOAA 2GCDA 5CEIA 4LYNA 3SRVA 3Q53A 4W4XA 1Y91A 2JIUA 2ITVA 3SXFA 2W9FB 2BRNA 4OLIA 4MD8E 2ESMA 3UOHA 5H3QA 4QP3A 4J8MA 1L3RE 2XNBA 4K8AA 4OW8A 4F6WA 3DCVA 4HNFA 3HX4A 4MTAA 4O84A 3IG7A 5KBQA 5EYKA 3KULB 3OD6X 5CZIA 3ODZX 3D83A 3DZOA 4F08A 4GKHA 2UV2A 4X2FA 4XG3A 5DT3A 2GHGA 4WNKA 5I4NA 4B6LA 4R78A 3ZOSA 4FSUA 2JKKA 3SLSA 3SKCA 3Q9WA 4I92A 4XG7A 4FTTA 4QMZA 4CZTA 3RPYA 3KMMA 4RJ7A 3CD8A 3FQHA 3FZPA 4ITIA 3OWKA 5C4LA 3PXFA 3FLSA 1WBNA 4XG2A 5L6WL 4KA3A 3CTJA 5KMNA 1UV5A 5CASA 1FMKA 3GB2A 4L7SA 5CU2A 4RQVA 3DLZA 5EI2A 5HI2A 3ZH8A 4ENYA 1KSWA 5CXZA 4PDPA 3D2KA 3TIZA 4B7TA 4QMNA 3UGCA 4GS6A 3PPKA 5M4FA 3NVKI 3GC0A 3VS4A 4LRJA 4E6AA 2ITQA 4OAVB 1EH4A 1U5RA 2YM5A 1CKPA 3EQGA 4R5YA 4BCQA 1NA7A 5IQAA 2H96A 3VJNA 4M7IA 3UQGA 1P14A 1B39A 1TQPA 3LOKA 3E8EA 3E8NA 3RCDA 4CV9A 4PX6A 2QCSA 3BYMA 5BQ0A 4PP7A 3MH1A 4QP9A 2PWLA 1J7IA 1ZRZA 5FTQA 5DIAA 4QTDA 3KA0A 2OH4A 4BCHA 3QBNA 5L8JA 2I0VA 5EHOA 3A8WA 4YJRA 3LLAA 4MX9A 2VWXA 3LE6A 5KZ0A 4WBBB 3FZSA 1WCCA 3E5AA 2YM6A 2F57A 3GOKA 3R2BA 3AC5A 4L43A 2H6DA 1OBGA 3QUPA 3A4PA 4IVAA 4LRMA 2YWPA 3GXLA 4RX8A 4DAWA 5FDPA 4XMOA 4FNZA 4AFJA 1PXOA 3RM7A 5IH4A 2HY0A 2W1HA 5AADA 5AUVA 1J1CA 2X6EA 3FPMA 3FKOA 4QMLA 5JGBA 4OT6A 1KWPA 4IM0A 5KHXA 4YP8A 3BHHA 3CKXA 2A19B 3V3VA 4TYIA 1PMEA 1UNGA 4EZ5A 3MIYA 5EDQA 3KXXA 4CFMA 5ANDA 3UPXA 4LMUA 4M15A 4FKIA 4BC6A 1APME 2FH9A 5FBNC 1B38A 5IQDA 3O7LD 2IWIA 3N51A 2WMQA 2XEYA 4DFYA 2HW7A 3R9RA 2BRMA 3T9TA 3IDPA 4O0RA 4I5CA 2Q0NA 2R3FA 3LCDA 3E8CA 3R8VA 3O71A 5DPVA 5JFWA 3R8PA 2G2HA 1GIHA 1IEPA 2F2UA 3ERKA 4J1RA 4JI9A 4U44A 4FL1A 2UVYA 3LM5A 2RIOA 4E73A 3FUPA 3EN4A 1J1BA 1H1PA 3H9FA 1FVTA 2UZTA 2UZDA 1PXJA 3AGLA 2BAQA 1XQZA 3LAUA 3JY0A 3Q32A 4FV9A 1U54A 4FVQA 5EYCA 4C3FA 2XM8A 4DG3E 5ACKA 3TUBA 5AP4A 3H0ZA 5CU4A 5GJGA 2B53A 2ONLA 3CQUA 4PF4A 3BHYA 2J2IB 3QGWA 2DWBA 3KCKA 3QXPA 4I22A 3FMEA 4BDEA 5FGKA 2QQ7A 1BLXA 4A4LA 3KC3A 2QONA 2XK3A 3T3UA 4Z7HA 2XKFA 3F2NA 2X7OA 5HICA 1Q4LA 5C4KA 2IZRA 2W1DA 3PLAE 3M42A 3VS2A 4NIFA 5FTOA 3QZFA 4OTPA 2XF0A 4RLLA 3FLYA 1UNLA 3QFVA 1FVVA 3C4WA 3HV6A 1R39A 3EFJA 3OHTA 5ETCA 5E91A 2ZV7A 2QO2A 3BX5A 2Y4IB 3JR1A 3C5IA 5KKRC 3ZRMA 1PXPA 4V04A 2BZKB 2NO3A 3U8WA 3A8XA 5M4CA 4R8QA 1ZYJA 3BCEA 3SG8A 5HIDA 4PRJA 4B9DA 2JDSA 3V5PA 5J9YA 5L2SA 3P7CA 3UQCA 5B2KA 1ERKA 3HRCA 3PE2A 3DU8A 4EJNA 2PULA 4D55A 4ZMEA 2UW8A 1ZMWA 3F2RA 2BRBA 4Z55A 4ZY5A 4XCUA 4O7YA 2OSCA 2BRGA 1Q8YA 2C6LA 3CJFA 5LCKA 3RBWA 4RBLA 3UOKA 1PYXA 4HZRA 3UIXA 2Z7QA 3OVVA 5JZNA 2W17A 2JITA 4K77A 2VTOA 1NVQA 3SOCA 3K3IA 4TN6A 4BCKA 4L7FA 1OM1A 4CTCA 4U41A 1YOJA 4O7VA 2UZUE 2YHVA 2BALA 3R83A 1PXLA 3O8UA 3BV3A 2R3RA 4ERWA 4FKSA 4PTEA 4EOSA 3A60A 4FSNA 4AT4A 4BWKA 1YDTE 3E62A 4D4YA 3DJ7A 4M84A 3QTUA 3UJGA 4MXAA 3TACA 3ZRLA 4CNHA 3SHEA 5CF4A 2OIBA 2V7AA 3DTWA 5HNGA 2YM4A 4AX8A 3TDWA 4RC2A 2HK5A 5A4QA 4JT3A 4BI0A 3BBTB 4JRVA 5GHVA 2QOHA 4XV9A 2X8IA 4IC8A 5C9CA 4FTLA 2GHMA 2WTIA 3FPQA 2F4JA 3NW5A 4TYEA 2WTCA 4C2WA 3A7HA 5AUYA 4AZTA 3UO5A 2RGPA 3ZBXA 4P5QA 2VAGA 5EKOA 5BVFA 4FKGA 5CAQA 2VWBA 4AW2A 4GVJA 4JDKA 4FTNA 4G9RA 5L6PA 4IAAA 2XB7A 2O8YA 3UZPA 1UKHA 1G8SA 3V5LA 3R7VA 2UZEA 4YJVA 3ZM4A 2QU6A 1OL5A 2RG5A 3LM0A 4JLCA 5L2QA 3K2LA 3ZLXA 5L8LA 2XCHA 1GOLA 3RCJA 4O7SA 4R7BA 5M51A 3FZ1A 1GY3A 1QCFA 4W8DA 1BUHA 5EM6A 1H28A 2AC3A 2BTSA 3MH0A 3QRUA 2OU7A 2VTLA 1UKIA 3PJ1A 4OR5A 2IW8A 1OMWA 3W2SA 4R1YA 4BYJA 4ZZNA 4ZAUA 4QMSA 1OI9A 1O6YA 5CS6A 2XNOA 3REPA 2BIKB 3JY9A 4BB4A 4O2ZA 3NYVA 4MHAA 1BL6A 4QQJA 5IQFA 5CSXA 3FSFA 4G3DA 3SW7A 4WUNA 4JAJA 2IZUA 3ZLSA 3R7UA 4BIEA 2ZMCA 5E1SA 2XK9A 4FZFB 2JDRA 5FEEA 1BI7A 3DBCA 3FJQE 3ZZEA 3UOJA 4O7LA 2HW6A 3C0IA 4NKAA 3PJ2A 5L8KA 4BFMA 2O64A 4IEBA 4D0WA 3EZVA 3MSSA 3B8QA 4NTTA 3LFQA 3LCSA 1T45A 4ANSA 1XH7A 4JS8A 2IW9A 3FLNC 3GGFA 4QTAA 3KK9A 1Q62A 5IA1A 1WZYA 5KMLA 1U59A 4OAUC 2BCJA 1YXUA 1IASA 2WTKC 2J0IA 4MXZA 4L01A 4ZLOA 2YAKA 3D0EA 1ZYDA 4YHFA 5A6NA 5E8ZA 4AZWA 3FHRA 3BYVA 1F3MC 1ZZ2A 3H4JA 2Y8OA 5DWRA 1ZXEA 4YO4A 5A14A 3TN8A 4O0VA 2XJ2A 5LVMA 4XP0A 3UP2A 5JGAA 4NL0A 5F95A 3Q04A 5F9EA 3FLWA 3GUBA 3ZONA 3CSVA 4LFIA 3RPOA 3CXWA 1PRYA 5AUTA 1Y8GA 4AGUA 5CANA 3BHVA 4O0WA 1TQMA 4W9WA 4ZZMA 2QVSE 3NRMA 4YJTA 3DBEA 2HZ0A 2QODA 3HMPA 4F7NA 4XRLA 3AC8A 4FTCA 4EYMA 4YPDA 3VBXA 4BKZA 1ZAOA 5HKMA 4I93A 1OIUA 3OY3A 4G6NA 5IA0A 1JQHA 5CQWA 5CF8A 3EHAA 4O1OA 3L1SA 4AA0A 2WMSA 3PP0A 3NUYA 5HCYA 3P0MA 4UBAA 2J5EA 4TT7A 3NCZA 4W9XA 4C7TA 5HQ0A 3QRKA 5CNNA 2XRUA 3MN3A 4IDVA 2PVMA 3EB0A 4S34A 5CENA 2BZJA 4GCJA 4I1ZA 4FGRA 4MBJA 4AN2A 3C7QA 5IISA 3MY5A 4NM3A 3VS3A 3DZQA 2WQNA 3KL8A 4ANQA 3MIAA 4CEGA 2ITOA 2WQOA 4RRVA 5IDNA 3O51A 2XYNA 4FKJA 3V6SA 3LCOA 3WF6A 4D28A 5AUUA 3D9VA 4IWPA 4CKIA 4CRLA 4BF2A 3O7LB 2W1IA 4EWQA 4GIIA 1KE5A 1YXTA 4LUEA 3SXRA 2BZIB 3TKIA 4DEGA 5ETFA 4DYMA 1CM8A 5M56A 3ZYAA 3W16A 2BUJA 2EVAA 4QMTA 4QOXA 4XLIA 4JR7A 5FXSA 3ZDIA 5LJJA 1Q5KA 5AR5A 3TV6A 3HP2A 5J8IA 3LW0A 5JKGA 2B4SB 3LKMA 2JAMA 4UZDA 4FKRA 3D4QA 2XJ1A 2CN5A 3A61A 2YABA 2C6OA 3PWDA 5EOLA 5C26A 3Q4UA 1H24A 4AN9A 2QG5A 4H3QA 2R5TA 4ITJA 5CU3A 3W2OA 4CT1A 3HAMA 2B9FA 2UVXA 2VO6A 2YJRA 2PE0A 1P4OA 1JWHA 3CBLA 2QOBA 4RT7A 4Q5EA 4TL0A 3P7BA 4DT9A 5I9UA 4CLIA 2GTMA 4QNYA 4XV2A 4HPTE 2R3KA 4PMPA 3GT8A 2GFCA 2PPQA 2LGCA 4X3FA 4ZTHA 4DGGA 2YDKA 4ITHA 1VR2A 3NW7A 2VTSA 3QKMA 3NYXA 2JDOA 4WUAA 2QI8A 1Q41A 4JAIA 4GT5A 5E8UA 3B2WA 4AU8A 4BIDA 4CCUA 3DJ6A 1QPCA 3OUNB 2YCSA 3ZEPA 4R3PA 3O8PA 1U4DA 2IG7A 4AT5A 3BYUA 4DT8A 4CG9A 4EYJA 3Q2MA 2PUUA 1JNKA 3CLYA 1KE7A 2WNTA 3CGOA 3V5JA 1YOLA 3QC4A 1ZYLA 3EQCA 3PSBA 3R7GA 4L45A 2XIZA 4I41A 4DEAA 1NVSA 3MFSA 3QWKA 3BHUA 4HCTA 3ORNA 4MNEA 2YIYA 2FSMX 5CT0A 4IAFA 3IK3A 4E1ZA 3PDTA 5EQPA 3LFNA 3MWUA 3R63A 4EK6A 3D5XA 4K2RA 4EQCA 4MYGA 4DTBA 4BWPA 4P90A 4CT2A 4YJSA 4C4HA 4EOLA 5JFSA 4PNKA 3TZ7A 4O22A 1YXSA 4UMRA 4DCEA 2GFSA 3ALNA 3NEWA 3C0HA 5EQEA 4EH6A 5D10A 4BDFA 2ITXA 4H3PA 4OBPA 4AQCA 3UTOA 4BCIA 3Q4TA 4OGRA 5JK3A 1H1RA 4DFUA 3QRJA 4FIIA 3W10A 2XBJA 2YCFA 1V0OA 4ACMA 1JSTA 3TKHA 3OXTA 1SNXA 4EHEA 2OXDA 1CTPE 1XH8A 4FYOA 4E5BA 5M57A 3LIJA 5HX8A 3R7EA 4IACA 3QALE 1OVEA 3OG7A 2PL0A 2P0CA 5AFVA 2W4JA 4G3EA 3OXIA 4A07A 3QTWA 4I20A 5HESA 4F7LA 2QU5A 4D0XA 3I0QA 5K3YA 4ZS0A 3V5QA 4BCGA 3HEGA 3QQHA 2DS1A 2WMWA 3D15A 3ENHA 4MXYA 5IA3A 1FVRA 2R0IA 1NY3A 4E3CA 2R2PA 1JLUE 1ZZLA 3Q96A 1O6KA 3R1QA 5TKDA 5A4TA 3F3UA 4H3BA 3DS6A 4NW6A 4Y95A 3ORLA 5FBOA 3TNWA 1TVOA 3DKGA 3ETAA 4BCPA 2PVRA 4DH1A 5DLSA 4TNBA 2UW3A 3HV5A 4E8AA 1R1WA 1Z57A 2OBJA 1W84A 2YITA 3OCGA 2YZLA 3BE9A 3QLGA 3F61A 3L8VA 2GU8A 5A3XA 4ERKA 4EC8A 3RAHA 2Q83A 1JOWB 2R3IA 1VYZA 4GV1A 4YGAA 3FMNA 3I7CA 4ZSLA 3SW4A 3UYTA 3LXKA 4FSWA 5JT2A 1JBPE 1AQ1A 3C51A 4HVIA 5AR2A 4OT5A 3WYYA 2PZIA 2VU3A 2W96B 4F09A 2H34A 4BI2A 5HTIA 4IAYA 1OIQA 3FMDA 4I6FA 3TJDA 4DEDA 4BHNA 4J52A 2XS0A 4QPAA 4AOTA 2OW3A 5EM5A 4KIKA 2ITUA 5FQDC 2BKKA 4Y5HA 2B55A 2C0OA 4IDTA 1VJYA 2A0CX 3I4BA 3VHEA 4FODA 2RF9A 1OECA 2RSVA 2CGXA 1UWHA 4XG8A 4A9RA 5LVNA 4G34A 2G2FA 3A7FA 3GCQA 4FGBA 3CIKA 1BMKA 5GZAA 4UYAA 4AZSA 3WIGA 2FB8A 5FP6A 3I81A 1KV1A 2XK6A 4ID7A 3DNEA 4KSQA 3R8UA 3TZ8A 2VTAA 2R3JA 4J53A 3Q9YA 4L00A 5DEYA 4X7QA 1SVEA 3C1XA 3GP0A 4ONAA 5T3QA 1G5SA 2WQMA 4KRCA 4O0YA 3EYGA 1BX6A 3P23A 4I0SA 4G3CA 4GYIA 2PVLA 3KKVA 1R78A 4EUUA 3LCTA 1PKDA 3LMHA 4YZ9A 4NT4A 4P7EA 2C6IA 4H1MA 1YI3A 1XH5A 3TZMA 5BUIA 1X8BA 4O81A 4YJPA 2QO9A 3QAME 4P4CA 3ZXTA 2PYWA 2X2KA 4FG8A 4MQ2A 4CVAA 4EK8A 3PZHA 3QTIA 3FXZA 3TT0A 3WZKA 4A9UA 3VUHA 4IVBA 5CAOA 2WMXA 2GNLA 3OWLA 2PVFA 3OC1A 4BCNA 3VHKA 2PY3A 1Y6AA 2BAJA 3HMMA 3BGQA 4MBIA 3UOLA 3C0GA 3R7IA 1H07A 4D2WA 4L3LA 1H25A 3ZEWA 4EKLA 5K0XA 4U5JA 2UW7A 3ANRA 3LXPA 5LVLA 2E9NA 2CKEA 3UMXA 4FV3A 5CALA 1PMUA 2A2AA 2YCQA 2R3OA 4PL4A 2HXLA 3FC1X 3COHA 4F70A 2WKMA 2IZSA 5A54A 2C5YA 2B1PA 2JIVA 3O17A 5EKNA 3HV3A 1Q97A 4FTUA 2IVSA 3ODYX 4C34A 1K2PA 4CZUA 4E20A 4E5WA 4ZJJA 5KUPA 3B8RA 4PTGA 4CRSA 4I94A 3MJ2A 3GEQA 4IWQA 4DHFA 4F6UA 4GK2A 4OTDA 5IQGA 2BVAA 3GQIA 1M52A 3DAEA 3ITZA 3PLSA 5EW3A 1OKVA 2BROA 2XNPA 2UW5A 1FMOE 3TZ9A 3R9DA 4HCUA 1AD5A 4YSJA 5CSWA 1WBPA 3EZRA 4I6QA 1OL2A 1WVXA 3GNIB 3PXYA 4NH1A 5HVJA 2G1TA 5ETAA 2IO6A 1YW2A 2XMYA 3H3CA 2C68A 3PVBA 3QCXA 5EDRA 4C33A 1GIIA 4RIWA 3LCKA 4W4WA 1ZMVA 1NT2A 3MPAA 4E6DA 4EWHA 4EUTA 2B7AA 3BWJA 4AFEA 3GU6A 1A48A 2XKCA 3A7IA 3PG1A 4YZDA 4TWCA 3R00A 4E5AX 1AGWA 4BDDA 2Z2WA 2RFNA 2OGVA 3OOMA 4LOOA 2W99B 4F9YA 2C5OA 2VD5A 4PY1A 3D7ZA 4QP4A 4W4VA 3WILA 1Z5MA 2HZIA 2WTWA 4DLJA 1WAKA 3E92A 3G0EA 4DTKA 4UY9A 2GS2A 2C6MA 3MDYA 2GDOA 3AT2A 3OCTA 4AXAA 3ZSHA 3PXKA 3IGGA 1LEWA 4NSTA 3QRTA 4YC6A 2XYUA 5I9WA 4LGGA 3HUCA 3ROCA 3U87A 4IH8A 1XBBA 4FTMA 5BVEA 5A46A 5KE0A 5K5NA 4O82A 4L53A 4QMMA 3RGFA 4M69B 4LM5A 2QOIA 4ZK5A 1LUFA 3UZRA 3FXWA 4C3RA 4C4GA 4U80A 3PWYA 3G0FA 3C13A 4DGOA 1JAMA 4B99A 4RX9A 1IAJA 2FSOX 4HCVA 3QTQA 4XLVA 4QP8A 3NGAA 3RM6A 3EFWA 1UU7A 1QL6A 4S30A 4F7JA 3H30A 2HZ4A 3UVQA 4C38A 5LCJA 1J91A 2W9ZB 3Q60A 3H0YA 3R21A 4TRLA 3RK7A 5IA2A 5CI6A 3CQWA 3IDCA 4FSQA 5EI6A 4ANBA 4D2TA 4BI1A 4GJ2A 4U3YA 3UNKA 3FZOA 1FGKA 2JGZA 3CY2A 4K11A 1Y57A 2O63A 4IZ7A 5DN3A 3RPRA 2YIWA 4JDJA 2QKRA 2AYPA 5ACBC 2WMRA 3TI1A 3BELA 3HMIA 2YDIA 4TYHB 3OS3A 5B2LA 5K5XA 2PZ5A 5BVWA 5EK7A 5E90A 3BU3A 4FTQA 3FI4A 3EQFA 5BPYA 5BYYA 4GT4A 4J98A 4XH6A 3DAJA 2QKWB 3AQVA 3SRVB 3IO7A 2XVDA 3P1AA 1OPKA 4B8MA 5AAEA 1UNHA 5KCVA 1OUKA 4TTHB 1PMVA 2FA2A 4IIRA 4AGWA 2B54A 1Q24A 2V5QA 4IB1A 4I0TA 3P9JA 3SQQA 4OTFA 4M12A 3Q3BA 3OXZA 3R2YA 5F1ZA 3TNPC 5ETIA 3QL8A 4ACHA 2YIQA 1PJKA 4NZWB 2IZTA 4KSPA 4FV5A 3TXOA 3E64A 3K54A 2QLUA 3P4KA 4E93A 5JZJA 2PMNX 2WB8A 2ZOQA 3O8TA 4L52A 5CTPA 5F20A 3OEZA 3W2RA 3F5UA 1WBVA 2WMUA 5EHYA 4U42A 4H36A 3FZTA 3IONA 4C62A 4JIAA 4W4YA 1M2PA 1OPLA 3L9MA 4FV7A 1OITA 4K0YA 5EH0A 2GS7A 2VNYA 1URWA 2JDTA 1W0XC 1E9HA 3NX8A 4U45A 3C4EA 4WA9A 4XOYA 1DI8A 5KMJA 5HE2A 5JMSA 4NTSA 1BYGA 3MA3A 4WO5A 3NPCA 5FEQA 2JC6A 3NUUA 4GU9A 4QYGA 2X7GA 4O96A 4FT3A 3FMLA 4AT3A 4NFMA 5FWKK 2QLQA 4EOMA 5ANOA 3OBGA 4P5ZA 4O6EA 3ACJA 3HNGA 3OCSA 3U4UA 4JVGA 3GU8A 3LFFA 4Y85A 3ZFXA 4EOIA 4F9CA 2XIRA 1W7HA 3S2PA 3GFEA 2XM9A 5B2MA 3PA4A 3PVWA 1NVRA 4FUYA 2OKRA 4CZYB 4RC4A 3OMVA 4FKPA 2VX0A 3LZBA 2HYYA 5JQ8A 5AIRA 4RX5A 5HIEA 3MYGA 4LV5A 5CX9A 4EH5A 4CSVA 2GQGA 3RZFA 2PUNA 3KF7A 4MF0A 4PQNA 1RW8A 2WTJA 5FEDA 3UIMA 4LRKA 3WZEA 5CU0A 3FE3A 4V05A 5D12A 3VRYA 3HDMA 2YEXA 3G9NA 4QP6A 4E4MA 2UZVA 1VYWA 3F88A 2UUEA 2VTTA 2YA9A 2ZDUA 4TKSA 4QTCA 5ANKA 5HX6A 4I6HA 2J51A 2WOTA 2XNMA 4N70A 3ZO2A 2RFDA 2OZAA 4YSMA 3O0GA 3QCSA 4C37A 4KBCA 5C8NA 3QA0A 5IUHA 4ASZA 5HLPA 1F0QA 5A4LA 4AACA 4FR4A 4KAOA 1SMHA 2E9OA 2E9PA 4ZLZA 3R9HA 5C27A 3BBWA 2I7QA 3GCUA 4U43A 5HG7A 1BKXA 2VTIA 3R04A 3SC1A 4EQMA 5HBEA 3G15A 3A2CA 5AWMA 4I4EA 3NNXA 4FEUA 4A9TA 4JJRA 3EN6A 4BDJA 1Q3DA 3U51A 3ZU7A 2ITZA 3V6RA 4FEVA 5FUTA 2X4ZA 5LWNA 3O23A 4IM2A 4ZTLA 3W32A 1A06A 4JDIA 2FYSA 3NDMA 2XRWA 5L6OA 4M66A 3MVMA 3MPTA 4IWDA 3AD6A 4FE2A 3U55A 1FINA 1SM2A 3G2FA 1SZMA 3BPRA 3I6UA 4IE9A 4QP1A 5D7AA 5EG3A 4PPCA 5AR3A 3W1FA 3EN5A 3OWJA 4X3FC 2NP8A 5IQBA 5DR2A 2ITYA 5HBJA 1A9UA 2VX1A 3EQHA 4BHZA 3TTIA 2X1NA 2PMLX 2XKEA 3FWQA 4IZAA 4QQCA 4A06A 4BBFA 4QRCA 5GZ9A 2CKPA 3MTLA 2F2CB 3OZ6A 2C6KA 1WMKA 3KXGA 2VTRA 3NS9A 2BDFA 4I5MA 4JG6A 4O91A 2J9MA 2WEVA 4PL5A 4XEYA 1J7UA 2I0EA 5HCXA 3IQ7A 4A9YA 5EM7A 4X21A 5AUXA 4EHZA 3EKKA 5M44A 2ZVAA 1ZY4A 3M1SA 4MXXA 4AZFA 2VX3A 4FX3A 2C47A 3E88A 3QTXA 4YURA 4RVKA 2OFUA 4WG3A 4KB8A 5IZFA 1H27A 1BI8A 4JRNA 5DNRA 4F0GA 1R3CA 3DAKA 2W5BA 1XO2B 3KY2A 1NXKA 2X81A 4NIFB 3VULA 4LMNA 4V01A 3GC8A 5HE3A 5G6VA 4DFZE 2JEDA 3MTFA 2WTDA 2OXXA 3A99A 4X0MA 5CVFA 3GBZA 5FP5A 3R30A 5H2UA 3ACKA 3ZBFA 4HVGA 3DXPA 5DT4A 5IDPA 4C58A 3QHRA 5LARA 5IMXA 3UC4A 4ANOA 5DEWA 2XBAA 5BYLA 4I0RA 2GNIA 3VS7A 4GH2A 3UPZA 4WNMA 5HO7A 4DCAA 4JQ7A 4RVTA 1ZOHA 1YVJA 2C4GA 2CJMA 4AG8A 3QQFA 4ZSJA 5AR4A 2VWZA 4X6RA 2C6EA 4WG4A 5FRIA 4EH7A 3E93A 2EXCX 3U6HA 1P5EA 1W83A 1Y8YA 1GZKA 2C6TA 2Y0AA 3NR9A 5T68A 3ZO1A 3MVJA 2X9FA 3D14A 4WD5A 3ZXZA 5K4JA 2ETKA 3QQUA 4NJDA 4EEVA 3TTJA 5IPJA 2X4FA 4IZ5A 4XRJA 1GZ8A 2VNWA 3RAKA 3S4QA 1URCA 3GFWA 4F7SA 2A4LA 2JLDA 3ZO4A 4FK3A 3CP9A 3KXMA 3RALA 3WE8A 4BCOA 3DXNA 4C4IA 5CAVA 1Q99A 1P2AA 2Z7LA 3LJ0A 4JBPA 4FKOA 5J79A 4KKGA 3DTCA 3RWQA 1U46A 5J7BA 2ZJWA 2FGIA 4AW0A 2C69A 4Z3VA 4ZS4A 4L67A 5DOSA 4EHVA 1R0EA 1OIYA 2YN8A 5LMAA 2OWBA 3F3ZA 4JBQA 3EQDA 4F64A 3AC2A 3QX2A 5C01A 4V0GB 3QC9A 2XK8A 4EK5A 3O50A 4XUFA 3C4CA 2BIYA 3RHKA 3DOGA 4MAOA 4BTKA 4KS7A 4HJOA 3RI1A 1H1QA 3QA8A 4O83A 4QT1A 3QCYA 3QQJA 4GIHA 4YZBA 3FZRA 3TUDA 2GQRA 4DBNA 4C57A 4HW7A 3DPKA 4QMXA 4ZJIA 5JH6A 4IB0A 4EH4A 1SVGA 3V8WA 3HLLA 1E1VA 3DDQA 3W8QA 3PJ8A 5BUEA 4R77A 3P7AA 3U6JA 4KIOA 4CQEA 2CPKE 1XH9A 4RVLA 3ZSGA 2ZV2A 3KXNA 4ANNA 3I79A 4EOPA 3VUMA 5AM6A 4D1ZA 3QZIA 3RNYA 4AOIA 4D2SA 2HXQA 5J7HA 1H1SA 4X2GA 4XBUA 1H1WA 4EORA 4D9UA 2ERZE 4BKJA 5M4UA 3NVMB 3U54A 2CHLA 4BTMA 3Q6UA 4U3ZA 3C4XA 4FT7A 2BKZA 4EOKA 2VGOA 4ACGA 5JFXA 4YU2A 1G3NA 3RK5A 4J99A 2EXEA 2Y4PA 3C4ZA 5CAUA 2WPAA 1S9JA 4RA4A 4UXQA 3TV7A 1GJOA 2V7OA 3C4FA 4E4NA 5HU9A 4DGLC 2YWVA 3ID6C 4LOQA 5I0BA 2ACXA 3ROYA 3E3PA 3TJCA 5KMMA 3I5NA 3R1SA 3V01A 2QD9A 2J0LA 4BDIA 3K5UA 3LHJA 2G15A 3MI9A 3ENMA 2YM7A 3QXOA 4FIEA 4FV6A 3F3WA 4UX9A 4Y5QA 3FMHA 4UALA 1ND4A 1ZLTA 5AX9A 1V0BA 2BDJA 4I6BA 5CQUA 3O96A 3D5VA 4FI1A 3KGAA 4KKHA 5JQ5A 4HGTA 4JL9A 5KMKA 5J87A 2OJGA 3QHWA 4OTRA 4GFGA 4YNEA 1JSUA 5D9HA 4DG2E 2ZB0A 5A4EA 2WAJA 4DFXE 3JYAA 4FICA 2QOCA 4O38A 5AAFA 2B9JA 3U9NA 5BVNA 3F3TA 4W8EA 5HO8A 3VBYA 3WZUA 3NZ0A 5HZNA 3FLZA 4CTBA 4ASXA 5L3AA 3NUSA 3JS2A 4PV0A 3QQGA 1YDSE 4S31A 5AP1A 2PVNA 2JDVA 4LGDA 5E7RA 3VQHA 4U9AA 3W2CA 3ZTXA 4PMSA 4C2VA 4E7WA 4WSYA 2IJMA 3QD0A 4Q9ZA 4E4LA 2ITNA 2Z60A 4BGHA 5FDXA 4AZEA 4AW1A 4AGCA 3R8LA 4HVSA 3ZUTA 4CV8A 3HYHA 2UZLA 3H9OA 3VVHA 4KUJA 3Q5IA 3TKUA 5M55A 3FI8A 1QPJA 5IMEA 5TE0A 3E3BX 4WNPA 4RJ5A 1OKWA 2NRUA 5BVDA 4BZDA 2GPHA 5DGZA 3BLHA 3COIA 3F5PA 4FTJA 4NK9A 5HU3A 5KX8A 3ZUVA 4EH8A 4IBMA 4K33A 3ATTA 3HUBA 4E6CA 3UVRA 4CCBA 4F9WA 4AAAA 4UN0C 5FLFA 3QLFA 4AE9A 4NKSA 4R7IA 3BU5A 5IU2A 5HVYA 3EMGA 3ZS5A 1Q8UA 2OO8X 4KBAA 4OTIA 3IGOA 2R3LA 1KOAA 4PDOA 4RIXA 5D41A 3RZBA 4OBQA 3L8SA 3PRIA 4I24A 4QMOA 3VWAA 1UVRA 3LXLA 4RJ3A 3PA3A 3COMA 2BTRA 1YKRA 3KRJA 3LFDA 4RFYA 3DXQA 4HYIA 5HD7A 4MXCA 2WGJA 1PKGA 4TYGA 3DA6A 3F7ZA 3N9XA 3ZMMA 1JKSA 3QKKA 4PPBA 2R9SA 4EOQA 3SA0A 4WRGA 3HDNA 1Q8ZA 3IW7A 3VBQA 3JUHA 3PJCA 3WBLA 1VEBA 5AP7A 3VBWA 2VWIA 5HVKA 3HKOA 2IVUA 4RC3A 4Q9SA 5CY3A 4YZNA 2Y6OA 5AV1A 5I3RA 2YM8A 3PY1A 4YZMA 5L2WA 4NCTA 4L42A 1PXNA 2C0IA 3NAYA 3MFTA 3LJ1A 5D7VA 5EYDA 3R9OA 3TNIA 5M53A 3DKFA 4GT3A 4NYEA 3AT4A 2VWUA 3TEIA 1O6LA 4YJQA 1B6CB 2QOQA 2WU6A 4RIYB 2OF4A 2YZAA 3QD4A 4FZDB 2PSQA 3DFCB 3VC4A 5ANIA 3W18A 4LQMA 4NWMA 5FG8A 3NMUF 5I9YA 3KQ7A 5DT0A 5J1WA 3ZLWA 4MH7A 4BZOA 3FI2A 2JFLA 3BEGA 4APPA 3UDBA 5DMZA 4U6RA 3PVUA 1PHKA 3MESA 4AW5A 1S9IA 1YRPA 4UB7A 5BMMA 3OUKA 3PXZA 4BTJA 1JSVA 5M07A 4G5PA 4DTAA 5KKRB 3EFLA 3MY1A 3LFBA 2OH0E 4OTGA 4U97A 3NWWA 2BHHA 4O27B 4L8MA 2YAAA 4OTHA 3F5GA 2QOKA 4E26A 1ATPE 4M0YA 1YWRA 5IH5A 1Q8WA 1M7NA 5HBHA 1OB3A 2CLQA 3DBQA 2BDWA 4BKYA 4PTCA 4QTBA 4KD1A 3PPJA 4LV8A 5DRBA 2REIA 4IAIA 2O65A 3LQ8A 3FSKA 3WF7A 3MFUA 4ZLYA 3QX4A 3LXNA 5TOZA 4KBKA 3V04A 4HPUE 4IWOA 3PP1A 2X8EA 2F49A 4D2VA 2XNGA 4J97A 2PHKA 2XIKA 2RFSA 5JRSA 4EH9A 3FI3A 3ZM9A 5D11A 3FMKA 3DB8A 1LEZA 3F7WA 1Q8TA 4O21A 4MNEB 5IUGA 1KUTA 3L8XA 3THBA 5HNBA 4RZWA 2J0JA 4IVCA 3VS1A 3PVGA 5JRQA 3PSCA 5G1XA 4AA5A 4USDA 3K3JA 2B0QA 1J7LA 4GEOA 4AUAA 4YUQA 5KNJA 4L6QA 4Q5HA 3RMFA 5J5TA 2I1MA 3NNUA 4YO6A 3FLQA 2O5KA 4MNFA 4EK3A 3VF8A 3P79A 2EB3A 2OFVA 4WOVA 4XV1A 4FC0A 4YBKA 3C50A 1FBNA 2VO3A 3KXZA 1Q61A 1QPDA 2KTYA 3F66A 4ZJVA 4R3CA 5CEMA 5E8TA 2CGVA 4F63A 3FYKX 4YLJA 1YDRE 2V22A 3I60A 4WBOA 1YXVA 4APCA 3OT3A 4S2ZA 4RX7A 3PY0A 4KINA 4CQGA 4AA4A 4FEWA 2WQEA 4A7CA 2QOLA 3MV5A 2YIRA 3UYSA 4ZY4A 4YBJA 4X6QC 4RG0A 1IA8A 3UIBA 4EOOA 2R3PA 4IB5A 5BUJA 2W5AA 2VTQA 3GC9A 4XG9A 5CF5A 3L9LA 3TCPA 4CKRA 4GUEA 3VS6A 4L68A 4R1VA 2QR7A 2GNJA 3C5UA 2YISA 3EKNA 3PTGA 4M13A 3UODA 4O7RA 2CGUA 3VBTA 5AMNA 4RPVA 2CN8A 3MA6A 5FXRA 4QQ5A 5KBRA 1H08A 2RFEA 3AMBA 5AIKA 4X3JA 3CPCA 3DGKA 3Q52A 3QUEA 2CKQA 2JBOA 4BDGA 3R02A 1XKKA 1M17A 4JG8A 3WF5A 4EI4A 3Q5ZA 4C61A 5EQYA 3TNQB 2UW4A 4CMOA 5C03A 1YXXA 2HZNA 4XG4A 3ZFYA 1ZYSA 2YLFA 3VAPA 4ENXA 4FA2A 1P4FA 3KRRA 2PUIA 4IX4A 2O0UA 4FZAB 2XCKA 2Y7JA 3ALOA 5AV2A 4ZXTA 3GU5A 2WMAA 1JKLA 3QUDA 4ZTSA 4EKKA 3G51A 4K1BA 3BIZA 3SGCA 3R1YA 2V55A 4FZ7A 3NIZA 5ITAA 4MD9E 3L9PA 4XX9A 4BDCA 4O1PA 3I0OA 3C9WA 3NLBA 4K6ZA 4KRDA 4QYHA 3MGYA 3DQXA 5JFVA 2OF2A 3D5UA 2Y4IC 3D7TA 2X39A 4FOCA 4Y8DA 5ANEA 1DI9A 4BICA 5HCZA 1OIRA 3COKA 4KIKB 2VWWA 2UZOA 3ORPA 4PUZA 5BMSA 2XIXA 3G6HA 2GQSA 2QG7A 3A7JA 2CGWA 4GG5A 4K9YA 2H9VA 3R7OA 5M09A 4MWIA 2PVHA 2OK1A 3R22A 4G6OA 3UO4A 1ZYCA 4NM7A 1NW1A 4RWKA 3QD2B 5KZIA 2GHLA 3RJCA 2WTKB 4DH3A 5DA3A 4WIHA 3IKAA 1WFCA 4RWIA 4CKJA 2YLEA 4FKVA 3G90X 4EBWA 1H0VA 4JIKA 4FTRA 4PP9A 3FL4A 3HRFA 1UU9A 2P4IA 2X9EA 5ANGA 5EW8A 4ALVA 3TUCA 2PZRA 2WMTA 3VUKA 4GFOA 5GZ8A 5AP5A 4QTEA 4NFNA 1IG1A 5F94A 4G5JA 4II5A 2PUPA 4FKWA 4G3FA 5KMIA 4O7ZA 4FOBA 2W7XA 3SAYA 4AZVA 4IFGA 4ZSGA 5JEBA 3NSZA 2QOOA 4TPTA 4IM3A 1DM2A 5DVRA 1V1KA 3W2QA 5IQIA 2J0MB 3Q9XA 4A4OA 4Q2AA 4RFZA 4BIBA 1ZARA 4NEUA 2P3GX 3AD4A 3DKCA 3KN6A 4GMYA 4LUDA 1OL1A 4DLIA 4ZTNA 5CU6A 5HLNA 4FT0A 2CCHA 2PTKA 4BTFA 4GVAA 4J7BA 3MB6A 1PXKA 4PNIA 3IOPA 3WI6A 2YM3A 5J9LA 4L46A 1H26A 3CTQA 3EL8A 2NRYA 4JDHA 5IKWA 2QURA 4ACCA 2NNWB 3V5WA 5HG5A 4X2NA 2FSLX 3PIXA 5M4IA 1FPUA 3VRZA 4H05A 4N4SA 3CKWA 3MH3A 4N57A 1PY5A 3VNTA 4CFVA 5BX0A 2Z02A 1DS5A 5AR7A 2WMBA 4FMQA 5IQEA 1UU8A 2FUMA 3DQWA 2E2BA 1Q3WA 4O0TA 4KIQA 1MQ4A 3S95A 4C59A 4CFWA 4UMPA 4IMYA 4F9AA 5J9ZA 4U81A 1H0WA
chains in the Genus database with same CATH superfamily
2W1GA 4UMQA 3KULA 5J95A 3LJ2A 3IPHA 1CKIA 4PMMA 1OKZA 5CAPA 3S3IA 4Y73A 3OTVA 4H58A 4G16A 2ETMA 4GK3A 5M06A 5IA5A 1MRUA 4YLKA 1LR4A 3LFEA 4C8BA 3R6XA 3OW4A 4UEUA 5BYZA 5DI1A 2P33A 1W82A 4B0GA 4UMTA 3ANQA 3H10A 3HMNA 3NUNA 2JIIA 3KU2A 4JR3A 4RIWB 4NM0A 2V62A 5EDPA 4BDKA 1REKA 3AC4A 4XP3A 3N4VA 2O2UA 2W1EA 4DHIB 1I44A 3R28A 5ICPA 4JOAA 4KNBA 3FKNA 4UWCA 3UO6A 2XJ0A 1XWSA 3OP5A 3EQPA 3LFSA 5IA4A 4QP7A 4QMYA 3VUGA 1RJBA 2GTNA 3GVUA 2R3MA 3V8SA 2PMIA 3OT8A 3ZRKA 3OF0A 2WQBA 4IX3A 4F0FA 4IZYA 3PUPA 3KREA 2WO6A 5T6KA 4IVDA 3SG9A 2XUUA 3QQLA 1TKIA 3G6GA 1YWNA 4HNIA 3O2MA 4BWXA 5HE0A 4IFCA 1WBTA 3E7VA 4RZVA 4JQ8A 3ULZA 3VW6A 3IOKA 4I5PA 2XZSA 4PMTA 4QYFA 4UV0A 3RVGA 2PVKA 5HGIA 4DG0E 2BMCA 2IW6A 3EH9A 1XR1A 3DV3A 2CCIA 4MF1A 4RA5A 2GNHA 4C0TA 3E87A 2P2HA 3QZHA 4AWIA 4GKIA 4FVRA 1RQQA 2OJFE 4N0SA 5H8GA 4F9BA 4XS2A 5GIPE 3RTPA 2Y6MA 4HVDA 5I5ZA 4I21A 1VZOA 2ITTA 3PSDA 4XYFA 4DHZA 4AXEA 3PA5A 2OG8A 5A6OA 3FL5A 5HTBA 4Y72A 2VO0A 4OUCA 4QMWA 4RLKA 4LGHA 2XK4A 3LMGA 2UW0A 4H1JA 3LMIA 4D2PA 3TDVA 4B4LA 3FDNA 3WIKA 4EZ3A 2X0GA 3GENA 3HMOA 5AEPA 5IEVA 4D1SA 2WHBA 3K5VA 4AGDA 3PZEA 1LP4A 3P78A 5HO6A 4AP7A 2X6DA 2OLCA 3DK3A 4FG9A 2J6MA 3IW8A 3WE4A 3WF9A 1JVPP 3D2IA 4WG5A 5H8BA 4CMUA 5IEXA 2XKDA 4O86A 2QC6A 5EYMA 2HY81 4LL0A 4M68A 4FV0A 2P2IA 2ITPA 3SV0A 2XP2A 2XNEA 3EYHA 4U8ZA 1CKJA 4YJOA 3UNJA 3ZLYA 4CFNA 3S1HA 4DH7A 2ETRA 3W0MA 3F5XA 2ZYBA 3MH2A 4DE4A 5L2IA 3UE4A 4FV1A 4CGAA 5GIOE 4DINA 5B7VA 3TNHA 4DEIA 2Z7SA 3BV2A 3OCBA 5J1VA 4BR3A 3FV8A 1OPJA 3BGPA 3MJ1A 3ORIA 4FL2A 3G5DA 4I4FA 3T8OA 1GZNA 4C36A 4D4VA 4FT9A 4IXPA 3W8LA 1J3HA 2HAKA 3POZA 2BFXA 4F99A 4FBXA 5CNOA 3SOAA 3ORMA 1XBCA 3DNDA 4FT5A 4YLLA 3CQEA 5K9IA 4DGMA 5DYJA 3DLSA 4FEQA 1UA2A 1OBDA 2XK7A 1XBAA 4FIHA 2W5HA 4RJ4A 4RJ8A 4FK6A 4TWOA 4C4EA 4MBLA 3NYNA 3KMUA 5DRDA 4DITA 3FMJA 4RWJA 5CEKA 2WTVA 3PPZA 4G31A 2R0UA 3VO3A 5BNJA 3DFAA 4C4JA 3L8PA 2PMOX 4BZNA 3V5TA 3QU0A 1PXIA 4WT6A 4RFMA 4ZTMA 3QTSA 3CC6A 3RK9A 3HVCA 4MWHA 4R3RA 5CT7A 4TZRA 3V8TA 2C5VA 1TFFA 5IQCA 2UW9A 3KMWA 5FM2A 4DBXA 4FTIA 4F0IA 4Z16A 1YI6A 4EOJA 2QNJA 2I0HA 4FNWA 2E9UA 2RG6A 2ZMDA 3NUXA 3VJOA 2ZV8A 4FIGA 5LMKA 3VUIA 4BDAA 3NAXA 1CSNA 4EH2A 4TNDA 4R6VA 1JKKA 3GOPA 3BKBA 3TMOA 2UW6A 1JKTA 3IS5A 4YPSA 3BHTA 2XH5A 5DH3A 1KE8A 2GSFA 4OTQA 2WEIA 2OZAB 2EUFB 5AV4A 4DFBA 4KIPA 1RDQE 1U54B 1W98A 4BCJA 3OOGA 4HGSA 2VRXA 3IECA 3GU7A 4NCTC 1IRKA 2PZYA 3PIZA 2VTNA 4FYNA 3F3VA 4TWPA 3VS5A 2ERKA 3BL9A 3TWJA 4R5SA 2VWVA 3QWJA 3SXSA 3ZUUA 4FKTA 4EQUA 4YMJA 4GUBA 4M14A 3RKBA 5F4NA 3TV4A 4LI5A 3PJ3A 4GYGA 4MEDA 3UG1A 2DQ7X 4ARKA 5DFPA 4EONA 2ZV9A 5AUWA 4E4XA 3DY7A 3EN7A 3D5WA 5AV3A 1TQIA 4RJ6A 4GU6A 2X2LA 4D4SA 4D2RA 5GJDA 2WZJA 3KK8A 1QMZA 4EJ7A 2FO0A 2UZBA 4ZTQA 2BR1A 4D5HA 4AS0A 4EBVA 1H4LA 4A4XA 3QCQA 4LOPA 1M7QA 3FHIA 3LPBA 4WKQA 3ZC6A 4O7NA 3VUDA 1REJA 2VGPA 4BN1A 2GNFA 4JBVA 2YDJA 2ITWA 4MKCA 3QTRA 4FEXA 4FL3A 3W0QA 3HZTA 4UZHA 5HD4A 2WU7A 4MXOA 3EQBA 5CEOA 3BYOA 5EHLA 2ZDTA 3M11A 3W33A 1OL7A 5DE2A 1FOTA 4FVPA 2OIQA 4HYUA 4DEBA 4C3PA 2ZFYA 2ZM3A 4IAKA 4O0SA 5CI7A 2W0JA 2PVJA 3U6IA 4HOKA 5AA9A 2J0KA 4BCMA 4DA5A 3E7OA 4V0GA 4IADA 4QMPA 2RKUA 5JN2A 1YI4A 2HENA 2WD1A 4FSRA 5LVOA 4RSSA 3I1AA 4YC3A 2CLXA 4IANA 4OTWA 3MVHA 3R7YA 5BVKA 4FSTA 3E8DA 4QP2A 5GNKA 3HAVA 5I9VA 2EWAA 1HCLA 1OL6A 2RL5A 3WYXA 3UDSA 3R9NA 3TYKA 4Z7GA 2FSTX 3BGZA 2XEZA 3NNVA 4MD7E 3QZGA 3AD5A 4FV8A 4RIOA 5CSVA 4KKEA 4IC7A 2R3HA 3KN5A 2B9HA 3KVXA 5E8XA 3DKOA 3R1NA 3SVVA 2C30A 3H9RA 2X7FA 4L9IA 1IR3A 3ET7A 3OY1A 4UWYA 1OGYA 3UBDA 1ZOGA 3CY3A 3SX9A 3WF8A 4QMQA 3ORXA 2IPXA 5CYIA 2C1BA 4LG4A 2J5FA 3P5KA 5TR6A 1JPAA 4TWNA 2WMVA 4G3GA 5I9ZA 4TW9A 3JVSA 1H8FA 2BFYA 5HIBA 2AUHA 2HWPA 4PDSA 4FNXA 2WELA 4G9CA 3FXXA 4IW0A 4IX6A 2XIYA 1MP8A 5DG5A 5C8MA 2IVTA 4HYSA 3Q4CA 4XNEA 4XOZA 5H9BA 4DH8A 3GC7A 1WVWA 1KV2A 4QO9A 4FKUA 4YJNA 2F7EE 3UG2A 4CYJA 3QD3A 1KOBA 3A7GA 3ZDUA 4QQTA 4TY1A 3R8ZA 3U4WA 1YWVA 2B9IA 3IDBA 5KMOA 1OUYA 2OJJA 1HOWA 4HZSA 4YHTA 1KE9A 3EFKA 1PXMA 5AR8A 5E4HA 2A1AB 2OIDA 4FF8A 2VV9A 2F9GA 3FQSA 2JKMA 4ZOGA 3ZFMA 3PUFC 5AP6A 3E63A 5DR9A 5E1EA 4C4FA 2VTJA 4DEHA 4U0IA 3GCSA 3NYOA 3R73A 4J71A 4JG7A 4KS8A 4OBOA 5HG8A 2Q0BA 4BJJA 4BY9E 5HORA 5A9UA 4MK0A 2HIWA 4QYYA 3ULIA 4BCFA 5DR6A 2X8DA 4ZMFA 4N6YA 2C1AA 4BVUA 1DAYA 2ZAZA 4C35A 4D4RA 2SRCA 3EOCA 5K4IA 5K0KA 1MQBA 1V0PA 5EOBA 4YHJA 4YZCA 3N4TA 4ANLA 4IX5A 3EQRA 1YHSA 4O2PA 4BRXA 3EJ1A 1WVYA 3CEKA 1KE6A 3AC3A 4QMVA 4ZY6A 1ST4A 3MFRA 2JKQA 3WZDA 1MRYA 1WBWA 3LVPA 3AG9A 2Y9QA 3QRIA 3POOA 4UYNA 5LOHA 2PE2A 2E9VA 4HYHA 4CFFA 4G17A 3BLQA 1YHVA 3I6WA 5M08A 4J8NA 1H01A 4O4BB 4NUSA 4O7TA 2J50A 5CSPA 1SNUA 4R7HA 2JKOA 5D1JA 3KVWA 3DDPA 2BRHA 1HCKA 3UP7A 3PIYA 3RPVA 3KEXA 3ORZA 1F5QA 2UVZA 3T9IA 3UVPA 4YNOA 3HGKA 3HV4A 3VF9A 5LXMA 2XNNA 5E9EA 2JD5A 5CWZA 2R3NA 3AT3A 3BRBA 3NIEA 5FM3A 2CNQA 3PXQA 5FXQA 3DK6A 4FKQA 3ZSIA 4O0UA 3ZO3A 4TYJA 3HP5A 3LLTA 2R4BA 3ORKA 4EL9A 4GK4A 5JSMA 5IUIA 3F2AA 3WARA 4FSYA 4CLJA 5C8KA 2IVVA 1GAGA 3FMMA 3F69A 2VTHA 3BZ3A 1FGIA 3CS9A 3FAAA 3OWPA 4D5KA 1ZWSA 2C3LA 4FTKA 2BAKA 4KWPA 3TG1A 4O4CA 3KRXA 5AP0A 4PWNA 4EC9A 3KF4A 4BDHA 4EH3A 3CGFA 4MCVA 4TXCA 3PXRA 5AP3A 5I9XA 5H8EA 3CJGA 3WOWA 3I7BA 2WOUA 1WBSA 1Z9XA 4WNOA 3FBVA 4FV2A 3AXWA 5E8VA 4NJ3A 3BLRA 2CNUA 1BL7A 4RIYA 1PF8A 3AMYA 3JPVA 4QNAA 4AN3A 4XV3A 3TIYA 3CD3A 2ZB1A 3BQRA 5C1QB 4D9TA 4D1XA 1SYKA 4MVFA 2CKOA 3DB6A 3EN9A 3Q9ZA 3NCGA 3VN9A 4I5HA 5AM7A 2IN6A 3BEAA 2W1CA 4BYIA 5LQFA 4BGQA 5J5SA 4AOJA 1YOMA 5CVGA 4DF3A 3IW6A 4XJ0A 2FVDA 3UC3A 3HV7A 4ANMA 4LL5A 4FSMA 4RQKA 4GFMA 4YR8A 4IQ6A 3EWHA 1ZMUA 4RIXB 5AV0A 2OZOA 4CG8A 4L44A 4U79A 4I3ZA 2YERA 4AQKA 1XJDA 1LPUA 2CDZA 2F7ZE 4XP2A 2CMWA 1DAWA 3KCFA 2OXYA 3VS0A 3EL7A 4AAYA 1W2CA 3R0TA 3OROA 3VIDA 5E8YA 4BBMA 4IB3A 4GW8A 4DC2A 5ANJA 2PE1A 2C5NA 4JQEA 4ZSAA 1IAHA 3OFMA 4X3FB 3GCPA 4IAZA 2PU8A 3PRFA 1I09A 3HA8A 4O6LA 2HCKA 2YACA 3FY0A 1M14A 2I6LA 2YIXA 3ELJA 4M97A 4FNYA 4XG6A 1GNGA 3B2TA 3ORTA 4X2KA 3HL7A 4J96A 4AF3A 2HELA 4CFXA 4YTFA 2C6DA 4YC8A 2VTMA 4ORKA 1U5QA 3EQIA 3S00A 2F7XE 4EK4A 4D58A 1MUOA 5HEZA 5TO8A 4ASEA 4H39A 4RGJA 3F82A 4DFLA 2Z7RA 4WHZA 4FUXA 5E8WA 5FTGA 3OW3A 3QQKA 2W05A 3SDJA 3QF9A 4IJ9A 5AJQA 2OI4X 2VN9A 2BILB 3JVRA 2P55A 2XA4A 3KXHA 5BVOA 4RVMA 3VQUA 3PYYA 3W55A 2JFMA 2C3JA 2R7BA 2HOGA 3NNWA 5TF9A 3LQ5A 3VUTA 2EB2A 4USEA 5IEYA 3TM0A 5AA8A 3PG3A 4USFA 5CEPA 5LMBA 3GI3A 3AMAA 3HRBA 4QMUA 4O7WA 3RP9A 1STCE 4C02A 4BBEA 4XBRA 3OEFX 4HGLA 1XH6A 4YTCA 5A4CA 5CSHA 4U7ZA 2OICA 5AX3A 3MS9A 4KABA 4ZP5A 5CXHA 3UIUA 3LQ3A 4QYEA 3PY3A 5KHWA 3JXWA 4BL1A 4YTIA 2LAVA 3IW5A 3KB7A 3QKLA 3BU6A 1UU3A 2I40A 4BGGA 4DFNA 3OTUA 1SVHA 4ZIMA 4AE6A 5AUZA 4CYIA 2C3KA 3FKLA 3G9LX 3MW1A 3P5JC 2C3IB 3RAIA 2AC5A 3RWPA 5L4QA 2OJIA 4F4PA 3R01A 2VTPA 2J4ZA 2EU9A 2QR8A 2B52A 3KFAA 3QGYA 5DBXA 2VWYA 3NW6A 2ZM1A 3BE2A 2WIHA 4DN5A 2JAVA 1H00A 4J95A 3MBLA 1M2QA 2QOFA 3OBJA 4CMTA 2W4KA 3RAWA 4CFUA 1RE8A 2GMXA 3GCVA 4ACDA 3FYJX 5CLPA 4Y46A 2ZM4A 3DJ5A 4K18A 5HHWA 1UWJA 4G2FA 1ZOEA 2QHMA 5E8SA 2JBPA 3SD0A 3ATSA 4DH5A 2V0DA 4I6LA 2PVYA 4F6SA 4YTHA 3ZZWA 4RMZA 4M0ZA 4UMUA 4L3JA 4CD0A 5I3OA 3BI6A 4PL3A 5TT7A 4GG7A 3NUAA 4HGEA 3CTHA 1GZOA 4G1WA 5LWMA 4Z9LA 3Q2JA 2X2MA 2OJ9A 4L3PA 4Y83A 1XH4A 2G2IA 3TL8A 5JGDA 1OZ1A 4FKLA 4FIJA 4F65A 2DUVA 1MRVA 3W2PA 4O0XA 2W1FA 5FD2A 3UMWA 5KO1A 2G01A 3FQEA 2HWOA 3VONA 4FTOA 3RINA 5LVPA 4F1MA 3RPSA 3F9NA 4FTAA 4WSQA 5CF6A 3EIDA 3F6XA 4FRFA 4QD6A 4WRSA 2GS6A 2PZPA 4JXFA 4ZSEA 2VO7A 2UZWE 3DK7A 1OGUA 3Q6WA 5EFQA 5GJFA 2R7IA 3PE1A 5LMKC 5IQHA 4E6QA 4JX3A 3R71A 4FG7A 2PK9A 2WFYA 1WBOA 3CPBA 1XHAA 4S32A 4FIFA 4CXAA 3LFCA 1L8TA 4GRBA 2ONLC 5IG1A 3BYSA 4EHGA 2QO7A 3KRWA 3MB7A 5E92A 3AGMA 4BDBA 1PYEA 3MY0A 3GQLA 3CR0A 3ZC5A 2UZNA 4EZ7A 3G33A 2VUWA 2R3QA 1G8AA 3NUPA 1M2RA 3DT1A 2W4OA 4ZEGA 2EXMA 3RNIA 2A27A 4QPMA 2DYLA 3DBFA 3II5A 3LFAA 4U40A 4A9SA 3FC2A 4QPSA 5B0XA 3L9NA 5AP2A 4B8LA 5HG9A 3N4UA 1W8CA 3CCNA 4NM5A 4ALWA 1CDKA 5HTCA 3QTZA 3D7TB 4F1OA 4IHPA 3V51A 4N6ZA 4ASDA 3MPMA 3GU4A 3FY2A 5DHJA 3U9CA 4NW5A 2G9XA 5L2TA 2CNVA 3UNZA 4UXLA 2WXVA 4FV4A 2O3PA 1FQ1B 2R3GA 3HA6A 3RHXA 1PMNA 2BZHB 3PFQA 5CEQA 2WIPA 4M8TA 4P2KA 4G6LA 3Q4ZA 4ZTRA 3UQFA 2W1ZA 3CE3A 3QYZA 1O9UA 3IW4A 3BQCA 5HLWA 2QHNA 4XHKB 3BWFA 4GL9A 3P08A 1YQJA 4JX7A 4YJUA 5AAGA 3R8MA 2CSNA 4IJPA 1ZY5A 2VZ6A 2YFXA 4GSBA 4NU1A 5CZHA 2GNGA 5HE1A 3A4OX 2H8HA 5GINE 4M69A 1Y6BA 5CVHA 2A98A 4MQ1A 5EM8A 1CMKE 4ALUA 2BHEA 4F1TA 3QYWA 5IH6A 3S0OA 1QPEA 3HECA 3VW8A 4HVHA 2J90A 3I5ZA 4FZ6A 3KIOC 1YHWA 3MVLA 1R0PA 4RWLA 3T3VA 5HNIX 4I23A 1K9AA 4DGNA 3P86A 5EI8A 1K3AA 4FSZA 3FEGA 1PW2A 4ZZOA 2KULA 2BPMA 2C0TA 2R64A 1IA9A 3WZJA 2J7TA 1GIJA 3M2WA 4UWBA 4PDYA 4X2JA 2Z8CA 4S33A 4JNWA 5EW9A 3VBVA 1E1XA 2W06A 3ZHPC 4PPAA 2C5XA 4DEEA 2NPQA 3KRLA 3UDTA 3DBDA 3ZCLA 3UZTA 4GJ3A 3AOXA 4TYHA 1OKYA 2YJSA 4M3QA 3AC1A 4JBOA 2I0YA 1T46A 5IF1A 3D94A 4M67A 2YCRA 3A62A 5HOAA 2GCDA 5CEIA 4LYNA 3SRVA 3Q53A 4W4XA 1Y91A 2JIUA 2ITVA 3SXFA 2W9FB 2BRNA 4OLIA 4MD8E 2ESMA 3UOHA 5H3QA 4QP3A 4J8MA 1L3RE 2XNBA 4K8AA 4OW8A 4F6WA 3DCVA 4HNFA 3HX4A 4MTAA 4O84A 3IG7A 5KBQA 5EYKA 3KULB 3OD6X 5CZIA 3ODZX 3D83A 3DZOA 4F08A 4GKHA 2UV2A 4X2FA 4XG3A 5DT3A 2GHGA 4WNKA 5I4NA 4B6LA 4R78A 3ZOSA 4FSUA 2JKKA 3SLSA 3SKCA 3Q9WA 4I92A 4XG7A 4FTTA 4QMZA 4CZTA 3RPYA 3KMMA 4RJ7A 3CD8A 3FQHA 3FZPA 4ITIA 3OWKA 5C4LA 3PXFA 3FLSA 1WBNA 4XG2A 5L6WL 4KA3A 3CTJA 5KMNA 1UV5A 5CASA 1FMKA 3GB2A 4L7SA 5CU2A 4RQVA 3DLZA 5EI2A 5HI2A 3ZH8A 4ENYA 1KSWA 5CXZA 4PDPA 4O4FA 3D2KA 3TIZA 4B7TA 4QMNA 3UGCA 4GS6A 1XMMA 3PPKA 5M4FA 3NVKI 3GC0A 3VS4A 4LRJA 4E6AA 1ST0A 2ITQA 4OAVB 1EH4A 1U5RA 2YM5A 1CKPA 3EQGA 4R5YA 4BCQA 1NA7A 5IQAA 2H96A 3VJNA 4M7IA 3UQGA 1P14A 1B39A 1TQPA 3LOKA 3E8EA 3E8NA 3RCDA 4CV9A 4PX6A 2QCSA 3BYMA 5BQ0A 4PP7A 3MH1A 4QP9A 2PWLA 1J7IA 1ZRZA 5FTQA 5DIAA 4QTDA 3KA0A 2OH4A 4BCHA 3QBNA 5L8JA 2I0VA 5EHOA 3A8WA 4YJRA 3LLAA 4MX9A 2VWXA 3LE6A 5KZ0A 4WBBB 3FZSA 1WCCA 3E5AA 2YM6A 2F57A 3GOKA 3R2BA 3AC5A 4L43A 2H6DA 1OBGA 3QUPA 3A4PA 4IVAA 4LRMA 2YWPA 3GXLA 4RX8A 4DAWA 5FDPA 4XMOA 4FNZA 4AFJA 1PXOA 3RM7A 2XAOA 5IH4A 2HY0A 2W1HA 5AADA 5AUVA 1J1CA 2X6EA 3FPMA 3FKOA 4QMLA 5JGBA 4OT6A 1KWPA 4IM0A 5KHXA 4YP8A 3BHHA 3CKXA 2A19B 3V3VA 4TYIA 3BLAA 1PMEA 1UNGA 4EZ5A 3MIYA 5EDQA 3KXXA 4CFMA 5ANDA 3UPXA 4LMUA 4M15A 4FKIA 4BC6A 1APME 2XAMA 2FH9A 5FBNC 1B38A 5IQDA 2AEGA 3O7LD 2IWIA 3N51A 2WMQA 2XEYA 4DFYA 2HW7A 3R9RA 2BRMA 3T9TA 3IDPA 4O0RA 4I5CA 2Q0NA 2R3FA 3LCDA 3E8CA 3R8VA 3O71A 5DPVA 5JFWA 3R8PA 2G2HA 1GIHA 1IEPA 2F2UA 3ERKA 4J1RA 4JI9A 4U44A 4FL1A 2UVYA 3LM5A 2RIOA 4E73A 3FUPA 3EN4A 1J1BA 1H1PA 3BL7A 3H9FA 1FVTA 2UZTA 2UZDA 1PXJA 3AGLA 2BAQA 1XQZA 3LAUA 3JY0A 3Q32A 4FV9A 1U54A 4FVQA 5EYCA 4C3FA 2XM8A 4DG3E 5ACKA 3TUBA 5AP4A 3H0ZA 5CU4A 5GJGA 2B53A 2ONLA 3CQUA 4PF4A 3BHYA 2J2IB 3QGWA 2DWBA 3KCKA 3QXPA 4I22A 3FMEA 4BDEA 5FGKA 2QQ7A 1BLXA 4A4LA 3KC3A 2QONA 2XK3A 3T3UA 4Z7HA 2XKFA 3F2NA 2X7OA 5HICA 1Q4LA 5C4KA 2IZRA 2W1DA 3PLAE 3M42A 3VS2A 4NIFA 5FTOA 3QZFA 4OTPA 2XF0A 4RLLA 3FLYA 1UNLA 3QFVA 1FVVA 3C4WA 3HV6A 1R39A 3EFJA 3OHTA 5ETCA 5E91A 2ZV7A 2QO2A 3BX5A 2Y4IB 3JR1A 3C5IA 5KKRC 3ML1A 3ZRMA 1PXPA 4V04A 2BZKB 2NO3A 3U8WA 3A8XA 5M4CA 4R8QA 1ZYJA 3BCEA 2NYAA 5HIDA 3SG8A 4PRJA 4B9DA 2JDSA 3V5PA 5J9YA 5L2SA 3P7CA 3UQCA 5B2KA 1ERKA 3HRCA 3PE2A 3DU8A 4EJNA 2PULA 4D55A 4ZMEA 2UW8A 1ZMWA 3F2RA 2BRBA 4Z55A 4ZY5A 1TZDA 4XCUA 4O7YA 2OSCA 2BRGA 1Q8YA 2C6LA 3CJFA 5LCKA 3RBWA 4QEBA 4RBLA 3UOKA 1PYXA 4HZRA 3UIXA 2Z7QA 3OVVA 5JZNA 2W17A 2JITA 4K77A 2VTOA 1NVQA 3SOCA 3K3IA 4TN6A 4BCKA 4L7FA 1OM1A 4CTCA 4U41A 1YOJA 4O7VA 2UZUE 2YHVA 2BALA 3R83A 1PXLA 3O8UA 3BV3A 2R3RA 4ERWA 4FKSA 4PTEA 4EOSA 3A60A 4FSNA 4AT4A 4BWKA 1YDTE 3E62A 4D4YA 3DJ7A 4M84A 3QTUA 3UJGA 4MXAA 3TACA 3ZRLA 4CNHA 3SHEA 5CF4A 2OIBA 2V7AA 3DTWA 5HNGA 2YM4A 4AX8A 3TDWA 4RC2A 2HK5A 5A4QA 4JT3A 4BI0A 3BBTB 4JRVA 5GHVA 2QOHA 4XV9A 2X8IA 4IC8A 5C9CA 4FTLA 2GHMA 2WTIA 3FPQA 2F4JA 3NW5A 3W0PA 4TYEA 2WTCA 4C2WA 3A7HA 5AUYA 4AZTA 3UO5A 2RGPA 3ZBXA 4P5QA 2VAGA 5EKOA 5BVFA 4FKGA 5CAQA 2VWBA 4AW2A 4GVJA 4JDKA 4FTNA 4G9RA 5L6PA 4IAAA 2XB7A 2O8YA 3UZPA 1UKHA 2IEWA 1G8SA 3V5LA 3R7VA 2UZEA 4YJVA 3ZM4A 2QU6A 1OL5A 2RG5A 3LM0A 4JLCA 5L2QA 3K2LA 3ZLXA 5L8LA 2XCHA 1GOLA 3RCJA 4O7SA 4R7BA 5M51A 3FZ1A 1GY3A 1QCFA 4W8DA 1BUHA 5EM6A 1H28A 2AC3A 2BTSA 3MH0A 3QRUA 2OU7A 2VTLA 1UKIA 3PJ1A 4OR5A 2IW8A 1OMWA 3W2SA 4R1YA 4BYJA 4ZZNA 4ZAUA 4QMSA 1OI9A 1O6YA 5CS6A 2XNOA 3REPA 2BIKB 3JY9A 4BB4A 4O2ZA 3NYVA 4MHAA 1BL6A 4QQJA 5IQFA 5CSXA 3FSFA 4G3DA 3SW7A 4WUNA 4JAJA 2IZUA 3ZLSA 3R7UA 4BIEA 2ZMCA 5E1SA 2XK9A 4FZFB 2JDRA 5FEEA 1BI7A 3DBCA 3FJQE 3ZZEA 3UOJA 4O7LA 2HW6A 3C0IA 4NKAA 3PJ2A 5L8KA 4BFMA 2O64A 4IEBA 4D0WA 3EZVA 3MSSA 3B8QA 4NTTA 3LFQA 3LCSA 1T45A 4ANSA 1XH7A 4JS8A 2IW9A 3FLNC 3GGFA 4QTAA 3KK9A 1VLRA 1Q62A 5IA1A 1WZYA 5KMLA 1U59A 4OAUC 2BCJA 1YXUA 1IASA 2WTKC 2J0IA 4MXZA 4L01A 4ZLOA 2YAKA 3D0EA 1ZYDA 4YHFA 5A6NA 4QDEA 5E8ZA 4AZWA 3FHRA 3BYVA 1F3MC 1ZZ2A 3H4JA 2Y8OA 5DWRA 1ZXEA 4YO4A 5A14A 3TN8A 4O0VA 2XJ2A 5LVMA 4XP0A 3UP2A 5JGAA 4NL0A 5F95A 3Q04A 5F9EA 3FLWA 3GUBA 3ZONA 3CSVA 4LFIA 3RPOA 3CXWA 1PRYA 5AUTA 1Y8GA 4AGUA 5CANA 3BHVA 4O0WA 1TQMA 4W9WA 4ZZMA 2QVSE 3NRMA 4YJTA 3DBEA 2HZ0A 2QODA 3HMPA 4F7NA 4XRLA 3AC8A 4FTCA 4EYMA 4AXCA 4YPDA 3VBXA 4BKZA 1ZAOA 5HKMA 4I93A 1OIUA 3OY3A 4G6NA 5IA0A 1JQHA 5CQWA 5CF8A 3EHAA 4O1OA 3L1SA 4AA0A 2WMSA 3PP0A 3NUYA 5HCYA 3P0MA 4UBAA 2J5EA 4TT7A 3NCZA 2XARA 4W9XA 4C7TA 5HQ0A 3QRKA 5CNNA 2XRUA 3MN3A 4IDVA 2PVMA 3EB0A 4S34A 5CENA 2BZJA 4GCJA 4I1ZA 4FGRA 4BJJB 4MBJA 4AN2A 3C7QA 5IISA 3MY5A 4NM3A 3VS3A 3DZQA 2WQNA 3KL8A 4ANQA 3MIAA 4CEGA 2ITOA 2WQOA 4RRVA 5IDNA 3O51A 2XYNA 4FKJA 3V6SA 3LCOA 3WF6A 4D28A 5AUUA 3D9VA 4IWPA 4CKIA 4CRLA 4BF2A 3O7LB 2W1IA 4EWQA 4GIIA 1KE5A 1YXTA 2IF8A 4LUEA