3FI4A

P38 kinase crystal structure in complex with ro4499
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
349
structure length
339
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSKPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Mapping Binding Pocket Volume: Potential Applications towards Ligand Design and Selectivity
rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
total genus 105
structure length 339
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fi4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fi4A01
2B9HA 2W4JA 3EL8A 2PMNX 4EQCA 1NA7A 4R3PA 4CQGA 1NY3A 1Y8YA 3SLSA 4E4NA 3PJ3A 4S31A 4U79A 4ZSJA 3WZDA 4AW1A 4DH5A 2WNTA 1OIRA 1UVRA 2BALA 2Y4IB 3MTLA 4UYNA 4V0GB 4YJQA 5AA8A 4YTHA 4ZSGA 3PJ2A 3BV3A 3QC4A 2VGOA 4L46A 4EUUA 2V0DA 4JVGA 5IEYA 4F99A 4DFLA 3NNXA 5FD2A 4TWCA 1ZYJA 3PSCA 3ITZA 1YDRE 3KULA 4GT3A 4QMVA 2WMBA 3QQGA 5CI7A 4WT6A 4BN1A 4IFCA 3NMUF 2YCQA 2XK9A 2C1BA 4YNEA 4UXQA 5BYYA 2R3PA 5JGBA 2W5AA 3QQKA 4TN6A 3R2BA 5CVFA 5HU3A 5D7VA 2JAVA 4QOXA 5J1WA 5AP3A 1OBDA 2VTLA 2ONLA 4F4PA 2PZRA 2EUFB 3PA4A 3U4WA 3ZEWA 3W2PA 5AR3A 3VRYA 4Z55A 3FHRA 4XG7A 4UN0C 2R7IA 4A9UA 4FV9A 4M69A 3S0OA 4PWNA 2HENA 3PA5A 1M2RA 1XQZA 4ZZMA 4P2KA 5GNKA 5JFWA 3SRVA 4BZOA 3VUTA 2QI8A 4M67A 4LUEA 4USDA 5E90A 4CCBA 4F1OA 4Y83A 5LMKC 2GTMA 3CSVA 1XKKA 3S2PA 3OCBA 1CDKA 3LFFA 4WNKA 5EYCA 4IX3A 2BRBA 5AJQA 4KIQA 3QD3A 4FV8A 4L43A 2VTRA 5AADA 4FTIA 2XK3A 4FSWA 4NKSA 3QKKA 2E2BA 4DBXA 3KFAA 4FYOA 4QMWA 3C5UA 1KV1A 4FV4A 3VO3A 4A9YA 4AGUA 4ZLYA 4QO9A 1UWJA 5EHOA 4IC8A 3PRIA 4NUSA 3DKFA 5J87A 3ZSIA 5L2WA 5F1ZA 2QG5A 4B7TA 2VD5A 4IMYA 3HV5A 3F61A 2HIWA 4ZY4A 5GIPE 2YIYA 2VNYA 3GC0A 1BX6A 5HLNA 4LM5A 2YCFA 5BUIA 3GC9A 3UZPA 3QYWA 4RPVA 5FGKA 3R6XA 2F2CB 3DJ7A 4WBBB 2IZTA 3HMIA 1TKIA 2GDOA 4I5PA 4O7VA 3HAMA 5EW9A 3ZH8A 5JT2A 5I9YA 2JEDA 1OL7A 3DY7A 5TKDA 2C1AA 3PZHA 4NJDA 2AUHA 5AP7A 2I0YA 3QC9A 1GZ8A 4KBKA 4RIYA 2R3LA 1YOJA 3TJDA 4ZJVA 5JSMA 2WO6A 4IAFA 2KTYA 4J97A 4MAOA 3ORNA 4RWKA 5C03A 4D2VA 5D10A 4FZ6A 3C4FA 4GYGA 2WTKC 4K18A 1YQJA 3FAAA 4QPAA 3M11A 4F9AA 1OUKA 2ITZA 3BV2A 3V5JA 3VS7A 4U97A 2VUWA 2W9FB 4ZY6A 1H1QA 1OGUA 5EOBA 3TTIA 4DTKA 4JAJA 3CGFA 3NUUA 3H3CA 4CLJA 5HO8A 4BWPA 3RWPA 3UO4A 4BCMA 5B7VA 3O51A 4PDOA 2GPHA 1YXSA 4GFMA 4RQKA 1UWHA 3O7LB 4AN9A 3LAUA 5FXRA 4HJOA 2REIA 1APME 4QP1A 4IM0A 4LRKA 4OT5A 5DPVA 4GU6A 3FI3A 2ZOQA 4IW0A 4FEVA 2W5BA 3BU6A 3CY2A 4DEHA 2BROA 3FLSA 4IADA 2XUUA 4LMUA 4AFJA 5L2IA 1Y57A 4FIHA 3Q32A 4AW5A 4RVTA 1H28A 4YZCA 1NT2A 3CPCA 2GS7A 2OJJA 2JFLA 1KWPA 2PE1A 4R6VA 4ZS0A 2RF9A 3PXQA 3MPAA 4QYEA 4DCEA 3UP2A 2VX3A 3UOHA 3DXPA 2QKRA 3EKNA 3QKMA 4BBMA 4MNEB 4H39A 4TL0A 4HVSA 3EQGA 4X3FB 4C37A 5EKOA 4O1PA 2BTRA 3POOA 1YXVA 2BAKA 2WMSA 3BHHA 3ULZA 4L8MA 3D9VA 3C51A 1XBCA 4XOYA 4NZWB 3ZO1A 4FIEA 3OTUA 1L8TA 5IQCA 3BLHA 4FTAA 4NW6A 3HA6A 3VS3A 4BHZA 3B8RA 4WG3A 3UG1A 5J9LA 4U45A 3HRFA 5KHWA 4R5SA 5ETFA 3ZC5A 1PMUA 2F7EE 2GHLA 4I0RA 2R3RA 4EUTA 2QODA 2W05A 3LE6A 5M4CA 4J8MA 4R3RA 2BMCA 1G5SA 2UW5A 4O0XA 4TT7A 5HCZA 5A9UA 2CNQA 4IX6A 4PL4A 4F65A 3EMGA 5E8XA 1WBNA 2XJ1A 2XNBA 2YACA 2PVKA 3D7TA 1PMEA 2OI4X 4OUCA 4AZVA 5CTPA 3COMA 1KUTA 3G0EA 3LFSA 3LXKA 2IW8A 3PDTA 2W4KA 2BVAA 3MB7A 4AG8A 2G2HA 3GQLA 3F7ZA 1PKDA 4O6LA 1A06A 1RE8A 1R3CA 4QTDA 2WB8A 3DBDA 4U5JA 3FQSA 4NIFB 4B0GA 1FINA 4FZ7A 4PF4A 4B99A 2VWWA 4EH2A 4ZK5A 5A4TA 1ND4A 4UMQA 4DT9A 2YM8A 1J1BA 3K54A 3QGWA 3OBGA 1UU7A 2UW4A 3E8EA 3GI3A 1R78A 4FVPA 4GIIA 4FNYA 4RJ8A 1URWA 2PMLX 2J0JA 3R7OA 3HEGA 2B52A 4YR8A 2EXCX 4NT4A 4GYIA 3PUPA 4Z7GA 5I9VA 5IQGA 3H30A 3BBTB 4K9YA 4TPTA 4RWJA 3CP9A 5IQBA 4ZTHA 3WF9A 1PY5A 3PXRA 4OTGA 1H07A 4IVAA 1O9UA 3FUPA 3ZONA 3DKOA 1REJA 4BGGA 4I6FA 4KD1A 5EFQA 4EOPA 3JPVA 3N4TA 4FV1A 3REPA 3SXRA 2YFXA 5EQYA 5C26A 1M2QA 3P5KA 4ZSLA 5M06A 5ETCA 1PHKA 2PMIA 4GUBA 4LRMA 2HY81 3BYSA 1VR2A 2CKEA 4FT0A 3EJ1A 2ETKA 4BKZA 4G2FA 3W8LA 5JZJA 5JFSA 2C5NA 3PY1A 1XHAA 4EJNA 4DA5A 4TWPA 3KK8A 1YWNA 5CXZA 2YAKA 4U9AA 2ONLC 1MRVA 4D9TA 2OJ9A 4DTBA 4ACGA 5H8EA 4YPDA 4J1RA 1URCA 4Y8DA 4UEUA 2Z8CA 4QPMA 3OS3A 4IAAA 4EK3A 1YI3A 5DEYA 2C6EA 5AP1A 4IB5A 4AT4A 3BYVA 4R7IA 5HBJA 3QWKA 4O96A 4Y85A 3PRFA 1HCLA 2F4JA 4G3DA 2C3IB 4Y5QA 4DTAA 3RK7A 2GHMA 3QKLA 3G90X 2DQ7X 4L52A 3UGCA 2WMVA 4BHNA 5AM6A 2BIYA 4FTCA 4PL3A 2R0UA 2GFSA 1JKSA 3E92A 3EQBA 2R5TA 3FZRA 3IDCA 4YP8A 3WYXA 3LM0A 4XG6A 5E9EA 4PNIA 3PE1A 3O23A 2PVFA 4QT1A 4UALA 1YOLA 1Z9XA 5L6WL 5A4LA 4K33A 2RIOA 3E3PA 2X6DA 1ZYCA 4C34A 4YMJA 2VGPA 2FGIA 4HW7A 5ITAA 4G3CA 1W83A 4CZYB 4BR3A 2W99B 2YM5A 4EWQA 5L3AA 5HZNA 4JG8A 2XRUA 4PUZA 2G1TA 3HVCA 3P79A 4R5YA 4FNXA 4BY9E 3ERKA 4YGAA 3OWLA 4N4SA 3PJ8A 1UKIA 4BCQA 3NVKI 2CNVA 3QAME 2VX0A 3U9NA 5FTQA 1XH9A 3PWYA 3HX4A 5CX9A 5A4EA 4XG9A 4UMTA 4FKPA 4R7HA 3BGQA 2HELA 3QA8A 5G6VA 4KRDA 4QMMA 1Q8TA 1GZKA 3ZXZA 3OT8A 5JZNA 3W2RA 2C5XA 2XA4A 2Z2WA 3UDBA 3VHEA 3PE2A 3RM7A 1PMNA 3FMHA 3Q4UA 3DK6A 1T45A 2J6MA 1XR1A 4BDKA 1M14A 5HGIA 3VVHA 1EH4A 4KB8A 4FZAB 5H8GA 3QUDA 3SGCA 1WMKA 2ITNA 4QMOA 3R7IA 5C4LA 5M07A 1W0XC 1H26A 2C6OA 5LMAA 3ZDIA 5IA2A 4L01A 4MK0A 2QOKA 3SHEA 2YM4A 5C9CA 2VTPA 5JFVA 2W7XA 3QTUA 2YZLA 1R0EA 2YN8A 1P14A 3LJ0A 3GVUA 2JFMA 4IACA 4XOZA 5ANEA 5E8TA 3UVPA 4ANMA 3OHTA 2J9MA 2ITVA 3ZUUA 1BYGA 1YOMA 3HKOA 2VTNA 4BBEA 3PVGA 4CFWA 2JD5A 3IW8A 4G9RA 3TACA 4BVUA 4H05A 3CC6A 2W1GA 4FF8A 4J99A 3VHKA 3GUBA 3ZU7A 4DEDA 2QR8A 4APPA 2G15A 1PJKA 2X2LA 3NRMA 3ODYX 3UIMA 5HG9A 4EOSA 4F7LA 3IK3A 3DXQA 4ZJIA 1OZ1A 4ACHA 3NW5A 3QRKA 4B4LA 3U6IA 4D2PA 1WFCA 5C27A 2R3FA 4RX9A 5AUWA 5IKWA 5DG5A 3A8XA 3C0HA 4O1OA 2IZUA 3IKAA 1S9JA 3AGLA 1QPDA 1PXMA 3DDPA 4PPCA 4C59A 3RGFA 4AZTA 4RJ6A 3OY3A 3F3VA 1IG1A 3CLYA 5M55A 4U6RA 5BVWA 3VN9A 4FTLA 4YO4A 4M68A 4PPBA 3DTCA 4FICA 3ENMA 4O38A 3RVGA 4G31A 4XRJA 4Y46A 3Q60A 2C6MA 4OTWA 4TW9A 4HZSA 2B7AA 1WAKA 1XH4A 3CTQA 3CCNA 3MJ2A 5E8UA 2VZ6A 4CT1A 4HCTA 3E63A 4MNEA 4BTMA 2UW0A 2BZHB 3AT2A 3UNZA 4RIWB 1J1CA 1JQHA 5IA0A 2YA9A 1FVVA 3EFWA 2OGVA 4ALVA 4F70A 5LVMA 3MGYA 2W5HA 2GS2A 5J9YA 4Q2AA 2GHGA 1P4OA 4W4WA 4M12A 4D9UA 4DH3A 4ANLA 3S1HA 3SDJA 2OIDA 4F1MA 2F7ZE 5KKRB 5HI2A 2VU3A 4IAIA 3SQQA 4RJ5A 4E7WA 2W9ZB 5CAOA 4I6BA 2IW9A 5BVDA 4RQVA 3NSZA 2R9SA 4PP9A 2PSQA 3A7JA 1LP4A 3P7AA 3V5TA 3NW7A 3IECA 4QD6A 1X8BA 4AN3A 4D2SA 5ICPA 3HDNA 4EH8A 4AOIA 4ACCA 2JKMA 3F3TA 1SZMA 2R3MA 3QWJA 1H1WA 4E4LA 4E6DA 3H0ZA 2GNIA 4TZRA 1FQ1B 3R7EA 4Z9LA 5DHJA 5KHXA 3RCJA 4GIHA 4NEUA 3R30A 5TF9A 3GNIB 4YURA 4J7BA 2C3JA 3B2TA 3VBXA 1MRYA 5BPYA 3DBCA 4XV1A 4C4HA 1BL7A 3RJCA 4AOJA 4FODA 2I7QA 4JNWA 4NIFA 5ANKA 4X2JA 1O6YA 1XH7A 3Q9WA 4UWCA 2W17A 4M97A 3F5UA 5EDQA 5HCXA 3BU3A 2IPXA 3TKHA 3V8TA 4EHZA 1ERKA 2JKQA 2XKCA 4YZ9A 5TE0A 4MXCA 4EOMA 2W4OA 3KULB 4JIAA 2I6LA 3VBYA 3I7BA 4O2PA 4CMTA 3LMHA 1KOAA 4LOOA 4ZEGA 3F5GA 2OG8A 3G9LX 1WVWA 2R4BA 3ZO2A 1MQ4A 4M0ZA 2EB3A 3AGMA 4CMOA 4I23A 4O0YA 1U59A 3C4XA 5GIOE 3RHXA 2W1IA 4CG8A 3SOAA 5AEPA 3DAKA 4GKIA 3R9DA 3G51A 2E9OA 1M7QA 3GCPA 4QP2A 1GZNA 5HIEA 2Y7JA 3SRVB 4K11A 4BCJA 3IOKA 4JX7A 3QUEA 5KBRA 4O7WA 1Q8YA 4CFUA 4RZWA 4XP0A 2J5FA 4GS6A 5L8LA 2OJFE 4MXXA 2H6DA 3DJ5A 2HZ4A 5CVHA 3ELJA 3CJFA 4UY9A 2HAKA 3VS5A 5BMSA 1RDQE 1UKHA 1YI4A 3AMBA 2P2HA 4IWQA 4ERKA 1XWSA 5L2TA 3R7YA 2GU8A 3GEQA 5LCJA 3GCSA 3DZQA 4TXCA 3MH2A 3UQCA 3WE4A 3DZOA 3FY0A 4XUFA 2Z7LA 4XEYA 4MBIA 3F2NA 1JWHA 2F9GA 4AZSA 3DFAA 4EKLA 4YBJA 3OC1A 3BPRA 4GH2A 3Q04A 4CVAA 3KGAA 2QOOA 3QTQA 4I24A 4QP3A 1JKLA 2VTHA 2B0QA 3ZLYA 4DH7A 2I0VA 5CF5A 2FA2A 3EQPA 3G15A 5AWMA 1T46A 5DRDA 2FSTX 4YC3A 4BKJA 2WEVA 3PXYA 2BAJA 3NYVA 2JDTA 2JC6A 4L3PA 4PP7A 3PY0A 4CFVA 2VTAA 4IWOA 2XKEA 4BCKA 3IO7A 4QMLA 4BYJA 3U4UA 4I92A 4YHTA 1WVYA 2UW3A 5DR9A 1HCKA 3N51A 2CPKE 5CALA 5E8YA 1SVEA 3WZJA 2JIUA 3V51A 4FV6A 5HCYA 5CSPA 4O0SA 1NVQA 2ITTA 5HESA 5J7HA 2RG5A 4ZS4A 2BRHA 4D5KA 4HYIA 2O3PA 4EH6A 1KSWA 5EI6A 3GU4A 2X81A 4YSMA 3I60A 4PTEA 2Y6MA 5DOSA 3ZUVA 4FKUA 2QU5A 1FOTA 2E9UA 2XM8A 5E7RA 3SG9A 3UIXA 3UMXA 3S95A 2QHMA 3D5UA 3CJGA 4RFMA 5CEOA 3F3ZA 3OEZA 4H58A 4NM0A 3CQWA 4EBVA 1JLUE 1WVXA 4UMPA 3LPBA 2PZPA 1M52A 1YWRA 5DH3A 5IDPA 4D1XA 4F63A 1H0WA 4TYGA 3HRBA 5EKNA 4GT4A 3N4UA 3LMGA 2J0LA 3R1YA 1A48A 3VULA 5D12A 4O27B 4W8DA 4EQUA 4DH8A 2BIKB 3BWFA 1ZMVA 3U6JA 3VBVA 1PXLA 1KE6A 3VS2A 5AUXA 5JK3A 2PU8A 3O96A 3H9RA 3A7GA 5B0XA 3V8WA 4RG0A 3CD8A 5I9UA 1WCCA 4QP9A 5HE3A 2C6TA 3LVPA 3VBTA 4MD9E 3OWJA 4XV2A 4FR4A 5IUHA 4QMTA 4IJ9A 5CVGA 5KMNA 3NDMA 3ZC6A 2IZRA 2IG7A 5IDNA 3DT1A 3MI9A 4I22A 2A4LA 4JDHA 5LVOA 2OO8X 4RSSA 1GAGA 2DWBA 4HVGA 4W9XA 2B54A 2CSNA 1UA2A 3PA3A 1J7IA 3UVRA 4RGJA 4C4EA 1PXIA 3O17A 4WNMA 4WKQA 3TKIA 5A6NA 3OROA 2E9PA 4ZMEA 4PTGA 2O8YA 3NR9A 5AV2A 2HZNA 1Z5MA 3ZLXA 4YSJA 3TNIA 3QF9A 4MXAA 4RZVA 2P0CA 3BYOA 3E88A 2WEIA 4W4XA 2RFEA 4XLVA 5HKMA 2GQRA 3QBNA 3DS6A 1K9AA 4UX9A 3C1XA 4WG5A 3FYJX 2WELA 5E8SA 1JKKA 3CBLA 4HOKA 3R8VA 5HIBA 3LCSA 3LMIA 4UV0A 5BVEA 4MKCA 4MD7E 5CSWA 2HY0A 4OGRA 4A4OA 4AA5A 2VTTA 3DAJA 4RIWA 4BWXA 4BDEA 1FGIA 2R3KA 3F6XA 3PWDA 3R9HA 4X6QC 5FEQA 3V5PA 3RPRA 5A54A 5JN2A 3V6SA 4N57A 5IA4A 3NNVA 4FSUA 3KY2A 4JT3A 4GCJA 3PP0A 3M2WA 4HZRA 2ZV8A 2QOLA 4M7IA 4NYEA 4X21A 3UQGA 1Y91A 3RTPA 1LEWA 3CD3A 3NUXA 3BELA 1OL2A 3TCPA 5B2KA 5IQEA 2Z7SA 3NCZA 4FEQA 4JJRA 4E26A 2BPMA 3VC4A 4FA2A 3GP0A 4DEAA 2XEYA 4DGLC 4RJ3A 3ORPA 3HA8A 5EHLA 4FG7A 1YVJA 3AT3A 3I6WA 5BX0A 4R78A 3QXPA 4FOBA 3ROYA 1J7UA 2O2UA 5AV0A 3JXWA 4OR5A 2OFVA 4YPSA 5GZ9A 5IPJA 4UYAA 1GY3A 4M84A 5AV4A 4E5WA 4W4VA 3FKLA 2Y6OA 3R1NA 3MY5A 2PZ5A 4E93A 5K3YA 2OICA 2B53A 4B8MA 5IQHA 3HECA 1MP8A 4U40A 4WA9A 4JG6A 3V01A 3KXXA 4EH9A 3RAWA 4WUNA 3D7ZA 1CTPE 3U6HA 4B8LA 5CANA 3WIGA 3EN7A 5J9ZA 3GENA 3RZBA 5JGDA 3F2RA 2VTIA 5HHWA 5IA3A 3EN6A 3E93A 3RPOA 2OXDA 5CF4A 3UE4A 4RFYA 1JSVA 2X7OA 3PZEA 3HV4A 3QTSA 4ALUA 4BGQA 2Y0AA 1KE5A 2RFDA 2WZJA 5GJFA 4DLIA 3P7CA 3R22A 2E9NA 2YLEA 3BHUA 3VQHA 1ZZ2A 3JR1A 3DKCA 4QMQA 2JDSA 3WI6A 5EQPA 2WTCA 4IB3A 3VAPA 4FKVA 4HCUA 2P55A 4MX9A 2DS1A 3DA6A 3R2YA 5CQUA 2UZWE 4EJ7A 3EB0A 3LXPA 3DDQA 3BX5A 3WF7A 3FZSA 3RK9A 4J95A 4EH5A 4FKSA 4ZTLA 3LFDA 5IF1A 4A9TA 4ARKA 4G6OA 3O2MA 4J71A 3F9NA 2X1NA 4L68A 5FRIA 4AP7A 1WBWA 3BE2A 5HG8A 3TG1A 1CSNA 3D15A 4CKRA 3D4QA 4D5HA 4O21A 4YZNA 1AD5A 1H1PA 2BR1A 2UVZA 4CNHA 4ANQA 2OKRA 3NUNA 2YIXA 4QYGA 3JY9A 3ODZX 3QCXA 3ACKA 5JKGA 1PXPA 1TQMA 5M4UA 4E20A 5IISA 4X2FA 3TL8A 3HV3A 4BDAA 5J5SA 2QONA 3QUPA 4BFMA 5B2MA 3UO6A 1BLXA 2RFSA 3H9OA 5H8BA 4QP4A 3AC8A 4IXPA 3UO5A 2B9JA 3FLQA 5FLFA 3D83A 1BI8A 1WBTA 3ANQA 3AOXA 4GU9A 3R00A 3PVWA 2H9VA 2GS6A 5BUEA 3I1AA 3RHKA 2Z60A 2HW7A 3KXHA 3ALNA 4G9CA 4YTIA 4PMMA 1QL6A 1V0PA 2F49A 2X7GA 4WSYA 3UNKA 4DE4A 2ZMCA 4FV2A 3EH9A 3P08A 2GQGA 2IO6A 5HTBA 2PVMA 2NNWB 3HLLA 4WNOA 3KN5A 3VBWA 4UBAA 4EK4A 4RC2A 1DI8A 3A4OX 3M1SA 2W1ZA 4Q9ZA 3FWQA 4OTRA 3ZBXA 2X9FA 4LL0A 3GU8A 5G1XA 4ZMFA 3ORKA 3THBA 3AC4A 4AE6A 2CCIA 4AGCA 2ITUA 2WOUA 3P1AA 4YLJA 3T8OA 5JMSA 3WBLA 5IZFA 5AX3A 2BCJA 4XHKB 4RVMA 2WU7A 2X2MA 5T6KA 5CAPA 2XKDA 4C33A 4JQEA 3R8UA 4IB0A 5K0XA 2GFCA 3CEKA 4FKRA 4KSQA 2UVXA 5FTOA 1IRKA 5HO7A 1UNGA 3FEGA 2UV2A 4ANBA 3BKBA 5BVKA 4O0WA 2V7OA 4AZFA 1M7NA 3II5A 4FTNA 4KIKB 4R8QA 5E1EA 3W2CA 4O81A 4XP2A 4I3ZA 1MRUA 3AQVA 3SXFA 1U5RA 1IASA 4KBCA 3C13A 3FDNA 4G16A 4JRNA 3F2AA 5CF6A 5E92A 5FEDA 3V04A 3QRIA 4CT2A 4PMTA 2IN6A 4BCOA 2V22A 5KO1A 5I4NA 3IW7A 3D2IA 3FKNA 4JR7A 3VUGA 3ZTXA 4AU8A 4UMRA 5CEKA 3IG7A 5LVLA 3D0EA 4DH1A 3VW6A 5CEPA 4DT8A 4EOQA 3MVMA 2PE0A 2VTMA 3M42A 3O8UA 3RALA 4U43A 4YJVA 3ZBFA 4WSQA 3HL7A 5KNJA 4RX8A 1U54B 4AXAA 2RG6A 3EQRA 3PXZA 4LUDA 4AGWA 4A4XA 4AX8A 4BCGA 5CU0A 3UZRA 5JRSA 5M4FA 3TDWA 3LFAA 4NTSA 5EOLA 3R73A 2CGXA 3BEAA 4XX9A 4U3ZA 1BL6A 2J51A 4QYFA 3AMAA 3G6HA 2UVYA 4I4EA 4I21A 4HYUA 5ACKA 4TWNA 3R8LA 2YWPA 1WZYA 4OT6A 3S00A 2OZOA 2W96B 3LLAA 5EI2A 3PYYA 2OH4A 2W1HA 2Q0NA 4ONAA 2F57A 4UB7A 4ZSEA 5I3RA 2UZVA 2ZM1A 3LXNA 3HMPA 3GC7A 4GL9A 1SVGA 5I9XA 3ZM9A 1H24A 3W1FA 4E4MA 1OECA 2ZJWA 3MS9A 4JIKA 5EM6A 3OOMA 5KKRC 4X3JA 3OD6X 4YJUA 3FE3A 3PPKA 4ANSA 4C38A 2YLFA 4C7TA 3FLYA 4II5A 1LUFA 3TZ8A 3I5NA 5C1QB 3PG3A 4XLIA 5KE0A 4O7RA 3OZ6A 3KL8A 4I5MA 5I5ZA 4D0XA 3A4PA 5JH6A 4O7TA 4FX3A 5M08A 3F82A 4KRCA 5C01A 5EW8A 3PPJA 1K2PA 2F7XE 3VS6A 3Q4ZA 2HYYA 4RT7A 2X0GA 2KULA 3NAXA 1YHWA 3FL4A 3CPBA 1AGWA 4USFA 4DFBA 4QMXA 4FIGA 2H34A 4UWBA 4YO6A 2B9IA 3MH1A 4BDIA 3KA0A 4E6CA 1RJBA 2WHBA 1ZLTA 2ZDUA 2R3GA 5FDXA 5DR2A 2VTSA 5HX6A 4GVJA 3VRZA 4WO5A 2CN8A 4U8ZA 5GINE 3OCTA 4H3BA 5FG8A 3DB6A 5K5XA 3Q9XA 1OKZA 3SVVA 2O65A 4OTQA 3LXLA 5BUJA 3MFUA 2V5QA 2XIRA 2P33A 2UZOA 3P4KA 5AR8A 4FEUA 2PVNA 1UNHA 4JDIA 4FSZA 4E6QA 1OPLA 2JBPA 3HMOA 3I5ZA 4NL0A 4JI9A 2QNJA 3DK3A 4GJ3A 3CKXA 3ZUTA 4FG8A 4BRXA 2OK1A 1K3AA 4PDSA 3GFWA 1IAHA 4IH8A 2WTDA 4RFZA 4ERWA 4YC6A 4FEXA 3NIZA 4IVCA 2CN5A 4NK9A 4WG4A 5LCKA 2NP8A 4EOJA 5LXMA 4FKQA 4FVQA 3U55A 3ZHPC 3HMNA 2J5EA 1R39A 2W1DA 4NH1A 3DOGA 3GBZA 5DT4A 2YISA 1JPAA 4MYGA 2GSFA 2AC5A 4HVDA 5DLSA 3PVBA 4ENXA 4YU2A 1SNUA 3Q2MA 3E5AA 2EU9A 1CMKE 3E3BX 2O5KA 3IS5A 2VN9A 2WIHA 4O91A 4F6WA 4YJOA 3R8ZA 1QCFA 3A8WA 4BTJA 3K3IA 3F7WA 3OP5A 2PMOX 3ATSA 5AP0A 5HNBA 2UZLA 4OBOA 5M53A 2IZSA 2CHLA 4FTOA 2BAQA 1UU9A 2WMXA 3CKWA 4DFUA 3COKA 1B39A 2GQSA 3GXLA 3TZ9A 5LVPA 4CLIA 3KRRA 4GK3A 3DBFA 2QO9A 1YHSA 3TUBA 1QMZA 4G1WA 3FQHA 4GK2A 4C36A 4OTFA 3PJ1A 5AUYA 4D4RA 2X8DA 4PX6A 4C62A 4BCFA 3RNIA 4C4FA 2H8HA 2X9EA 4YTFA 1PXJA 3EQFA 5CI6A 4YZDA 2C4GA 4QNAA 3MTFA 4DG0E 1Q3DA 3GOKA 3CXWA 3KCFA 4G34A 4IFGA 3RZFA 1BI7A 4P5ZA 4JG7A 4IVDA 5B2LA 4M66A 1UU3A 3C50A 5C8NA 5ANIA 3AD4A 3FMJA 3EYHA 5CAVA 3VW8A 4XCUA 1XH5A 2C0TA 4O86A 2X4ZA 4KUJA 4FTMA 5TOZA 4QMZA 2GMXA 5AP4A 3PSBA 4MQ1A 2X6EA 2Y8OA 3DNEA 3R1QA 5F95A 3GFEA 2JIVA 3C9WA 4E1ZA 4IJPA 3IONA 4DBNA 4DLJA 1V0OA 2XCHA 2PTKA 4JOAA 4JR3A 4FTUA 2OH0E 4ZTRA 3SA0A 4J98A 3Q52A 4ZSAA 1OKYA 4BDJA 4QTAA 1LEZA 3WE8A 5CU6A 4HGLA 5A6OA 4USEA 3TNHA 1OUYA 1BUHA 2PYWA 3AD6A 4RWIA 3P9JA 3R8PA 4AA0A 4BBFA 4XH6A 4HGEA 2C0IA 3EFJA 3FKOA 4FV0A 4G3GA 4J8NA 4XMOA 4C4GA 5DMZA 3NEWA 3Q6UA 4CZUA 5CNNA 5CASA 5AAEA 3GT8A 5AUUA 3UOLA 2XKFA 3MDYA 1PXKA 2C68A 5FDPA 1XH8A 3E7VA 4KIOA 4KIKA 4JRVA 4EOIA 5IH6A 4LYNA 5L6PA 2BRGA 3MA3A 4GFGA 1B6CB 3GU5A 3HV7A 2J0KA 4MNFA 2W1FA 5GZAA 3I0OA 1CKJA 3MB6A 5EM7A 2VO0A 3GQIA 3VS1A 2YJRA 4ZLOA 3N4VA 1WBPA 2BZKB 4Y95A 4U3YA 4LGHA 3OFMA 3CR0A 3HV6A 2WXVA 1YHVA 3NLBA 4S32A 4CRSA 2YHVA 5DRBA 2BZJA 4QTEA 2A2AA 4MBLA 4BDDA 1ATPE 3RMFA 4M8TA 3QYZA 2C47A 1LPUA 1YDSE 2J0IA 4BZNA 3L8SA 4L6QA 5A4CA 3KMWA 3MIYA 5AR2A 2RFNA 1ZYDA 2XS0A 1U54A 3MYGA 5FP5A 3RCDA 5K5NA 2CKOA 4EOKA 1REKA 5L4QA 5AUZA 3RP9A 3CQUA 5M09A 5A4QA 3OF0A 5AIRA 4FT7A 3QGYA 3PIZA 4U44A 3I4BA 4AFEA 4RJ4A 3N9XA 4YZMA 3NX8A 5IQAA 1KE7A 4LGDA 4AACA 2OLCA 4GG7A 3NZ0A 3R63A 4FVRA 4XBRA 4D2WA 3MFRA 4BZDA 4BI1A 3EYGA 2VTQA 2YJSA 3U51A 3PIYA 3T9TA 4PDPA 2OU7A 3OY1A 3TV7A 4CEGA 3C4CA 1ZY5A 4IZYA 3BLQA 3C7QA 3I0QA 1YRPA 3G9NA 5AFVA 5DFPA 3NPCA 4IDVA 2ITXA 3ZEPA 3NUPA 3UMWA 4ZZNA 2XRWA 3TT0A 5CEQA 5M4IA 3PFQA 4W4YA 3GU6A 4IZ5A 2P4IA 4AN2A 2OXXA 3BLRA 4LV5A 1JSTA 3B8QA 3FMMA 3MIAA 4K2RA 2AC3A 3FMNA 4P7EA 5HBHA 2VO3A 3T9IA 2XJ0A 4QNYA 4XJ0A 2CLQA 2QOFA 2UUEA 3VUKA 2A27A 3UZTA 4FBXA 4Z7HA 5LWNA 4NCTA 4FKGA 1JOWB 4BIEA 3VUIA 3DCVA 2J0MB 2WQBA 2PE2A 3H10A 3Q53A 3NNUA 1WBSA 3QTZA 2QHNA 4MXZA 4O0TA 3LLTA 3E87A 3D94A 5LOHA 5CEMA 3CY3A 2CLXA 3DKGA 4QP6A 3FLWA 4RLKA 4FSNA 3UBDA 1MUOA 4C61A 4GMYA 3W2SA 3TN8A 4DC2A 1U46A 4EK6A 4CD0A 4A07A 1PRYA 3FPMA 5J79A 1XO2B 5HTCA 4KKHA 2IWIA 5IQDA 3Q5ZA 2JKKA 4O0UA 1F3MC 1ZWSA 1J91A 4AW0A 4YJNA 1Q4LA 4D4YA 3A7IA 4Z16A 1CKIA 3MFSA 4GV1A 4MEDA 2QCSA 5DEWA 3IDBA 2HZ0A 4FUXA 3AXWA 5DT3A 5GZ8A 3MPMA 4QMNA 3ATTA 2HXQA 2OSCA 2X7FA 4MXOA 3FI2A 1TQPA 4WBOA 3TM0A 3KCKA 3PG1A 3S3IA 1W98A 2WMAA 2CGVA 3W55A 4GSBA 5HD7A 4L3LA 4D0WA 1O6LA 3ORMA 3SD0A 2XYNA 2ZDTA 3Q5IA 5CXHA 5DWRA 3OUNB 3ZM4A 1W82A 3A7HA 5EG3A 4DEBA 5IQIA 4EC9A 2YIQA 5HEZA 1RQQA 4R3CA 4TRLA 3C4EA 3DQXA 5A3XA 4QMUA 2BFYA 3ZRKA 3E62A 1R0PA 4H1JA 4LGGA 5M51A 4KWPA 4O22A 4ZTSA 3FMLA 3LM5A 5L2QA 2YERA 5CY3A 4OAUC 1U5QA 4FG9A 3V5WA 4IHPA 4EZ7A 1OIUA 3ZFYA 4TYHA 3F66A 5ETAA 3RNYA 1OL1A 3A2CA 3T3UA 3UC4A 2CGUA 2DYLA 4FTKA 2PVRA 3HP2A 3OWPA 4OLIA 4QMPA 1KV2A 3HP5A 3QZIA 2ZMDA 4GW8A 4FIJA 2IVVA 3D2KA 4I5CA 4P4CA 4BB4A 4ORKA 3R8MA 3ZRLA 2UW8A 3UP7A 2Z7RA 3OXIA 3QQLA 4RVLA 5J8IA 3TIZA 2XNEA 4Q5HA 2I0HA 4AOTA 5AV3A 5BYZA 2BKKA 1DI9A 2WD1A 3NCGA 3ZLWA 3RAHA 3WZKA 4LL5A 4RMZA 4X2GA 4ASDA 5CZIA 3QX2A 4CQEA 2I1MA 5HORA 1ZOEA 3ZLSA 2UZDA 3LCTA 4LQMA 4IAZA 2BUJA 4ZTQA 1FMOE 2PUNA 3BHYA 4CFFA 4F0GA 2BDWA 4U42A 4BL1A 5AR5A 4AT3A 3G33A 2F2UA 3ALOA 3NYOA 3PLSA 3COIA 1Q41A 4IANA 3COHA 4UZHA 3AC1A 1E1VA 4HNIA 5DGZA 2VWYA 5DVRA 3RBWA 3TWJA 3Q2JA 4FZFB 2YITA 3EZVA 3HZTA 3B2WA 4JDJA 4XV3A 3RK5A 2VO7A 1ZMUA 3HUBA 2CNUA 2W0JA 3LCKA 3ZXTA 4XG3A 3QRJA 2B9FA 4PQNA 2R3OA 2B4SB 1B38A 2UZUE 2WGJA 5AAGA 5E8ZA 5H9BA 4N6YA 3CTJA 5KCVA 1IEPA 2EXEA 4M15A 1BMKA 2OBJA 4E4XA 2FO0A 3TUCA 5HTIA 2ITQA 5L2SA 4S30A 3TNPC 1VYZA 4FIFA 2J2IB 2WMTA 1PMVA 3GCVA 3LZBA 3QA0A 4MXYA 5EDPA 4ZTMA 3L1SA 4JQ7A 2HW6A 4TWOA 1ZXEA 4KS7A 3WYYA 1Q99A 3PIXA 4S33A 4Y72A 3VJOA 3MY1A 3DGKA 4R1VA 1Y8GA 4PV0A 4XYFA 5KZIA 4C57A 4CV9A 3BE9A 5BMMA 4RA5A 4FL2A 4EKKA 2A0CX 3A7FA 3IW6A 3K3JA 4FIIA 4L7FA 2CKQA 3P23A 3QTXA 4EBWA 1H00A 5BYLA 3R21A 4I5HA 4BICA 2QR7A 3ZYAA 1OVEA 2BHEA 4O7ZA 3OVVA 1VZOA 3A61A 2OF4A 3EQDA 3BQCA 2HXLA 5EW3A 3D5WA 4C0TA 3IW4A 2JBOA 4L45A 4DGGA 4EZ5A 4RX5A 4G6NA 1IA9A 2J4ZA 1JSUA 2OJIA 3KRJA 3L9PA 4FOCA 2GNLA 3DU8A 4IAYA 5FQDC 3WILA 3LHJA 2R64A 5M57A 1NW1A 4FEWA 1W8CA 4LI5A 4YZBA 5KBQA 2C6IA 3JUHA 3OCGA 5DN3A 4RIXB 5ANOA 4TTHB 2XP2A 4KBAA 4MQ2A 4HVIA 4GK4A 3H4JA 3IDPA 3K5VA 4MVFA 3R9RA 4A9RA 2ITYA 4D1ZA 1ZOGA 2ITOA 3KN6A 3QCSA 4S2ZA 4TKSA 4JBQA 3TDVA 3ID6C 3PP1A 1XJDA 5KX8A 4KNBA 2PVLA 3W8QA 2HWOA 2CCHA 2XIKA 3MH0A 3FSKA 3UQFA 3ORLA 5CQWA 3R01A 4YUQA 3OXTA 3G5DA 3TV4A 2QVSE 1J3HA 2CKPA 4TNDA 3DFCB 3SAYA 2FUMA 2C5VA 4MWHA 2UW9A 3TEIA 3NUAA 2XB7A 3LFCA 2PUPA 3EKKA 3QQFA 2XNNA 5L8JA 2O63A 5EYKA 5DIAA 4AF3A 1NXKA 5BVFA 1OL6A 2G2IA 4A7CA 4AT5A 4X7QA 4O7LA 3BU5A 3E8CA 2VWXA 4ZZOA 1OBGA 1LR4A 1ZAOA 2P3GX 3GC8A 4LOPA 3PY3A 2RKUA 5HQ0A 1OPJA 3DAEA 5KZ0A 3R83A 3VNTA 5C8KA 3NGAA 4XP3A 2X4FA 4NJ3A 4BC6A 4CGAA 4FKLA 5CZHA 3DQWA 4FZDB 3ZDUA 4DEIA 3HGKA 4ITHA 3AC2A 2W1CA 3F3UA 5EYDA 2C3LA 2VO6A 3BGPA 5KMLA 4J52A 4NCTC 4O6EA 1GNGA 5CLPA 1Q97A 1UU8A 4S34A 5E8WA 5HD4A 3U8WA 3VUHA 4ASXA 5EI8A 3QFVA 4AS0A 2VWBA 5HX8A 4IM3A 2JDOA 3C5IA 4O84A 3FXZA 1L3RE 2OFUA 2H96A 4RX7A 5IEXA 4I94A 1ZRZA 4ANNA 5FXQA 4RJ7A 3HMMA 3GU7A 1WBVA 1O6KA 2DUVA 4RLLA 2PZYA 2BTSA 2PVHA 4QTCA 4C58A 3W10A 3L9NA 1P2AA 2QOBA 4MWIA 3IQ7A 2R3NA 3PXKA 3S4QA 4Y5HA 4QYYA 3LOKA 3RPYA 1DAWA 4X0MA 2C5YA 4BDFA 4E6AA 4O0RA 2WQOA 2C6DA 2IW6A 3CQEA 5C4KA 3OMVA 5AP6A 3BQRA 3MA6A 3I7CA 3SW7A 4NFMA 3TJCA 4QQ5A 4KKGA 3KU2A 4FV3A 4A06A 3SG8A 4BWKA 1XBAA 3GCQA 4G3EA 5I3OA 5AV1A 4DEGA 4MF0A 4FL1A 4E73A 4JS8A 5D1JA 4C02A 3RAKA 3ENHA 2QLQA 3ULIA 3PJCA 5EH0A 4V04A 4IDTA 2RSVA 3NUYA 5HNIX 2ZYBA 5CWZA 4NTTA 4CTCA 3ZMMA 2B55A 4BDBA 5EM5A 5I0BA 4O82A 4BKYA 3FZTA 3G6GA 4CRLA 4DGNA 2JDVA 3HRCA 3LIJA 1FBNA 5CSVA 3TI1A 3MVLA 4L00A 2W06A 5DYJA 1PYEA 3QTWA 2JIIA 3NWWA 5HE1A 2NRYA 3MESA 4M14A 4BCHA 2PK9A 3BHVA 2YCRA 4XS2A 4GEOA 4UXLA 5F4NA 5FEEA 4O83A 4QYHA 1ZOHA 2PHKA 4CFXA 4IC7A 5CU3A 3LQ5A 4IAKA 2BRNA 4KKEA 4ASEA 4JBVA 2E9VA 5F9EA 2UW6A 3LFQA 4F6UA 3UTOA 2G9XA 2XIZA 5E8VA 4EK8A 5KMOA 2VNWA 3HYHA 1E9HA 3KF7A 4BTFA 1G8AA 2ITWA 2PY3A 4YHJA 4L44A 2C3KA 2R3HA 3JVRA 2J90A 2VTOA 4CZTA 5HNGA 2Y4PA 5DE2A 3UOKA 3WF5A 3VQUA 4BCPA 5D7AA 2IVUA 4EH3A 5CF8A 3QQUA 3QL8A 4R7BA 3Q4CA 4XRLA 4D55A 3I79A 3CGOA 4CKIA 5BVNA 2UZBA 2VWVA 3EOCA 4D2RA 1ZYSA 2HWPA 3RAIA 4ZAUA 2YEXA 4I0TA 4QQJA 4X2KA 3L9MA 3W2QA 3TZMA 3FC2A 2C69A 3KC3A 5HO6A 1ZMWA 2XNPA 4MH7A 4BYIA 2Q83A 3OXZA 3ZZEA 3BI6A 4RC4A 4U7ZA 4BDCA 2YCSA 4M3QA 3PVUA 5IUIA 3HAVA 3FJQE 2FSLX 5DBXA 1P4FA 3PSDA 5EQEA 3VWAA 2QU6A 2JITA 2WQMA 4C3PA 2QURA 3FXWA 2QC6A 1U4DA 1SNXA 4NW5A 3DV3A 1DS5A 3SX9A 4HPTE 5CAUA 3PLAE 1OPKA 1IR3A 2XK8A 3IOPA 2EB2A 2C5OA 4AZEA 5KMMA 5IA1A 4APCA 1PF8A 2NPQA 4BCNA 4LFIA 4YJRA 5K0KA 4YJSA 5IEVA 4C35A 2I0EA 3QCYA 3F5XA 5AA9A 4LV8A 3MY0A 3V8SA 5M56A 3GGFA 2GCDA 4WRSA 5E91A 4EOLA 5L6OA 1ZY4A 4NM7A 3FZOA 2GNHA 3ETAA 1Q3WA 2LAVA 2I40A 2YDJA 3F5PA 4H36A 3NYNA 4W9WA 1G3NA 5KMJA 5E4HA 2BILB 3UPXA 1Q5KA 2OJGA 4ACDA 3SV0A 4XBUA 2X8EA 2X8IA 2YIWA 3FC1X 3O8PA 2ZB1A 3R7GA 3EWHA 3I81A 4KS8A 3CIKA 3AD5A 4FK6A 1GOLA 3MBLA 2WPAA 4IWPA 1MQBA 3R9OA 2OZAB 5HICA 4RC3A 4BDHA 4C8BA 2Y9QA 4RIXA 4EOOA 3KEXA 2WFYA 3QZFA 2VV9A 2VRXA 2O0UA 2WIPA 3A62A 4HYSA 3IGGA 4CG9A 2LGCA 3FL5A 2A1AB 5K4IA 4EL9A 5J7BA 4PPAA 2V55A 2BFXA 3KMMA 1UNLA 3V6RA 3VIDA 4AE9A 3P0MA 4K8AA 1Q62A 1R1WA 1JAMA 1OITA 4X6RA 2HK5A 2YZAA 5IH5A 3UIBA 4JLCA 4DFYA 1P5EA 5CT0A 5HG7A 3ET7A 4ZOGA 3ZSHA 3SOCA 2EVAA 2JGZA 3JS2A 1F0QA 4G17A 2VTJA 1GJOA 3FI4A 2QLUA 1YXTA 2YDKA 4H3QA 5D41A 5FM3A 3NNWA 5HG5A 3FI8A 2FVDA 5AP2A 3LQ3A 3K5UA 4GJ2A 5AMNA 3E8DA 1ZZLA 2A19B 4FI1A 4BCIA 1OL5A 3NIEA 1Y6BA 3UIUA 4F9WA 3DBQA 4D28A 2GNFA 4CTBA 1JNKA 1YI6A 5HE0A 3KRXA 4U41A 4LMNA 3TTJA 4DYMA 3TNQB 2BHHA 3OW3A 1E1XA 4I4FA 4PMSA 4WD5A 2BDJA 1SVHA 1FMKA 5AM7A 4IB1A 5EM8A 4TYJA 2IVSA 3OBJA 2WTVA 1OKVA 3ORIA 2JAMA 5FBOA 4N70A 4Y73A 2G01A 1JBPE 2WMRA 4IE9A 4LOQA 4FKOA 4OTDA 5E1SA 2NO3A 3FY2A 5ACBC 3ROCA 3ZFMA 4F7JA 2OW3A 4L3JA 4QQCA 4DG2E 3HNGA 4YLLA 1QPCA 2NRUA 2XMYA 4ZLZA 4AA4A 4OAVB 4FKIA 2PVYA 3U9CA 2Q0BA 4I93A 2XNGA 2ITPA 3BZ3A 1IA8A 3QU0A 3QD4A 3QHWA 4AWIA 5BNJA 4JBPA 3P86A 2PUUA 3D5VA 2EWAA 1Q8UA 4V0GA 2BZIB 2QOHA 2WTWA 5LMBA 4L9IA 3AT4A 4F9YA 5L8KA 3QXOA 4QTBA 4YTCA 1FPUA 5IH4A 2QO2A 4F7SA 2ZV2A 4O2ZA 4K1BA 3ACJA 4EQMA 3UJGA 4Z3VA 2R3JA 5FM2A 3KXMA 5BVOA 5I9WA 4MF1A 4NWMA 4GUEA 2XH5A 2JKOA 5HVJA 4FT3A 2QQ7A 2BRMA 4DINA 4PRJA 3V5QA 3U87A 1PXOA 4MCVA 5JQ5A 2XVDA 3P78A 4JBOA 4AUAA 4PNKA 4RVKA 3QCQA 2UZEA 4TYHB 2R0IA 5CU2A 5AUTA 4FE2A 4B9DA 4G5PA 3RPSA 2J50A 2RGPA 5CS6A 4ANOA 4BTKA 4ITJA 4FGBA 2VWUA 4MD8E 1XH6A 4G6LA 2GNJA 1PKGA 4QP7A 3MWUA 4BI0A 5TO8A 3FMDA 5JRQA 3ORZA 4TY1A 4YJPA 3KQ7A 4ZJJA 3UPZA 4HNFA 3NAYA 4FNWA 3Q96A 4AW2A 1YDTE 1H1SA 2OF2A 3ANRA 4YC8A 1FVRA 2WMWA 5AR7A 4CV8A 4X2NA 3DXNA 4K77A 4MBJA 2WU6A 4FSMA 4EONA 4CCUA 3RWQA 2WTIA 4FSYA 5CYIA 2QD9A 2XZSA 3TIYA 4EI4A 3LKMA 2C6LA 2GNGA 5LQFA 4JAIA 1Q8ZA 4F6SA 3KRLA 5F94A 4IQ6A 5JEBA 2FH9A 4PMPA 1GIIA 3I6UA 4G5JA 5EHYA 4UMUA 3EFKA 4OW8A 3KXGA 1M2PA 5D11A 3G2FA 3FLNC 3FV8A 3POZA 2WMUA 4XNEA 4NU1A 1F5QA 3DNDA 1NVRA 4JQ8A 5FBNC 4FSRA 5IUGA 4FTRA 5A14A 3QD0A 1KE8A 4FNZA 4IM2A 4NSTA 4FT9A 4J53A 2QG7A 5JGAA 3GCUA 3C4ZA 2QOCA 4FKTA 4L42A 1VJYA 2WTKB 3UYTA 2WMQA 1A9UA 3QQHA 3KMUA 3KVXA 4E5AX 4DITA 5H3QA 3KREA 1YWVA 4I6QA 2PULA 4XV9A 4C4IA 3O0GA 1TQIA 3LFNA 1AQ1A 3R28A 4KABA 4CYIA 4DFNA 5TR6A 5DI1A 3UYSA 1GZOA 4DAWA 1V1KA 4C4JA 2HZIA 2YIRA 2R3IA 4ZIMA 4EWHA 4O7SA 2Z02A 4EEVA 3LW0A 1VEBA 3RPVA 3E8NA 4JX3A 3QZGA 5DNRA 4U81A 4OBQA 1H27A 2OIQA 5FXSA 3QALE 5CNOA 4V01A 3JVSA 3Q9ZA 2BKZA 5DT0A 4TYIA 4YJTA 3W33A 2FYSA 3QRUA 1CKPA 4H3PA 4L7SA 1TVOA 2R2PA 4U0IA 1OI9A 2Z7QA 3R9NA 4IIRA 4PL5A 3K2LA 2C6KA 3BHTA 2OIBA 1H8FA 5FP6A 2ZB0A 3W16A 1H1RA 5IU2A 1OMWA 2R7BA 3H9FA 4I6HA 5HLWA 3V5LA 5GHVA 3LFEA 3FBVA 1NVSA 5CSHA 5BQ0A 3D5XA 1Q61A 3NW6A 1OIYA 1HOWA 2JLDA 3DBEA 3WZEA 2UW7A 4CSVA 4I41A 4WNPA 1QPJA 3SW4A 4R77A 3A60A 4LRJA 5J5TA 4O7NA 1IAJA 3RM6A 3MFTA 1Q8WA 4F9CA 2XF0A 3TXOA 4KA3A 1FGKA 4FTQA 2ERKA 4C2VA 4F9BA 4RA4A 4KINA 5ETIA 5HBEA 3VS4A 4HYHA 4FC0A 3F69A 2EXMA 3L8VA 4GRBA 4YNOA 4BIDA 4GKHA 4FSTA 3W32A 3R0TA 4EHGA 2QO7A 4X3FA 5HE2A 4IEBA 4XG4A 3LJ2A 3NS9A 5LARA 3MSSA 3CE3A 2PPQA 2X39A 3T3VA 3UOJA 5KMIA 4FGRA 4DGMA 5EK7A 2V7AA 4IVBA 4KSPA 4F1TA 4EH7A 4PDYA 4PTCA 2OZAA 3LCDA 3OEFX 3FYKX 4I20A 1BKXA 3L9LA 4K6ZA 2XBAA 3TV6A 3FZPA 4QMYA 3TKUA 3WIKA 3VF9A 3R02A 2WQEA 4ACMA 3SXSA 2FSMX 3ZZWA 3VS0A 1H08A 5IA5A 2HCKA 3OTVA 2VX1A 5IQFA 3UNJA 1JKTA 3LFBA 2ETRA 3BRBA 3D14A 2AYPA 2PZIA 3OWKA 4FV7A 4MTAA 3R71A 4AQCA 3ORTA 3WOWA 4YBKA 4E3CA 1RW8A 4NFNA 4HVHA 2ERZE 1UV5A 3BEGA 4FSQA 5DR6A 4FKJA 5T3QA 3MJ1A 3EN4A 1PXNA 1ZARA 3MN3A 3EFLA 3E7OA 4FV5A 4DEEA 2PL0A 4MHAA 2O64A 4IZAA 1XBBA 5IMEA 2YABA 4E8AA 3NYXA 1Z57A 2YM6A 3FSFA 3R7UA 4CKJA 3KVWA 2XK4A 4TNBA 1OB3A 2UZNA 2XYUA 2OWBA 4L67A 5ANJA 4EHVA 5J1VA 4HGSA 2XCKA 1YXUA 1FVTA 2JDRA 3O71A 3A99A 2QKWB 4RRVA 4WRGA 4HGTA 5AR4A 4RWLA 3GOPA 3JY0A 1GIJA 3AC3A 4HCVA 4JXFA 3P7BA 3W18A 1DM2A 4CMUA 3OG7A 2ZAZA 3EQIA 5C8MA 4PY1A 2Y4IC 3C0GA 4GVAA 2C30A 1H4LA 3ZO3A 4M69B 3BYMA 3RKBA 3DLSA 3KK9A 3Q6WA 4BGHA 5FWKK 2W1EA 2XNOA 2QOQA 4DFZE 2CGWA 1SM2A 2FB8A 3WF8A 4EC8A 2PUIA 4EHEA 5I9ZA 2CMWA 4QRCA 1I44A 4ZTNA 2UZTA 5LWMA 3KF4A 4ITIA 3L8PA 4FK3A 3SC1A 3QLGA 4F64A 4QQTA 1J7LA 4DCAA 5TT7A 3C4WA 5FTGA 4D1SA 5CEIA 4ASZA 1PYXA 4DN5A 5LMKA 3OT3A 4NKAA 3UVQA 5CAQA 2J7TA 3VJNA 2IVTA 2C0OA 3ZFXA 3FZ1A 4F09A 3EN5A 3OW4A 4BIBA 1DAYA 1CM8A 4GG5A 1YW2A 4XG2A 4M0YA 2XBJA 2YAAA 2ZVAA 3NUSA 3LCOA 1SMHA 3QD2B 5LJJA 4FYNA 4D4VA 3BYUA 3ZRMA 5A46A 4NM5A 3V3VA 4IBMA 4D4SA 5JFXA 4G3FA 4C3RA 2QOIA 2B1PA 4ZXTA 4GT5A 1Y6AA 3CS9A 4F7NA 2XNMA 1W84A 1W7HA 3DJ6A 3UG2A 3WF6A 1VYWA 1OM1A 3VUMA 4CFMA 5K9IA 2HOGA 3MW1A 3Q9YA 4N0SA 4V05A 3TZ7A 4DG3E 3O7LD 4KAOA 5CENA 3ZOSA 3MVHA 2XK7A 4K0YA 1G8SA 4A9SA 2ZM4A 3PTGA 3BCEA 4ID7A 1H01A 1V0BA 4Q5EA 2ZV9A 4EYMA 1JVPP 2CJMA 1PW2A 3HUCA 3DK7A 4HPUE 2PWLA 4EH4A 3VBQA 3ZO4A 4RIYB 1SYKA 3QLFA 4J96A 5T68A 3BWJA 3ZCLA 1STCE 3KXNA 4M13A 2XK6A 3TUDA 2ZV7A 4F0FA 2WQNA 4FT5A 4O0VA 4Q9SA 4UZDA 4KIPA 5F20A 4GFOA 4AAAA 5J95A 4FL3A 1ZYLA 3EIDA 4WHZA 2BDFA 2YDIA 3FXXA 4FUYA 4C3FA 4ENYA 4A4LA 4W8EA 3Q3BA 3KB7A 3SKCA 3EZRA 4OTPA 3H0YA 1M17A 1H0VA 5AIKA 3ZSGA 4QPSA 4ALWA 4R1YA 5ANDA 3R7VA 4DF3A 2RL5A 4IX4A 3EQCA 3IW5A 2CDZA 5AX9A 5KMKA 3QHRA 1H25A 3R1SA 3GB2A 3VUDA 3U54A 5GJDA 3RI1A 2ZM3A 3MV5A 4JL9A 1KE9A 2VWZA 1YKRA 4NM3A 5HVYA 3Q4TA 2YWVA 3PXFA 5KUPA 3LQ8A 3NVMB 4UWYA 4U80A 4P5QA 2YM3A 4WOVA 3BIZA 3UODA 5EYMA 1OKWA 4AGDA 4EYJA 4CFNA 5EDRA 5DA3A 3DB8A 1QPEA 3FQEA 4IX5A 4TYEA 3WZUA 3R04A 3OUKA 4P90A 3F3WA 4D58A 3QX4A 3QTIA 3QQJA 4WUAA 2PVJA 2ESMA 3OCSA 4QP8A 4C2WA 5D9HA 4OTHA 4OTIA 5AUVA 5LVNA 3PPZA 3QTRA 2P2IA 3FHIA 3LJ1A 4H1MA 4CXAA 5ANGA 4EZ3A 3CTHA 3FPQA 4WIHA 4RBLA 4XG8A 4ZP5A 3O50A 4EORA 3RINA 1KOBA 4D2TA 3IPHA 3W2OA 4YLKA 3OOGA 3HDMA 4E5BA 2WAJA 1I09A 2X2KA 3MPTA 3O8TA 3FLZA 2XJ2A 2YM7A 1WBOA 4FKWA 2OXYA 3FMKA 4BF2A 5M44A 2V62A 3DLZA 3UC3A 4DHFA 3AMYA 3AC5A 2XEZA 3MVJA 5CU4A 4OBPA 3KXZA 2VWIA 2XIXA 3G0FA 3TNWA 5IG1A 5JQ8A 3D7TB 4F08A 4FMQA 4F0IA 2WKMA 4RIOA 3KKVA 4X3FC 5AP5A 5K4JA 4I1ZA 2XM9A 2R3QA 5FUTA 3EHAA 1GIHA 4DGOA 3KRWA 3DTWA 3IGOA 2FSOX 4I0SA 3WARA 2IJMA 4FTTA 5H2UA 2WOTA 3QRTA 4QMSA 5HOAA 3EQHA 3ZS5A 4BI2A 3QZHA 5HLPA 4YHFA 3C0IA 3F88A 3EN9A 1S9IA 3BGZA 3EL7A 5HU9A 2SRCA 2VAGA 2WTJA 4DFXE 4N6ZA 5CSXA 4L53A 3FMEA 4FTJA 3JYAA 3MH3A 5HVKA 3L8XA 1Q24A 4JDKA 5AAFA 3E64A 4CYJA 3VF8A 3ORXA 5CT7A 2ETMA 4EK5A 4LG4A 2XIYA 2ACXA 4B6LA 4BDGA 3BBWA 2G2FA 4IWDA 4AZWA 3DPKA 4ZY5A 2GTNA 5IMXA 4O7YA 1OIQA 3AG9A 5GJGA 5HIDA 4IZ7A 1YXXA
chains in the Genus database with same CATH superfamily
2B9HA 2W4JA 3EL8A 1W2CA 2PMNX 4EQCA 1NA7A 4R3PA 4CQGA 1NY3A 1Y8YA 3SLSA 4E4NA 3PJ3A 4S31A 4U79A 4ZSJA 3WZDA 4AW1A 4DH5A 2WNTA 1OIRA 1UVRA 2BALA 2Y4IB 3MTLA 4UYNA 4V0GB 4YJQA 5AA8A 4YTHA 4ZSGA 2XAMA 3PJ2A 3BV3A 3QC4A 2VGOA 4L46A 4EUUA 2V0DA 4JVGA 5IEYA 4F99A 4DFLA 4I6LA 3NNXA 5FD2A 4TWCA 1ZYJA 3PSCA 3ITZA 1YDRE 3KULA 4GT3A 4QMVA 2WMBA 3QQGA 5CI7A 4WT6A 4BN1A 4IFCA 3NMUF 2YCQA 2XK9A 2C1BA 4YNEA 4UXQA 5BYYA 2R3PA 5JGBA 2W5AA 3QQKA 4TN6A 3R2BA 5CVFA 5HU3A 5D7VA 2JAVA 4QOXA 5J1WA 5AP3A 1OBDA 2VTLA 2ONLA 4F4PA 2PZRA 2EUFB 3PA4A 3U4WA 3ZEWA 3W2PA 5AR3A 3VRYA 4Z55A 3FHRA 4XG7A 4UN0C 2R7IA 4A9UA 4FV9A 4M69A 3S0OA 4PWNA 2HENA 3PA5A 1M2RA 1XQZA 4ZZMA 4P2KA 5GNKA 5JFWA 3SRVA 4BZOA 3VUTA 2QI8A 4M67A 4LUEA 4USDA 5E90A 4CCBA 4F1OA 4Y83A 5LMKC 2GTMA 3CSVA 1XKKA 3S2PA 3OCBA 1CDKA 3LFFA 4WNKA 5EYCA 4IX3A 2BRBA 5AJQA 4KIQA 3QD3A 4FV8A 4L43A 2VTRA 5AADA 4FTIA 2XK3A 4FSWA 4NKSA 3QKKA 2E2BA 4DBXA 3KFAA 4FYOA 4QMWA 3C5UA 1KV1A 4FV4A 3VO3A 4A9YA 4AGUA 4ZLYA 4QO9A 1UWJA 5EHOA 4IC8A 3PRIA 4NUSA 3DKFA 5J87A 3ZSIA 5L2WA 5F1ZA 2QG5A 4B7TA 2VD5A 4IMYA 3HV5A 3F61A 2HIWA 4ZY4A 5GIPE 2YIYA 2VNYA 3GC0A 1BX6A 5HLNA 4LM5A 2YCFA 5BUIA 3GC9A 3UZPA 3QYWA 4RPVA 5FGKA 3R6XA 5L2IA 3BL7A 2F2CB 3DJ7A 4WBBB 2IZTA 3HMIA 1TKIA 2GDOA 4I5PA 4O7VA 3HAMA 5EW9A 3ZH8A 5JT2A 5I9YA 2XALA 2JEDA 1OL7A 3DY7A 5TKDA 2C1AA 3PZHA 4NJDA 2AUHA 5AP7A 2I0YA 3QC9A 1GZ8A 4KBKA 4RIYA 2R3LA 1YOJA 3TJDA 4ZJVA 5JSMA 2WO6A 4IAFA 2KTYA 4J97A 4MAOA 3ORNA 4RWKA 5C03A 4D2VA 3W0OA 5D10A 4FZ6A 3C4FA 4GYGA 2WTKC 4K18A 1YQJA 3FAAA 4QPAA 3M11A 4F9AA 1OUKA 3W0NA 2ITZA 3BV2A 3V5JA 3VS7A 4U97A 2VUWA 2W9FB 4ZY6A 1H1QA 1OGUA 5EOBA 3TTIA 4DTKA 4JAJA 3CGFA 3NUUA 3H3CA 4CLJA 5HO8A 4BWPA 3RWPA 3UO4A 4BCMA 5B7VA 3O51A 4PDOA 2GPHA 1YXSA 4GFMA 4RQKA 1UWHA 3O7LB 4AN9A 3LAUA 5FXRA 4HJOA 2REIA 1APME 4QP1A 4IM0A 4LRKA 4OT5A 5DPVA 4GU6A 3FI3A 2ZOQA 4IW0A 4FEVA 2W5BA 3BU6A 3CY2A 4DEHA 2BROA 3FLSA 4IADA 2XUUA 4LMUA 4O4CA 4AFJA 1Y57A 4FIHA 3Q32A 4AW5A 4RVTA 1H28A 4YZCA 1NT2A 3CPCA 2GS7A 2OJJA 2JFLA 1KWPA 2PE1A 4R6VA 4ZS0A 2RF9A 3PXQA 3MPAA 4QYEA 4DCEA 3UP2A 2VX3A 3UOHA 3DXPA 2QKRA 3EKNA 3QKMA 4BBMA 4MNEB 4H39A 4TL0A 4HVSA 3EQGA 4X3FB 4C37A 5EKOA 4O1PA 2BTRA 3POOA 1YXVA 2BAKA 2WMSA 3BHHA 3ULZA 4L8MA 3D9VA 3C51A 1XBCA 4XOYA 4LV7A 4NZWB 3ZO1A 4FIEA 3OTUA 1L8TA 5IQCA 3BLHA 4FTAA 4NW6A 3HA6A 3VS3A 4BHZA 3B8RA 4WG3A 3UG1A 5J9LA 4U45A 3HRFA 5KHWA 4R5SA 5ETFA 3ZC5A 1PMUA 2F7EE 2GHLA 4I0RA 2R3RA 4EUTA 2QODA 2W05A 3LE6A 5M4CA 4J8MA 4R3RA 2BMCA 1G5SA 2UW5A 4O0XA 4TT7A 5HCZA 5A9UA 2CNQA 4IX6A 4PL4A 4F65A 3EMGA 5E8XA 1WBNA 2XJ1A 2XNBA 2YACA 2PVKA 3D7TA 1PMEA 2OI4X 4OUCA 4AZVA 5CTPA 3COMA 1KUTA 3G0EA 3LFSA 3LXKA 2IW8A 3PDTA 2W4KA 2BVAA 3MB7A 4AG8A 2G2HA 3GQLA 3F7ZA 1PKDA 2X0QA 1A06A 1RE8A 1R3CA 4O6LA 2WB8A 3DBDA 4QTDA 4U5JA 3FQSA 4NIFB 4B0GA 1FINA 4FZ7A 4PF4A 4B99A 2VWWA 4EH2A 4ZK5A 5A4TA 1ND4A 4UMQA 2XARA 4DT9A 2YM8A 1J1BA 3K54A 3QGWA 3OBGA 1UU7A 2UW4A 3E8EA 3GI3A 1R78A 4FVPA 4GIIA 4FNYA 4RJ8A 1URWA 2PMLX 2J0JA 3R7OA 3HEGA 2B52A 4YR8A 2EXCX 4NT4A 4GYIA 3PUPA 4Z7GA 5I9VA 5IQGA 3H30A 3BBTB 4K9YA 4TPTA 4RWJA 3CP9A 5IQBA 4ZTHA 3WF9A 1PY5A 3PXRA 4OTGA 3UDSA 1H07A 4IVAA 1O9UA 3FUPA 3ZONA 3DKOA 1REJA 4BGGA 4I6FA 4KD1A 5EFQA 4EOPA 3JPVA 2ZFYA 3N4TA 4FV1A 3REPA 3SXRA 2YFXA 5EQYA 5C26A 1M2QA 3P5KA 4ZSLA 5M06A 5ETCA 1PHKA 2PMIA 4GUBA 4LRMA 2HY81 3BYSA 1VR2A 2CKEA 4FT0A 2IEWA 3EJ1A 2ETKA 4BKZA 4G2FA 3W8LA 5JZJA 5JFSA 2C5NA 3PY1A 1XHAA 4EJNA 4DA5A 4TWPA 3KK8A 1YWNA 5CXZA 2YAKA 4U9AA 2ONLC 1MRVA 4AXFA 4D9TA 2OJ9A 4DTBA 4ACGA 5H8EA 4YPDA 4J1RA 1URCA 4Y8DA 4UEUA 2Z8CA 4QPMA 3OS3A 4IAAA 4EK3A 1YI3A 5DEYA 2C6EA 5AP1A 4IB5A 4AT4A 3BYVA 4R7IA 5HBJA 3QWKA 4O96A 4Y85A 3PRFA 1HCLA 2F4JA 4G3DA 2C3IB 4Y5QA 4DTAA 3RK7A 2GHMA 3QKLA 3G90X 2DQ7X 4L52A 3UGCA 2WMVA 4BHNA 3W0RA 5AM6A 2BIYA 4FTCA 4PL3A 2R0UA 2GFSA 1JKSA 3E92A 3EQBA 2R5TA 3FZRA 3IDCA 4YP8A 3WYXA 3LM0A 4XG6A 5E9EA 4PNIA 3PE1A 3O23A 2PVFA 4QT1A 4UALA 1YOLA 1Z9XA 5L6WL 5A4LA 4K33A 2RIOA 3E3PA 4BJJB 2X6DA 1ZYCA 4C34A 4YMJA 2VGPA 2FGIA 4HW7A 5ITAA 4G3CA 1W83A 4CZYB 4BR3A 2W99B 2YM5A 4EWQA 5L3AA 5HZNA 4JG8A 2XRUA 4PUZA 2G1TA 3HVCA 3P79A 4R5YA 4FNXA 4BY9E 3ERKA 4YGAA 3OWLA 4N4SA 3PJ8A 1UKIA 4BCQA 3NVKI 2CNVA 3QAME 2VX0A 3U9NA 5FTQA 1XH9A 3PWYA 3HX4A 5CX9A 3TYKA 5A4EA 4XG9A 4UMTA 4FKPA 4R7HA 3BGQA 2HELA 3QA8A 5G6VA 4KRDA 4QMMA 1Q8TA 1GZKA 3ZXZA 3OT8A 5JZNA 3W2RA 2C5XA 2XA4A 2Z2WA 3UDBA 3VHEA 3PE2A 3NFFB 3RM7A 1PMNA 3FMHA 3Q4UA 3DK6A 1T45A 2J6MA 1XR1A 4BDKA 1M14A 5HGIA 3VVHA 1EH4A 4KB8A 4FZAB 5H8GA 3QUDA 3SGCA 1WMKA 2ITNA 4QMOA 3R7IA 5C4LA 5M07A 1W0XC 1H26A 2C6OA 5LMAA 3ZDIA 5IA2A 4L01A 4MK0A 2QOKA 3SHEA 2YM4A 5C9CA 2VTPA 5JFVA 2W7XA 3QTUA 2YZLA 1R0EA 2YN8A 4F78A 2XANA 1P14A 3LJ0A 3GVUA 2JFMA 4IACA 4XOZA 5ANEA 5E8TA 3UVPA 4ANMA 3OHTA 2J9MA 2ITVA 3ZUUA 1BYGA 1YOMA 3HKOA 2VTNA 4BBEA 3PVGA 4CFWA 2JD5A 3IW8A 4G9RA 3TACA 4BVUA 4H05A 3CC6A 2W1GA 4FF8A 4J99A 3VHKA 3GUBA 3ZU7A 4DEDA 2QR8A 4APPA 2G15A 1PJKA 2X2LA 3NRMA 3ODYX 3UIMA 5HG9A 4EOSA 4F7LA 3IK3A 3DXQA 4ZJIA 1OZ1A 4ACHA 3NW5A 3QRKA 4B4LA 3U6IA 4D2PA 1WFCA 5C27A 2R3FA 4RX9A 5AUWA 5IKWA 5DG5A 2IF8A 3A8XA 3C0HA 4O1OA 2IZUA 3IKAA 1S9JA 3AGLA 1QPDA 1PXMA 3DDPA 4PPCA 4C59A 3RGFA 4AZTA 4RJ6A 3OY3A 3F3VA 1IG1A 3CLYA 5M55A 4U6RA 5BVWA 3VN9A 4FTLA 4YO4A 4M68A 4PPBA 3DTCA 4FICA 3ENMA 4O38A 3RVGA 4G31A 4XRJA 4Y46A 3Q60A 2C6MA 4OTWA 4TW9A 4HZSA 2B7AA 1WAKA 1XH4A 3CTQA 3CCNA 3MJ2A 5E8UA 2VZ6A 4CT1A 4HCTA 3E63A 4MNEA 5BV3A 4BTMA 2UW0A 2BZHB 3AT2A 3UNZA 4RIWB 1J1CA 1JQHA 5IA0A 2YA9A 1FVVA 3EFWA 2OGVA 4ALVA 4F70A 5LVMA 3MGYA 2W5HA 2GS2A 5J9YA 4Q2AA 2GHGA 1P4OA 4W4WA 4M12A 4D9UA 4DH3A 4ANLA 3S1HA 3SDJA 2OIDA 4F1MA 2F7ZE 5KKRB 5HI2A 2VU3A 4IAIA 3SQQA 4RJ5A 4E7WA 2W9ZB 5CAOA 4I6BA 2IW9A 5BVDA 4RQVA 3NSZA 2R9SA 4PP9A 2PSQA 3A7JA 1LP4A 3P7AA 3V5TA 3NW7A 3IECA 4QD6A 1X8BA 4AN3A 4D2SA 5ICPA 4AQKA 3HDNA 4EH8A 4AOIA 4ACCA 2JKMA 3F3TA 1SZMA 2R3MA 3QWJA 1H1WA 4E4LA 4E6DA 3H0ZA 2GNIA 4TZRA 1FQ1B 3R7EA 4Z9LA 5DHJA 5KHXA 3RCJA 4GIHA 4NEUA 3R30A 5TF9A 3GNIB 4YURA 4J7BA 2C3JA 3B2TA 3VBXA 1MRYA 5BPYA 3DBCA 4XV1A 4C4HA 1BL7A 3RJCA 4AOJA 4FODA 2I7QA 4JNWA 4NIFA 5ANKA 4X2JA 1O6YA 1XH7A 3Q9WA 4UWCA 2W17A 4M97A 3F5UA 5EDQA 5HCXA 3BU3A 2IPXA 3TKHA 2NYAA 3V8TA 4EHZA 1ERKA 2JKQA 2XKCA 4YZ9A 5TE0A 2X0OA 4MXCA 4EOMA 2W4OA 3KULB 4JIAA 2I6LA 3VBYA 3I7BA 4O2PA 4CMTA 3LMHA 1KOAA 4LOOA 4ZEGA 3F5GA 2OG8A 3G9LX 1WVWA 2R4BA 3ZO2A 1MQ4A 4M0ZA 2EB3A 3AGMA 4CMOA 4I23A 4O0YA 1U59A 3C4XA 5GIOE 3RHXA 2W1IA 4CG8A 3SOAA 5AEPA 3DAKA 4GKIA 3R9DA 3G51A 2E9OA 1M7QA 3GCPA 4QP2A 1GZNA 5HIEA 2Y7JA 3SRVB 4K11A 4BCJA 3IOKA 4JX7A 3QUEA 5KBRA 4O7WA 1Q8YA 4CFUA 4RZWA 4XP0A 2J5FA 4GS6A 5L8LA 2OJFE 4MXXA 3BL9A 2H6DA 3DJ5A 2HZ4A 5CVHA 3ELJA 3CJFA 4UY9A 2HAKA 3VS5A 5BMSA 1RDQE 1UKHA 1YI4A 3AMBA 2P2HA 4IWQA 4ERKA 1XWSA 5L2TA 3R7YA 2GU8A 3GEQA 5LCJA 3GCSA 3DZQA 4TXCA 3MH2A 3UQCA 3WE4A 3DZOA 3FY0A 4XUFA 2Z7LA 4XEYA 4MBIA 3F2NA 1JWHA 2F9GA 4AZSA 3DFAA 4EKLA 4YBJA 3OC1A 3BPRA 4GH2A 3Q04A 4CVAA 3KGAA 2QOOA 3QTQA 4I24A 4QP3A 1JKLA 2VTHA 2B0QA 3W0SA 3ZLYA 4DH7A 2I0VA 5CF5A 2FA2A 3EQPA 3G15A 5AWMA 1T46A 5DRDA 2FSTX 4YC3A 4BKJA 2WEVA 3PXYA 2BAJA 3NYVA 2JDTA 2JC6A 4L3PA 4PP7A 3PY0A 4CFVA 2VTAA 4IWOA 2XKEA 4BCKA 3IO7A 4QMLA 4BJJA 4BYJA 3U4UA 4I92A 4YHTA 1WVYA 2UW3A 5DR9A 1HCKA 3N51A 2CPKE 5CALA 5E8YA 1SVEA 3WZJA 2JIUA 3V51A 4FV6A 5HCYA 5CSPA 4O0SA 1NVQA 2ITTA 5HESA 5J7HA 2RG5A 4ZS4A 2BRHA 4D5KA 4HYIA 2O3PA 4EH6A 1KSWA 5EI6A 3GU4A 2X81A 4YSMA 3I60A 4PTEA 2Y6MA 5DOSA 3ZUVA 4FKUA 2QU5A 1FOTA 2E9UA 2XM8A 5E7RA 3SG9A 3UIXA 3UMXA 3S95A 2QHMA 3D5UA 3CJGA 4RFMA 5CEOA 3F3ZA 3OEZA 4H58A 4NM0A 3CQWA 4EBVA 1JLUE 1WVXA 4UMPA 3LPBA 2PZPA 1M52A 1YWRA 5DH3A 5IDPA 4D1XA 4F63A 1H0WA 4TYGA 3HRBA 5EKNA 4GT4A 3N4UA 3LMGA 2J0LA 3R1YA 1A48A 3VULA 5D12A 4O27B 4W8DA 4EQUA 4DH8A 2BIKB 3BWFA 1ZMVA 3U6JA 3VBVA 1PXLA 1KE6A 3VS2A 5AUXA 5JK3A 2PU8A 3O96A 3H9RA 3A7GA 5B0XA 3V8WA 4RG0A 3CD8A 5I9UA 1WCCA 4QP9A 5HE3A 2C6TA 3LVPA 3VBTA 4MD9E 3OWJA 4XV2A 4FR4A 5IUHA 4QMTA 4IJ9A 5CVGA 5KMNA 3NDMA 3ZC6A 2IZRA 2IG7A 5IDNA 3DT1A 1OGYA 3MI9A 4I22A 2A4LA 4JDHA 5LVOA 2OO8X 4RSSA 1GAGA 2DWBA 4HVGA 4W9XA 2B54A 2CSNA 1UA2A 3PA3A 1J7IA 3UVRA 4RGJA 4C4EA 1PXIA 3O17A 4WNMA 4WKQA 3TKIA 5A6NA 3OROA 2E9PA 4ZMEA 4PTGA 2O8YA 3NR9A 5AV2A 2HZNA 1Z5MA 3ZLXA 4YSJA 3TNIA 3QF9A 4MXAA 4RZVA 2P0CA 3BYOA 3E88A 4AXEA 2WEIA 2X0PA 4MUQA 4W4XA 2RFEA 4XLVA 5HKMA 3AKJA 2GQRA 3QBNA 3DS6A 1K9AA 4UX9A 3C1XA 4WG5A 3FYJX 2WELA 5E8SA 1JKKA 3CBLA 4HOKA 3R8VA 5HIBA 3LCSA 3LMIA 4UV0A 5BVEA 4MKCA 4MD7E 5CSWA 2HY0A 4OGRA 4A4OA 4AA5A 2VTTA 3DAJA 4RIWA 4BWXA 4BDEA 1FGIA 2R3KA 3F6XA 3PWDA 3R9HA 4X6QC 5FEQA 3V5PA 3RPRA 5A54A 5JN2A 3V6SA 4N57A 5IA4A 3NNVA 4FSUA 3KY2A 4JT3A 4GCJA 3PP0A 3M2WA 4HZRA 2ZV8A 2QOLA 4M7IA 4NYEA 4X21A 3UQGA 1Y91A 4O4DA 1LEWA 3RTPA 3CD3A 3NUXA 3BELA 1OL2A 3TCPA 5B2KA 5IQEA 2Z7SA 3NCZA 4FEQA 4JJRA 4E26A 2BPMA 3VC4A 4FA2A 3GP0A 4DEAA 2XEYA 4DGLC 4RJ3A 3ORPA 3HA8A 5EHLA 4FG7A 1YVJA 3AT3A 3I6WA 5BX0A 4R78A 3QXPA 4FOBA 3ROYA 4O4EA 1J7UA 2O2UA 5AV0A 3JXWA 4OR5A 2OFVA 4YPSA 5GZ9A 5IPJA 4UYAA 1GY3A 3PFYA 4M84A 5AV4A 4O4BB 4W4VA 3FKLA 2Y6OA 4E5WA 3R1NA 3MY5A 2PZ5A 4E93A 5K3YA 2OICA 2B53A 4B8MA 5IQHA 3HECA 1MP8A 4U40A 4WA9A 4JG6A 3V01A 3KXXA 4EH9A 3RAWA 4WUNA 3D7ZA 1CTPE 3U6HA 4B8LA 5CANA 3WIGA 3EN7A 5J9ZA 3GENA 3RZBA 5JGDA 3F2RA 2VTIA 5HHWA 5IA3A 3EN6A 3E93A 3RPOA 2OXDA 5CF4A 3UE4A 4RFYA 1JSVA 2X7OA 3PZEA 3HV4A 3QTSA 4ALUA 4BGQA 2Y0AA 1KE5A 2RFDA 2WZJA 5GJFA 4DLIA 3P7CA 3R22A 2E9NA 2YLEA 3BHUA 3VQHA 3ML1A 1ZZ2A 1W2DA 3JR1A 3DKCA 4QMQA 2JDSA 3WI6A 5EQPA 2WTCA 4IB3A 3VAPA 4FKVA 4HCUA 2P55A 4MX9A 2DS1A 3DA6A 3R2YA 5CQUA 2UZWE 4EJ7A 3EB0A 3LXPA 3DDQA 3BX5A 3WF7A 3FZSA 3RK9A 4J95A 4EH5A 4FKSA 4ZTLA 3AKKA 3LFDA 5IF1A 4A9TA 4ARKA 4G6OA 3O2MA 4J71A 3F9NA 2X1NA 4L68A 5FRIA 4AP7A 1WBWA 3BE2A 5HG8A 3TG1A 1CSNA 3D15A 4CKRA 3D4QA 4D5HA 4O21A 4YZNA 1AD5A 1H1PA 2BR1A 2UVZA 4CNHA 4ANQA 2OKRA 3NUNA 2YIXA 4QYGA 3JY9A 3ODZX 3QCXA 3ACKA 5JKGA 1PXPA 1TQMA 5M4UA 4E20A 5IISA 4X2FA 3TL8A 3HV3A 4BDAA 5J5SA 3P5JC 2QONA 3QUPA 4BFMA 5B2MA 3UO6A 1BLXA 2RFSA 3H9OA 5H8BA 4QP4A 3AC8A 4IXPA 3UO5A 2B9JA 3FLQA 5FLFA 3D83A 1BI8A 1WBTA 3ANQA 3AOXA 4GU9A 3R00A 3PVWA 2H9VA 2GS6A 5BUEA 3I1AA 3RHKA 2Z60A 2HW7A 3KXHA 3ALNA 4G9CA 4YTIA 4PMMA 1QL6A 1V0PA 2F49A 2X7GA 4WSYA 3UNKA 4DE4A 2ZMCA 4FV2A 3EH9A 3P08A 2GQGA 2IO6A 5HTBA 2PVMA 2NNWB 3HLLA 4WNOA 3KN5A 3VBWA 4UBAA 4EK4A 4RC2A 1DI8A 3A4OX 3M1SA 2W1ZA 4Q9ZA 3FWQA 4OTRA 3ZBXA 2X9FA 4LL0A 3GU8A 5G1XA 4ZMFA 3ORKA 3THBA 3AC4A 4AE6A 2CCIA 4AGCA 2ITUA 2WOUA 3P1AA 4YLJA 3T8OA 5JMSA 3WBLA 5IZFA 5AX3A 2BCJA 4XHKB 4RVMA 2WU7A 2X2MA 5T6KA 5CAPA 2XKDA 4C33A 4JQEA 3R8UA 4IB0A 5K0XA 2GFCA 3CEKA 4FKRA 4KSQA 2UVXA 5FTOA 1IRKA 5HO7A 1UNGA 3FEGA 2UV2A 4ANBA 3BKBA 5BVKA 4O0WA 2V7OA 4AZFA 1M7NA 3II5A 4FTNA 4KIKB 4R8QA 5E1EA 3W2CA 4O81A 4XP2A 4I3ZA 1MRUA 3AQVA 3SXFA 3BLAA 1U5RA 1IASA 4KBCA 3C13A 3FDNA 4G16A 4JRNA 3F2AA 5CF6A 5E92A 5FEDA 3V04A 3QRIA 4CT2A 4PMTA 2IN6A 4BCOA 2V22A 5KO1A 5I4NA 3IW7A 3D2IA 3FKNA 4JR7A 3VUGA 3ZTXA 4AU8A 4UMRA 5CEKA 3IG7A 5LVLA 3D0EA 4DH1A 3VW6A 5CEPA 4DT8A 4EOQA 3MVMA 2PE0A 2VTMA 3M42A 3O8UA 3RALA 4U43A 4YJVA 3ZBFA 4WSQA 3HL7A 5KNJA 4RX8A 1U54B 4AXAA 2RG6A 3EQRA 3PXZA 4LUDA 4AGWA 4A4XA 4AX8A 4BCGA 5CU0A 3UZRA 5JRSA 5M4FA 3TDWA 3LFAA 4NTSA 5EOLA 3R73A 2CGXA 3BEAA 4XX9A 4U3ZA 1BL6A 2J51A 4QYFA 3AMAA 3G6HA 2UVYA 4I4EA 4I21A 4HYUA 5ACKA 4TWNA 3R8LA 2YWPA 1WZYA 4OT6A 3S00A 2OZOA 2W96B 3LLAA 5EI2A 3PYYA 2OH4A 2W1HA 2Q0NA 4ONAA 2F57A 4UB7A 4ZSEA 5I3RA 2UZVA 2ZM1A 3LXNA 3HMPA 3GC7A 4GL9A 1SVGA 5I9XA 3ZM9A 1H24A 3W1FA 4E4MA 1OECA 2ZJWA 3MS9A 4JIKA 5EM6A 3OOMA 5KKRC 4X3JA 3OD6X 4YJUA 3FE3A 3PPKA 4ANSA 4C38A 2YLFA 4C7TA 3FLYA 4II5A 1LUFA 3TZ8A 3I5NA 5C1QB 3PG3A 4XLIA 5KE0A 4O7RA 3OZ6A 3KL8A 4I5MA 5I5ZA 4D0XA 3A4PA 5JH6A 4O7TA 4FX3A 5M08A 3F82A 4KRCA 5C01A 5EW8A 3PPJA 1K2PA 2F7XE 3VS6A 3Q4ZA 2HYYA 4RT7A 2X0GA 2KULA 3NAXA 1YHWA 3FL4A 3CPBA 1AGWA 4USFA 4DFBA 4QMXA 4FIGA 2H34A 4UWBA 4YO6A 2B9IA 3MH1A 4BDIA 3KA0A 4E6CA 1RJBA 2WHBA 1ZLTA 2ZDUA 2R3GA 5FDXA 5DR2A 2VTSA 5HX6A 4AXCA 4GVJA 3VRZA 4WO5A 2CN8A 4U8ZA 5GINE 3OCTA 4H3BA 5FG8A 3DB6A 5K5XA 3Q9XA 1OKZA 3SVVA 2O65A 4OTQA 3LXLA 5BUJA 3AKLA 3MFUA 2V5QA 2XIRA 2P33A 2UZOA 3P4KA 5AR8A 4FEUA 2PVNA 1UNHA 4JDIA 4AAYA 4FSZA 4E6QA 1OPLA 2JBPA 3HMOA 3I5ZA 4NL0A 4JI9A 2QNJA 3DK3A 4GJ3A 3CKXA 3ZUTA 4FG8A 4BRXA 2OK1A 1K3AA 4PDSA 3GFWA 1IAHA 4IH8A 2WTDA 4RFZA 4ERWA 4YC6A 4FEXA 3NIZA 4IVCA 2CN5A 4NK9A 4WG4A 5LCKA 2NP8A 4EOJA 5LXMA 4FKQA 4FVQA 3U55A 3ZHPC 3HMNA 2J5EA 1R39A 2W1DA 4NH1A 3DOGA 3GBZA 5DT4A 2YISA 1JPAA 4MYGA 2GSFA 2AC5A 4HVDA 5DLSA 3PVBA 4ENXA 4YU2A 1SNUA 3Q2MA 3E5AA 2EU9A 1CMKE 3E3BX 2O5KA 3IS5A 2VN9A 2WIHA 3W0QA 4O91A 4F6WA 4YJOA 3R8ZA 1QCFA 3A8WA 4BTJA 3K3IA 3F7WA 3OP5A 2PMOX 3ATSA 5AP0A 5HNBA 2UZLA 4OBOA 5M53A 2IZSA 2CHLA 4FTOA 2BAQA 1UU9A 2WMXA 3CKWA 4DFUA 3COKA 1B39A 2GQSA 3GXLA 3TZ9A 5LVPA 4CLIA 3KRRA 4GK3A 3DBFA 2QO9A 1YHSA 3TUBA 1QMZA 4G1WA 3FQHA 1ST4A 4GK2A 4C36A 4OTFA 3PJ1A 5AUYA 4D4RA 2X8DA 4PX6A 4C62A 4BCFA 3RNIA 4C4FA 1XMMA 2H8HA 2X9EA 4YTFA 1PXJA 3EQFA 5CI6A 4YZDA 2C4GA 4QNAA 3MTFA 4DG0E 1Q3DA 3GOKA 3CXWA 3KCFA 4G34A 4IFGA 1TFFA 3RZFA 1BI7A 4P5ZA 4JG7A 4IVDA 5B2LA 4M66A 1UU3A 3C50A 5C8NA 5ANIA 3AD4A 3UDTA 3FMJA 3EYHA 5CAVA 3VW8A 4XCUA 1XH5A 2C0TA 4O86A 2X4ZA 2AEGA 4KUJA 4FTMA 5TOZA 4QMZA 2GMXA 5AP4A 3PSBA 4MQ1A 2X6EA 2Y8OA 3DNEA 3R1QA 5F95A 3GFEA 2JIVA 3C9WA 4E1ZA 4IJPA 3IONA 4DBNA 4DLJA 4DHJA 1V0OA 2XCHA 2PTKA 4JOAA 4JR3A 4FTUA 2OH0E 4ZTRA 3SA0A 4J98A 3Q52A 4ZSAA 3VONA 1OKYA 4BDJA 4QTAA 1LEZA 3WE8A 5CU6A 4HGLA 5A6OA 4USEA 3TNHA 1OUYA 1BUHA 2PYWA 3AD6A 4RWIA 3P9JA 3R8PA 2XAOA 4AA0A 4BBFA 4XH6A 4HGEA 4FJVA 2C0IA 3EFJA 3FKOA 4FV0A 4G3GA 4J8NA 4XMOA 4C4GA 5DMZA