3FI4A

P38 kinase crystal structure in complex with ro4499
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
349
structure length
339
Chain Sequence
b'ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSKPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Mapping Binding Pocket Volume: Potential Applications towards Ligand Design and Selectivity
rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
total genus 105
structure length 339
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fi4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fi4A01
3WF9A 2XIKA 3QWKA 3LQ5A 4IWOA 5EW9A 2HZNA 4M84A 4GSBA 4AU8A 1UA2A 1Q3DA 3IW5A 3CTQA 3KKVA 2UW5A 3OCSA 3UBDA 1URCA 2RSVA 4RC3A 2PVKA 3FI4A 4D2RA 2B0QA 2BZHB 4FTKA 3TUBA 4QNYA 1OKVA 5EHLA 3ORMA 4YSJA 4YTHA 3QD3A 4OUCA 4TL0A 4GT4A 4QP2A 4RG0A 3K54A 5HU3A 5E90A 1BMKA 2CSNA 3LFDA 4FG8A 2OJFE 2R3KA 2R3GA 3COMA 1VYWA 5E1SA 1O9UA 4YZCA 3NUXA 5ETFA 4N57A 3R8MA 3BI6A 3R21A 2OO8X 3B8RA 3DKGA 4TWPA 2ETKA 4G9RA 1APME 3S2PA 4H3PA 3FLWA 5FG8A 1V0OA 2X1NA 3VC4A 1W84A 2OBJA 3W8QA 2H34A 1Q8WA 3G51A 3MSSA 2VTQA 4MXAA 4TWNA 4DGMA 4HW7A 3AC3A 4MNFA 4ZY5A 4RPVA 2OH4A 3PP1A 4CCBA 1WVXA 4XH6A 2ITXA 4IB3A 5KMMA 2V0DA 4APCA 3H30A 4KRDA 3SLSA 2BR1A 2CHLA 1JVPP 3KCFA 4WBBB 5JGBA 4BHNA 2JLDA 5AP5A 2J0LA 3SV0A 4ZLZA 4QMLA 2CGXA 3MB7A 2YERA 3BZ3A 1A9UA 3R7GA 4AA5A 2ZV9A 2QG7A 3OTUA 2R0IA 3H0YA 5AUWA 4O1OA 4DCEA 4G3GA 3RVGA 3R02A 3HV7A 4FIFA 2EXEA 3R1YA 3T8OA 4V0GA 3EQFA 5DG5A 4PPCA 5D7VA 2W1FA 4IX6A 3IOPA 3BHTA 2R3NA 3FQEA 4YBKA 5KZIA 2Q83A 5CF8A 2EXCX 3LFCA 3UO4A 4UWYA 1ZMVA 3W32A 5BVNA 4RGJA 2YABA 3VUDA 4WO5A 1TQPA 2XM8A 3BYMA 4CG9A 1OPKA 3SC1A 4KAOA 4BCGA 3EQDA 3LM0A 5BUJA 2IVVA 4NJ3A 4BI0A 3AXWA 4JG6A 1OKZA 1OGUA 1R78A 4MAOA 4TN6A 4CT2A 5GIPE 2XKFA 3PJCA 4QMVA 3S95A 4GJ2A 3PZHA 2R3PA 1ZWSA 2R2PA 2WTJA 1W83A 2ITOA 4G3EA 4WG4A 3WF6A 3U6JA 4JIAA 1LP4A 3UODA 5BYLA 3ZU7A 4L9IA 3IPHA 2EXMA 4EJNA 4R78A 4NIFA 5DT0A 4LMUA 2C1AA 2W1ZA 3HMIA 2JD5A 4ZLYA 5B0XA 4FNWA 3F3VA 3SA0A 5IQFA 4GIHA 3QZHA 5IQBA 4MXXA 3RPSA 3TACA 3AMYA 2F7XE 4ZS4A 4H1JA 2X8IA 1PXOA 3DLSA 1ZLTA 1F0QA 2XNPA 4JQEA 3PIXA 3R8LA 4PF4A 2C6TA 2QOHA 2YIQA 4YC6A 1JKSA 5BVFA 5IG1A 4DT9A 3ZSGA 1VR2A 4CYJA 5DYJA 3LXPA 5IKWA 4EOPA 5C8KA 3KVWA 4QP1A 4MXOA 4XHKB 5F9EA 4CKRA 1NVQA 2WEVA 4DFNA 2WU6A 2BAKA 3A8XA 5AP0A 3L9LA 5HE1A 4FIIA 5CXHA 3FLNC 4O86A 3VS7A 3Q52A 3VO3A 2VZ6A 2HY81 2LAVA 4AN3A 4EI4A 1DAYA 2W1DA 3NNWA 3PE2A 3TXOA 2JDTA 3EFKA 1TVOA 3KVXA 2UZNA 2XKEA 4TNBA 1Y6BA 1GJOA 2CGWA 1YKRA 2X8DA 4FKGA 3C4CA 5TE0A 4F99A 2RFSA 3CEKA 3EKKA 3PJ3A 3QU0A 4YZNA 4E5AX 4I0RA 4S31A 3R7VA 4BBEA 1ZZLA 4PV0A 4CZUA 1BI8A 5KKRC 4ZK5A 3UIUA 4PWNA 4DTAA 3BU5A 2HAKA 3N51A 1H1PA 3HVCA 3S4QA 4IANA 4MNEB 4RLKA 2BCJA 3ALOA 3ZO4A 4FZ7A 1FINA 1JKKA 4E6CA 5IUIA 3ZO2A 3KREA 3D15A 3IW4A 4J96A 4EUUA 1NA7A 2HXLA 4Q9ZA 2UZTA 4CMOA 3FXWA 1RW8A 4F6SA 5IQIA 5DT4A 1YOMA 3QTWA 4BDDA 4IB5A 3ZBFA 4ZZNA 1XH5A 1WAKA 4KRCA 1HCKA 5LMAA 2GHLA 3NDMA 4BCNA 4XG2A 4UYNA 1NT2A 2O5KA 4YPSA 3F3UA 2WQMA 3GCUA 4H3BA 3UNJA 2YDKA 4JDJA 4CEGA 3ZO3A 1I09A 4H3QA 4XG8A 5GNKA 4GVJA 5EI6A 2VU3A 4N6YA 4RJ5A 4EK6A 2XNBA 1H07A 3FKNA 5CU2A 1OB3A 4GMYA 4UX9A 3UZRA 4JRVA 1ZZ2A 2IZTA 4WSYA 4XLIA 2ITPA 4FK6A 1Z57A 5KX8A 3GC0A 4G3DA 4GU9A 5HTIA 3A7GA 2WQEA 4R1VA 4FTCA 3FC2A 5EM7A 5HE2A 3ATSA 3DBCA 3KF7A 3EYHA 4D9TA 4CKJA 3R7EA 3QF9A 4EHVA 4B8LA 4GH2A 5TF9A 5CT0A 3PSDA 1H08A 4E6DA 5LVNA 5CXZA 5DVRA 1Y8GA 4U0IA 3GBZA 5CU6A 4L3PA 3BELA 3TZMA 3SG9A 4PL5A 3DTWA 5E91A 2ITNA 4EH3A 4QPMA 1Q8YA 2JAMA 3QRTA 4J98A 5L8JA 3SGCA 3DDPA 4OBPA 3WZUA 4AW0A 3S00A 2PZPA 2X81A 4I5MA 4XG9A 4KKGA 4HVIA 5B2MA 5T3QA 4ONAA 5DI1A 1ND4A 3I79A 4BBMA 3ZO1A 3UTOA 2FA2A 3EN9A 5DHJA 2EU9A 4AWIA 2UVYA 3NUAA 3AGMA 3SRVA 4QMXA 5C27A 4KD1A 3BHHA 4ZSLA 3LW0A 4D2SA 4C33A 4O83A 3NUSA 2X2LA 3ANQA 2R3RA 2B9JA 2WTKC 4GIIA 4MD9E 4HNIA 3ZUUA 5LJJA 2REIA 3GB2A 3LFEA 3Q4UA 4IH8A 5DEYA 2J5EA 1R39A 4CLIA 5IA5A 2X4ZA 1BL7A 3U4UA 5JQ8A 1U5RA 4MXCA 3BHVA 5E8WA 3QTUA 2QO2A 5IA0A 1MRVA 2VTRA 3E5AA 4QMUA 4MBIA 4NU1A 2W17A 3ZZWA 2JKMA 3OBGA 1KE7A 2C47A 2Q0NA 3IS5A 3O23A 4QMWA 3VUKA 1UVRA 3E92A 4UB7A 3TUCA 5KMIA 3VUTA 4NTSA 2FGIA 4FSYA 2R4BA 2X6EA 5BPYA 4WKQA 3NAXA 3MJ2A 4FSTA 5C4KA 4AT3A 2BVAA 4O2ZA 4ID7A 4PTGA 1NW1A 2W1CA 4ZSJA 4LMNA 3VS4A 2PMNX 4W4VA 3PZEA 4Y5HA 2C5NA 4AS0A 2FB8A 2WFYA 4FV8A 3BLQA 4BDGA 2XIZA 3E88A 2OIQA 4EZ7A 2WIHA 1JAMA 1P5EA 3CJGA 5L6OA 5I3OA 3R8PA 5L8KA 2JBOA 3F2AA 2OK1A 3EYGA 2A27A 3MFUA 4UV0A 2XUUA 3JVRA 3QRUA 4FZ6A 4XG3A 1JOWB 2C0TA 4H36A 4JS8A 5AJQA 4EOKA 3R63A 5EG3A 4IAFA 4PL4A 4FR4A 4JG7A 3VS3A 4BDFA 1BKXA 5EI2A 1RJBA 1PMEA 4ASEA 3F3ZA 2VWYA 4BCHA 3RGFA 3F7ZA 5HQ0A 3FY0A 1FQ1B 2BRNA 4A9SA 4F0IA 1KE6A 1BX6A 1MRUA 1KV2A 3UIXA 4CQEA 3UE4A 2F2UA 5J1WA 4IX3A 4YTIA 3DXPA 2V62A 3PXKA 2YAKA 3PJ2A 2Y4IC 4Q9SA 2VTMA 1ZAOA 2X2MA 4IADA 3C50A 3BE2A 4BWPA 3FZOA 1H25A 3FUPA 4WG3A 2ETRA 3WZDA 5IA4A 1L8TA 4QP7A 1U54B 5BMSA 3FHRA 2Z2WA 4BIEA 3NCZA 5AR4A 5LXMA 2PUNA 2EWAA 2NPQA 5CI7A 5IDPA 4HVHA 3MPAA 4KIPA 4RC4A 1SVEA 2FSLX 5CWZA 2CDZA 4TY1A 3IOKA 4W9WA 3RPRA 3UGCA 4W8DA 4S32A 1ZOGA 4Y85A 4DEAA 3HMNA 4R8QA 5HE0A 3F2RA 5BVDA 3RAIA 4BKYA 5I9VA 2IVUA 1WCCA 2YCFA 4MF0A 4DEGA 4I24A 4WNKA 4Y8DA 4RLLA 2BDFA 3I0QA 2OIDA 3A61A 3PE1A 3HV6A 5ACKA 4NW6A 4D5KA 1J1CA 3VJOA 2V7OA 2EB3A 3HDNA 4IAYA 5M51A 4EOSA 3R73A 3CIKA 4AUAA 5FUTA 2OJ9A 5DGZA 3ORKA 1IAHA 1J91A 2QU6A 4RWJA 3E7OA 3A8WA 4DBNA 5HNIX 3R0TA 3H4JA 1UNHA 2R3IA 2VTNA 4F63A 3MDYA 5CZIA 2XF0A 4WNOA 1ZXEA 2HZ4A 3ZONA 4DYMA 4DCAA 2A4LA 3C0HA 2GNHA 4X6QC 4YHJA 5AUTA 5LVOA 5F95A 3H0ZA 3ROCA 2C3LA 3NPCA 1GNGA 5FWKK 2IVSA 3Q2JA 5BYYA 3NGAA 5EH0A 3KK8A 5A4EA 4M15A 1XH9A 2GHGA 3LCOA 4UN0C 4P7EA 4U6RA 4W4WA 3PA4A 3DCVA 2CLQA 2GPHA 3PRFA 5CNOA 5ETIA 3ZSIA 4O7LA 3OT8A 3VUMA 2RIOA 3NWWA 2OGVA 3EQHA 3O17A 4Q5HA 4FV5A 3MS9A 3GCVA 4LG4A 5KBQA 3GGFA 3ORNA 3L1SA 2BIYA 2CN5A 3OEFX 5M06A 3QTZA 4DH5A 2F49A 2UVXA 3SW7A 2VN9A 3CR0A 5HX8A 4M67A 4EZ3A 4LOPA 2JC6A 1QCFA 3PSCA 4O0RA 2XA4A 2C5VA 2YM8A 3SKCA 2JIVA 4W4YA 1E1XA 3RKBA 4IBMA 3PJ1A 1JWHA 1ZYDA 3NRMA 3KY2A 3QX4A 2HELA 4JXFA 2R0UA 2I7QA 2C3KA 3TI1A 1XHAA 2JFMA 4Y83A 5AADA 4QMNA 3S1HA 4TYJA 4DITA 3D5XA 4MEDA 4OTQA 2BDWA 3UOLA 5CZHA 3KEXA 2GCDA 2SRCA 3U9CA 2H6DA 2OG8A 3IDCA 3AD6A 3VBYA 5KCVA 1BYGA 4HZSA 4LRJA 3SQQA 1OL2A 1FVRA 5AIKA 5HCYA 4A9RA 3CKWA 3QTRA 3QLFA 2CCHA 3AC2A 3V5QA 5HO8A 2GU8A 3JY9A 4R5SA 3L8XA 4E4LA 4C4HA 3LCDA 4WOVA 2B1PA 4FZAB 2VGOA 3KGAA 4GJ3A 5G6VA 1UWJA 3DOGA 2UZDA 2IW8A 4ZTQA 3GQIA 3ORTA 3JR1A 3C9WA 3NUNA 3NVMB 4BC6A 3ORPA 4QMQA 2XIYA 4YZDA 3RAKA 2XCKA 3IG7A 3VHKA 2R5TA 4G3CA 4GU6A 4JAJA 2OZAB 2J7TA 2YM3A 3AMBA 3HECA 4G3FA 4KABA 2CPKE 3D7ZA 3PY0A 4L7FA 1KE9A 4XRJA 1WZYA 4YJNA 5DWRA 3UZTA 2XNEA 3MVMA 1M2QA 1B39A 1DS5A 1XO2B 4Z9LA 3VUIA 2ZOQA 5AMNA 5AR2A 4IW0A 1WVYA 4QMPA 4MF1A 2VUWA 3G0FA 4FZFB 1JPAA 4X6RA 1YXSA 2W5AA 2VTLA 1WBWA 2YDIA 3HRCA 3LFNA 3VF9A 3SXRA 4YO4A 1Q5KA 2R3MA 5J95A 3OY1A 4XG4A 4I23A 4ACMA 4M7IA 4JVGA 1V1KA 4ZXTA 3HP2A 3NZ0A 1ZRZA 5E8VA 3F9NA 5HLNA 3A4OX 3FDNA 4EK8A 3W10A 5HO7A 4DT8A 3E3BX 3QKLA 4HCVA 4D1SA 4H1MA 4USEA 2VWBA 1YW2A 2XKCA 4QMOA 3Q96A 3KN5A 4R3RA 4AG8A 4ITHA 3R7IA 4AQCA 5DT3A 3UVRA 5K0KA 1YI4A 4EKKA 4J8NA 3WF5A 3K3IA 4YC8A 3NYNA 4EH6A 1AQ1A 4MXZA 2GFCA 5AP6A 3FLQA 2BIKB 4UMTA 1UNLA 2R3LA 4UWCA 4RVTA 5D41A 3FZSA 1O6YA 4K1BA 4A4LA 4HZRA 3RINA 2XJ1A 3BHYA 4U41A 2BILB 4G16A 4BDEA 4ORKA 3IW8A 3D5UA 4IJ9A 3II5A 5AP2A 5KE0A 5CENA 4DH1A 4FI1A 5IEXA 1M52A 1Q62A 2X7FA 3V8WA 4USFA 3U54A 5TOZA 2UUEA 2BALA 4FSNA 4KNBA 3AD5A 4K9YA 1EH4A 1ZYSA 5EYCA 3E87A 4F7SA 1WBOA 3G9NA 4RFMA 3R8VA 4EH5A 1GZ8A 4IFCA 3PY1A 4JBOA 3IQ7A 3P7AA 4RX9A 3WZEA 1CTPE 1H27A 3EFJA 1KWPA 1YHWA 2XRWA 5DEWA 2QOFA 2UZVA 3NUUA 2O2UA 4O7SA 2QCSA 3DNEA 3E64A 5K0XA 4D0WA 1XQZA 3HKOA 5HCXA 3FMLA 4X2NA 4LI5A 3R1QA 3G5DA 3EH9A 3PXQA 2J0JA 4JLCA 3GFEA 4MQ2A 5FTQA 1G8SA 4DF3A 4KBAA 4A9UA 2I0EA 4FKQA 3RPYA 2QU5A 1GIJA 4V04A 4AX8A 4YU2A 4AFEA 5AUYA 1MUOA 3OC1A 2ONLA 5JK3A 3GCQA 1Y57A 4NWMA 3FJQE 1WBNA 1PXIA 2H9VA 3QCYA 4FK3A 2Q0BA 3AMAA 4HVDA 2NP8A 4OBQA 4W8EA 4UEUA 5DRBA 3TTJA 1KUTA 4JNWA 5ITAA 4XOYA 4CVAA 5CALA 1CM8A 3BHUA 4B7TA 2YEXA 4GT5A 4P4CA 5FLFA 1U54A 5IQAA 2ZB0A 3D0EA 4RVLA 2GTNA 4IJPA 5CAVA 1REJA 4HPUE 4EOLA 4FSMA 5L2QA 3OFMA 4FGRA 4E6AA 2QG5A 4RFYA 4DH7A 5TT7A 4FGBA 3P1AA 1OL6A 3R8UA 3R7UA 3RNIA 5AV2A 2XNMA 4JRNA 1R0EA 3EKNA 4XV9A 1WBTA 4PMMA 4CGAA 2VTSA 2W1GA 3R30A 2XK4A 4DN5A 1XBAA 5ANJA 2XBJA 3NNVA 1ZY5A 4AZEA 4TKSA 4QMMA 4MHAA 4EOIA 2P55A 4B0GA 4I93A 3PUPA 3KRJA 4FTQA 3VHEA 5J5SA 3LJ2A 4ANQA 1UU9A 4FUYA 3ENMA 2OIBA 4YPDA 3TN8A 3ATTA 1H0VA 3QTIA 2UZBA 4IVCA 4D2PA 2VTJA 5L6WL 5LWNA 2OJGA 2BPMA 3Q4TA 3K5VA 4IFGA 4FTLA 3ETAA 3ZTXA 4FKVA 4FVRA 3IGGA 3SW4A 3MW1A 2WQBA 5E7RA 5HLPA 4BIBA 1MP8A 4FT7A 4F64A 1E9HA 4GYIA 3VS6A 1UU8A 3KFAA 3DBFA 5HO6A 3A7HA 3ZRLA 2OWBA 5LCJA 3ULZA 2R3JA 3LOKA 5CT7A 2G2IA 4YC3A 3EB0A 5TO8A 3V5LA 4C4FA 5GZAA 4R77A 3OUKA 3P78A 3R8ZA 2VX0A 4F1TA 1UWHA 5CEPA 5HORA 4QP9A 5CEOA 4LFIA 4IZAA 2YITA 5E8TA 3HNGA 2YCRA 4HGTA 5GHVA 2C3IB 3BEAA 1OBGA 2GQRA 3BCEA 4E6QA 4JT3A 5JMSA 1WBVA 4OR5A 4DFBA 5IH6A 4NFNA 1TQIA 2ZM4A 3NCGA 4LV8A 2G1TA 4H58A 3ZFMA 5I5ZA 3GVUA 3PIYA 3DBDA 3PXZA 4NCTA 4KBCA 4E4XA 3DQXA 3SHEA 1KE5A 4UXLA 2YAAA 1K2PA 3PLAE 2ZV7A 4O0UA 4BZNA 3CPCA 4BIDA 5IQHA 4IAIA 3KULB 3OCGA 4E8AA 2WXVA 4XYFA 3DKFA 3MH3A 3W8LA 4XOZA 2WMVA 5C8MA 3UOHA 3DFAA 4FIHA 2RFEA 3CLYA 2WB8A 3O71A 4YO6A 1JSTA 4AGUA 4I6QA 4IWDA 4NL0A 1JBPE 3TNIA 5IQEA 4QP8A 4G6OA 4RWKA 1XH7A 5AV3A 4EH9A 4G34A 4N6ZA 1UV5A 2PVHA 2I6LA 3F82A 3U8WA 4OTIA 4DGOA 3ITZA 4TZRA 4EONA 4EYJA 4XX9A 3C1XA 4BKJA 4L8MA 3GOKA 3FSKA 2WMXA 2JAVA 3FMJA 2Z60A 3TT0A 3RJCA 3HL7A 1P4FA 2XYNA 3E8DA 5EM8A 4EOMA 3NX8A 2XK3A 3CD8A 2WU7A 4BCOA 1WMKA 1MQ4A 3BU3A 5AM7A 5KMKA 3TDWA 4DFYA 4EWQA 4XS2A 4ZZOA 1TQMA 4UBAA 2DQ7X 5L2WA 1U5QA 1Z9XA 2PVNA 4AN9A 4XP3A 4DA5A 2Y7JA 3LLTA 4YZ9A 5IQGA 1SVGA 3BYOA 4I0SA 4X2FA 5B2LA 2J90A 3RNYA 4AOIA 5HZNA 3AT2A 4HNFA 2OLCA 4O27B 1VEBA 1U4DA 3D5VA 3ZLXA 5JZJA 5FXRA 2OZAA 2A2AA 3KRWA 3MA3A 4EKLA 5CSPA 3CXWA 4OTGA 1YQJA 2W1EA 2R7BA 4GVAA 4YJQA 4EUTA 4TTHB 1XKKA 4K18A 3AC4A 4E5WA 4I5PA 4GKIA 2B4SB 4AXAA 3PPZA 3F61A 2JDRA 4I41A 3GNIB 4C61A 4KB8A 4CRLA 3FSFA 3Q9ZA 3LVPA 4FSQA 3UC4A 3FLZA 3ZUVA 3FE3A 2J9MA 4QQCA 4MBLA 4APPA 4O96A 4CFVA 3U9NA 2WD1A 5JT2A 5A4CA 4ITJA 3OXIA 1U46A 1GIIA 3G6HA 3POOA 3DKOA 3O50A 1OIUA 2UZWE 4I4EA 4QMZA 3ODYX 3P5KA 4LL5A 1ZMWA 4CMUA 4ALWA 4BDAA 5FTGA 3EZVA 2QOOA 4J53A 4U79A 5HTBA 3NAYA 4WBOA 4ZJVA 2Y6OA 3PVUA 3WZKA 5CASA 5M09A 4YLJA 4IIRA 3UC3A 4E73A 5FBOA 2GHMA 3KRRA 3G90X 4FE2A 4R7IA 1J7LA 2PMLX 2C4GA 1GZNA 1F5QA 3VWAA 3QBNA 4MD7E 3HYHA 1T46A 4M8TA 2QOBA 3FYJX 4BF2A 3RMFA 3G9LX 2VWVA 5IF1A 2AYPA 2XCHA 3HZTA 4FKIA 4F09A 4F9BA 1TKIA 4WRSA 1YOJA 4JG8A 3I0OA 4QD6A 4JQ7A 4FOCA 5CU3A 3E62A 3W16A 4QT1A 1RQQA 4O22A 3REPA 4F0FA 2C30A 4FKPA 4EYMA 1PXNA 4BVUA 2ZM3A 2XBAA 2ITTA 3MFSA 4UYAA 1A48A 3VUHA 3F3TA 4ZMFA 4ENYA 2KULA 4DG3E 2VTTA 4IACA 4OTWA 3A62A 5DN3A 4D1XA 4F9AA 3OMVA 2GFSA 3W2RA 1R1WA 3GU4A 2CNVA 2PTKA 4DAWA 1AGWA 3ZXTA 5KMJA 4I0TA 4MYGA 3KXXA 3ZM4A 4D28A 2X7GA 3ID6C 1PXMA 4AF3A 5L6PA 4WUAA 4JI9A 1W8CA 5HG8A 1YI3A 3D5WA 3MFRA 2G15A 4FV3A 2DS1A 2YM6A 3DAEA 4ERKA 4R3CA 4RWLA 2BHHA 2E9PA 5CSHA 4M0YA 3KXGA 3LFBA 5CX9A 4J8MA 5FM3A 4TWCA 3TIZA 2P0CA 1G5SA 5LMBA 4IM3A 5AFVA 2PVMA 1PXLA 3HV4A 3ZEPA 5IEYA 2X4FA 4XBRA 5DRDA 4ZEGA 3QX2A 4RIOA 4D2VA 3NNXA 3OROA 4M13A 3QXPA 3R6XA 5LWMA 4LRKA 3O8PA 3W55A 3PA3A 3VBTA 4O91A 5F4NA 4EH2A 2YWVA 2IJMA 1H01A 2GS6A 4YP8A 4AW2A 2UZUE 5BYZA 4CFNA 5A54A 2C6KA 2I0HA 4EK3A 3W2SA 4GFOA 2XS0A 2VNWA 3UP7A 5AUZA 3PA5A 4RJ8A 4W9XA 2PK9A 2YZLA 3ZSHA 1XH4A 2C6IA 2VTPA 5EDRA 3BYUA 3DXNA 3R1SA 4UMUA 2PMIA 3KU2A 4RJ7A 2OF4A 2QOQA 3QZIA 4FYOA 3RTPA 4KIOA 4KWPA 5FBNC 2QOIA 4O0SA 1PHKA 4N70A 5JFVA 2W05A 3P86A 2ZVAA 3GXLA 4FKTA 3ZHPC 5JFWA 5L8LA 4O7YA 5TKDA 3RAHA 2W1HA 3ZDUA 5AR3A 5C03A 4R7BA 3L9MA 4ALUA 3WE4A 4AA0A 3GCPA 4AZFA 4EOOA 2OFUA 3G2FA 1YWNA 3QFVA 5ANEA 2JKOA 3V6SA 4K33A 4AW1A 2QOKA 2FH9A 3I6UA 4FTNA 4C38A 4UZDA 3LCSA 5FTOA 3LLAA 2BRHA 4RFZA 4O0YA 2J50A 3BV2A 5AIRA 3FMKA 4FVPA 1UU3A 3FI2A 4ASDA 3G0EA 3IO7A 2PUPA 3HAMA 2OU7A 2WTWA 4C7TA 2F7EE 1CSNA 4BDIA 4C0TA 5EI8A 3WIGA 4E3CA 4DEBA 5JFXA 4RT7A 3QRIA 1OECA 1Z5MA 5JEBA 3MTFA 4HGSA 1SNXA 1YHSA 1Y91A 5CAOA 3KF4A 4C4EA 4WT6A 3KK9A 1YXXA 4IDVA 4PP9A 1O6LA 2F57A 3Q5ZA 4IB0A 3CGOA 3ELJA 4R1YA 3CY2A 3LHJA 3E7VA 4Q2AA 5IZFA 2P4IA 3FC1X 3HX4A 3MN3A 4EHEA 5JFSA 4Z7HA 3QRJA 5J7HA 2RKUA 1T45A 3FI3A 3W1FA 4BCKA 4RIWB 4A4OA 3NNUA 5JZNA 2BAQA 4L44A 5AV1A 2RG5A 3KULA 4TYHB 5KZ0A 4PMSA 4P5QA 2R7IA 3GOPA 3ZDIA 4CFXA 1JLUE 2ZMCA 4I4FA 5D11A 5AP7A 4EL9A 5M44A 2JITA 2GNJA 3PPKA 3NIZA 3CKXA 3LFFA 3OXTA 5AUUA 4O7ZA 4KA3A 3C0GA 5HIEA 1YXVA 3ET7A 4WUNA 4YJOA 4FV9A 2IO6A 2JEDA 4FT5A 3TZ7A 3BQCA 4QYYA 4ZP5A 3QC9A 5FXSA 4MTAA 1M17A 5JSMA 3SVVA 4AN2A 2PULA 4L42A 4QNAA 4PTEA 1VJYA 1STCE 1URWA 3THBA 1ZARA 4YURA 1OI9A 2PHKA 3EQRA 3C0IA 4F0GA 3D4QA 4QPSA 2XNNA 3OXZA 3VBVA 3COKA 4IB1A 4EH8A 3RCJA 2WQOA 3FQSA 4CV8A 4FSRA 2PUIA 4JAIA 3F5PA 4PY1A 5DR6A 2IN6A 2I40A 5HNBA 2PZYA 4EJ7A 4E26A 2LGCA 4O7TA 3WILA 3PYYA 4L46A 1P4OA 2VWUA 5M55A 4ACCA 4ARKA 4HYSA 3UYTA 5ICPA 4X7QA 4E93A 4IVDA 4TRLA 2E9NA 5FM2A 3EN6A 2CJMA 2HIWA 5HVJA 2JIUA 5K5NA 2QQ7A 4NTTA 3NYOA 3EQCA 2Z8CA 4M12A 3V5TA 3EJ1A 3VQHA 4C3FA 2EUFB 2Z7RA 4PDYA 4IXPA 5H2UA 5J9ZA 5K4JA 2QVSE 3PWYA 3QXOA 4M69B 3O8TA 5AA8A 4FL2A 2V22A 1Q99A 4I21A 4NM5A 2Z02A 2GTMA 3GT8A 3E63A 4OAUC 4GV1A 4UMRA 2XIRA 1M7QA 3H9RA 4O7RA 4XP2A 2ZV2A 4BI2A 4P2KA 2JGZA 4RRVA 2YACA 3ACJA 3R71A 4I94A 4YNOA 2W06A 5J9LA 4EK5A 4O82A 3UVPA 3QCSA 3HV3A 3L9PA 1SNUA 4QP4A 3BX5A 2WTVA 3CPBA 3CJFA 3MTLA 2ITYA 3CY3A 4RVMA 3W2CA 2F7ZE 1YWVA 2O65A 3CE3A 1PF8A 3JY0A 2YDJA 4Y46A 4ZJJA 2UZOA 4PMPA 4YTFA 4QYEA 4QTEA 3EMGA 2B9HA 5C26A 4ZS0A 5CF5A 4QQTA 4YZMA 3GI3A 5IU2A 4FUXA 4F6WA 2W5HA 4O6LA 4M3QA 2A0CX 3Q60A 4YLLA 3VN9A 3UO5A 4X3FB 2HOGA 4J99A 3PVWA 2J5FA 4I1ZA 3GU5A 3HRFA 4DH3A 5D1JA 4EBVA 3UDBA 3HA6A 3I4BA 3Q32A 4RIYB 5B2KA 2CGUA 4D0XA 3MPTA 3Q04A 4F65A 1LPUA 1W98A 1H8FA 3PPJA 4FVQA 3FI8A 5E8XA 3MY5A 4LGHA 3AC5A 4X2KA 1JKTA 3CP9A 3W2QA 3ZCLA 2OI4X 5BUEA 3LQ3A 3O8UA 4MD8E 2Z7SA 4PDOA 1FMKA 1WVWA 5M57A 3D2IA 1YHVA 2ZB1A 4YHFA 5AA9A 2VD5A 2QO9A 5GJDA 1PMUA 5HG7A 2PZRA 4NEUA 3UNKA 2ONLC 3LIJA 2WELA 3UMXA 3IGOA 3QALE 2C68A 5EKOA 4CFFA 3A4PA 4PNIA 3V3VA 1IRKA 3F3WA 2UW0A 4MBJA 3MIYA 4GS6A 3BWFA 1H26A 3P7CA 2GMXA 4FF8A 4QTAA 3TDVA 4RQKA 3ORIA 3IW6A 1OL7A 2BFXA 2WTCA 4O0WA 4TW9A 3C4FA 5A4QA 2VX3A 2BAJA 2W5BA 3V6RA 2YM5A 4FTTA 1X8BA 4M97A 3VBWA 4C8BA 4FT0A 4CXAA 4JDIA 1S9IA 3RHKA 2YISA 4BGQA 1GY3A 3EOCA 5IA2A 2CKPA 4O7NA 2QR8A 5EFQA 2XH5A 4MNEA 3DB6A 1PKGA 2QLUA 1UNGA 4UY9A 4B9DA 1H0WA 4C62A 1PXKA 2W9FB 5M53A 4X2JA 1XJDA 3E8EA 3L9NA 4I5HA 3F66A 3QAME 4I6FA 2PY3A 4V05A 3A7IA 5EDQA 3COHA 2JIIA 4EOJA 5FDPA 3ZS5A 1DI9A 3WYXA 2BHEA 4HGLA 1ZY4A 4C57A 1OL5A 4ANNA 4PNKA 4N4SA 4XV2A 3NMUF 3UOKA 3FZRA 3HUBA 2V55A 4HCTA 4Y73A 4FC0A 4FKLA 3E8CA 3O2MA 4K0YA 1FBNA 4GFMA 3P9JA 3WI6A 4P90A 1OITA 2QI8A 1OKYA 4HYHA 3KN6A 4EWHA 5DA3A 3Q9YA 2CKQA 4M66A 3QZGA 2VV9A 3BBWA 5KO1A 4TPTA 5C9CA 4EBWA 4J1RA 4U3YA 3ODZX 4NM3A 2VO3A 2VAGA 4KIKB 3W33A 2PVJA 4G1WA 4X2GA 3AQVA 2QHMA 5CVFA 3HMPA 3P08A 1B38A 4BCIA 3R7YA 3BBTB 2W1IA 4DHFA 4OT6A 2CGVA 2O63A 4QYFA 2E9OA 5K4IA 5AV4A 1FGKA 2ITWA 4XJ0A 4E20A 4I22A 2W4JA 4J52A 4XV3A 3TNHA 1H24A 4IX4A 2EB2A 4HOKA 4GUBA 1SZMA 2C5OA 2CKEA 2YA9A 2PZ5A 3MI9A 5AR5A 3CD3A 5L4QA 4LOOA 4NCTC 4BY9E 4R6VA 4IE9A 4RVKA 3QRKA 5HCZA 4KS7A 5M4UA 2YCSA 2BRMA 5I9YA 3Q4CA 3KB7A 3W2OA 2UW8A 3MVJA 4C2WA 4DG0E 4BB4A 4EORA 3FY2A 3U87A 1GZOA 4NZWB 4ZTHA 3UZPA 3UOJA 4HYIA 3LFSA 4ZTNA 1IEPA 1DI8A 5E9EA 4PDSA 3OY3A 5EM5A 4CZYB 3QWJA 3WARA 2OICA 2W96B 5TR6A 2X39A 5LVPA 4FKUA 3LCTA 4FV0A 3V5PA 3LZBA 3WF8A 4GEOA 4FG7A 3QQGA 3MFTA 5AV0A 4ZLOA 3TUDA 3ZLYA 4O7WA 3QTXA 3E93A 1OL1A 5D10A 4U7ZA 2FSMX 4DLJA 4BYIA 4LUDA 5M07A 4XV1A 4DEIA 4U8ZA 2OW3A 4USDA 2RG6A 4GG7A 4AE9A 3PIZA 4DFXE 1XR1A 4MWIA 4WRGA 5K9IA 2J2IB 3IDBA 4Z55A 4TYHA 1NXKA 2XK7A 4GK3A 2PVRA 2I1MA 5AP1A 5BVWA 3F69A 3IW7A 4JJRA 4FKJA 4GKHA 2C1BA 3VIDA 2I0VA 4L45A 2UW6A 5EDPA 5T6KA 4ZTMA 5HD4A 4WIHA 1MRYA 4NKSA 3DK7A 1OIRA 4DGNA 2OF2A 3DKCA 2QD9A 3QQLA 4WD5A 2YLEA 5DR2A 4KKEA 2R3QA 1WBSA 4RX5A 3BRBA 3KXHA 2XK9A 3GENA 1M2PA 4QO9A 1J1BA 2XB7A 5H9BA 4DEHA 2UVZA 3HMOA 2JFLA 3K5UA 3PXYA 5E8SA 5HG5A 4FV4A 2PL0A 5IISA 3G15A 1SYKA 2PWLA 4FV7A 5HEZA 5IMXA 4O1PA 5H3QA 3BGZA 3FMNA 2V5QA 3KXMA 3DA6A 3TV4A 3KA0A 3RWPA 5IMEA 3HEGA 3JS2A 2WMQA 4RA4A 3GC9A 3PG3A 3T9IA 2WPAA 4FT3A 4OTPA 4KIQA 3CTHA 3QL8A 4BI1A 4OTDA 4C35A 1G8AA 3NYVA 5CAUA 4ZTLA 3VRZA 5DE2A 1PXPA 2QODA 2UW9A 4UZHA 4H39A 3QYWA 4NK9A 3TV6A 4AT5A 1J3HA 5BUIA 5KMNA 1WBPA 3TEIA 3QLGA 3SXFA 4NT4A 1ZOEA 5E8UA 4K8AA 3RP9A 4EQMA 5CEMA 4M69A 5AP4A 3KC3A 2WMWA 4AE6A 2J4ZA 4IC7A 5IUHA 5FEDA 3DAKA 4YBJA 4ACHA 2OZOA 3OOGA 5LMKA 2IG7A 3WYYA 1V0PA 3U55A 3MVHA 3C4XA 2Y6MA 2YIXA 4QTDA 4RWIA 3V01A 5AAEA 3AG9A 4FODA 5FEQA 2PZIA 3MYGA 3TM0A 4HCUA 3FPMA 2ZM1A 5DR9A 3BV3A 2B9IA 4D4YA 2B52A 4QP3A 2QOCA 3LJ1A 3PJ8A 4DEDA 3VBXA 1LR4A 2X2KA 3QA0A 2HY0A 2NRUA 3FQHA 1YI6A 5AX3A 4FBXA 4L00A 3RK5A 5A4LA 3IK3A 5F20A 5T68A 1QPDA 4YLKA 1OIQA 3ZRMA 3TNWA 3IKAA 2YFXA 2ZMDA 1GZKA 1CKPA 1V0BA 1Q8TA 2PPQA 3OOMA 2Y0AA 4IX5A 3BQRA 4FNXA 4X3FA 3BYVA 4AFJA 5AWMA 4O0TA 3C4EA 5E8YA 5FEEA 4RIXB 4E4MA 2R3FA 2IW6A 3EN4A 4RIYA 3AOXA 2IZUA 4GK4A 4O6EA 3ALNA 3Q53A 3EIDA 3SOAA 4ZY4A 4L53A 2J6MA 3LPBA 4QQ5A 5JRQA 3ZRKA 5C8NA 4NW5A 3A60A 3NSZA 2NO3A 5I9UA 4JX7A 3VBQA 2VO0A 3WF7A 3O51A 4FL1A 4IAKA 4BWXA 3PVGA 3LKMA 3HRBA 2VWWA 4C59A 3ZXZA 2DUVA 3VW8A 4JDKA 2I0YA 5HI2A 2GNIA 3T9TA 4HVGA 1OPLA 3EL8A 3K2LA 2HW7A 2G2FA 3DLZA 4IZYA 3EWHA 4DFLA 4C4GA 5M4CA 4F4PA 4TT7A 4ZTSA 4O0XA 4QMTA 4C4JA 5CF4A 3R2YA 4K2RA 4NH1A 5JQ5A 4BTMA 2C6LA 3MH0A 3QKKA 5HU9A 4U45A 1L3RE 2AC3A 1XH8A 3WE8A 3DB8A 3WBLA 4BZDA 3GC7A 4F9CA 3SRVB 4BDJA 5DH3A 5FGKA 4EHZA 2YCQA 1W7HA 3RHXA 5IDNA 4C4IA 3VW6A 3I1AA 5IQCA 3ZBXA 4ZSAA 2XNGA 1XH6A 2HENA 2WMBA 2XVDA 3LE6A 1DAWA 3CTJA 3C4WA 4WNMA 3ZOSA 5AX9A 3VS5A 3M2WA 3V04A 4DBXA 5LVMA 4LYNA 2RFNA 2ZYBA 2HZIA 4ITIA 1CDKA 3NLBA 3LJ0A 4G6NA 3OUNB 4MVFA 1IG1A 4CFMA 4LQMA 4G5JA 4CRSA 3ZC6A 2C5XA 3KMUA 4YUQA 5A3XA 3U51A 2WO6A 4ZSGA 1CKIA 4IVBA 2WKMA 2BMCA 4FZDB 4UMPA 4ZTRA 4S33A 1ZMUA 3GQLA 2F2CB 3OHTA 4MCVA 4CLJA 3OZ6A 5J9YA 3BLHA 3FKLA 2O3PA 4KIKA 4RZVA 2W0JA 3O7LD 4NSTA 1SMHA 4DEEA 3WOWA 2WTIA 3QZFA 4FNYA 4LL0A 4JR3A 3QQJA 4I3ZA 3QHRA 4E4NA 4F7LA 4FYNA 3RZBA 5IEVA 2RL5A 2RFDA 3VRYA 3IONA 1QPJA 3BU6A 3CGFA 2QURA 3P0MA 2RF9A 4F7JA 5ETCA 4YJVA 4M0ZA 3OG7A 3PY3A 4E5BA 2C5YA 3F5GA 3GC8A 1GOLA 5GIOE 4YSMA 4D4RA 4LV5A 2O64A 5EOBA 4DG2E 2HK5A 3DK6A 2GQGA 4BCMA 3P79A 5BVKA 4AZVA 4BKZA 1PRYA 3MIAA 5EQEA 3DJ5A 5J8IA 3NVKI 2YM7A 1YDRE 3UO6A 2BKZA 3E3PA 4L7SA 2UW4A 3TKIA 2WOTA 2Z7LA 4Z7GA 3Q6WA 3R28A 5KUPA 1PKDA 3PP0A 2XJ0A 1P2AA 5KNJA 5H8EA 5JGAA 4WA9A 2JKKA 1NVSA 4J95A 3BLRA 5HBHA 3I5NA 5KMOA 5IQDA 4ANMA 3ZH8A 1R0PA 3L8SA 3ORZA 4ZAUA 3DPKA 4RJ4A 4UXQA 3MH2A 5HVYA 4IHPA 4CFUA 5A14A 3UQCA 2UV2A 3MH1A 5KKRB 5GZ9A 3PXRA 3OTVA 3MY1A 4G2FA 3QTQA 3R01A 3LXNA 1NVRA 5FDXA 4TXCA 5A4TA 1YVJA 4GCJA 5EK7A 3DNDA 4C37A 3CQUA 2IZSA 3VF8A 4D1ZA 4KUJA 2C6MA 2PE0A 1PYEA 3QQFA 4QYHA 5CVHA 3SOCA 3D7TB 4B99A 2PYWA 5JGDA 5HHWA 4TNDA 3SXSA 5HBEA 1OM1A 1H28A 4FTOA 4BTJA 2OFVA 5EOLA 1H4LA 2VWZA 3V5JA 2QLQA 2W99B 5E92A 4BDCA 3MBLA 5D9HA 3TTIA 3DFCB 2VTHA 1S9JA 4II5A 4BDHA 1VYZA 4FSWA 4QOXA 3AC8A 4A06A 3ZMMA 2CNQA 3TCPA 1UKHA 4AT4A 4ZZMA 3KMMA 3PDTA 3P7BA 3BWJA 1H1SA 4X21A 4EQCA 1LEWA 4ASZA 1SM2A 3R9NA 3N4TA 2GSFA 2BKKA 2WGJA 3BYSA 1Q24A 3MGYA 4FIGA 4FV1A 4U42A 2YHVA 4YNEA 3VS1A 2FSOX 5H8GA 2C0IA 3W18A 4D4VA 3GU7A 4FKRA 4G17A 4GW8A 5J1VA 4RMZA 4LOQA 4AAAA 3UPZA 5C4LA 3BGQA 4YJTA 1HCLA 4JR7A 1A06A 3D83A 3QC4A 4Y72A 2QKRA 4CD0A 5IPJA 4JDHA 5CSVA 4X0MA 3HA8A 1ERKA 3FL4A 1O6KA 4O38A 2EVAA 2ZAZA 2WMTA 5C01A 3WZJA 1BUHA 5ANGA 3FAAA 4Y95A 4LRMA 5I4NA 4FTJA 3D14A 3TJDA 4A9YA 3FEGA 4FEWA 3GP0A 4XLVA 3GUBA 3LAUA 4Y5QA 2JDOA 3JVSA 5J87A 5K5XA 3O96A 3PVBA 4RJ3A 1FMOE 4IAZA 2UZLA 2BUJA 1FGIA 2YIWA 3PXFA 4JL9A 1J7UA 3SAYA 1KV1A 4U43A 3DT1A 5CSXA 4WHZA 3FYKX 3FZTA 2O8YA 3FWQA 5BQ0A 3BEGA 3R9HA 4D9UA 1BLXA 4GUEA 3V8TA 2UW3A 3TNQB 2W7XA 2CLXA 2WTKB 3DTCA 4AW5A 3DXQA 3GU8A 1E1VA 2YM4A 5KHXA 3OT3A 4XG7A 3DJ6A 5AEPA 5L2IA 2X7OA 4IMYA 4HJOA 3TG1A 4NM0A 5JKGA 4AOTA 5CANA 5E4HA 4D5HA 2R3OA 1PYXA 2A19B 3PG1A 4RC2A 1K3AA 3RALA 2QKWB 3CQWA 4IWPA 3VULA 4O0VA 3TZ9A 2GNFA 1IASA 2C6DA 3UYSA 1PY5A 2WEIA 3IDPA 3RWQA 4ENXA 5DFPA 1FOTA 2HWPA 5HTCA 4RIXA 4WSQA 4E7WA 3KRLA 1YXTA 2ESMA 3AT3A 5BX0A 2VO6A 4BDKA 4AGWA 3DZOA 2ITQA 2XKDA 2YIRA 2O0UA 3NEWA 5CS6A 4K6ZA 3VNTA 2HXQA 2YIYA 1JSUA 4XUFA 4PTCA 3OEZA 2OXDA 2HWOA 4FSZA 1KSWA 4RBLA 5CLPA 4GYGA 4YJSA 5CTPA 1G3NA 5DLSA 4YJUA 4DGLC 4YR8A 3KQ7A 4FIEA 3QQHA 1Y8YA 3UPXA 4CFWA 3UJGA 5CF6A 3B8QA 4FKSA 4EHGA 1KE8A 4IQ6A 4IEBA 2GS7A 3KRXA 2IWIA 5ANKA 2IW9A 3MJ1A 3OW4A 4ZIMA 3D9VA 5DMZA 2QC6A 3OCTA 1SVHA 4FTIA 5KBRA 2YZAA 5HICA 2HZ0A 4C58A 4F6UA 4Q5EA 2RGPA 4W4XA 2JDVA 5JRSA 3R1NA 3TWJA 1Q8ZA 2QO7A 3DBQA 1QMZA 3JXWA 2VTOA 4RX8A 3RK7A 2W4KA 4KSQA 2OXYA 2WMRA 5AP3A 3FHIA 4F1MA 2G2HA 3B2TA 1CKJA 2H8HA 4LGGA 4L68A 3SDJA 1LEZA 3PTGA 1QPEA 1KOBA 2VNYA 3EN5A 4C2VA 3P23A 2JBPA 1PMVA 2WQNA 3Q2MA 5F1ZA 3W2PA 2W4OA 3HDMA 4FG9A 4FTRA 1UKIA 3LMHA 1FVTA 2VRXA 3JUHA 2PVLA 3MWUA 3DJ7A 1KOAA 2C6OA 1JNKA 4EC9A 3UNZA 3LXKA 5FD2A 5ANIA 1PXJA 2Y4IB 4KKHA 2PE1A 3HLLA 4YJPA 3EQIA 2BTSA 1YXUA 1YDSE 3QQKA 5HKMA 4EH4A 5BNJA 3AC1A 3SG8A 3VJNA 3N9XA 3JPVA 1P14A 1YOLA 1VZOA 4MK0A 4U40A 4DLIA 2B54A 4BGGA 2DWBA 2BRGA 5AR8A 4S34A 4L67A 5HD7A 3ORLA 3BKBA 3H9OA 4O21A 2PE2A 4V01A 1OVEA 1JKLA 3FKOA 3KXNA 3PFQA 1M2RA 4I6HA 3UG2A 4BWKA 4PUZA 4HVSA 4BCJA 3QUPA 2ACXA 1H1QA 4GT3A 5HG9A 4F9YA 2BZIB 5J5TA 4NJDA 3QCQA 3RPVA 5M4IA 4OT5A 3LCKA 1DM2A 2F4JA 3CCNA 2VO7A 2XP2A 4JOAA 3T3VA 3Q9XA 3QQUA 2BROA 2IZRA 2WNTA 3M42A 3OS3A 4ANOA 5C1QB 5K3YA 2AC5A 2VX1A 2Y9QA 4ASXA 5BVOA 4XRLA 5CNNA 3F88A 2PU8A 3R2BA 4U3ZA 2Z7QA 2YJRA 4FV6A 4FT9A 4F08A 3FXZA 2GS2A 3ZFYA 4ERWA 5IUGA 4ACGA 3GFWA 4PQNA 3BPRA 4M68A 3R83A 3V8SA 4ACDA 2ERZE 4LUEA 4HPTE 4XNEA 4ANBA 5ETAA 5CQWA 3VS0A 4CQGA 3I60A 5LQFA 5EQYA 3DK3A 5I9WA 1XWSA 2VWXA 3ERKA 1WFCA 3BGPA 3ZEWA 4G9CA 5L2SA 2B9FA 2J0IA 5CEIA 4F70A 4AGDA 5A9UA 1IA8A 5AUVA 4F1OA 5CVGA 4YTCA 3LXLA 3PRIA 3ROYA 2OXXA 5IH5A 2OKRA 5KMLA 3RCDA 2WMAA 3OWJA 5AAGA 4DFUA 3O0GA 3RAWA 4CCUA 4H05A 3B2WA 5ANDA 2ZDTA 3A99A 2XEZA 3A2CA 3A7JA 4JQ8A 4BHZA 2A1AB 2XRUA 5FP6A 1M7NA 2BFYA 3FLYA 2XZSA 3NW7A 2C69A 4KSPA 4U44A 4FEVA 4O81A 4TYIA 3FZPA 4CTBA 4O7VA 1Q61A 3M1SA 3HGKA 4D55A 1XBCA 4QMSA 2HYYA 2Y8OA 2G9XA 1Q41A 2WTDA 3C4ZA 3D7TA 3P4KA 3QD0A 5EYDA 1GIHA 4FTUA 5AM6A 2CN8A 5B7VA 4D2WA 3F5UA 3UMWA 4E1ZA 4XEYA 1YRPA 3HP5A 4U80A 5CQUA 5GINE 5HESA 2CKOA 4FEQA 1ZYCA 3EFLA 4XG6A 5CY3A 4CSVA 2IPXA 3EQBA 2V7AA 3V51A 2W9ZB 3LFQA 3QYZA 3I81A 3FMMA 3I6WA 3TIYA 2XNOA 4NM7A 4HYUA 2YLFA 3H9FA 3VVHA 3HAVA 4BYJA 3EHAA 2OJIA 4OTHA 4J71A 2B55A 4AACA 2YN8A 2X8EA 5CYIA 3D2KA 2X9FA 3QUEA 4CNHA 1OIYA 4CV9A 3TJCA 4OAVB 4PPAA 5IA1A 2B7AA 3OF0A 4NKAA 2JKQA 5LMKC 5HOAA 2H96A 4Z3VA 4OTRA 5BVEA 4BN1A 1ATPE 3F5XA 3NS9A 3QD4A 1JQHA 1K9AA 4JBVA 3ZYAA 1OKWA 5JN2A 2IVTA 3ZUTA 4I5CA 3OWLA 1QPCA 5CU4A 2P3GX 2XIXA 5DOSA 4DC2A 4I6BA 2BZKB 2R3HA 2WOUA 4FMQA 4AGCA 2WHBA 2WZJA 4OLIA 1REKA 3QKMA 4UMQA 2GDOA 4PPBA 3LQ8A 4A7CA 1LUFA 3R22A 5FRIA 3I7CA 3UVQA 4MX9A 2P33A 3FPQA 2BZJA 3HMMA 3F7WA 3L8PA 4BZOA 4FEUA 5L2TA 3PWDA 3R7OA 3EN7A 3KCKA 1Q8UA 3VAPA 3Q3BA 1M14A 5F94A 2OSCA 4OTFA 2PUUA 5LVLA 3OWKA 3R9OA 3ORXA 3LFAA 4PRJA 3FBVA 3DS6A 2ITUA 1PMNA 2QHNA 4KS8A 3PSBA 2NRYA 3C7QA 4O2PA 4BCQA 4X3FC 1B6CB 2XK6A 5EYMA 3ZLWA 4BBFA 1OZ1A 3NW6A 4FX3A 3DQWA 4KINA 3OWPA 2XYUA 3QD2B 4XCUA 3KXZA 5ANOA 4BTKA 4NYEA 3R9RA 5HIDA 3Q4ZA 3QUDA 2E9UA 2PVYA 3F2NA 5LOHA 5E1EA 3LM5A 4N0SA 4NUSA 4PDPA 5D7AA 3ZC5A 4BICA 2AUHA 2E9VA 3AT4A 5ACBC 4FEXA 3T3UA 3AD4A 3TKUA 2FYSA 3CSVA 4BGHA 4PP7A 4FTMA 1OUKA 3FLSA 1NY3A 4BTFA 4NFMA 2HW6A 3TNPC 3FMDA 4B4LA 4L43A 4IZ5A 4S30A 4C02A 4AOJA 2JDSA 3NIEA 3Q9WA 4AZTA 2X9EA 2XEYA 3FMEA 4OGRA 4KBKA 4EEVA 4L3JA 4MWHA 3CC6A 3DY7A 5D12A 4YMJA 3KL8A 1H00A 1W0XC 3C5UA 1OUYA 3FMHA 4G6LA 4IC8A 3RM7A 1BL6A 3S3IA 4C3PA 1ZYJA 4BCPA 4FICA 2P2HA 4GFGA 4DTBA 2BTRA 3E8NA 4PMTA 4PX6A 1W82A 4IAAA 4CYIA 3EFWA 3DDQA 4U5JA 3GEQA 4I92A 3RM6A 4B6LA 3UQGA 5FP5A 4ZOGA 3DBEA 2WAJA 4FKWA 4IDTA 4FL3A 4V0GB 4L6QA 4HGEA 4DTKA 5KHWA 3RPOA 5J79A 4ZY6A 5HGIA 3GCSA 1Q97A 2WIPA 3MY0A 5A6NA 3H10A 3QA8A 5DIAA 5EW3A 3ULIA 3G33A 3UP2A 3H3CA 4TYEA 1QL6A 3N4VA 4ZMEA 1IR3A 1OMWA 5DBXA 3MPMA 4EH7A 4QRCA 3OP5A 5LCKA 2VTAA 4XP0A 2VWIA 3NW5A 3EZRA 2NNWB 4FTAA 1R3CA 4RIWA 3D94A 2FVDA 4YHTA 4JX3A 4UWBA 4AZSA 4CG8A 3RBWA 2E2BA 4L3LA 2ZV8A 2QNJA 4RZWA 3A7FA 5GZ8A 1RDQE 1UU7A 3ACKA 4RJ6A 4J97A 3L8VA 3NYXA 4UALA 3ENHA 2J51A 4G5PA 4EC8A 1H1WA 4NIFB 1HOWA 4BR3A 4AA4A 1XBBA 5EHYA 2OJJA 3OBJA 3UIBA 5DPVA 5LARA 5L3AA 5GJFA 3KMWA 3NUPA 4QTBA 3VQUA 3F6XA 4TYGA 5E8ZA 3ZZEA 4MKCA 4YJRA 3MV5A 5CEKA 5GJGA 2QR7A 4A4XA 2P2IA 5EKNA 4GL9A 3K3JA 3POZA 4YZBA 3CQEA 3NUYA 3OD6X 5CI6A 5HBJA 3DGKA 4WNPA 2CCIA 4S2ZA 3RI1A 3SX9A 2WMUA 4ZSEA 3S0OA 2X6DA 4IM0A 2XK8A 4A07A 3FL5A 4FNZA 3ZM9A 4AP7A 4M14A 4QTCA 4BCFA 2B53A 2GNLA 5CAQA 1PW2A 4XMOA 2GQSA 4XBUA 5AAFA 3LMIA 2J0KA 5CSWA 3I5ZA 3TZ8A 4CT1A 4AZWA 4R5YA 4WG5A 3GU6A 4BFMA 5HNGA 4FKOA 3TV7A 3G6GA 2BDJA 4L01A 5BMMA 4EZ5A 4JBPA 3M11A 3OVVA 3UQFA 3SD0A 4ANLA 1Q4LA 3ZLSA 5I9XA 1YWRA 5EM6A 2PVFA 5CAPA 3QGYA 4U9AA 4IWQA 4C36A 2UW7A 2X0GA 1PJKA 2KTYA 5AUXA 4ZJIA 5CEQA 4MXYA 4PL3A 4D2TA 2VTIA 4FSUA 3RK9A 4BL1A 4JIKA 2Y4PA 4IVAA 3MESA 3OCBA 1BI7A 2VGPA 3QHWA 2YWPA 4FOBA 2FSTX 2YJSA 4MH7A 2F9GA 3QTSA 4U81A 3R9DA 4GK2A 3ANRA 2R64A 1ZYLA 2G01A 4CZTA 1H1RA 1AD5A 5J7BA 3PLSA 3RZFA 4F9WA 1U59A 5HLWA 2XMYA 5HVKA 2FO0A 4FIJA 1RE8A 3FV8A 2C0OA 1FPUA 2PMOX 4C34A 4A9TA 4QQJA 1GAGA 2UZEA 3I7BA 5H8BA 3TKHA 4EOQA 2DYLA 3IECA 5IA3A 4QP6A 1IA9A 4J7BA 5M08A 3R00A 4CTCA 1IAJA 4DE4A 5IH4A 4IZ7A 5I0BA 4D4SA 3DAJA 3MA6A 1FVVA 2ERKA 3O7LB 3UIMA 4CMTA 3FXXA 4L52A 4LM5A 4R3PA 1I44A 4B8MA 3U6HA 2BRBA 4FV2A 4K11A 4TWOA 3QCXA 4RQVA 4BRXA 4GG5A 4O84A 3DU8A 5DNRA 5EQPA 2QONA 2WMSA 2FUMA 4IM2A 4RA5A 4R7HA 4EQUA 4G31A 2QOLA 3U6IA 2XM9A 3VS2A 5EW8A 4EK4A 4LGDA 3COIA 4FA2A 4BDBA 3WIKA 5CU0A 5JH6A 3EL7A 5HE3A 3V5WA 4K77A 3CBLA 3CS9A 3BIZA 4QYGA 2ZDUA 4RX7A 5M4FA 5HX6A 2R9SA 2ITVA 2J0MB 4RSSA 3DZQA 5FXQA 4OW8A 2XJ2A 2OH0E 3HUCA 3N4UA 1J7IA 2ITZA 3BE9A 5HIBA 4ALVA 5I9ZA 2CMWA 2C3JA 3Q5IA 3AGLA 4OBOA 5A6OA 4P5ZA 4DH8A 1ZOHA 3UG1A 3C51A 4I20A 2ZJWA 5EHOA 1Q3WA 5EYKA 3JYAA 5A46A 2ETMA 2PSQA 3U4WA 3DV3A 4JBQA 3VUGA 3C13A 5I3RA 4C3RA 3R04A 4U97A 3HV5A 3QGWA 3LMGA 4DGGA 4F7NA 4ANSA 4QPAA 1CMKE 1OBDA 4YGAA 2CNUA 4DINA 1Y6AA 3MVLA 3OW3A 4QMYA 4Z16A 3ZFXA 1JSVA 3TL8A 3C5IA 4CKIA 1F3MC 4GRBA 4MQ1A 5FQDC 4DFZE 3EQGA 4X3JA 5AR7A 3MB6A 1MQBA 5G1XA 3EQPA 2C6EA 2HCKA 1OPJA 2GNGA 3FZ1A 3NR9A 3Q6UA 4D58A 5M56A 1YDTE
chains in the Genus database with same CATH superfamily
3WF9A 2XIKA 3QWKA 3LQ5A 4IWOA 5EW9A 2HZNA 4M84A 4GSBA 4AU8A 1UA2A 1Q3DA 3IW5A 3CTQA 3KKVA 2UW5A 3OCSA 3UBDA 1URCA 2RSVA 4RC3A 2PVKA 3FI4A 4D2RA 2B0QA 2BZHB 4FTKA 3TUBA 4QNYA 1OKVA 5EHLA 3ORMA 4YSJA 4YTHA 3QD3A 4OUCA 4TL0A 4GT4A 4QP2A 4RG0A 3K54A 4QEBA 5HU3A 5E90A 1BMKA 2CSNA 3LFDA 4FG8A 2OJFE 2R3KA 2R3GA 3COMA 1VYWA 5E1SA 1O9UA 4YZCA 3NUXA 5ETFA 4N57A 3R8MA 3BI6A 3R21A 2OO8X 3B8RA 3DKGA 4TWPA 2ETKA 4G9RA 1APME 3S2PA 4H3PA 3FLWA 5FG8A 1V0OA 2X1NA 3VC4A 1W84A 2OBJA 3W8QA 2H34A 1Q8WA 3G51A 3MSSA 2VTQA 4MXAA 4TWNA 4DGMA 4HW7A 3AC3A 4MNFA 4ZY5A 5BV3A 4RPVA 2OH4A 3PP1A 4CCBA 1WVXA 4XH6A 2ITXA 4IB3A 5KMMA 2V0DA 4APCA 3H30A 4KRDA 3SLSA 2BR1A 2CHLA 1JVPP 3KCFA 4WBBB 5JGBA 4BHNA 2JLDA 5AP5A 2J0LA 3SV0A 4ZLZA 4QMLA 2CGXA 3MB7A 2YERA 3BZ3A 1A9UA 3R7GA 4AA5A 2ZV9A 2QG7A 3OTUA 2R0IA 3H0YA 5AUWA 4O1OA 4DCEA 4G3GA 3RVGA 3R02A 3HV7A 4FIFA 2EXEA 3R1YA 3T8OA 4V0GA 3EQFA 5DG5A 3W0SA 4PPCA 5D7VA 2W1FA 4IX6A 3IOPA 3BHTA 2R3NA 3FQEA 4YBKA 5KZIA 2Q83A 5CF8A 2EXCX 3LFCA 3UO4A 4UWYA 1ZMVA 3W32A 5BVNA 4RGJA 2YABA 3VUDA 4WO5A 1TQPA 2XM8A 3BYMA 4CG9A 1OPKA 3SC1A 4KAOA 4BCGA 3EQDA 3LM0A 5BUJA 2IVVA 4NJ3A 4BI0A 3AXWA 4JG6A 1OKZA 1OGUA 1R78A 4MAOA 4TN6A 4CT2A 5GIPE 2XKFA 3PJCA 4QMVA 3S95A 4GJ2A 3PZHA 2R3PA 1ZWSA 2R2PA 2WTJA 1W83A 2ITOA 4G3EA 4WG4A 3WF6A 3U6JA 4JIAA 1LP4A 3UODA 5BYLA 3ZU7A 4L9IA 3IPHA 2EXMA 4EJNA 4R78A 4NIFA 5DT0A 4LMUA 2C1AA 2W1ZA 3HMIA 2JD5A 4ZLYA 5B0XA 4FNWA 3F3VA 3SA0A 5IQFA 4GIHA 3QZHA 5IQBA 4MXXA 3RPSA 3TACA 3AMYA 2F7XE 4ZS4A 4H1JA 2X8IA 1PXOA 3DLSA 1ZLTA 1F0QA 2XNPA 4JQEA 3PIXA 3R8LA 4PF4A 2C6TA 2QOHA 2YIQA 4YC6A 1JKSA 5BVFA 5IG1A 4DT9A 3ZSGA 1VR2A 4CYJA 5DYJA 3LXPA 5IKWA 4EOPA 5C8KA 3KVWA 4QP1A 4MXOA 4XHKB 5F9EA 4CKRA 1NVQA 2WEVA 4DFNA 2WU6A 2BAKA 3A8XA 5AP0A 3L9LA 5HE1A 4FIIA 5CXHA 3FLNC 4O86A 3VS7A 3Q52A 3VO3A 2VZ6A 2HY81 2LAVA 4AN3A 4EI4A 1DAYA 2W1DA 3NNWA 3PE2A 3TXOA 2JDTA 3EFKA 1TVOA 3KVXA 2UZNA 2XKEA 4QDVA 4TNBA 1Y6BA 1GJOA 2CGWA 1YKRA 2X8DA 4FKGA 3C4CA 5TE0A 4F99A 2RFSA 3CEKA 3EKKA 3PJ3A 3QU0A 2XARA 4YZNA 4E5AX 4BJJB 4I0RA 4S31A 3R7VA 4BBEA 1ZZLA 4PV0A 4CZUA 1BI8A 5KKRC 4ZK5A 3UIUA 4PWNA 4DTAA 3BU5A 2HAKA 3N51A 1H1PA 3HVCA 3S4QA 4IANA 4MNEB 4RLKA 2BCJA 3ALOA 3ZO4A 4FZ7A 1FINA 1JKKA 3W0NA 4E6CA 3VONA 5IUIA 3ZO2A 3KREA 3D15A 3IW4A 4J96A 4EUUA 1NA7A 2HXLA 4Q9ZA 2UZTA 4CMOA 3FXWA 1RW8A 4F6SA 5IQIA 5DT4A 1YOMA 3QTWA 4BDDA 4IB5A 3ZBFA 4ZZNA 1XH5A 1WAKA 4KRCA 1HCKA 5LMAA 2GHLA 3NDMA 4BCNA 4XG2A 4UYNA 1NT2A 2O5KA 4YPSA 3F3UA 2WQMA 3GCUA 4H3BA 3UNJA 2YDKA 4JDJA 4CEGA 3ZO3A 1I09A 4H3QA 4XG8A 5GNKA 4GVJA 5EI6A 2VU3A 4N6YA 4RJ5A 4EK6A 2XNBA 1H07A 3FKNA 5CU2A 1OB3A 4GMYA 4UX9A 3UZRA 4JRVA 1ZZ2A 2IZTA 4WSYA 4XLIA 2ITPA 4FK6A 1Z57A 5KX8A 3GC0A 4G3DA 4GU9A 5HTIA 3A7GA 2WQEA 4R1VA 4FTCA 3FC2A 5EM7A 5HE2A 3ATSA 3DBCA 3KF7A 3EYHA 4D9TA 3W0PA 4CKJA 3R7EA 3QF9A 4EHVA 4B8LA 4GH2A 5TF9A 5CT0A 3PSDA 1H08A 4E6DA 5LVNA 5CXZA 5DVRA 1Y8GA 4U0IA 3GBZA 5CU6A 4L3PA 3BELA 3TZMA 3SG9A 4PL5A 3DTWA 5E91A 2ITNA 4EH3A 4QPMA 1Q8YA 2JAMA 3QRTA 4J98A 5L8JA 3SGCA 3DDPA 4OBPA 3WZUA 4AW0A 3S00A 2PZPA 2X81A 4I5MA 4XG9A 4KKGA 4HVIA 5B2MA 5T3QA 4ONAA 5DI1A 1ND4A 3I79A 4BBMA 3P5JC 3ZO1A 3UTOA 2FA2A 3EN9A 5DHJA 4DDGA 2EU9A 4AWIA 2UVYA 3NUAA 3AGMA 3SRVA 4QMXA 5C27A 4KD1A 3BHHA 4ZSLA 3LW0A 4D2SA 4C33A 4O83A 3NUSA 2X2LA 3ANQA 2R3RA 2B9JA 2WTKC 4GIIA 4MD9E 4HNIA 4O4FA 3ZUUA 5LJJA 2REIA 3GB2A 3LFEA 3Q4UA 4IH8A 5DEYA 2J5EA 1R39A 4CLIA 5IA5A 2XALA 2X4ZA 1BL7A 3U4UA 5JQ8A 1U5RA 4MXCA 3BHVA 5E8WA 3QTUA 2QO2A 5IA0A 1MRVA 2VTRA 3E5AA 4QMUA 4MBIA 4NU1A 2W17A 3ZZWA 2JKMA 3OBGA 1KE7A 2C47A 2Q0NA 3IS5A 3O23A 4QMWA 3VUKA 1UVRA 3E92A 4UB7A 3TUCA 5KMIA 3VUTA 4NTSA 2FGIA 4FSYA 2R4BA 2X6EA 5BPYA 4WKQA 3NAXA 3MJ2A 4FSTA 5C4KA 4AT3A 2BVAA 4O2ZA 4ID7A 4PTGA 1NW1A 2W1CA 4ZSJA 4LMNA 3VS4A 2PMNX 4W4VA 3PZEA 4Y5HA 2C5NA 4AS0A 2FB8A 2WFYA 4FV8A 1ST4A 3BLQA 4BDGA 2XIZA 3E88A 2OIQA 4EZ7A 2WIHA 1JAMA 1P5EA 3CJGA 5L6OA 5I3OA 3R8PA 5L8KA 2JBOA 3F2AA 2OK1A 3EYGA 2A27A 3MFUA 4UV0A 2XUUA 3JVRA 3QRUA 4FZ6A 4XG3A 1JOWB 2C0TA 4H36A 4JS8A 5AJQA 4EOKA 3R63A 5EG3A 4IAFA 4PL4A 4FR4A 4JG7A 3VS3A 4BDFA 1BKXA 4O4CA 5EI2A 1RJBA 1PMEA 4ASEA 3F3ZA 2VWYA 4BCHA 3RGFA 3F7ZA 5HQ0A 3FY0A 1FQ1B 2BRNA 4A9SA 4F0IA 1KE6A 1BX6A 1MRUA 1KV2A 3UIXA 4CQEA 3UE4A 2F2UA 5J1WA 4IX3A 4YTIA 3DXPA 2V62A 3PXKA 2YAKA 3PJ2A 2Y4IC 4Q9SA 2VTMA 1ZAOA 2X2MA 4IADA 3C50A 4AAYA 3BE2A 4BWPA 3FZOA 1H25A 3FUPA 4WG3A 2ETRA 3WZDA 5IA4A 1L8TA 4QP7A 1U54B 5BMSA 3FHRA 2Z2WA 4BIEA 3NCZA 5AR4A 5LXMA 2PUNA 2EWAA 2NPQA 5CI7A 5IDPA 4HVHA 3MPAA 4KIPA 4RC4A 1SVEA 2FSLX 5CWZA 2CDZA 4TY1A 3IOKA 4W9WA 3RPRA 3UGCA 4W8DA 4S32A 1ZOGA 4O4EA 4Y85A 4DEAA 3HMNA 4R8QA 5HE0A 3F2RA 5BVDA 3RAIA 4BKYA 5I9VA 2IVUA 1WCCA 4DHZA 2YCFA 4MF0A 4DEGA 4I24A 4WNKA 4Y8DA 4RLLA 2BDFA 3I0QA 2OIDA 3A61A 3PE1A 3HV6A 5ACKA 4NW6A 4D5KA 1J1CA 3VJOA 2V7OA 2EB3A 3HDNA 4IAYA 5M51A 4EOSA 3R73A 3CIKA 4AUAA 5FUTA 2OJ9A 5DGZA 3ORKA 1IAHA 1J91A 2QU6A 4RWJA 3E7OA 3A8WA 4DBNA 5HNIX 3R0TA 3H4JA 1UNHA 2R3IA 2VTNA 4F63A 3MDYA 5CZIA 2XF0A 4WNOA 1ZXEA 2HZ4A 3ZONA 4DYMA 4DCAA 2A4LA 3C0HA 2GNHA 4X6QC 4YHJA 5AUTA 5LVOA 5F95A 3H0ZA 3ROCA 2C3LA 3NPCA 1GNGA 5FWKK 2IVSA 3Q2JA 5BYYA 3NGAA 5EH0A 3KK8A 5A4EA 4M15A 1XH9A 2GHGA 3LCOA 4UN0C 4P7EA 4U6RA 4W4WA 2A98A 3PA4A 3DCVA 2CLQA 2GPHA 3PRFA 5CNOA 5ETIA 3ZSIA 4O7LA 3OT8A 3VUMA 2RIOA 3NWWA 2OGVA 3EQHA 3O17A 4Q5HA 4FV5A 3MS9A 3GCVA 4LG4A 5KBQA 3GGFA 3ORNA 3L1SA 2BIYA 2CN5A 3OEFX 5M06A 3QTZA 4DH5A 2F49A 2UVXA 3SW7A 2VN9A 3CR0A 5HX8A 4I6LA 4M67A 4EZ3A 4LOPA 2JC6A 1QCFA 3PSCA 4O0RA 2XA4A 2C5VA 2YM8A 3SKCA 2JIVA 4W4YA 1E1XA 3RKBA 4IBMA 3PJ1A 1JWHA 1ZYDA 3NRMA 3KY2A 3QX4A 2HELA 4JXFA 2R0UA 2I7QA 2C3KA 3TI1A 1XHAA 2JFMA 4Y83A 5AADA 4QMNA 3S1HA 4TYJA 4DITA 3D5XA 4MEDA 4OTQA 2BDWA 3UOLA 5CZHA 3KEXA 2GCDA 2SRCA 3U9CA 2H6DA 2OG8A 3IDCA 3AD6A 3VBYA 5KCVA 1BYGA 1ST0A 4HZSA 4LRJA 3SQQA 1OL2A 1FVRA 5AIKA 5HCYA 4A9RA 3CKWA 3QTRA 3QLFA 2CCHA 3AC2A 3V5QA 5HO8A 2GU8A 3JY9A 4R5SA 3L8XA 4E4LA 4C4HA 3LCDA 4WOVA 2B1PA 4FZAB 2VGOA 3KGAA 4GJ3A 5G6VA 1UWJA 3DOGA 2UZDA 2IW8A 4ZTQA 3GQIA 3ORTA 3JR1A 3C9WA 3NUNA 3NVMB 4BC6A 3ORPA 4QMQA 2XIYA 4YZDA 3RAKA 2XCKA 3IG7A 3VHKA 2R5TA 4G3CA 1W2FA 4GU6A 4JAJA 2OZAB 2J7TA 2YM3A 3AMBA 3HECA 4G3FA 4KABA 2CPKE 3D7ZA 3PY0A 4L7FA 1KE9A 4XRJA 1WZYA 4YJNA 5DWRA 3UZTA 2XNEA 3MVMA 1M2QA 1B39A 1DS5A 1XO2B 4Z9LA 3VUIA 2ZOQA 5AMNA 5AR2A 4IW0A 1WVYA 4QMPA 4MF1A 4JMQA 2VUWA 3G0FA 4FZFB 1TZDA 1JPAA 4X6RA 1YXSA 2W5AA 2VTLA 1WBWA 2YDIA 3HRCA 3LFNA 3VF9A 3SXRA 4YO4A 1Q5KA 2R3MA 5J95A 3OY1A 4XG4A 4I23A 4ACMA 4M7IA 4JVGA 1V1KA 4ZXTA 3HP2A 3NZ0A 1ZRZA 5E8VA 3F9NA 5HLNA 4MUQA 3A4OX 3FDNA 4EK8A 3W10A 5HO7A 4DT8A 3E3BX 3QKLA 4HCVA 4D1SA 4H1MA 4USEA 2VWBA 1YW2A 2XKCA 4QMOA 3Q96A 3KN5A 4R3RA 4AG8A 4ITHA 3R7IA 4AQCA 5DT3A 3UVRA 5K0KA 1YI4A 4EKKA 4J8NA 3WF5A 1VLRA 3K3IA 4YC8A 3NYNA 4EH6A 1AQ1A 4MXZA 2GFCA 5AP6A 3FLQA 2BIKB 4UMTA 1UNLA 2R3LA 4UWCA 4RVTA 5D41A 3FZSA 1O6YA 4K1BA 4A4LA 4HZRA 3RINA 2XJ1A 3BHYA 4U41A 2BILB 4G16A 4BDEA 4ORKA 3IW8A 3D5UA 4IJ9A 3II5A 5AP2A 5KE0A 5CENA 4DH1A 4FI1A 5IEXA 1M52A 1Q62A 4DC2A 2X7FA 3V8WA 4USFA 3U54A 5TOZA 2UUEA 1XMMA 2BALA 4FSNA 4KNBA 3AD5A 4K9YA 1EH4A 1ZYSA 5EYCA 3E87A 4F7SA 1WBOA 3G9NA 4RFMA 3R8VA 4EH5A 1GZ8A 4IFCA 3PY1A 4JBOA 3IQ7A 3P7AA 4RX9A 3WZEA 1CTPE 1H27A 3EFJA 1KWPA 1YHWA 2XRWA 5DEWA 2QOFA 2UZVA 3NUUA 2O2UA 4O7SA 2QCSA 3DNEA 3E64A 5K0XA 4D0WA 1XQZA 3HKOA 5HCXA 3FMLA 4X2NA 4LI5A 4F78A 3R1QA 3G5DA 3EH9A 3PXQA 2J0JA 4JLCA 3GFEA 4MQ2A 5FTQA 1G8SA 1TFFA 3BL9A 4KBAA 4DF3A 4A9UA 2I0EA 4FKQA 3RPYA 2QU5A 1GIJA 4V04A 4AX8A 4YU2A 4AFEA 5AUYA 1MUOA 3OC1A 2ONLA 5JK3A 3GCQA 1Y57A 4NWMA 3FJQE 1WBNA 1PXIA 2H9VA 3QCYA 4FK3A 2Q0BA 3AMAA 4HVDA 2NP8A 4OBQA 4W8EA 4UEUA 5DRBA 3TTJA 1KUTA 4JNWA 5ITAA 4XOYA 4CVAA 5CALA 1CM8A 3BHUA 4B7TA 2YEXA 4GT5A 4P4CA 5FLFA 1U54A 5IQAA 2ZB0A 3D0EA 4RVLA 2GTNA 4IJPA 5CAVA 1REJA 4HPUE 4EOLA 4FSMA 5L2QA 3OFMA 4FGRA 4E6AA 2QG5A 4RFYA 4DH7A 5TT7A 4FGBA 3P1AA 1OL6A 3R8UA 3R7UA 3RNIA 5AV2A 2XNMA 4JRNA 1R0EA 3EKNA 4XV9A 1WBTA 4PMMA 3PFYA 4CGAA 2VTSA 2W1GA 3R30A 2XK4A 4DN5A 1XBAA 5ANJA 2XBJA 3NNVA 1ZY5A 4AZEA 4TKSA 4QMMA 4MHAA 4EOIA 2P55A 4B0GA 4I93A 3PUPA 3KRJA 4FTQA 3VHEA 5J5SA 3LJ2A 4ANQA 1UU9A 4FUYA 3ENMA 2OIBA 4YPDA 3TN8A 3ATTA 1H0VA 3QTIA 2UZBA 2XANA 4IVCA 4D2PA 2VTJA 5L6WL 5LWNA 2OJGA 2BPMA 3Q4TA 3K5VA 4IFGA 4FTLA 3ETAA 3ZTXA 4FKVA 4FVRA 3IGGA 3SW4A 3MW1A 2WQBA 5E7RA 5HLPA 4BIBA 1MP8A 4FT7A 4F64A 1E9HA 4GYIA 3VS6A 1UU8A 3KFAA 3DBFA 5HO6A 3A7HA 3ZRLA 2OWBA 5LCJA 3ULZA 2R3JA 3LOKA 3NFGB 5CT7A 2G2IA 4YC3A 3EB0A 5TO8A 3V5LA 4C4FA 5GZAA 4R77A 3OUKA 3P78A 3R8ZA 2VX0A 4F1TA 1UWHA 5CEPA 5HORA 1W2DA 4QP9A 5CEOA 4LFIA 4IZAA 2YITA 5E8TA 3HNGA 2YCRA 4HGTA 5GHVA 2C3IB 3BEAA 1OBGA 2GQRA 3BCEA 4E6QA 4JT3A 5JMSA 1WBVA 4OR5A 4DFBA 5IH6A 4NFNA 1TQIA 2ZM4A 3NCGA 4LV8A 2G1TA 4H58A 3ZFMA 5I5ZA 3GVUA 3PIYA 3DBDA 3PXZA 4NCTA 4KBCA 4E4XA 3DQXA 3SHEA 1KE5A 4UXLA 2YAAA 1K2PA 3PLAE 2ZV7A 4O0UA 4O4BB 4BZNA 3CPCA 4BIDA 4AXFA 5IQHA 4IAIA 3KULB 3OCGA 4E8AA 2WXVA 4XYFA 3DKFA 3MH3A 3W8LA 4XOZA 2WMVA 5C8MA 3UOHA 3DFAA 4FIHA 2RFEA 3CLYA 2WB8A 3O71A 4YO6A 1JSTA 4AGUA 4I6QA 4LV7A 3UDTA 4IWDA 4NL0A 1JBPE 3TNIA 5IQEA 4QP8A 4G6OA 4RWKA 1XH7A 5AV3A 4EH9A 4G34A 4N6ZA 1UV5A 2PVHA 2I6LA 3F82A 3U8WA 4OTIA 4DGOA 4FRFA 3ITZA 4TZRA 4EONA 4EYJA 4XX9A 3C1XA 4BKJA 4L8MA 3GOKA 3FSKA 2WMXA 2JAVA 3FMJA 2Z60A 3TT0A 3RJCA 3HL7A 1P4FA 2XYNA 3E8DA 5EM8A 4EOMA 3NX8A 2XK3A 3CD8A 2WU7A 4BCOA 1WMKA 1MQ4A 3BU3A 5AM7A 5KMKA 3TDWA 4DFYA 4EWQA 4XS2A 4ZZOA 1TQMA 4UBAA 2DQ7X 5L2WA 1U5QA 1Z9XA 2PVNA 4AN9A 4XP3A 4DA5A 2Y7JA 3LLTA 4YZ9A 5IQGA 1SVGA 3BYOA 4I0SA 4X2FA 5B2LA 2J90A 3RNYA 4AOIA 5HZNA 3AT2A 4HNFA 2OLCA 4O27B 1VEBA 1U4DA 3D5VA 3ZLXA 5JZJA 5FXRA 2OZAA 2A2AA 3KRWA 3MA3A 4EKLA 5CSPA 3CXWA 4OTGA 1YQJA 2W1EA 2R7BA 4GVAA 4YJQA 3W0MA 4EUTA 4TTHB 1XKKA 4K18A 3AC4A 4E5WA 4I5PA 4GKIA 2B4SB 4AXAA 3PPZA 3F61A 2JDRA 4I41A 3GNIB 4C61A 4KB8A 4CRLA 3FSFA 3Q9ZA 3LVPA 4FSQA 3UC4A 3FLZA 3ZUVA 3FE3A 2J9MA 4QQCA 4MBLA 4APPA 4O96A 4CFVA 3U9NA 2WD1A 5JT2A 5A4CA 4ITJA 3OXIA 1U46A 1GIIA 3G6HA 3POOA 3DKOA 3O50A 1OIUA 2UZWE 4I4EA 4QMZA 3ODYX 3P5KA 4LL5A 1ZMWA 2XAOA 4CMUA 4ALWA 4BDAA 5FTGA 3EZVA 2QOOA 4J53A 4U79A 5HTBA 3NAYA 1G8JA 4WBOA 4ZJVA 2Y6OA 3PVUA 3WZKA 5CASA 5M09A 4YLJA 4IIRA 3UC3A 4E73A 5FBOA 2GHMA 3KRRA 3G90X 4FE2A 4R7IA 1J7LA 2PMLX 2C4GA 1GZNA 1F5QA 3VWAA 3QBNA 4MD7E 3HYHA 1T46A 4M8TA 2QOBA 3FYJX 4BF2A 3RMFA 3G9LX 2VWVA 5IF1A 2AYPA 2XCHA 3HZTA 4FKIA 4F09A 4F9BA 1TKIA 4WRSA 1YOJA 4JG8A 3I0OA 4QD6A 4JQ7A 4FOCA 5CU3A 3E62A 3W16A 4QT1A 1RQQA 4O22A 3REPA 4F0FA 2C30A 4FKPA 4EYMA 1PXNA 3W0OA 4BVUA 2ZM3A 2XBAA 2ITTA 3MFSA 4UYAA 1A48A 3VUHA 3F3TA 4ZMFA 4ENYA 2KULA 4DG3E 2VTTA 4IACA 4OTWA 3A62A 5DN3A 4D1XA 4F9AA 3OMVA 2GFSA 3W2RA 1R1WA 3GU4A 2CNVA 2PTKA 4DAWA 1AGWA 3ZXTA 5KMJA 4I0TA 4MYGA 3KXXA 3ZM4A 4D28A 2X7GA 3ID6C 1PXMA 4AF3A 5L6PA 4WUAA 4JI9A 1W8CA 5HG8A 1YI3A 3D5WA 3MFRA 2G15A 4FV3A 2DS1A 2YM6A 3DAEA 4ERKA 4R3CA 4RWLA 2BHHA 2E9PA 5CSHA 4M0YA 3KXGA 3LFBA 5CX9A 4J8MA 5FM3A 4TWCA 3TIZA 2P0CA 1G5SA 5LMBA 4IM3A 5AFVA 2PVMA 1PXLA 3HV4A 3ZEPA 5IEYA 2X4FA 4XBRA 5DRDA 4ZEGA 3QX2A 4RIOA 4D2VA 3NNXA 3OROA 4M13A 3QXPA 3R6XA 5LWMA 4LRKA 3O8PA 3W55A 3PA3A 3VBTA 4O91A 5F4NA 4EH2A 2YWVA 2IJMA 1H01A 2GS6A 4YP8A 4AW2A 2UZUE 5BYZA 4CFNA 5A54A 2C6KA 2I0HA 3NFFB 4EK3A 3W2SA 4GFOA 2XS0A 2VNWA 3UP7A 5AUZA 3PA5A 4RJ8A 4W9XA 2PK9A 2YZLA 3BL7A 3ZSHA 1XH4A 2C6IA 2VTPA 5EDRA 3BYUA 3DXNA 3R1SA 4UMUA 2PMIA 3KU2A 4RJ7A 2OF4A 2QOQA 3QZIA 4FYOA 3RTPA 4KIOA 4KWPA 5FBNC 2QOIA 4O0SA 1PHKA 4N70A 5JFVA 2W05A 3P86A 2ZVAA 3GXLA 4FKTA 3ZHPC 5JFWA 5L8LA 4O7YA 5TKDA 3RAHA 2W1HA 3ZDUA 5AR3A 5C03A 4R7BA 3L9MA 4ALUA 3WE4A 4AA0A 3GCPA 4AZFA 4EOOA 2OFUA 3G2FA 1YWNA 3QFVA 5ANEA 2JKOA 3V6SA 4K33A 4AW1A 2QOKA 2FH9A 3I6UA 4FTNA 4C38A 4UZDA 3LCSA 5FTOA 3LLAA 2BRHA 4RFZA 4O0YA 2J50A 3BV2A 5AIRA 3FMKA 4FVPA 1UU3A 3FI2A 4ASDA 3G0EA 3IO7A 2PUPA 3HAMA 2OU7A 2WTWA 4C7TA 2F7EE 1CSNA 4BDIA 4C0TA 5EI8A 3WIGA 4E3CA 4DEBA 5JFXA 4RT7A 3QRIA 1OECA 1Z5MA 5JEBA 3MTFA 4HGSA 1SNXA 1YHSA 1Y91A 5CAOA 3KF4A 4C4EA 4WT6A 3KK9A 1YXXA 4IDVA 4PP9A 1O6LA 2F57A 3Q5ZA 4IB0A 3CGOA 3ELJA 4R1YA 3CY2A 3LHJA 3E7VA 4Q2AA 5IZFA 2P4IA 3FC1X 3HX4A 3MN3A 4EHEA 5JFSA 4Z7HA 3QRJA 5J7HA 2RKUA 1T45A 3FI3A 3W1FA 4BCKA 4RIWB 4A4OA 3NNUA 5JZNA 2BAQA 4L44A 5AV1A 2RG5A 3KULA 4TYHB 5KZ0A 4PMSA 4P5QA 2R7IA 3GOPA 3ZDIA 4CFXA 1JLUE 2ZMCA 4I4FA 5D11A 5AP7A 4EL9A 5M44A 2JITA 2GNJA 3PPKA 3NIZA 3CKXA 3LFFA 3OXTA 5AUUA 4O7ZA 4KA3A 3C0GA 5HIEA 1YXVA 3ET7A 4WUNA 4YJOA 4FV9A 2IO6A 2JEDA 4FT5A 3TZ7A 3BQCA 4QYYA 4ZP5A 4LDTA 3QC9A 5FXSA 4MTAA 1M17A 5JSMA 3SVVA 4AN2A 2PULA 4L42A 4QNAA 4PTEA 1VJYA 1STCE 1URWA 3THBA 1ZARA 4YURA 1OI9A 2PHKA 3EQRA 3C0IA 4F0GA 3D4QA 4QPSA 2XNNA 3OXZA 3VBVA 3COKA 4IB1A 4EH8A 3RCJA 2WQOA 3FQSA 4CV8A 4FSRA 2PUIA 4JAIA 3F5PA 4PY1A 5DR6A 2IN6A 2I40A 5HNBA 2PZYA 4EJ7A 4E26A 2LGCA 4O7TA 3WILA 3PYYA 4L46A 1P4OA 2VWUA 5M55A 4ACCA 4ARKA 4HYSA 3UYTA 5ICPA 4X7QA 4E93A 4IVDA 4TRLA 2E9NA 5FM2A 3EN6A 2CJMA 2HIWA 5HVJA 2JIUA 5K5NA 2QQ7A 4NTTA 3NYOA 3EQCA 2Z8CA 4M12A 3V5TA 3EJ1A 3VQHA 4C3FA 2EUFB 2Z7RA 4PDYA 4IXPA 5H2UA 5J9ZA 5K4JA 2QVSE 3PWYA 3QXOA 4M69B 3O8TA 5AA8A 4FL2A 2V22A 1Q99A 4I21A 4NM5A 2Z02A 2GTMA 3GT8A 3E63A 4OAUC 4GV1A 4UMRA 4DHJA 2XIRA 1M7QA 3H9RA 1XMLA 4XP2A 4O7RA 2ZV2A 4BI2A 4P2KA 2JGZA 4RRVA 2YACA 3ACJA 3R71A 4I94A 4YNOA 2W06A 5J9LA 4EK5A 4O82A 3UVPA 3QCSA 3HV3A 3L9PA 1SNUA 4QP4A 3BX5A 2WTVA 3CPBA 3CJFA 3MTLA 2ITYA 3CY3A 4RVMA 3W2CA 2F7ZE 1YWVA 2O65A 3CE3A 1PF8A 3JY0A 2YDJA 4Y46A 4ZJJA 2UZOA 4PMPA 4YTFA 4QYEA 3TYKA 4QTEA 3EMGA 2B9HA 5C26A 4ZS0A 5CF5A 4QQTA 4YZMA 3GI3A 5IU2A 4FUXA 4F6WA 2W5HA 4O6LA 4M3QA 2A0CX 3Q60A 4YLLA 3VN9A 3UO5A 4X3FB 2HOGA 4J99A 3PVWA 2J5FA 4I1ZA 3GU5A 3HRFA 4DH3A 5D1JA 4EBVA