3FI4A

P38 kinase crystal structure in complex with ro4499
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
349
structure length
339
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSKPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping Binding Pocket Volume: Potential Applications towards Ligand Design and Selectivity
rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 105
structure length 339
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fi4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fi4A01
4YTCA 4IWPA 3RJCA 5IUGA 4ACDA 4O0TA 2R4BA 4FTRA 2OIDA 2RIOA 4F0GA 2X8IA 4W4VA 4FKRA 4IB0A 3I7BA 1LEWA 1VZOA 2XB7A 3EQGA 3KVXA 3HECA 4BR3A 5EHYA 4NWMA 3FLZA 5CVFA 5HG8A 1U54A 3GQLA 3HMIA 5HLNA 1IAHA 2WQBA 4F70A 4GH2A 4IFCA 3HRFA 1T45A 4ZS4A 2WAJA 3OTUA 2YZAA 1J7LA 5C01A 4DBNA 3MVLA 1Z57A 3O7LB 5FM2A 3VUHA 3QKMA 5IH4A 3W16A 4TWNA 3HV7A 2WD1A 3GOPA 4E4LA 3Q5ZA 4GT4A 4ZLZA 5HCZA 4DEIA 3MPTA 3FI4A 5L8LA 5FM3A 5HIEA 3AD6A 3O8TA 4NKSA 4KUJA 4P90A 2FSLX 3GC7A 2WMQA 3OXTA 3FMDA 4HOKA 4FV9A 4RT7A 5HZNA 2IO6A 2CN8A 5CY3A 4YC8A 3ZOSA 5IQCA 2F49A 3E8DA 3GOKA 4FKGA 5T68A 2WU6A 3LIJA 4MBIA 3L9NA 2JGZA 3JS2A 3A7FA 4TRLA 2OLCA 4YZCA 3DAKA 4FV1A 5LMAA 2PL0A 5KZIA 3LKMA 3U55A 2J50A 2PZRA 4CYIA 1QL6A 1UU3A 2ETKA 2GFSA 4E6DA 5HU9A 1PXLA 4PQNA 4EEVA 4U45A 3WF5A 4D2WA 4CMOA 2XZSA 3EOCA 4OTWA 2Z02A 4IAAA 2O3PA 2VWBA 3GC9A 5FDXA 3HA8A 3W1FA 3E63A 4WNPA 3PYYA 3QQKA 2YIRA 3A2CA 1NXKA 2O0UA 2YLEA 5I3OA 4EQMA 5J9LA 5GJGA 2C6KA 2VTQA 4IMYA 4ZLOA 2LAVA 1CTPE 3ZBXA 5HCYA 3FYKX 5HVYA 3V51A 2OSCA 4BI0A 3GP0A 3DPKA 5I9YA 5F1ZA 2EB2A 4U81A 4Q5EA 4EH4A 5A6OA 2P2IA 4ANLA 4FTMA 5KNJA 1YDRE 2WTWA 4GL9A 2I7QA 4YJNA 3B2WA 3LZBA 4S34A 4M0YA 5K0KA 4PTGA 3PJ3A 3DBCA 2OBJA 3AXWA 5DEYA 5CENA 4QYFA 2Z7QA 3COIA 3IDBA 5LMKC 3FXWA 1YOLA 2C3KA 3CGFA 3DXNA 3E5AA 1GNGA 4IWOA 3FI3A 2FB8A 3MJ1A 4DH3A 3AT3A 2UZWE 4R1VA 5FLFA 4OAVB 2VTJA 3NUNA 3MV5A 3OG7A 4XJ0A 5DNRA 2H6DA 3QFVA 4LL5A 3DQXA 4BWXA 3E88A 3COKA 3QXOA 4FZFB 5CU4A 4AZEA 3V6SA 5EM7A 4FV5A 4FKVA 5J8IA 3CSVA 3R9OA 3TNQB 2VTIA 5J1WA 3WF7A 3HP2A 5A4CA 4TTHB 2VTNA 1ZMVA 2Y6MA 3RHXA 2QVSE 4CYJA 4BFMA 3L9PA 4GS6A 2XM8A 1ZZLA 2JKQA 2OFVA 2V5QA 5BMSA 5AADA 3QYWA 5EI2A 5BYYA 3VO3A 2GS6A 3W10A 5LJJA 4NKAA 3HMPA 4BGHA 3G33A 3W8QA 3R7GA 4K18A 3GFEA 4EOJA 4YSMA 2X7GA 4PDSA 4UBAA 5E8ZA 5L8JA 4BTKA 3QRJA 5C03A 3ORNA 2W96B 4CFVA 2BUJA 4E4XA 5AA8A 5JZNA 4CCBA 4YPSA 4LV8A 1LEZA 2F2CB 3CKXA 2C47A 3FPQA 5EKNA 2C6TA 4J7BA 4QMTA 4WNKA 1FOTA 4YJTA 4YLJA 3II5A 4QTAA 2WU7A 2WELA 3D7TB 1WBTA 2WB8A 1ZYSA 2B55A 1Q62A 4J1RA 2HW7A 3F82A 3FLQA 3Q4ZA 4AT4A 5JFSA 4NCTA 1J91A 3ORZA 4FTIA 4FT7A 5CSXA 5JQ8A 2HK5A 4HW7A 2CGVA 2XKFA 3QZFA 5KMIA 3R73A 4QT1A 2BZJA 2WEIA 5DYJA 2BRHA 5CVHA 3ATTA 4RVKA 3DQWA 5HE1A 3OWKA 4KIKA 4CNHA 1K9AA 4IZAA 4OTRA 3QD3A 2OICA 2AC5A 3E3PA 1GZ8A 3BE9A 3HX4A 1XQZA 1GZNA 4CMUA 1H0WA 4IB3A 4GRBA 2Q83A 4RJ7A 3AD4A 4LOQA 1PF8A 3OOGA 3RCDA 5ANIA 3D7ZA 1WBSA 5DT0A 3TT0A 3FQSA 3H9FA 4YNEA 3UOJA 3JVSA 3PXYA 5HLWA 1YXSA 2Q0BA 1KWPA 3HV5A 3SXFA 4F6UA 3FLWA 3V8WA 3DB8A 5EKOA 5I9WA 1HOWA 3LFSA 3PVUA 4KKHA 2JLDA 5IUHA 4U7ZA 3H9RA 3DFCB 4NTTA 1YVJA 1YOMA 5EK7A 4BCQA 1JSTA 2OF4A 2VV9A 4QQCA 2PTKA 3FMHA 5LVLA 5HOAA 4EH9A 2R64A 4CXAA 2YM5A 4JIAA 4WRGA 4C35A 3Q9ZA 1REJA 3VRYA 2JIVA 1BKXA 4MQ1A 4LI5A 3VBYA 4ACGA 4UB7A 1Q24A 4NJ3A 3FV8A 4J53A 3EQHA 5DBXA 5EI8A 4O86A 5DI1A 1PXNA 3Q2JA 4BRXA 2VWUA 3EFWA 2ITPA 1P2AA 3O0GA 3I60A 4IB5A 4KWPA 2BRGA 3VS0A 2PHKA 5IA3A 3TZ7A 3QUDA 1UU8A 2WQEA 4ZY6A 2O2UA 5CYIA 3SW7A 4QP9A 5EW9A 4BCIA 4HNIA 2JBPA 4MXXA 4XRLA 2OJFE 1PMEA 3R1QA 3ZLXA 2GPHA 2I0EA 2YDJA 4B8MA 4YO4A 5L6OA 3UNKA 3TNWA 3FUPA 1IR3A 1H07A 2WMAA 4PWNA 2PVYA 4Q2AA 3R2BA 4QQJA 4WD5A 5CF5A 4HVGA 5HIDA 3ZO2A 4L68A 3FY0A 4X3FC 4AACA 1F3MC 4Q9SA 4I4EA 4QYYA 4NUSA 4EHZA 5AEPA 4U79A 3TIYA 4UXQA 2EB3A 4BGQA 4EWQA 4OT6A 5BPYA 4BGGA 5BYZA 2WTIA 3EJ1A 3ZONA 4ANBA 2QOFA 4NW5A 3SX9A 3T9TA 4ZLYA 5M09A 3VUDA 3E8CA 1YI4A 4JRVA 2V0DA 2W1EA 5GNKA 5TO8A 3BHYA 4XMOA 4C3FA 4DN5A 2O64A 1BYGA 4NH1A 4DFNA 1B38A 2X4ZA 3R21A 3FJQE 3OMVA 4C4FA 1Y8GA 5D12A 3FC2A 2HWPA 2VD5A 4X21A 3P08A 4RLLA 4O2ZA 2W0JA 1OPKA 2XF0A 5LCJA 3KULB 5AMNA 3A99A 1Y57A 2C68A 2ZV7A 3NUSA 3S3IA 1YXXA 2C6OA 4EK3A 4TT7A 2UZTA 3TIZA 5AP4A 2RFSA 2BDFA 2GHGA 5AIKA 2CNUA 3W2RA 4CQGA 4FZ6A 5BVFA 1UA2A 2FVDA 2C6EA 4K11A 1ZXEA 1G8SA 4IAZA 2C1BA 1QPCA 4A9RA 2QHNA 3JPVA 2OK1A 3NIEA 4M8TA 4F9CA 3QKKA 5CU6A 5FGKA 3G0EA 4J96A 2BHHA 2IN6A 2OJJA 2R3IA 4KKEA 4MF1A 3QCSA 1I44A 1WVXA 4QMSA 1HCLA 3DLSA 2XRWA 2YHVA 4UWYA 5M4UA 4GK4A 5EQYA 3DCVA 4DGGA 4F7JA 3UODA 1QPJA 4KBKA 4O6LA 4APPA 4H3PA 2OXYA 4F1MA 3V8TA 3QQLA 4O27B 2OIBA 3KCKA 5BYLA 2PK9A 2OZOA 4U97A 2CN5A 4IDVA 5DVRA 3RK5A 4NIFB 4ALUA 1XBBA 2XEZA 3TKHA 4BCKA 5CS6A 5DRBA 1OZ1A 4D2SA 2VZ6A 1UU7A 2YCRA 4GU6A 4E73A 1OVEA 2YM6A 3KB7A 1XH7A 5BVNA 2CKEA 3IECA 4PP7A 5I9ZA 3EKKA 1GIHA 2GDOA 5EDRA 3R8MA 2R3MA 2LGCA 2YCQA 2VX3A 3ULIA 1DAYA 2XK3A 3QHRA 4FIJA 4O7WA 2B9HA 2J5FA 1H1PA 4AOJA 4E6QA 4F99A 3VHEA 4DFLA 3ZRMA 4ALVA 1XBAA 2EU9A 4FNXA 4FOBA 2V22A 3A4OX 5JGBA 2Y4IB 4TPTA 4FSUA 4M69B 3EFLA 5HBHA 4XG8A 4MWHA 3TJCA 5IEVA 2YISA 1ZAOA 4RZWA 2F9GA 2C6IA 2O8YA 2BR1A 2QURA 4V04A 4E26A 2HELA 4FIIA 5E8WA 4M0ZA 3A8XA 2J0JA 2Z7SA 1H0VA 2VNYA 4TNDA 2GQRA 1GJOA 3FEGA 2ERKA 2G2IA 2VU3A 3C5IA 2X6DA 3QZIA 5FEDA 3R7OA 3RPSA 1BUHA 2W4KA 5AX3A 4IACA 4BDGA 3AC8A 5BUEA 2UW3A 5JN2A 1MQBA 5CSHA 3E8EA 3PSCA 2PPQA 5EDPA 4RWJA 4GMYA 4FG7A 2GQGA 3AC1A 3ALOA 3K2LA 2OH4A 2UZOA 3DXQA 3C4CA 5CEQA 4QYGA 3EQDA 4Y95A 3RWPA 3ZS5A 2ZM4A 2XA4A 4ZEGA 4YJPA 4DG0E 4NJDA 2E9UA 3W2OA 2W7XA 4RJ8A 2ZMDA 1U46A 1Z5MA 2BROA 3ACJA 4YO6A 4FV3A 3O7LD 2P3GX 4Q9ZA 3UMWA 1WBOA 3PZEA 3Q9XA 1YOJA 1EH4A 2V7AA 3FI8A 4X2KA 4HYIA 4JBQA 4RJ6A 3L8SA 1FVTA 3MH1A 4MBLA 1OM1A 2YA9A 3RK9A 4CRLA 4FTTA 4R3CA 4RGJA 3WE4A 4AX8A 2OU7A 3P5KA 5EOBA 4P2KA 2JAVA 3OUKA 3W2PA 2XVDA 4XBRA 4FGRA 3GCVA 3E87A 1KV1A 3DKFA 3I79A 4G3GA 2WMBA 4V0GA 3RALA 4MWIA 4BIDA 4DAWA 1BL7A 4EH8A 4M84A 1J3HA 4D1ZA 3TTIA 4CD0A 2Z8CA 4AS0A 3EIDA 4APCA 3HMMA 3LXLA 3OWJA 2VO3A 5HO7A 1YXVA 1R1WA 1ZARA 3RBWA 4HPTE 3G6HA 4F0IA 3Q4UA 3BIZA 2I1MA 4I20A 2IPXA 4EUTA 5IQGA 2WMRA 4EBWA 3GI3A 4PL5A 5CF6A 3VS2A 4OTGA 5M51A 1E1XA 3Q3BA 3VBTA 3PG3A 3KRWA 2B7AA 5C4LA 1BLXA 2Y4PA 3QC4A 4L3JA 4A9UA 3MB6A 2RF9A 1O6YA 2A27A 4B8LA 2X7FA 3EN4A 3S1HA 1NA7A 4MX9A 3K54A 4FTLA 4D9TA 3P23A 3I0OA 4M97A 3SXRA 4X6QC 2W1CA 3TUCA 1OBGA 4DFUA 1LR4A 4AGUA 4UALA 3IW8A 3QBNA 5FRIA 5IZFA 1LPUA 3OEFX 3DBEA 3WIKA 1MRYA 4AOIA 4R3RA 4W9WA 4TYGA 3R2YA 2BPMA 3SVVA 3GXLA 3R01A 3DJ6A 2WNTA 3DTCA 4HCUA 3FKOA 4YJQA 4AXAA 3SG8A 1PHKA 1RQQA 4TXCA 1FINA 4RG0A 5GIPE 5I3RA 1SYKA 3PJCA 3EKNA 2IVUA 3NNVA 4GIIA 1M14A 4QP8A 4EZ3A 1IG1A 2YITA 2BFYA 4ZTNA 3TZMA 4AN2A 2PUIA 5CF8A 1XKKA 5B2LA 2VTMA 4E8AA 4GEOA 3AQVA 1BL6A 1NVRA 2PZYA 3Q96A 2XP2A 3QTXA 4QP4A 5HG9A 4FV6A 5KBQA 3BLQA 4O81A 4EZ7A 3CJFA 3QC9A 4ANOA 4R1YA 4E7WA 3IG7A 5CEPA 5C8MA 4IH8A 2VUWA 3ITZA 3BEGA 5HTCA 5DRDA 1CMKE 3BU5A 5AM7A 1QMZA 2QG7A 3Q6UA 4YHFA 1UKIA 4UXLA 3VNTA 2WTKC 5KCVA 5LOHA 4FK6A 4RIWB 5CNNA 4AGDA 2NP8A 4R7HA 2HZIA 4QP1A 2IZSA 3ZRLA 5EYCA 3NVKI 3F5UA 3F88A 3L1SA 4RIXA 4AZSA 2OWBA 1PRYA 4BTFA 4NM3A 4FSNA 4RFMA 3VF8A 3U9NA 3TACA 3F6XA 1PMNA 1FBNA 3AC2A 3PXFA 3C0GA 5AP5A 3LPBA 4IVBA 3SW4A 3TI1A 3PTGA 1OBDA 4PL3A 5HVJA 2F7EE 3GC0A 3RCJA 2JIIA 1PYEA 4H3BA 5K5XA 5AIRA 4ZK5A 4DEEA 4KRCA 4D2RA 2BKKA 2E9NA 4EH2A 1ZYCA 5ITAA 3VUTA 2PWLA 3EN6A 4CLIA 3UVQA 1OL5A 3F2AA 1S9IA 4L52A 4TW9A 5HGIA 4RWLA 3WI6A 4KS8A 5HG7A 4EZ5A 3W18A 4JBVA 3NYOA 4FV4A 4W4WA 4FZDB 4F6WA 2WFYA 4ZSLA 2V55A 3R1SA 2GTNA 1PXPA 5M44A 4XLVA 1JPAA 5CX9A 3OBJA 2C3IB 2OO8X 5K4JA 1JSUA 2C6LA 4YUQA 3EMGA 3KXGA 3C4ZA 4O7TA 4R7IA 2IVVA 2HOGA 3PPKA 3IW5A 3UP7A 4BB4A 4D28A 5F94A 2JDVA 4F9YA 3CD8A 4ANMA 4K33A 4Z9LA 4GW8A 3R7IA 3UZPA 4NM5A 2GNFA 3VF9A 4BWKA 2VO7A 1FGKA 3DXPA 5GZAA 4QQ5A 1ZYJA 2AUHA 4HVDA 1XJDA 3RK7A 3ZO1A 3EQCA 4IDTA 4U9AA 3IQ7A 4B9DA 5E90A 3BHTA 3EWHA 4GG7A 5AP0A 5JQ5A 5L2WA 2QG5A 3H30A 4KRDA 5E8TA 2UZEA 5I4NA 2BZKB 3FPMA 2VWWA 4BDEA 2ZJWA 3LMIA 4XS2A 2GHLA 5AM6A 4FKTA 5F95A 1U59A 1Q41A 2HAKA 1Q8TA 4FODA 4AWIA 3PXZA 3S2PA 1RDQE 5BVKA 4FG8A 2EXMA 2BRBA 2O5KA 3D9VA 3TCPA 4JQ7A 3NDMA 5KUPA 3CR0A 3H0YA 1KE6A 2VWVA 3MGYA 3DDPA 4L53A 3DZOA 4QYHA 5C26A 3CBLA 3ZYAA 5FBNC 3HV3A 3DBDA 3TEIA 4QMLA 5TE0A 4C2WA 3DU8A 5J5SA 1I09A 2W1DA 3VC4A 2GMXA 4CV8A 5CEKA 2NPQA 4R5SA 1JVPP 4F1TA 1R3CA 2BAKA 5BUJA 2VO0A 5DFPA 4ACCA 4JI9A 4Z3VA 4AOTA 4EH5A 4XV9A 4FEVA 2W05A 3MDYA 2XYNA 2R3JA 2W99B 1TQMA 4IFGA 5ETCA 4PDPA 5E7RA 4B0GA 3CD3A 4O7VA 3I0QA 5BVWA 4QP3A 1VYWA 4KAOA 3TZ9A 2UUEA 4CTCA 5ETFA 1J7UA 4FZ7A 4D4RA 4PF4A 3CQWA 3KEXA 3RKBA 4TN6A 4B6LA 4D5HA 1URWA 2W5BA 4B99A 2QLUA 2ITVA 3ZH8A 3MESA 4IAYA 3VWAA 2W1FA 2CPKE 5IQHA 1STCE 1E1VA 4I93A 4GG5A 3RI1A 3EN5A 1Q8WA 4FEUA 1OL6A 4IZ5A 2PE0A 3NNWA 5BQ0A 3G9NA 2NO3A 2CKPA 5AV2A 3NUUA 4I6HA 1OUYA 4EK6A 5AFVA 3C13A 3FAAA 4N6YA 2BAQA 4M66A 4O0UA 2BALA 3BU6A 1G3NA 4YPDA 5CEMA 3QU0A 4X7QA 3C4XA 3HZTA 2QKWB 3Q32A 4C58A 5K5NA 3BYOA 2OW3A 3U6HA 4BHNA 3OCSA 4DG3E 5CF4A 3MA3A 4XG4A 3GC8A 4FKQA 3ZM9A 3UYSA 3D7TA 3FMJA 4G34A 4KB8A 3WZJA 3QLFA 2ITTA 4TL0A 4I4FA 2W1IA 3PVWA 3IPHA 5ANEA 4FV7A 1YDSE 4M7IA 3KY2A 3PA4A 4JDHA 3R28A 5M4FA 1JKSA 2IZRA 2GNHA 3SKCA 5HESA 3KL8A 4G17A 4NT4A 3E8NA 1SVEA 3OWPA 4C3PA 4S33A 2X39A 5AV1A 3GVUA 5B0XA 1Q61A 1OMWA 3R8LA 4FZAB 4X2FA 3ZUUA 3LCTA 4ZXTA 3QTWA 4O0SA 4C4HA 2XS0A 1M2QA 1KE8A 4I0RA 3C7QA 4U3YA 1YI3A 3M11A 2EUFB 5DN3A 5HD7A 1UU9A 1H8FA 2RKUA 4H1JA 2C5NA 3VS7A 3C0IA 5JEBA 4OT5A 3OWLA 3MVJA 3VUGA 3OUNB 4HZRA 3PUPA 1DM2A 4I5HA 4E5WA 4WBBB 1PW2A 3KK8A 3H3CA 3ZC5A 2P4IA 5CAVA 4EK4A 3T3UA 2XJ2A 2HIWA 3RAKA 4RJ5A 3FBVA 3HMNA 4HVSA 2WOUA 3H9OA 4K77A 3ZEWA 4A06A 4EOOA 4BYIA 1JNKA 1GZKA 2H9VA 1UKHA 3AGLA 3O8PA 4YJSA 4IVAA 3UP2A 5GINE 5CAPA 4XP3A 4LMNA 4W8DA 4MHAA 3UTOA 3DGKA 4DEAA 3C0HA 1SMHA 2IZUA 4JL9A 4UMRA 2QU5A 4WRSA 5H2UA 3ZUVA 2VTTA 3A7JA 4WSYA 2R3HA 5EOLA 5GJFA 2YIYA 5M06A 3EYGA 2JEDA 4L9IA 5LVNA 3OZ6A 3A7GA 5LWNA 3MS9A 3QTQA 1P4OA 5EDQA 5AUTA 2QOHA 1PXOA 1XWSA 4DEGA 3ORLA 3QKLA 2P33A 4C0TA 5HX8A 3KRJA 3I5ZA 5E92A 4EBVA 1J1BA 2JKKA 4RFZA 3OF0A 1PMVA 4YZMA 4ZY5A 1H28A 3UIUA 4E1ZA 4UWCA 3SRVB 3QXPA 4FV0A 1K2PA 4S2ZA 4CMTA 4MF0A 4AU8A 4L45A 4O0WA 2VGPA 4J8NA 2JKMA 1GIIA 5DE2A 3SG9A 3WZDA 5KBRA 1JSVA 3ZLYA 3VJNA 4IW0A 2WQOA 4RA5A 3U8WA 3C50A 2VRXA 2RFNA 1ZRZA 3E7OA 3F5PA 3MBLA 4Y72A 4I41A 2WGJA 2ACXA 5AUXA 4C4GA 3V5TA 4O7RA 4YR8A 1U5QA 2WTKB 2WMWA 4AN3A 2CSNA 5E91A 3U87A 3FZOA 1Q5KA 4IC7A 3UQCA 2XKEA 3UO6A 4LGHA 4FTOA 3W2CA 5JFWA 4UEUA 3QGWA 3HAVA 3HV6A 3ANRA 4MXCA 4HNFA 4O2PA 3EB0A 1R78A 4X3JA 3RPOA 2ZB0A 1YWRA 4JQ8A 4OTDA 3UOLA 2JIUA 5H9BA 4IX5A 2VTRA 2XBJA 2ONLA 3LM5A 2AC3A 2RFDA 3LQ5A 2HZ4A 2OI4X 1MQ4A 3GCPA 3KU2A 4I21A 5CSWA 5IQDA 4N4SA 4L7FA 2Z60A 4XOYA 1U4DA 3MPMA 3F3TA 4ZP5A 1H27A 1OIUA 2B1PA 1YW2A 3E93A 4Y46A 4EK5A 4ZJVA 5JRSA 3IGOA 4FVPA 2HXQA 2CLQA 2HENA 4HYHA 3EYHA 2WIPA 4RVMA 2UW4A 4J71A 3VJOA 3NUAA 4EOPA 4ZSEA 4USEA 4I5CA 1F5QA 2BIYA 2J6MA 2YDKA 4GKHA 4FOCA 4CFWA 3KFAA 3LCSA 2WIHA 4NM7A 4QPMA 3BCEA 3QTUA 5J5TA 4IM3A 1PKGA 4L42A 3MFSA 3U6IA 5A9UA 2PUUA 4MXOA 2R0IA 2PSQA 3H10A 2P0CA 2PVFA 3EQRA 2E9VA 4PDOA 2VO6A 2B53A 3BGZA 4F9AA 1M7QA 4GT3A 3QQUA 5FTGA 2QOCA 4Q5HA 2B4SB 4DBXA 4LOOA 5JKGA 1OUKA 3FHRA 2H8HA 3G5DA 5LWMA 3LE6A 5M53A 3N4UA 1B6CB 3WARA 2BCJA 3R9DA 3U6JA 2C0IA 3C4WA 1ZMUA 4CFMA 3OY3A 2YJSA 4I1ZA 1BI8A 3UMXA 4F64A 2Y4IC 3MIYA 3OHTA 5C8KA 5C8NA 2QOBA 2R3LA 1IEPA 4IM0A 3D5WA 3QX4A 4TNBA 4EKKA 3D15A 3KKVA 3SLSA 4C7TA 4H05A 2E9PA 3QF9A 5BNJA 1KSWA 2I40A 3ZTXA 1OL1A 3NAXA 3PIXA 3ZXZA 4LM5A 3SOCA 4FVRA 4XV3A 3BQRA 3P1AA 5KMNA 4AZFA 4YU2A 3ANQA 4G5JA 5CU0A 2C69A 1HCKA 3HDMA 5HX6A 2PMOX 4JG8A 4OBOA 3UIBA 4FTAA 5FXQA 3LXKA 4C37A 4WT6A 3AMYA 1ZWSA 4CKIA 4WNMA 5KKRB 4F7LA 4ZMEA 4LL0A 4A4XA 4R8QA 3V5PA 5KHWA 2XNOA 4WIHA 3FMLA 4JR3A 3I4BA 4JBOA 3BV3A 4BL1A 5HO8A 2OJ9A 3FI2A 4Y73A 1GY3A 2BDWA 3HAMA 3LQ8A 4CV9A 3E62A 3BX5A 4G6OA 1WAKA 3EH9A 4M68A 3OY1A 3AD5A 4DT9A 2DWBA 4FKWA 4QTBA 4NFNA 3R63A 1WBWA 2H96A 3KF4A 5B2KA 3ZSHA 3QTZA 5HCXA 2QNJA 3UO4A 4JOAA 3U9CA 2JDSA 5L3AA 3SDJA 4Y5QA 3DAEA 3F7WA 2RG5A 4TYJA 2CMWA 2BFXA 4I23A 1OPLA 1SNXA 3CTQA 3RINA 3ENMA 2Z7RA 3MTFA 4WBOA 3UG1A 3TNPC 5IQFA 4QMVA 1CDKA 4U80A 3N4VA 2GTMA 4ENXA 4NU1A 5CQWA 5TOZA 4IX3A 3JUHA 3P78A 4W4XA 3RZFA 4OUCA 3Q04A 3EQPA 3DJ7A 5H8GA 3U4WA 3SRVA 4EL9A 4I6BA 4F7NA 3M1SA 3QRKA 4RWKA 3SGCA 5IA1A 4C33A 1WZYA 5CLPA 4BICA 5DG5A 5IPJA 4S31A 5AR8A 4RVLA 4LUDA 5CU3A 5K3YA 2RSVA 3FLNC 4QMZA 5EHLA 4NYEA 3QGYA 4ZSGA 3O71A 3HGKA 4JDKA 2C6MA 3OCTA 2FSTX 4L6QA 5CQUA 4KSPA 1ZY5A 2ITNA 3TL8A 4UX9A 4MXZA 2YM3A 3A61A 4BI1A 4BDDA 2VNWA 3RPYA 3HRBA 4PPBA 3KVWA 1YXUA 2OF2A 4E6AA 5LARA 4AFEA 1B39A 2WMSA 4P4CA 4HGSA 2AYPA 1YDTE 5HU3A 4RIOA 3R71A 3WF6A 1RE8A 4QMXA 2VGOA 3L9LA 5AR5A 3QWKA 2YM7A 3CLYA 5LCKA 3SHEA 4V01A 1A48A 4BIEA 3DK7A 3CTJA 1Q8YA 4AGCA 4D2PA 2CHLA 4WUAA 4EHGA 2GNIA 4QNAA 3AC5A 4J97A 4FKPA 1W7HA 4I6FA 2JFMA 3D4QA 2YWVA 2GFCA 4TZRA 2ZAZA 1UNGA 1W98A 2BZHB 3G6GA 4NW6A 3CGOA 1FMKA 4GUEA 4G9CA 4I5PA 4XNEA 4O7NA 2DYLA 4OTIA 5CU2A 4X2GA 5E8XA 4FV2A 3HVCA 3ZMMA 4CTBA 2R3NA 4I94A 1VYZA 2WXVA 3PJ8A 3TXOA 3WOWA 4BCHA 4DH7A 3Q4CA 4G3DA 2XK7A 4O91A 4PY1A 3H4JA 3QX2A 2J51A 1H26A 4D2VA 2J4ZA 4FVQA 5IMEA 5CALA 1A9UA 1TKIA 4ZTQA 4F65A 3ULZA 1XH5A 4OBPA 1PMUA 2ZB1A 3ZLSA 3IOPA 3OD6X 4DHFA 4RX7A 4K1BA 3COMA 4IZYA 2NNWB 3EHAA 2C3JA 2CCIA 4U40A 3GQIA 3PWDA 4FNYA 3F5XA 2XIXA 1SZMA 5DR2A 5M56A 5IQAA 4ZZOA 3ORPA 3QZGA 4M14A 5HLPA 2HZ0A 2XIYA 3REPA 3TV7A 2CKOA 5AUWA 4RVTA 5L6WL 2OJGA 3QQHA 2HY0A 4AE6A 4BBEA 4JXFA 2XK9A 3BV2A 3BYSA 4JAIA 2ITXA 5FTOA 2Y8OA 2W1ZA 5IQBA 4C4EA 1H1SA 1OL7A 4FTUA 3FZPA 3OP5A 3FC1X 3R00A 1OKVA 3BGQA 3B8QA 4NK9A 3MN3A 2ETMA 2YAAA 3NSZA 5F20A 4FUYA 4I6QA 2XK4A 4NEUA 4U3ZA 1OECA 5AUYA 2ITOA 4BCFA 4EONA 2WMXA 4BCOA 3V5WA 4XG3A 4QP2A 3F9NA 3LAUA 3DKGA 1R39A 3UNJA 5IA4A 3PY1A 4TYHB 3DKOA 1O6KA 4S32A 2ZVAA 3TUDA 5E4HA 3K3IA 3E7VA 1REKA 3L8XA 1H4LA 3Q9WA 4X0MA 1WBPA 3S00A 4LOPA 4UN0C 3F61A 3ETAA 3RTPA 2BTSA 4FSQA 2WHBA 2GS2A 4IANA 5ETAA 4D4SA 5DH3A 5IA2A 5KZ0A 5I9UA 4BIBA 4TKSA 4QMWA 3N51A 5CXZA 1H01A 4WG5A 4QTDA 4DH1A 2XKDA 2R9SA 1P14A 3BHUA 5HD4A 5J7BA 5BVOA 5HVKA 2XNNA 4H1MA 2WMTA 5EH0A 5CZIA 4N70A 5DMZA 4OTPA 4DLJA 4I0TA 3ZUTA 4R7BA 4WG3A 1DS5A 3I1AA 3DNEA 5J7HA 1NT2A 3CQEA 2Y6OA 5HNIX 3QA8A 3T3VA 5A4QA 3TV4A 4IB1A 4UMQA 3R0TA 3OEZA 4GK2A 5IEXA 5CNOA 4GV1A 3UVRA 2ESMA 4AW5A 1JWHA 1J1CA 4TYHA 3MW1A 3NUPA 3MJ2A 1G5SA 4BHZA 4O7YA 2FO0A 1MUOA 3DAJA 3NW6A 2WTDA 2HWOA 1WFCA 1Y6AA 5CANA 5HKMA 4E5AX 4DINA 1K3AA 4QNYA 5EHOA 2UW5A 3MFTA 1Q97A 3PIZA 4JX7A 3R02A 5J9YA 4DCAA 3JXWA 5B7VA 1UNHA 4YHJA 5LMKA 4ZAUA 4D55A 2HXLA 3GFWA 2YACA 5FXSA 5EM5A 4F7SA 5LMBA 2X2KA 1YWNA 2YJRA 4J52A 5H8BA 4QOXA 3P7AA 3ALNA 4WUNA 4EC9A 4K8AA 4CSVA 2QO9A 2PVMA 4XG9A 3KGAA 5AP2A 4IZ7A 2OZAB 2PZ5A 4PMMA 3AOXA 4YZBA 5E8UA 1QCFA 3CJGA 2PVLA 4D0WA 5TT7A 5JSMA 4TWOA 1Q3WA 3G9LX 4RQKA 3V5LA 4ITHA 3C4FA 5IDPA 3GCQA 2W9ZB 2XNEA 4IVDA 2R3RA 3QL8A 1XO2B 2UV2A 5GIOE 5BVEA 1YI6A 3MB7A 2QR8A 4BC6A 5KE0A 4CGAA 4V0GB 5J95A 5KMOA 2XIRA 4II5A 4RX8A 4U8ZA 3PJ1A 2ZM1A 3JY9A 3E64A 3OT3A 1FQ1B 4BCJA 3PY0A 3S0OA 3BYMA 4ZJIA 4DH5A 3NIZA 4M13A 4GKIA 2YWPA 4YURA 4O84A 2XMYA 4G31A 3RAHA 5FQDC 1JKKA 3NYNA 3QA0A 4G16A 3PWYA 2KULA 3G90X 3GB2A 4CFNA 2R3PA 5HICA 5KO1A 4A9TA 2QC6A 3VS5A 4BDBA 3PIYA 1BI7A 2ZV2A 4CKJA 2JFLA 3UIXA 4C36A 1IRKA 2WEVA 4NCTC 4RIWA 1VR2A 1OPJA 3FZSA 4M67A 4YJOA 5D41A 1GAGA 3F3UA 5JMSA 4RC2A 3VUKA 5I0BA 4EWHA 4L7SA 4UWBA 4FSTA 4GFOA 2YIWA 2YIQA 4JVGA 5IISA 4NL0A 4ASXA 3LJ1A 3P9JA 3QTSA 4USDA 4ZTMA 1APME 4FF8A 4GSBA 2CKQA 1CKJA 3UOKA 3NUYA 4ZMFA 2W06A 1VEBA 3HP5A 3TN8A 2UW0A 3FXXA 3T9IA 4HYUA 3W2QA 1ZY4A 3FSFA 3VBWA 4U6RA 4BDJA 4F9WA 4K0YA 3TTJA 2HW6A 1LP4A 2FGIA 2IVTA 3LCOA 3U4UA 5T3QA 3OW3A 3BBTB 4DGLC 4XP2A 2BILB 2C5YA 2GU8A 3NX8A 4MNEB 4OGRA 5GJDA 3QUEA 5C4KA 4FT9A 4J98A 3C4EA 4RQVA 3FMNA 4I22A 4Z7HA 3CIKA 4IEBA 3HMOA 1R0PA 3UGCA 5LVPA 4IX6A 1IASA 3VUIA 3JR1A 4G1WA 3NYXA 3EN7A 3HYHA 3C5UA 1WBVA 3L9MA 4IIRA 5ANDA 3UBDA 2C30A 4LV5A 4TY1A 2G15A 2VTPA 4PMPA 4C2VA 2QHMA 2GHMA 3FMMA 3BPRA 3ORXA 3FZTA 5KKRC 4Y5HA 5AUUA 3KF7A 4AA5A 4O83A 3PFQA 4EYJA 1SM2A 1ZZ2A 3Q52A 4QMMA 4FC0A 1UWHA 4UZDA 4WO5A 4HCVA 2WOTA 4EOIA 3LMGA 3ZEPA 2CJMA 1NW1A 3F69A 4CZTA 3PE2A 3Q53A 4MYGA 5DHJA 4C34A 3PA5A 3COHA 3QD2B 2XCHA 4FT0A 4QD6A 3ZZEA 5L2TA 3Q2MA 3CKWA 2X8EA 4KSQA 4ZIMA 4HZSA 3EZVA 4CFXA 5A14A 3BGPA 4CKRA 2IG7A 5DEWA 4U5JA 1GIJA 5DLSA 4QMPA 3AT2A 4BCNA 2R5TA 4QPSA 1W8CA 3DK6A 3ZFMA 1PXJA 5A4EA 5T6KA 4QP6A 4DFYA 4RWIA 3GGFA 2J9MA 2EXEA 3IGGA 5IF1A 4V05A 3MH0A 5AAGA 1R0EA 5EYKA 3LW0A 3OOMA 4XH6A 2CNVA 4C02A 4IJ9A 3IO7A 4X3FA 3HKOA 4C62A 3VS3A 4M15A 3MTLA 3DBQA 5BMMA 4C61A 5CT0A 5L2IA 1ATPE 4XP0A 3ZCLA 4ZTHA 4AFJA 4M69A 2YCSA 3UJGA 4BDKA 5HE3A 5BX0A 5LVOA 5ACKA 5FP5A 1KOBA 3GT8A 2Y7JA 2ITWA 4BN1A 5AP7A 3EFKA 3RAWA 3FLYA 3D0EA 2IWIA 2O65A 3R7EA 5ICPA 4YJUA 5JGDA 2ZM3A 1DAWA 2E9OA 3V5QA 4A4OA 3A4PA 4ASZA 4QTCA 4BKJA 4I5MA 4JDJA 3ZO4A 2EVAA 2G1TA 3OCGA 2CLXA 4FKLA 4C4IA 3WZUA 4KIQA 2QOQA 4PV0A 4Y83A 4EJNA 2ETRA 1RW8A 5F9EA 2RG6A 2J90A 3MIAA 4FV8A 2XNPA 4G3CA 4JR7A 4L44A 3RNYA 4LRMA 4AW2A 2OIQA 2R7BA 2W17A 3A7IA 1OKWA 3HEGA 2OG8A 3L8PA 4PX6A 2PMNX 2W1GA 3BWJA 3KN5A 2G9XA 3LM0A 2YABA 3MH2A 4XG7A 2ZDTA 1W0XC 3LFCA 3PVBA 4GCJA 5HBEA 3D5UA 3O50A 2R3KA 2GCDA 3BHVA 3GU4A 3ODZX 2YERA 4D2TA 3C51A 4CZYB 4EK8A 3SV0A 4IM2A 2FYSA 3CC6A 3ATSA 2PVHA 3DS6A 3FKNA 3GU5A 3UE4A 3VBXA 3PZHA 4N57A 2YCFA 3D2IA 2R0UA 3R7YA 5DR9A 5M4CA 4LRKA 4YBKA 2I0YA 1OL2A 2A0CX 3G2FA 3OW4A 3WE8A 2JD5A 4OW8A 3V8SA 3FSKA 4BKZA 2BKZA 2ERZE 5IQIA 3PRIA 3K5UA 4WG4A 1IA9A 4EJ7A 3LLTA 4FT3A 3IDCA 4IBMA 4BYJA 2OZAA 4OR5A 3CXWA 4QMOA 5EQPA 3O17A 4R3PA 4AZVA 5L6PA 3VVHA 4LMUA 3GNIB 3R8ZA 2C0TA 4XLIA 4BZDA 5JFVA 2C5XA 5HE0A 1YKRA 3RZBA 3NW5A 4IWDA 4EOMA 1Q4LA 4FTCA 1H1RA 4O7ZA 2XRUA 3WIGA 2WTVA 5AR7A 5CTPA 2J0MB 3R7VA 4YZ9A 4FUXA 2X2LA 3P4KA 4E4MA 5L8KA 4JJRA 4I0SA 4XYFA 4AA0A 2GNGA 3CPCA 1QPDA 4HCTA 3CPBA 4B7TA 2SRCA 2W5AA 4FI1A 1UNLA 2C3LA 3BYVA 4USFA 3Q60A 3QYZA 4FIGA 2W4JA 4PRJA 2JC6A 4BDCA 4E5BA 4JT3A 2OXDA 5D7AA 1JKTA 3CEKA 3RPRA 3QALE 3TNIA 2DS1A 5D9HA 2GNLA 5AR2A 1CKPA 4E20A 3OCBA 3MY5A 2NRUA 2ZOQA 5KMJA 1X8BA 2UZUE 4PMTA 3VIDA 2QI8A 1Z9XA 4LG4A 3R1NA 4IADA 4RX9A 3F66A 4JS8A 5L4QA 4Z7GA 2A19B 3DK3A 3QD4A 2VAGA 4MD7E 4YGAA 4F0FA 2Y9QA 4J95A 3S4QA 3M42A 4KIKB 4MQ2A 3R1YA 1CSNA 3HDNA 4ACHA 5K9IA 4OLIA 1V0PA 2PUNA 3DZQA 2R7IA 2P2HA 3NMUF 5JFXA 5EM8A 4GFMA 1NY3A 3KXZA 4YTIA 1OGUA 4C8BA 3PXKA 5CI6A 2ITUA 4QMYA 3HL7A 4MKCA 4BBMA 3KC3A 2X0GA 3BQCA 4HYSA 5G6VA 4GJ2A 3F3VA 2YDIA 2CNQA 5EYDA 4BZNA 1TVOA 3TJDA 2J2IB 4DTAA 4CFUA 3DKCA 3ORTA 5CSVA 1S9JA 4DGOA 3C1XA 4OTQA 4X6RA 2V7OA 3ODYX 5HO6A 1FPUA 4DEDA 4FSRA 4GYIA 3M2WA 3BKBA 4EH6A 3NAYA 4KNBA 2GQSA 3N9XA 3R8PA 3OXIA 5AWMA 4FNZA 4G5PA 1O9UA 4U43A 4XG6A 4DFBA 1Q8UA 2BDJA 4UYAA 3VS4A 5JZJA 4D0XA 2QD9A 3VBVA 3TDVA 4E93A 2DUVA 5LQFA 4E3CA 5C1QB 3MY1A 2CCHA 2VWXA 2E2BA 2WO6A 2EXCX 2XBAA 1M2RA 1M2PA 4MAOA 3ZZWA 2QOKA 3ZXTA 3G0FA 3LFBA 3VBQA 4OTHA 4BF2A 3VUMA 4F08A 5A4LA 2JKOA 3FE3A 3A7HA 5J79A 3PA3A 3P79A 5IU2A 1H08A 3CTHA 3JY0A 4O22A 3IW7A 4EH7A 4FKSA 1AQ1A 2ITZA 3OVVA 2PYWA 4CG8A 5AUZA 3PPZA 5CAQA 2CGXA 2UZDA 4FYNA 4MD9E 3UPXA 3WBLA 4ENYA 4FE2A 2YM8A 1ZMWA 3BBWA 4RBLA 3UQFA 3NCGA 4NSTA 2ITYA 5HTBA 3NPCA 4OAUC 4D9UA 4KS7A 5A6NA 1Q99A 1SVHA 3IW4A 3PXRA 5FP6A 5AUVA 1MRUA 3UG2A 3SQQA 3VAPA 3VULA 4OTFA 4AW1A 3ROYA 3PJ2A 4AW0A 2OGVA 4JAJA 4O7LA 5HBJA 1UWJA 4FGBA 3RGFA 2QLQA 3KXMA 5D7VA 3Q6WA 2YN8A 3UZRA 5D1JA 5LVMA 4DLIA 5CSPA 3D5XA 4ID7A 4EOSA 4DITA 3ET7A 4D58A 4C4JA 4QMQA 2JDOA 3BYUA 4JG6A 3UNZA 2ZV9A 2IZTA 1OITA 4E4NA 3SA0A 2WMUA 1GOLA 2F7ZE 3IS5A 3I6WA 5E1SA 2V62A 2UZVA 3QHWA 4RIXB 4BCMA 4CCUA 4PNIA 4AF3A 3EQBA 3THBA 2WMVA 2YM4A 4DT8A 3KXXA 1KV2A 4CT2A 4YC3A 3HV4A 2F7XE 1URCA 3UZTA 2OKRA 4BDFA 2I0VA 4NM0A 4MEDA 3SXSA 4RC4A 3RM7A 3S95A 2B9JA 3QUPA 4UMTA 2DQ7X 3C9WA 3AMBA 4TYEA 2Y0AA 4PTCA 3G15A 4BY9E 4H36A 4ASEA 4FG9A 2C1AA 4CLJA 3LJ0A 3AG9A 5G1XA 1YWVA 5I9XA 4YMJA 1E9HA 3NS9A 2VTAA 2VWIA 4IHPA 4RX5A 3PP1A 4NZWB 1XBCA 2A2AA 2CGUA 3T8OA 1PXMA 2QONA 3PRFA 2QQ7A 3HUCA 1PY5A 3LFFA 3FWQA 3UC4A 5FTQA 3FLSA 5AAEA 3ERKA 3EL7A 1SNUA 4YLLA 4RPVA 4DC2A 5DA3A 5AA9A 3LMHA 5IA0A 5L2SA 4GT5A 4O6EA 5AJQA 3FY2A 2JDTA 2BTRA 5JT2A 4DEBA 1NVSA 4CG9A 4W8EA 2XKCA 3DV3A 2X1NA 3KA0A 4ASDA 4FL2A 4F6SA 3VS1A 4L01A 5M57A 2X9FA 3DNDA 3O96A 5IG1A 1H00A 5CI7A 1G8AA 4ZY4A 4CVAA 5BUIA 4F09A 2XCKA 1NVQA 2JITA 1YQJA 3D2KA 1P5EA 4EOQA 5CWZA 4O7SA 3NYVA 4EHEA 3SC1A 3R9HA 4EI4A 1MRVA 2I0HA 3NR9A 4IQ6A 4FSYA 4RFYA 1WCCA 4R77A 5IUIA 4X3FB 4PNKA 1M17A 3MI9A 1WVWA 2ZYBA 4O38A 5EG3A 3WYXA 5FUTA 2XNGA 3LXNA 4HGLA 3HUBA 4G6LA 1M7NA 2PZIA 3NVMB 4FKJA 5AP1A 1P4FA 3PY3A 5FXRA 3NEWA 4HGTA 4ITIA 5ANKA 4GK3A 3KXNA 4BVUA 4IE9A 5IDNA 3AC4A 3A60A 3AMAA 3DT1A 1YHWA 3PPJA 4J99A 2CGWA 4QRCA 4UZHA 2QOOA 4EKLA 3QD0A 4XHKB 5JH6A 4FNWA 3TM0A 5DWRA 4AAAA 1ZLTA 1F0QA 4FTQA 5BVDA 1PKDA 4BDAA 4L8MA 3ZFXA 1U54B 2UVXA 3NCZA 4FR4A 4R78A 1V0OA 4YSJA 4FSWA 3ZFYA 1OIYA 3W32A 1JKLA 3BI6A 3QRTA 3WZEA 1YHSA 5L2QA 5AR4A 1CM8A 3LFDA 4AG8A 5TF9A 4B4LA 3Q5IA 2WPAA 4A07A 1TQPA 4BBFA 2XK8A 2FH9A 3GU6A 4QQTA 3KRLA 5IH6A 3LHJA 5HG5A 4RLKA 4HVIA 3BRBA 2O63A 3EL8A 5FWKK 3DFAA 5H8EA 4C3RA 3FYJX 1W84A 4RSSA 5ANJA 4PTEA 2R3QA 3OXZA 5EI6A 4ITJA 3WYYA 2YZLA 3TDWA 3Q4TA 3OT8A 2QOIA 3OBGA 4EC8A 3KMUA 2XJ1A 3QWJA 4ONAA 1JLUE 4MXAA 4YZDA 3R9RA 1FMOE 3V04A 1ERKA 2B9IA 2HYYA 3NNUA 5ANOA 3IK3A 4FTJA 4ORKA 4DE4A 2ZMCA 2FSOX 3GU7A 4DF3A 1Q3DA 2GS7A 2VTHA 3GCSA 3ZDUA 1XH9A 2A1AB 3NGAA 4UMUA 3O2MA 2R3OA 4CRSA 1KUTA 3Q9YA 3FL4A 1CKIA 4QP7A 3KCFA 2FUMA 3ZSIA 2P55A 3FDNA 4YTHA 5ETIA 2W9FB 4IVCA 1AD5A 5HORA 3MA6A 4AUAA 3ZM4A 4FIEA 3TV6A 3DJ5A 3QRUA 3OFMA 3EQIA 4JNWA 3POOA 2J5EA 2X7OA 4CZUA 2VTLA 4PP9A 5FBOA 5KMMA 3VW6A 1JQHA 3V01A 2VN9A 4FMQA 2NRYA 5M55A 1WBNA 4O1OA 1QPEA 3BELA 2C6DA 3MYGA 4WOVA 4L43A 3KULA 4AZWA 4L67A 5A54A 2PVRA 4FEWA 4AZTA 3DDQA 4MTAA 3PVGA 4IXPA 4XEYA 2YAKA 4RJ3A 5E8SA 3MH3A 2QKRA 4I92A 4QTEA 1RJBA 3B8RA 2H34A 3NLBA 4RJ4A 3B2TA 3DOGA 3FQEA 2VWYA 4FL3A 5D10A 3V3VA 3BLRA 1DI9A 3I6UA 4EHVA 3HLLA 5GZ9A 4ARKA 4DYMA 3P86A 4EORA 4ERWA 4MVFA 3UC3A 2PY3A 3R8UA 3VN9A 4N6ZA 4JQEA 4DH8A 3R8VA 3CCNA 1TQIA 4YLKA 1XH6A 4RMZA 4BWPA 4EQUA 5M07A 4WNOA 3LCDA 3FZRA 4LGGA 1WMKA 1V1KA 2IW6A 5E1EA 5AV0A 5KHXA 1L8TA 1FGIA 4AN9A 3HRCA 4XBUA 5K0XA 3UYTA 3O8UA 4AT3A 4XCUA 3MPAA 3ID6C 5HNGA 3VHKA 3IKAA 1BX6A 4EQCA 4IJPA 2G01A 4ZJJA 3WILA 2Z7LA 3LFQA 5FEQA 2PU8A 3LFEA 2UW6A 3DB6A 2UVYA 4H3QA 3N4TA 4M3QA 5IMXA 1KE5A 2XNMA 2YLFA 5KMLA 4FKOA 5HHWA 2WTJA 4KINA 2UW9A 4IWQA 2J7TA 5CVGA 5DPVA 5F4NA 3ZBFA 3UPZA 2PVNA 5AX9A 4D1SA 2W1HA 2XJ0A 4EYMA 4QPAA 3VS6A 4A9SA 4JDIA 4FX3A 4F4PA 5E9EA 4LQMA 2ZDUA 5HTIA 4X2NA 4A9YA 4S30A 3TUBA 4BCPA 3QQFA 2PE1A 4CFFA 2PVJA 4K6ZA 3RPVA 1UV5A 4O0XA 3QLGA 2HCKA 3QQGA 4JG7A 4M12A 3TKIA 5IA5A 3VRZA 1ND4A 4O0VA 3RVGA 4ERKA 4JIKA 4KKGA 4ZTRA 4H58A 4N0SA 5GHVA 1JBPE 5LXMA 3O23A 3FMKA 2RL5A 3D83A 3EQFA 4W9XA 2IW8A 3CS9A 5K4IA 1Y8YA 5CAUA 2C5VA 1SVGA 2BRMA 2Z2WA 3BWFA 1DI8A 3BU3A 4AA4A 2R2PA 4KA3A 3P7CA 4AT5A 4JX3A 4RIYB 1V0BA 4YJRA 3TZ8A 4P7EA 1VJYA 2BAJA 4ANQA 4F63A 5FDPA 1YRPA 4A4LA 1KOAA 1W82A 3F7ZA 4BKYA 2UW7A 3PXQA 5HEZA 3R7UA 4IX4A 2YEXA 1OIRA 4YBJA 5J1VA 4A7CA 1IA8A 4YJVA 3IONA 3D14A 3LVPA 3QTRA 5EW8A 3SAYA 5E8YA 1AGWA 2HZNA 2PMIA 2XIKA 3OS3A 1FVRA 1PYXA 2XNBA 3R83A 4OBQA 3PDTA 2BVAA 4RC3A 5GZ8A 4FYOA 3K3JA 2GNJA 5A3XA 3LOKA 1LUFA 2B0QA 3KRRA 3LFAA 3ENHA 4DTKA 3FXZA 2X6EA 5EFQA 5EM6A 3ROCA 4BDIA 4ZZNA 3MFUA 4C59A 5J9ZA 3BHHA 2ONLC 2UW8A 4G3EA 5FG8A 1H1WA 4QYEA 2GSFA 3W2SA 4W4YA 4BTJA 4CEGA 2CDZA 2BZIB 5DIAA 3QAME 5CEIA 3PLAE 2A4LA 2R3FA 4EUUA 4TWCA 2VX0A 4L00A 5JRQA 2EWAA 2X9EA 4LRJA 3FMEA 1FVVA 3QRIA 4O0RA 4LGDA 4MXYA 2F4JA 4GUBA 2R3GA 4FKIA 4XG2A 2HY81 5EQEA 4O1PA 2RGPA 2ZV8A 3R22A 4HJOA 4X2JA 3OTVA 3QCQA 4TWPA 3I7CA 3ZHPC 3ACKA 5FD2A 1PXKA 4EH3A 5A46A 3GEQA 2QOLA 4BDHA 3OROA 5EW3A 3W8LA 4RA4A 4AQCA 5M08A 3R9NA 4KABA 3KMWA 1ZYDA 1WVYA 2OJIA 4XX9A 4FL1A 4FBXA 5I9VA 2PULA 1OKYA 3A62A 4R5YA 3EZRA 3I5NA 3E3BX 5HIBA 4K2RA 3NNXA 3G51A 1YHVA 2IW9A 2PUPA 4Z55A 3SOAA 4RIYA 3UO5A 3ZRKA 1J7IA 3NRMA 4DA5A 2YIXA 4ANSA 2C0OA 4G9RA 1H24A 4MNFA 1ZOHA 4P5ZA 3F2NA 4RRVA 3MVMA 3DLZA 2G2HA 3P0MA 2PVKA 3PSDA 4KIPA 3RAIA 4NTSA 5A4TA 3AC3A 4YHTA 3IW6A 2J0KA 2UZBA 3DY7A 4KBAA 3NW7A 4XOZA 3ZDIA 4C38A 3QQJA 3RNIA 3U51A 4CQEA 1U5RA 3K5VA 4FEQA 4U0IA 2QODA 4Y8DA 4DGNA 4GVJA 3QZHA 5JGAA 4Z16A 3JVRA 2JDRA 4YTFA 4LYNA 4H39A 2B9FA 3ZC6A 3WF9A 2PE2A 4FT5A 3TG1A 2ITQA 3RP9A 3MSSA 1KE9A 3QCYA 3U54A 3QCXA 4HGEA 4TYIA 4NFMA 1PJKA 3IDPA 4FTKA 4DFZE 2Q0NA 4ZS0A 5DT4A 2WQMA 2B52A 3R6XA 3W33A 4L3PA 4D5KA 4GU9A 1PXIA 4FIFA 4G3FA 5JK3A 2OXXA 3ORMA 3UDBA 4LUEA 4D4VA 5AP6A 4O82A 4DFXE 1Y91A 5I5ZA 3KXHA 1XH8A 4P5QA 2UZNA 4YZNA 4R6VA 4FA2A 2XYUA 3PE1A 2J0LA 1Y6BA 5FEEA 3ZLWA 5AAFA 4Y85A 3R30A 3EFJA 3RMFA 4KIOA 5E8VA 4D1XA 4BCGA 5AP3A 2BRNA 2RFEA 4FK3A 4GFGA 1OI9A 2BIKB 3CY3A 3VQHA 3RHKA 4FEXA 4QMNA 3RM6A 4ZTLA 2BHEA 4K9YA 3DTWA 4PDYA 1L3RE 4WKQA 4UYNA 2XUUA 4L46A 5TKDA 3TNHA 4EOKA 2QU6A 3MY0A 5M4IA 2JAMA 4JBPA 5CT7A 3FQHA 1ZYLA 2F2UA 3JYAA 3F3ZA 1Q8ZA 2XIZA 4MCVA 3ORIA 4XV1A 5CZHA 5IKWA 4HVHA 5HQ0A 3LLAA 2VX1A 3TWJA 5B2MA 2C5OA 4ANNA 2FA2A 3KRXA 3GENA 4QMUA 4FIHA 5AR3A 4BZOA 5DOSA 5KX8A 4MBJA 4PUZA 3D5VA 4UV0A 4AGWA 4U42A 5EYMA 2X81A 1GZOA 2X2MA 4XUFA 4ZZMA 5CXHA 2WZJA 4EOLA 4G2FA 3CE3A 4IC8A 2KTYA 4UMPA 5C9CA 2W5HA 1M52A 3CQUA 3NWWA 5IEYA 5KMKA 1H25A 3OC1A 4ALWA 4FICA 1BMKA 2QO2A 3GBZA 3UVPA 3AT4A 4FSZA 4NIFA 3F3WA 4DEHA 3LFNA 5HE2A 1MP8A 4DG2E 2YFXA 2F57A 5AV3A 1O6LA 3IOKA 2QR7A 3MVHA 3O51A 4U44A 2PZPA 2VTOA 3GCUA 4GVAA 2QCSA 3DA6A 2REIA 3KQ7A 2J0IA 3QTIA 4O96A 4DCEA 3FKLA 2G2FA 4U41A 3BE2A 3LXPA 4O21A 2FSMX 4AE9A 1JOWB 3FZ1A 4IAIA 4PL4A 5IQEA 4YNOA 2IJMA 1IAJA 3KN6A 3ZSGA 2B54A 3ELJA 3CY2A 5AV4A 2UVZA 3FL5A 3MFRA 4GYGA 3RWQA 3ZO3A 3FHIA 4L3LA 4PPCA 4CT1A 5H3QA 3MWUA 3ZU7A 3LQ3A 4I24A 4IAKA 4JRNA 4KD1A 3GUBA 4GIHA 5HI2A 1W83A 4RZVA 3BZ3A 3PP0A 3V5JA 3H0ZA 3POZA 5DGZA 4LFIA 1ZOEA 4DTBA 2X8DA 4AP7A 4PMSA 3TKUA 1OKZA 3L8VA 5DR6A 4FKUA 4WHZA 4WA9A 1XR1A 1YXTA 2QO7A 3I81A 2OH0E 3SD0A 4UY9A 4ACMA 5HNBA 4BI2A 3HNGA 3NUXA 2OFUA 2W4OA 4FSMA 4WSQA 4F9BA 2WTCA 2WKMA 4ZTSA 4IAFA 3PLSA 2I6LA 1KE7A 3PG1A 5J87A 5C27A 4KBCA 3HA6A 4I3ZA 3UOHA 4PPAA 2UZLA 4ZSJA 5CAOA 4C57A 2XEYA 2WQNA 5CASA 4BTMA 3WF8A 4F1OA 3KK9A 5DT3A 2IVSA 1ZOGA 3P7BA 4XV2A 4JLCA 3DBFA 2PMLX 4O0YA 2VTSA 4J8MA 1OIQA 3A8WA 5ANGA 5ACBC 4XRJA 1XH4A 3BLHA 4MD8E 3EN9A 3F2RA 1OB3A 3LCKA 4QO9A 4E6CA 1H1QA 4YC6A 1JAMA 1UVRA 3VW8A 3V6RA 3GU8A 4MH7A 4DGMA 2X4FA 1XHAA 5CEOA 4D4YA 2XH5A 3BEAA 3E92A 3UQGA 4HPUE 1T46A 3D94A 4ZSAA 2C4GA 5TR6A 2VWZA 1A06A 2BMCA 2XM9A 3KMMA 3LJ2A 3CP9A 4GJ3A 5D11A 4MK0A 3KREA 3PSBA 3AGMA 3R04A 3W55A 3ORKA 2JBOA 4FTNA 2XK6A 3F5GA 4ZOGA 4YP8A 4G6NA 3UIMA 3NZ0A 4MNEA 3VQUA 3WZKA 5IH5A
chains in the Genus database with same CATH superfamily
4YTCA 4IWPA 3RJCA 5IUGA 4ACDA 4O0TA 2R4BA 4FTRA 2OIDA 2RIOA 4F0GA 2X8IA 4W4VA 4FKRA 4IB0A 3I7BA 1LEWA 1VZOA 2XB7A 3EQGA 3KVXA 3HECA 3BL9A 4MUQA 5EHYA 4NWMA 3FLZA 5CVFA 5HG8A 1U54A 3GQLA 3HMIA 5HLNA 1IAHA 2WQBA 4F70A 4GH2A 4IFCA 3HRFA 1T45A 4ZS4A 2WAJA 3OTUA 2YZAA 1J7LA 5C01A 4DBNA 3MVLA 1Z57A 3O7LB 3P5JC 5FM2A 3VUHA 3QKMA 5IH4A 3W16A 4TWNA 3HV7A 2WD1A 3GOPA 4E4LA 3Q5ZA 4GT4A 4ZLZA 5HCZA 4DEIA 3MPTA 3FI4A 5L8LA 5FM3A 5HIEA 3AD6A 3O8TA 4NKSA 4KUJA 4P90A 2FSLX 3GC7A 2WMQA 3OXTA 3FMDA 4HOKA 4FV9A 4RT7A 5HZNA 2IO6A 2CN8A 5CY3A 4YC8A 3ZOSA 5IQCA 2F49A 3E8DA 3GOKA 4FKGA 5T68A 2WU6A 3LIJA 4MBIA 3L9NA 2JGZA 3JS2A 3A7FA 4TRLA 2OLCA 4YZCA 3DAKA 4FV1A 5LMAA 2PL0A 5KZIA 3LKMA 3U55A 2J50A 2PZRA 4CYIA 1QL6A 1UU3A 2ETKA 2GFSA 4E6DA 5HU9A 1PXLA 4PQNA 4EEVA 4U45A 3WF5A 4D2WA 4CMOA 2XZSA 3EOCA 4OTWA 2Z02A 4IAAA 2O3PA 2VWBA 3GC9A 5FDXA 3HA8A 3W1FA 3E63A 4WNPA 3PYYA 3QQKA 2YIRA 3A2CA 1OGYA 1NXKA 2O0UA 2YLEA 5I3OA 4EQMA 5J9LA 5GJGA 2C6KA 2VTQA 4AAYA 4IMYA 4ZLOA 2LAVA 1CTPE 3ZBXA 5HCYA 3FYKX 5HVYA 3V51A 2OSCA 4BI0A 3GP0A 3DPKA 5I9YA 5F1ZA 2EB2A 4U81A 4Q5EA 4EH4A 5A6OA 2P2IA 4ANLA 4FTMA 5KNJA 1YDRE 2WTWA 4GL9A 2I7QA 4YJNA 3B2WA 3LZBA 4S34A 4M0YA 5K0KA 4PTGA 3PJ3A 3DBCA 2OBJA 3AXWA 5DEYA 5CENA 4QYFA 2Z7QA 3COIA 3IDBA 5LMKC 3BLAA 3FXWA 1YOLA 2C3KA 3CGFA 3DXNA 3E5AA 1GNGA 4IWOA 3FI3A 2FB8A 3MJ1A 4DH3A 3AT3A 2UZWE 4R1VA 5FLFA 4OAVB 2VTJA 3NUNA 3MV5A 3OG7A 4XJ0A 5DNRA 2H6DA 3QFVA 4LL5A 3DQXA 4BWXA 3E88A 3COKA 3QXOA 4FZFB 5CU4A 4AZEA 3V6SA 5EM7A 4FV5A 4FKVA 5J8IA 3CSVA 3R9OA 3TNQB 2VTIA 5J1WA 3WF7A 3HP2A 5A4CA 4TTHB 2VTNA 1ZMVA 2Y6MA 3RHXA 2QVSE 4CYJA 4BFMA 3L9PA 4GS6A 2XM8A 1ZZLA 2JKQA 2OFVA 2V5QA 5BMSA 5AADA 3QYWA 5EI2A 5BYYA 3VO3A 2GS6A 3W10A 5LJJA 4NKAA 3HMPA 4BGHA 3G33A 3W8QA 3R7GA 4K18A 3GFEA 4EOJA 4YSMA 2X7GA 4PDSA 4UBAA 5E8ZA 5L8JA 4BTKA 3QRJA 5C03A 3ORNA 2W96B 4CFVA 2BUJA 4E4XA 5AA8A 5JZNA 4CCBA 4YPSA 4LV8A 1LEZA 2F2CB 3CKXA 2C47A 3FPQA 5EKNA 2C6TA 4J7BA 4QMTA 4WNKA 1FOTA 4YJTA 4YLJA 3II5A 4QTAA 2WU7A 2WELA 3D7TB 1WBTA 2WB8A 1ZYSA 2IEWA 2B55A 1Q62A 4J1RA 2HW7A 3F82A 3FLQA 3Q4ZA 4AT4A 5JFSA 4NCTA 1J91A 3ORZA 4FTIA 4FT7A 5CSXA 5JQ8A 2HK5A 4HW7A 2CGVA 2XKFA 3QZFA 5KMIA 3R73A 4QT1A 2BZJA 2WEIA 5DYJA 2BRHA 5CVHA 3ATTA 4RVKA 3DQWA 5HE1A 3OWKA 4KIKA 4CNHA 1K9AA 4IZAA 4OTRA 3QD3A 2OICA 2AC5A 3E3PA 1GZ8A 3BE9A 3HX4A 1XQZA 1GZNA 4CMUA 1H0WA 4IB3A 4GRBA 2Q83A 4RJ7A 3AD4A 4LOQA 1PF8A 3OOGA 3RCDA 5ANIA 3D7ZA 1WBSA 5DT0A 3TT0A 3FQSA 3H9FA 4YNEA 3UOJA 3JVSA 3PXYA 4BJJB 5HLWA 1YXSA 2Q0BA 1KWPA 3HV5A 3SXFA 4F6UA 3FLWA 3V8WA 3DB8A 5EKOA 5I9WA 1HOWA 3LFSA 3PVUA 4KKHA 2JLDA 5IUHA 4O4CA 4U7ZA 3H9RA 3DFCB 4NTTA 1YVJA 1YOMA 5EK7A 4BCQA 1JSTA 2OF4A 2VV9A 4QQCA 2PTKA 3FMHA 5LVLA 5HOAA 4EH9A 2R64A 4CXAA 2YM5A 4JIAA 4WRGA 4C35A 3Q9ZA 1REJA 3VRYA 2JIVA 1BKXA 4MQ1A 4LI5A 3VBYA 4ACGA 4UB7A 1Q24A 4NJ3A 3FV8A 4J53A 3EQHA 5DBXA 5EI8A 4O86A 5DI1A 1PXNA 3Q2JA 4BRXA 2VWUA 3EFWA 2ITPA 1P2AA 3O0GA 3I60A 4IB5A 4KWPA 2BRGA 3VS0A 2PHKA 5IA3A 3TZ7A 3QUDA 1UU8A 2WQEA 4ZY6A 2O2UA 5CYIA 3SW7A 4QP9A 5EW9A 4BCIA 4HNIA 2JBPA 4MXXA 4XRLA 2OJFE 3W0MA 1PMEA 3R1QA 3ZLXA 2GPHA 2I0EA 2YDJA 4B8MA 4YO4A 5L6OA 3UNKA 3TNWA 3FUPA 1IR3A 1H07A 2WMAA 4PWNA 2PVYA 4Q2AA 3R2BA 4QQJA 4WD5A 5CF5A 4HVGA 5HIDA 3ZO2A 4L68A 3FY0A 4X3FC 4AACA 1F3MC 4Q9SA 4I4EA 4QYYA 4NUSA 4EHZA 5AEPA 4U79A 3TIYA 4UXQA 2EB3A 4BGQA 4EWQA 4OT6A 5BPYA 4BGGA 5BYZA 2WTIA 3EJ1A 3ZONA 4ANBA 2QOFA 4NW5A 3SX9A 3T9TA 4ZLYA 5M09A 3VUDA 2X0OA 3E8CA 1YI4A 4JRVA 2V0DA 2W1EA 5GNKA 5TO8A 3BHYA 4XMOA 4C3FA 4DN5A 2O64A 1BYGA 4NH1A 4DFNA 1B38A 2X4ZA 3R21A 3FJQE 3OMVA 4C4FA 1Y8GA 5D12A 3FC2A 2HWPA 2VD5A 4X21A 3P08A 4RLLA 4O2ZA 2W0JA 1OPKA 2XF0A 5LCJA 3KULB 5AMNA 3A99A 1Y57A 2C68A 2ZV7A 3NUSA 3S3IA 1YXXA 2C6OA 4EK3A 4TT7A 2UZTA 3TIZA 5AP4A 2RFSA 2BDFA 2GHGA 5AIKA 2CNUA 3W2RA 4CQGA 4FZ6A 5BVFA 1UA2A 2FVDA 2C6EA 4K11A 1ZXEA 1G8SA 4IAZA 2C1BA 1QPCA 4A9RA 2QHNA 3JPVA 2OK1A 3NIEA 4M8TA 4F9CA 3QKKA 5CU6A 5FGKA 4DDGA 3G0EA 4J96A 2BHHA 2IN6A 2OJJA 2R3IA 4KKEA 4MF1A 3QCSA 1I44A 1WVXA 4QMSA 1HCLA 3DLSA 2XRWA 2YHVA 4UWYA 5M4UA 4GK4A 5EQYA 3DCVA 4DGGA 4F7JA 3UODA 1QPJA 4KBKA 4O6LA 4APPA 4H3PA 2OXYA 4F1MA 3V8TA 3QQLA 4O27B 2OIBA 3KCKA 5BYLA 2PK9A 2OZOA 4U97A 2CN5A 4IDVA 5DVRA 3RK5A 4NIFB 4ALUA 1XBBA 2XEZA 3TKHA 4BCKA 5CS6A 5DRBA 1OZ1A 4D2SA 2VZ6A 1UU7A 2YCRA 4GU6A 4E73A 1OVEA 2YM6A 3KB7A 1XH7A 5BVNA 2CKEA 3IECA 4PP7A 5I9ZA 3EKKA 1GIHA 2GDOA 5EDRA 3R8MA 2R3MA 2LGCA 2YCQA 2VX3A 3ULIA 1DAYA 2XK3A 3QHRA 4FIJA 4O7WA 2B9HA 2J5FA 1H1PA 4AOJA 4E6QA 4F99A 3VHEA 4DFLA 3ZRMA 4ALVA 1XBAA 2EU9A 4FNXA 4FOBA 2V22A 3A4OX 5JGBA 2Y4IB 4TPTA 4FSUA 4M69B 3EFLA 5HBHA 4XG8A 4MWHA 3TJCA 2XARA 5IEVA 2YISA 1ZAOA 4RZWA 2F9GA 2C6IA 2O8YA 2BR1A 2QURA 4V04A 4E26A 2HELA 4FIIA 5E8WA 4M0ZA 3A8XA 2J0JA 2Z7SA 1H0VA 2VNYA 4TNDA 2GQRA 1GJOA 3FEGA 2ERKA 2G2IA 2VU3A 3C5IA 2X6DA 3QZIA 5FEDA 3R7OA 3RPSA 1BUHA 2W4KA 5AX3A 4IACA 4BDGA 3AC8A 5BUEA 2UW3A 5JN2A 1MQBA 5CSHA 3E8EA 3PSCA 2PPQA 5EDPA 4RWJA 4LDTA 4GMYA 4FG7A 2GQGA 3AC1A 3ALOA 3K2LA 2OH4A 2UZOA 3DXQA 3C4CA 5CEQA 4QYGA 3EQDA 4Y95A 3RWPA 3ZS5A 2ZM4A 2XA4A 4ZEGA 4YJPA 4DG0E 4NJDA 2E9UA 3W2OA 2W7XA 4RJ8A 2ZMDA 1U46A 1Z5MA 2BROA 3ACJA 4YO6A 4FV3A 3O7LD 2P3GX 4Q9ZA 3UMWA 1WBOA 3PZEA 3Q9XA 1YOJA 1EH4A 2V7AA 3FI8A 4X2KA 4HYIA 4JBQA 4RJ6A 3L8SA 1FVTA 3MH1A 4MBLA 1OM1A 2YA9A 1W2FA 3RK9A 4FTTA 4R3CA 4RGJA 3WE4A 4AX8A 4CRLA 2OU7A 3P5KA 5EOBA 4P2KA 2JAVA 3OUKA 1ST0A 3W2PA 2XVDA 4XBRA 3TYKA 4FGRA 3GCVA 3E87A 1KV1A 3DKFA 3I79A 4G3GA 2WMBA 4V0GA 3RALA 4MWIA 4BIDA 4DAWA 1BL7A 4EH8A 4M84A 1J3HA 4D1ZA 3TTIA 4CD0A 2Z8CA 4AS0A 3EIDA 4APCA 3HMMA 3LXLA 3OWJA 2VO3A 5HO7A 1YXVA 1R1WA 1ZARA 3RBWA 4HPTE 3G6HA 4F0IA 3Q4UA 3BIZA 2I1MA 4I20A 2IPXA 4EUTA 5IQGA 2WMRA 4EBWA 3GI3A 4PL5A 5CF6A 3VS2A 4OTGA 5M51A 1E1XA 3Q3BA 3VBTA 3PG3A 3KRWA 2B7AA 5C4LA 1BLXA 2Y4PA 3QC4A 4L3JA 4A9UA 3MB6A 2RF9A 1O6YA 2A27A 4B8LA 2X7FA 3EN4A 3S1HA 1NA7A 3KIOC 4MX9A 3K54A 4FTLA 4D9TA 3P23A 3I0OA 4M97A 3SXRA 4X6QC 3NFGB 2W1CA 3TUCA 1OBGA 4DFUA 1LR4A 4AGUA 4UALA 3IW8A 3QBNA 5FRIA 5IZFA 1LPUA 3OEFX 3DBEA 3WIKA 1MRYA 4AOIA 4R3RA 4W9WA 4TYGA 3R2YA 2BPMA 3SVVA 3GXLA 3R01A 3DJ6A 2WNTA 3DTCA 4HCUA 3FKOA 4YJQA 4AXAA 3SG8A 1PHKA 1RQQA 4TXCA 1FINA 4RG0A 5GIPE 5I3RA 1SYKA 3PJCA 3EKNA 2IVUA 3NNVA 4GIIA 1M14A 4QP8A 4EZ3A 1IG1A 2YITA 2BFYA 4ZTNA 3TZMA 4AN2A 2PUIA 5CF8A 1XKKA 5B2LA 2VTMA 4E8AA 4GEOA 3AQVA 1BL6A 1NVRA 2PZYA 3Q96A 2XP2A 3QTXA 4QP4A 5HG9A 4FV6A 5KBQA 3BLQA 4O81A 4EZ7A 3CJFA 3QC9A 4ANOA 4R1YA 4E7WA 3IG7A 5CEPA 5C8MA 4IH8A 2VUWA 3ITZA 3BEGA 5HTCA 5DRDA 1CMKE 3BU5A 5AM7A 1QMZA 2QG7A 3Q6UA 4YHFA 1UKIA 4UXLA 3VNTA 2WTKC 5KCVA 5LOHA 4FK6A 4RIWB 5CNNA 4BJJA 4AGDA 2NP8A 4R7HA 2HZIA 4QP1A 2IZSA 3ZRLA 5EYCA 3NVKI 3F5UA 3F88A 3L1SA 4RIXA 4AZSA 2OWBA 1PRYA 4BTFA 4NM3A 4FSNA 4RFMA 3VF8A 3U9NA 3TACA 1PMNA 3F6XA 1FBNA 3AC2A 3PXFA 3C0GA 3W0PA 5AP5A 3LPBA 4IVBA 3SW4A 3TI1A 3PTGA 1OBDA 4PL3A 5HVJA 2F7EE 3GC0A 3RCJA 2JIIA 1PYEA 4O4FA 4H3BA 5K5XA 5AIRA 4ZK5A 4DEEA 4KRCA 4D2RA 4F78A 2BKKA 2E9NA 4EH2A 1ZYCA 5ITAA 3VUTA 2PWLA 3EN6A 4CLIA 3UVQA 1OL5A 3F2AA 1S9IA 4L52A 4TW9A 5HGIA 4RWLA 3WI6A 4KS8A 5HG7A 4EZ5A 3W18A 4JBVA 3NYOA 4FV4A 4W4WA 4FZDB 4F6WA 2WFYA 4ZSLA 2V55A 3R1SA 2IF8A 2GTNA 1PXPA 5M44A 4XLVA 1JPAA 5CX9A 3OBJA 2C3IB 2OO8X 5K4JA 1JSUA 2C6LA 4YUQA 3EMGA 3KXGA 3C4ZA 4O7TA 4R7IA 2IVVA 2HOGA 3PPKA 3IW5A 3UP7A 4BB4A 4D28A 5F94A 2JDVA 4F9YA 3CD8A 4ANMA 4K33A 4Z9LA 4GW8A 3R7IA 3UZPA 4NM5A 2GNFA 3VF9A 4BWKA 2VO7A 1FGKA 3DXPA 5GZAA 4QQ5A 1ZYJA 2AUHA 4HVDA 1XJDA 3RK7A 3ZO1A 3EQCA 4IDTA 4U9AA 3IQ7A 4B9DA 5E90A 3BHTA 3EWHA 4GG7A 5AP0A 5JQ5A 5L2WA 2QG5A 3H30A 4KRDA 5E8TA 2UZEA 5I4NA 2BZKB 3FPMA 2VWWA 4BDEA 2ZJWA 3LMIA 4XS2A 2GHLA 5AM6A 4FKTA 5F95A 1U59A 1Q41A 2HAKA 1Q8TA 4FODA 4AWIA 3PXZA 3S2PA 1RDQE 5BVKA 4FG8A 2EXMA 2BRBA 2O5KA 3D9VA 3TCPA 4JQ7A 3NDMA 5KUPA 3CR0A 3H0YA 1KE6A 2VWVA 3MGYA 3DDPA 4L53A 3DZOA 4QYHA 5C26A 3CBLA 3ZYAA 5FBNC 3HV3A 3DBDA 3TEIA 4QMLA 5TE0A 4C2WA 3DU8A 5J5SA 1I09A 2W1DA 3VC4A 2GMXA 4CV8A 5CEKA 2NPQA 4R5SA 1JVPP 4F1TA 1R3CA 2BAKA 5BUJA 2VO0A 5DFPA 4ACCA 4JI9A 4Z3VA 4AOTA 4EH5A 4XV9A 4FEVA 2W05A 3MDYA 2XYNA 2R3JA 2W99B 1TQMA 4IFGA 5ETCA 4PDPA 5E7RA 4B0GA 3CD3A 4O7VA 3I0QA 5BVWA 3AKJA 4QP3A 1VYWA 4KAOA 3TZ9A 2UUEA 4CTCA 5ETFA 1J7UA 4FZ7A 4D4RA 4PF4A 3CQWA 3KEXA 3RKBA 4TN6A 4B6LA 4D5HA 1URWA 3VONA 2W5BA 4B99A 2QLUA 2ITVA 3ZH8A 3MESA 4IAYA 3VWAA 2W1FA 2CPKE 5IQHA 1STCE 1E1VA 4I93A 4GG5A 3RI1A 3EN5A 1Q8WA 4FEUA 1OL6A 4IZ5A 2PE0A 3NNWA 5BQ0A 3G9NA 2NO3A 2CKPA 5AV2A 3NUUA 4I6HA 1OUYA 4FRFA 4EK6A 5AFVA 3C13A 3FAAA 4N6YA 2BAQA 4M66A 4O0UA 2BALA 3BU6A 1G3NA 4YPDA 5CEMA 3QU0A 4X7QA 3C4XA 3HZTA 2QKWB 3Q32A 4C58A 5K5NA 1W2CA 3BYOA 2OW3A 3U6HA 4BHNA 3OCSA 4DG3E 5CF4A 3MA3A 4XG4A 3GC8A 4FKQA 3ZM9A 3UYSA 3D7TA 3FMJA 4G34A 4KB8A 3WZJA 3QLFA 2ITTA 4TL0A 4I4FA 2W1IA 3PVWA 3IPHA 5ANEA 4FV7A 1YDSE 4M7IA 3KY2A 3PA4A 4JDHA 3R28A 5M4FA 1JKSA 2IZRA 2GNHA 3SKCA 5HESA 3KL8A 4G17A 4NT4A 1SVEA 3E8NA 3OWPA 4C3PA 4S33A 2X39A 5AV1A 3GVUA 5B0XA 1Q61A 1OMWA 3R8LA 4FZAB 4X2FA 3ZUUA 3LCTA 4ZXTA 3QTWA 4O0SA 4C4HA 2XS0A 1M2QA 1KE8A 4I0RA 3C7QA 4U3YA 1YI3A 3M11A 2EUFB 5DN3A 5HD7A 1UU9A 1H8FA 2RKUA 4H1JA 2C5NA 3VS7A 3C0IA 5JEBA 4OT5A 3OWLA 3MVJA 3VUGA 3OUNB 4HZRA 3PUPA 1DM2A 4I5HA 4E5WA 4WBBB 1PW2A 3KK8A 3H3CA 3ZC5A 2P4IA 5CAVA 4EK4A 3T3UA 2XJ2A 2HIWA 3RAKA 4RJ5A 3FBVA 3HMNA 4HVSA 2WOUA 3H9OA 4K77A 3ZEWA 4A06A 4EOOA 4BYIA 1JNKA 1GZKA 2H9VA 1UKHA 3AGLA 3O8PA 4YJSA 4IVAA 3UP2A 5GINE 5CAPA 4XP3A 4LMNA 4W8DA 4MHAA 3UTOA 3DGKA 4DEAA 3C0HA 1SMHA 2IZUA 4JL9A 4UMRA 2QU5A 4WRSA 5H2UA 3ZUVA 2VTTA 3A7JA 4WSYA 2R3HA 5EOLA 5GJFA 2YIYA 3W0NA 3EYGA 3W0QA 2JEDA 5M06A 4L9IA 5LVNA 3OZ6A 3A7GA 5LWNA 3MS9A 3QTQA 1P4OA 5EDQA 5AUTA 2QOHA 1PXOA 1XWSA 4DEGA 3ORLA 3QKLA 2P33A 4C0TA 5HX8A 3KRJA 3I5ZA 5E92A 4EBVA 1J1BA 2JKKA 4RFZA 3OF0A 1PMVA 4YZMA 4ZY5A 1H28A 3UIUA 4E1ZA 4UWCA 3SRVB 3QXPA 4FV0A 1K2PA 2A98A 4S2ZA 4CMTA 4MF0A 4AU8A 4L45A 4O0WA 2VGPA 4J8NA 2JKMA 1GIIA 5DE2A 3SG9A 3WZDA 5KBRA 1JSVA 3ZLYA 3VJNA 4IW0A 2WQOA 4RA5A 3U8WA 3C50A 2VRXA 2RFNA 1ZRZA 3E7OA 3F5PA 3MBLA 4Y72A 4I41A 2WGJA 2ACXA 5AUXA 4C4GA 3V5TA 4O7RA 4YR8A 1U5QA 2WTKB 2WMWA 4AN3A 2CSNA 5E91A 3U87A 3FZOA 1Q5KA 4IC7A 3UQCA 2XKEA 3UO6A 4LGHA 4FTOA 2ZFYA 3W2CA 5JFWA 4UEUA 3QGWA 3HAVA 3HV6A 3ANRA 4MXCA 4HNFA 4O2PA 3EB0A 1R78A 4X3JA 3RPOA 2ZB0A 1YWRA 4JQ8A 4OTDA 3UOLA 2JIUA 5H9BA 4IX5A 2VTRA 2XBJA 2ONLA 3LM5A 2AC3A 2RFDA 3LQ5A 2HZ4A 2OI4X 1MQ4A 3GCPA 3KU2A 4I21A 5CSWA 5IQDA 4N4SA 4L7FA 2Z60A 4XOYA 1U4DA 3MPMA 3F3TA 4ZP5A 1H27A 1OIUA 2B1PA 1YW2A 3E93A 4Y46A 4EK5A 4ZJVA 5JRSA 3IGOA 4FVPA 2HXQA 2CLQA 2HENA 4HYHA 3EYHA 2WIPA 4RVMA 2UW4A 4J71A 3VJOA 3NUAA 4EOPA 4ZSEA 4USEA 4I5CA 1F5QA 2BIYA 2J6MA 2YDKA 4GKHA 4FOCA 4CFWA 3KFAA 3LCSA 2WIHA 4NM7A 4QPMA 3BCEA 3QTUA 5J5TA 4IM3A 1PKGA 4L42A 3MFSA 3U6IA 5A9UA 2PUUA 4MXOA 2X0PA 2R0IA 2PSQA 3H10A 2P0CA 2PVFA 3EQRA 2E9VA 4PDOA 2VO6A 2XANA 2B53A 3BGZA 4F9AA 1M7QA 4GT3A 3QQUA 5FTGA 2QOCA 4Q5HA 2B4SB 4DBXA 4LOOA 5JKGA 1OUKA 3FHRA 2H8HA 3G5DA 5LWMA 3LE6A 5M53A 3N4UA 1B6CB 3WARA 2BCJA 3R9DA 3U6JA 2C0IA 3C4WA 1ZMUA 4CFMA 3OY3A 2YJSA 4I1ZA 1BI8A 3UMXA 4F64A 4AQKA 2Y4IC 3MIYA 3OHTA 5C8KA 5C8NA 2QOBA 2R3LA 1IEPA 4IM0A 3D5WA 3QX4A 4TNBA 4EKKA 3D15A 3KKVA 3SLSA 4C7TA 4H05A 2E9PA 3QF9A 5BNJA 1KSWA 2I40A 3ZTXA 1OL1A 3NAXA 3PIXA 3ZXZA 4LM5A 3SOCA 4FVRA 4XV3A 3BQRA 3P1AA 5KMNA 4AZFA 4YU2A 3ANQA 4G5JA 5CU0A 2C69A 1HCKA 3HDMA 5HX6A 2PMOX 4JG8A 4OBOA 3UIBA 4FTAA 5FXQA 3LXKA 4C37A 4WT6A 3AMYA 1ZWSA 4CKIA 4WNMA 5KKRB 4F7LA 4ZMEA 4LL0A 4A4XA 4R8QA 3V5PA 5KHWA 1W2DA 2XNOA 3FMLA 4WIHA 4JR3A 4DHIB 3I4BA 4JBOA 3BV3A 4BL1A 5HO8A 2OJ9A 3FI2A 4Y73A 1GY3A 2BDWA 3HAMA 3LQ8A 4CV9A 3E62A 3BX5A 4G6OA 1WAKA 3EH9A 4M68A 3OY1A 3AD5A 4DT9A 2DWBA 4FKWA 4QTBA 4NFNA 3R63A 1WBWA 2H96A 3KF4A 5B2KA 3ZSHA 3QTZA 5HCXA 2QNJA 3UO4A 4JOAA 3U9CA 2JDSA 5L3AA 3SDJA 4Y5QA 3DAEA 3F7WA 2RG5A 4TYJA 2CMWA 2BFXA 4I23A 1OPLA 1SNXA 3CTQA 3RINA 3ENMA 3W0OA 2Z7RA 3MTFA 4WBOA 3UG1A 3TNPC 5IQFA 4QMVA 1CDKA 4U80A 3N4VA 2GTMA 4ENXA 4NU1A 5CQWA 5TOZA 4IX3A 3JUHA 3P78A 4W4XA 3RZFA 4OUCA 3Q04A 3EQPA 3DJ7A 5H8GA 3U4WA 3SRVA 4EL9A 4I6BA 4F7NA 3M1SA 3QRKA 4RWKA 3SGCA 5IA1A 4C33A 1WZYA 5CLPA 4BICA 5DG5A 5IPJA 4S31A 5AR8A 4RVLA 4LUDA 5CU3A 5K3YA 2RSVA 3FLNC 4QDEA 4QMZA 5EHLA 4NYEA 3QGYA 3PFYA 4ZSGA 3O71A 3HGKA 4JDKA 2C6MA 3OCTA 2FSTX 4L6QA 5CQUA 4KSPA 1ZY5A 2ITNA 3TL8A 4UX9A 4MXZA 2YM3A 3A61A 4BI1A 4BDDA 2VNWA 3RPYA 3HRBA 4PPBA 3KVWA 1YXUA 2OF2A 4E6AA 5LARA 4AFEA 1B39A 2WMSA 4P4CA 4HGSA 2AYPA 1YDTE 5HU3A 4RIOA 3R71A 3WF6A 1RE8A 4QMXA 2VGOA 3L9LA 5AR5A 3QWKA 2YM7A 3CLYA 5LCKA 3SHEA 4V01A 1A48A 4BIEA 3DK7A 3CTJA 1Q8YA 4AGCA 4D2PA 2CHLA 4WUAA 4EHGA 2GNIA 4QNAA 3AC5A 4J97A 4FKPA 1W7HA 4I6FA 2JFMA 3D4QA 2YWVA 2GFCA 4TZRA 2ZAZA 1UNGA 1W98A 2BZHB 3G6GA 4NW6A 3CGOA 1FMKA 4GUEA 4G9CA 4I5PA 4XNEA 4DHJA 4O7NA 2DYLA 4OTIA 5CU2A 4X2GA 5E8XA 4FV2A 3HVCA 3ZMMA 4CTBA 2R3NA 4I94A 1VYZA 2WXVA 3PJ8A 3TXOA 3WOWA 4BCHA 4DH7A 3Q4CA 4G3DA 2XK7A 4O91A 4PY1A 3H4JA 3QX2A 2J51A 1H26A 4D2VA 2J4ZA 4FVQA 5IMEA 5CALA 1A9UA 1TKIA 4ZTQA 4F65A 3ULZA 1XH5A 4OBPA 1PMUA 2ZB1A 3ZLSA 3IOPA 3OD6X 4DHFA 4RX7A 4K1BA 3COMA 4IZYA 2NNWB 3EHAA 2C3JA 2CCIA 4U40A 3GQIA 3PWDA 4FNYA 3F5XA 2XIXA 1SZMA 5DR2A 5M56A 5IQAA 4ZZOA 3ORPA 3QZGA 4M14A 5HLPA 2HZ0A 2XIYA 3REPA 3TV7A 2CKOA 5AUWA 4RVTA 5L6WL 2OJGA 3QQHA 2HY0A 4AE6A 4BBEA 4JXFA 2XK9A 3BV2A 3BYSA 4JAIA 2ITXA 5FTOA 2Y8OA 2W1ZA 5IQBA 4C4EA 1H1SA 1OL7A 4FTUA 3FZPA 3OP5A 3FC1X 3R00A 1OKVA 3BGQA 3B8QA 4NK9A 3MN3A 2ETMA 2YAAA 3NSZA 5F20A 4FUYA 4I6QA 2XK4A 4NEUA 4U3ZA 1OECA 5AUYA 2ITOA 4BCFA 4EONA 2WMXA 4BCOA 3V5WA 4XG3A 4QP2A 3F9NA 3LAUA 3DKGA 1R39A 3BL7A 3UNJA 5IA4A 3PY1A 4TYHB 3DKOA 1O6KA 4S32A 2ZVAA 3TUDA 5E4HA 3K3IA 3E7VA 1REKA 3L8XA 1H4LA 3Q9WA