3FI4A

P38 kinase crystal structure in complex with ro4499
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
349
structure length
339
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSKPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Mapping Binding Pocket Volume: Potential Applications towards Ligand Design and Selectivity
rcsb
source organism Homo sapiens
total genus 105
structure length 339
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fi4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fi4A01
3EQHA 5JT2A 2XA4A 4BWPA 3DLZA 3MV5A 2VWIA 1MP8A 4GJ2A 1SYKA 2E9NA 5K9IA 5M06A 4A4XA 3EMGA 3ZFMA 5E8WA 4OT6A 2CCIA 5I9VA 1G3NA 4FSTA 3QTQA 3JY9A 2CMWA 4FTAA 4E4LA 1ZYSA 3TDVA 1R78A 3MJ2A 4H58A 3GU4A 2F9GA 4M14A 4AF3A 4P2KA 1H4LA 4GUBA 2BRBA 3KQ7A 5IG1A 5AP0A 1H26A 4UYAA 3TNQB 4FT5A 4QTEA 4UWBA 2Z7SA 5FTGA 1J1CA 4RA5A 3QZGA 4IWOA 3AMAA 4ZS4A 4KA3A 2UZUE 4JVGA 3FDNA 3GUBA 4S34A 5HU3A 5TR6A 1GOLA 3NIZA 1QPDA 4YJNA 5KKRC 3QQKA 4IB1A 5FP5A 4FMQA 4FA2A 4XRJA 2XS0A 4XV2A 3DBEA 2F2CB 4XCUA 2C6DA 4QYGA 4CFVA 5CEKA 4EK5A 3DA6A 3Q3BA 3OCTA 2H8HA 3D4QA 4M13A 5L3AA 2BZIB 3UO5A 3TCPA 3OZ6A 2C4GA 4MAOA 5CYIA 4GFMA 4LQMA 4XEYA 1BUHA 3BYUA 4V0GB 2WTJA 5IF1A 1PF8A 3A60A 3VS4A 2IN6A 4PPBA 3JPVA 3COIA 3G9NA 1XO2B 3E64A 4AE6A 4AA4A 1ZRZA 4DEIA 4YJUA 1F3MC 3AG9A 1OIRA 3FUPA 2R7BA 2E9OA 4L3PA 5DT3A 3FY2A 2VWZA 1YHVA 2V0DA 4FV5A 4U42A 4AA0A 2IG7A 3MESA 4I6QA 1A06A 3Q96A 4EOMA 4M69A 4AZEA 4EZ5A 3QD3A 5EHYA 1IASA 3BQCA 4L8MA 3ZLWA 2B0QA 4FTQA 2OJFE 5K5XA 5LMKC 4U8ZA 4FEXA 3BI6A 4TWPA 4JG7A 2O2UA 4RIXB 4I92A 1RQQA 4X3FC 5CX9A 5AV3A 3CR0A 5DH3A 4ANOA 5KUPA 1DI9A 1JAMA 3COMA 4DFZE 4H36A 3VHKA 4H3BA 5IDNA 2Y4IB 2GFSA 4UYNA 2C69A 4NH1A 4HCVA 2YJRA 2XKDA 3I5NA 5J9ZA 4QMXA 1ZOHA 4G9RA 1IAHA 2NP8A 4X6QC 2Q83A 3QCQA 3NYXA 5JQ5A 1V0OA 3I5ZA 1OIUA 1A48A 4WHZA 2C6EA 4HNFA 4RC2A 3SW7A 5BMMA 2BZJA 2OJIA 4D28A 2HZ4A 3I6UA 4X0MA 2ERZE 3DOGA 2BIYA 3PY0A 3I7CA 3NVMB 5EDQA 3TUCA 3C5UA 1B39A 3G5DA 4TKSA 3DZOA 3TEIA 2C6LA 1UNLA 4QMZA 3G9LX 4X2NA 5JMSA 4HYIA 3RAWA 4CV9A 2ACXA 2Z2WA 4UMRA 2QG7A 4IADA 2RG6A 3L9MA 1SVGA 2XP2A 4FBXA 2YISA 1Y8YA 1IR3A 4QP3A 4C02A 3SRVA 4JQEA 4FTNA 4YBKA 3F7ZA 5LMKA 4IAFA 2WU7A 4J98A 3NUNA 1WAKA 2YDJA 3Q5IA 4QP4A 4X3FA 3UIXA 4D9TA 2HWOA 3HV6A 2UZNA 5BUIA 2BROA 1J1BA 4C2VA 2PZPA 3P5KA 4BIBA 5HX8A 3I7BA 3RK5A 4ACMA 5KE0A 2QKWB 3F66A 3CP9A 3I81A 2WU6A 3PRIA 1Z9XA 4IVBA 2RIOA 4LOPA 5IA5A 4M97A 2JAVA 3RKBA 3ANQA 4YR8A 4WSQA 2BDFA 2C5OA 5DIAA 1R0PA 3DZQA 4FL1A 5BVOA 3TUDA 1PMNA 3BEAA 4M68A 4QQJA 2PVFA 4YPSA 4U80A 4Y85A 4EZ3A 2I0HA 5CSXA 3DKOA 1R1WA 5BVWA 5T68A 2QC6A 2R3NA 2IZSA 3U9CA 3UC4A 3R63A 4R5YA 5HLWA 1JSVA 3E88A 4MBIA 4MWHA 4WRSA 1H1RA 4XP3A 2GDOA 5LXMA 3KULB 4FG9A 2YIXA 3NGAA 4DFNA 4YURA 3SKCA 4P5QA 5F94A 4NCTC 2X9FA 3LJ0A 4EH8A 4IDVA 1MRYA 5ANOA 2R7IA 5CY3A 4QNYA 2XNMA 4KNBA 4PWNA 4FEQA 4FIGA 3QTXA 5AR5A 3F3VA 1YXTA 1OKZA 3O51A 4IC8A 4C62A 2XIYA 5G1XA 3RP9A 2BZKB 5AUUA 3VIDA 4O7VA 4AN3A 2VTIA 3FLWA 5ETCA 2KTYA 4JIKA 3A7HA 4NU1A 4GFGA 5I5ZA 3ENHA 3OXTA 4I4EA 3A99A 3PLSA 4GK4A 5EM6A 2C5YA 2W9ZB 3H30A 4K9YA 2W4OA 1PXMA 3KEXA 3ODZX 5FXSA 4O6EA 4D1SA 4RIOA 3GVUA 3UNZA 3LW0A 4FKOA 1H0VA 4P5ZA 3VBQA 2IPXA 1GZKA 2HYYA 3CJGA 2W9FB 4FKJA 1I44A 4FSRA 4BY9E 3QCSA 4ZS0A 3CCNA 4DG3E 4IBMA 3EOCA 1R39A 4IX4A 2PY3A 5K4JA 3DY7A 3QWJA 2VTJA 2E9UA 2X2LA 2XIRA 4M69B 2XKFA 4BDFA 4USEA 5H3QA 4TWOA 3UJGA 2NRYA 3H0YA 4AS0A 4QD6A 3WE8A 4FV2A 2Y9QA 2JBPA 3UPZA 3R22A 1NA7A 4NCTA 3U55A 3PVUA 4E6CA 3H9OA 2WMRA 4MD7E 5DR2A 4QQ5A 3VWAA 5J79A 2CJMA 3MH2A 3R7UA 3FMJA 4JS8A 2WQEA 3QZFA 4QYEA 1UKHA 5C8KA 4RGJA 5E92A 4OAVB 2X9EA 4L43A 5AP5A 4BDGA 2VGPA 4TNBA 3W2QA 5EOBA 3KMUA 3WF7A 4KUJA 4MNFA 5DWRA 1REJA 2DQ7X 4NYEA 5EQEA 4EK8A 3VUIA 3QX2A 4F9WA 3CD3A 4IC7A 4R7HA 3U87A 4Q2AA 4AGUA 4CFNA 2J0IA 3SW4A 5HESA 5CVHA 5E4HA 4ZK5A 4Y5HA 3FY0A 2QOLA 3UQGA 1UWJA 3BCEA 3F69A 4UMPA 4KBAA 4DEAA 2VNYA 4FSZA 3KFAA 3BYSA 4DFXE 2R3PA 4L53A 4ZTQA 4RC4A 4O7RA 2XVDA 2UUEA 1NXKA 4QTBA 3R8ZA 3W2RA 1YRPA 3U4UA 4I1ZA 4TT7A 5EYDA 4O0VA 4N4SA 3TG1A 3GENA 3CLYA 2W5BA 3DLSA 4NM5A 1TQIA 2C3KA 2XEYA 4CXAA 3OEFX 5LVOA 2C1BA 3H3CA 3MBLA 4X3FB 4BN1A 5BVNA 1Q3WA 3PJ3A 4D1ZA 5GZAA 2BAKA 4DG0E 2VGOA 5EKNA 4QP8A 4RQKA 1W7HA 3OVVA 3RVGA 3GFWA 3VBYA 5LVNA 1GZ8A 2GS7A 3C0GA 3SDJA 4W4XA 4EQUA 1L8TA 2IVTA 1UU7A 3CJFA 5DN3A 2PSQA 1O6KA 4CKRA 3B8QA 3BV2A 2JKKA 3GU7A 2OICA 2CNVA 5HHWA 2Z8CA 4MBLA 3AMYA 2RG5A 4O21A 2NNWB 4OGRA 2VD5A 5HNGA 4HVHA 1KV2A 5BYZA 3E7OA 3PJCA 2WHBA 4YGAA 4QP7A 3S00A 4AX8A 1RW8A 5HI2A 3FMKA 1JSUA 5IH5A 3U6JA 2VZ6A 1Z57A 3TNPC 1ZYJA 3KVWA 3A4OX 4GT3A 4BGGA 3RM7A 5EG3A 2PTKA 4DLIA 3OCGA 2PZYA 2WMUA 3PPJA 4P4CA 4Q9ZA 4YJPA 4OTFA 3R1SA 3JR1A 2BRHA 4AG8A 3BU5A 3S2PA 3NPCA 4G3EA 4IVAA 2BIKB 4ID7A 3UOJA 2B55A 3QQJA 5AP6A 3PIXA 5AUXA 3G90X 1XHAA 4W4YA 1ZYDA 2XYUA 3FXWA 5EHLA 4E7WA 3MGYA 4EQMA 4Y73A 5I9WA 2B1PA 4XMOA 1Q8ZA 3ZLSA 4RA4A 2VO7A 4RVMA 1BX6A 3MVHA 4FTCA 3RAIA 4CCUA 1Z5MA 4HVDA 2XJ1A 4R3PA 4F0IA 5LWNA 3F7WA 1XJDA 4Q5EA 2GS6A 3COKA 1DM2A 5AX3A 3AC2A 3BX5A 2ZB0A 3R9RA 1K3AA 2XM8A 3D7TA 5C27A 4DN5A 4I41A 2PUNA 3V5JA 2YABA 2PUUA 3LMGA 4FTRA 3ZXTA 4X7QA 3ID6C 3M11A 2YERA 5HG8A 3GU5A 4FV1A 2FSMX 1CKPA 4H3PA 2UVZA 4IQ6A 4MTAA 4QMLA 4IVCA 2VU3A 3PWYA 2EXCX 3EHAA 4NTSA 3UGCA 4YJTA 4L3LA 2EU9A 4ZSEA 4ZSAA 2HCKA 5GJDA 4ANLA 1NT2A 4XYFA 4ZTHA 2UV2A 5E1SA 1XH7A 3CY2A 4I93A 4QMPA 4F08A 1CSNA 4DAWA 1WBOA 2FB8A 2J0MB 3E8NA 3JYAA 3VJOA 4KKGA 3MB7A 4BCPA 4GW8A 1ZZLA 3POZA 1OPLA 4TZRA 5AR2A 3QQFA 4ALVA 4TXCA 1AGWA 3L9LA 2HXQA 4HGTA 4AN9A 3U6HA 4IAZA 3SV0A 4A4LA 5CU0A 1P14A 3ORMA 2EB3A 2DWBA 3LM0A 4P7EA 4P90A 2XUUA 5FLFA 3FI3A 4G9CA 3NUUA 4L45A 2FSLX 4PMSA 4CQEA 5CSVA 3NNWA 3EFLA 4XNEA 3PVWA 5DFPA 5HNIX 2HY0A 2IZRA 2ZMCA 3KRXA 4FG7A 5FP6A 4JI9A 3VUHA 3PIYA 4FF8A 4KRCA 5DOSA 4DF3A 5CU2A 2W5HA 5DRDA 5I9UA 3EQCA 3MB6A 2PVJA 2XK6A 3V8TA 2BHHA 3C0HA 3RPYA 3UG2A 3D9VA 4I5MA 4HYSA 3R7YA 2YCFA 3AC1A 3NZ0A 3QKMA 1TQPA 2R2PA 2FVDA 4QP2A 3R28A 5HEZA 1PRYA 2CKQA 4MNEB 3ETAA 5FBNC 3UO6A 4BDBA 5AAEA 3PXYA 4YLKA 3W32A 5EYCA 5L6WL 3TTIA 4NK9A 4D2SA 3O7LB 4FZ6A 3QQLA 4FT3A 4O0XA 3DQXA 1WBVA 4WT6A 4EOQA 4DCAA 2W96B 3NEWA 4OTRA 3BHHA 3NNXA 1YKRA 1QPJA 3FBVA 4IH8A 3HGKA 1UWHA 3KXHA 3ZUTA 4H1MA 5E90A 4HW7A 2QOIA 1UU9A 3RI1A 5HG5A 3V04A 5AWMA 2WEVA 4AFEA 5M56A 2C6TA 2A27A 2QOKA 1U54A 3DCVA 3FSKA 3LCKA 5EDRA 3RPSA 4A9RA 4A9SA 4AW5A 4QTAA 2BUJA 2XCHA 3LFDA 3KU2A 5CWZA 5HKMA 4ANBA 3LIJA 5CVGA 2YEXA 3ZS5A 4JJRA 2A19B 4L52A 3LQ3A 3C4CA 2XH5A 3HV5A 5ANGA 3GB2A 1JKKA 2PPQA 4YHJA 3T9TA 4XG3A 5HCXA 4CKJA 4LV8A 2Y4PA 2R3MA 3NUXA 2YIRA 3IKAA 4UBAA 5JFVA 4O7LA 4FV6A 3ZH8A 5B2MA 1JSTA 2ITYA 2J0LA 2QQ7A 5IKWA 5M4IA 4W8EA 4ENXA 5CAOA 1H24A 2OGVA 1WCCA 3CTQA 4USDA 4RJ4A 4O7WA 2W1GA 4FKTA 3PRFA 3ROYA 4ZY4A 4H05A 4UZDA 3V6RA 1LEWA 4WNOA 3U51A 5KO1A 4FI1A 5F1ZA 5EW8A 1ATPE 4AACA 5JSMA 3BV3A 4XG4A 4A7CA 2ZM4A 2R3KA 3KMWA 4LOOA 4WSYA 4XP2A 3FI8A 1JKTA 2W06A 3UMWA 3GNIB 4QMSA 4J1RA 3UTOA 3ZCLA 5JEBA 2YHVA 4D1XA 2FH9A 4M0YA 2QONA 5ANEA 3LKMA 4O81A 3OOMA 3PVGA 3F2RA 4KRDA 2ITZA 4LRJA 1RDQE 2C47A 3TI1A 5HCYA 1BL6A 4I3ZA 3VS7A 2CNUA 1H1QA 4FTMA 4Z7HA 4TYHA 3WF6A 4IM2A 5CXHA 4CLIA 2O8YA 2R3LA 2ZV2A 4FV8A 3OWPA 3BZ3A 4O7ZA 2UW9A 4LL0A 1M2PA 3NYNA 3OUKA 3T3UA 4APCA 5EOLA 4BIEA 3W1FA 3VC4A 5KMLA 5AUWA 2OH0E 4XG9A 5HORA 3NNVA 5AIRA 3K3JA 4ERWA 5CZHA 4EYJA 1MQBA 3LXKA 5AADA 4WKQA 2BRMA 3UODA 5JGBA 3NR9A 3OEZA 5L8KA 1M14A 3ZO1A 1WBTA 1CM8A 1YVJA 4PNIA 2J9MA 3MWUA 3BYOA 5BYYA 3EZVA 4XOZA 4CGAA 5AP4A 3V51A 4QTCA 4PNKA 5L8LA 3RBWA 4BR3A 5AMNA 4AZVA 3G15A 1BYGA 3HMPA 3VNTA 2GSFA 4UMUA 4CVAA 1PHKA 3C50A 4YNOA 5CVFA 5IUGA 3VBTA 4MX9A 4XUFA 2ZB1A 4HNIA 5HGIA 2BKKA 4EI4A 4DINA 4XG2A 4D4YA 2ITOA 2BAQA 1UVRA 2QHNA 2QU5A 4NJ3A 3ZBXA 3DJ7A 5ACBC 4DEEA 2HZIA 1M2RA 5IQBA 3QTSA 4M67A 1Q62A 1OGUA 2PZ5A 4YZMA 4DBNA 3TZ9A 1VYZA 4LUEA 5A4QA 5CI6A 3FMLA 4F6SA 1FGKA 3FLNC 3ZMMA 1P4FA 3NAXA 3VQHA 4CV8A 4R3RA 4GCJA 4O2PA 3MSSA 4PPCA 4BWKA 2GQSA 4JRVA 4D5KA 3QC4A 2YM7A 1IA8A 2E2BA 2JAMA 2YDIA 4ASXA 5JN2A 4HZSA 2AC5A 2YLFA 3EQBA 4HPTE 4KINA 1PMEA 2F7EE 2W1EA 1KE5A 5CU4A 3N4UA 2HELA 1Q8UA 2CKEA 4QMVA 4BZNA 3FLSA 3KXMA 2W4JA 2CLQA 4QQTA 2QO2A 4HPUE 1U54B 3PDTA 3EFJA 4FV0A 4WD5A 3VULA 4OTHA 4YNEA 3AC4A 2JDOA 3LXNA 4K1BA 1PKDA 1PKGA 3A8WA 4WG3A 3WF5A 5CEMA 5FEDA 2J6MA 5FEQA 3HNGA 2GNHA 2OU7A 3R7GA 4L44A 4RVTA 2XMYA 4Y8DA 3LVPA 3VUMA 3ZRKA 3NW7A 4MWIA 4N0SA 5HO8A 2QLUA 3TV7A 4YU2A 4USFA 4FNYA 3C4EA 3Q9ZA 2HENA 4IXPA 3LXPA 5L6OA 2GU8A 3RPRA 2C6MA 4AZSA 1Q8YA 2ITVA 2XK3A 2YIWA 4BCKA 1PXKA 3Q2MA 4HCTA 4BKZA 3QUDA 4JNWA 4XS2A 5IA3A 4IANA 2H34A 3FYJX 4HZRA 5L2TA 2X0GA 4AFJA 4XBUA 3CD8A 4G3CA 2WOUA 5JKGA 3GGFA 3EN9A 1KSWA 3H4JA 4PV0A 3SLSA 1P2AA 4TTHB 4U79A 1UA2A 3EQRA 3LFBA 2BKZA 5J8IA 4FGRA 3UZRA 3DB6A 4B9DA 4PTEA 4K6ZA 2OZOA 3FXXA 4FYOA 3RWQA 4PDYA 1YOJA 2CPKE 4KIPA 3H0ZA 3QYZA 5H2UA 3BLRA 3PA5A 3QU0A 2WOTA 3OTVA 4W9XA 3VBVA 5D7AA 5IISA 4GRBA 3MJ1A 2CHLA 3FZSA 2V7AA 4DGMA 3EKKA 4DH7A 3UBDA 5AR8A 2BVAA 3VS6A 5LWMA 2ZOQA 2YM3A 5E8TA 1O6LA 4KKHA 4EUUA 1XH5A 1MRVA 2JIIA 3U4WA 4F99A 2ETMA 4C4IA 3IW7A 3EZRA 2UZDA 3W16A 5B7VA 1PXLA 3MY5A 4ZY5A 4EOIA 1ZLTA 3C7QA 1WZYA 3IONA 4OTIA 5C4LA 2ITTA 5AP1A 3BPRA 3PUPA 4AAAA 3E93A 3HA8A 4E3CA 5TF9A 3TUBA 2FSOX 3ORZA 2W1DA 1MRUA 4YC3A 3IW4A 4YZCA 4HVGA 5DR9A 5BVKA 5TT7A 2C0IA 4GG7A 4BCHA 5A4EA 2JDTA 4GU9A 5BYLA 2UZVA 2PYWA 3G6GA 4CFMA 3UOKA 1W8CA 3PSCA 4O91A 2YJSA 1APME 1YQJA 3LMHA 3W2SA 2W1IA 4WG5A 4XG7A 3KK9A 1PXIA 1NVRA 3IK3A 4MEDA 3CQWA 4ZXTA 3ZONA 2UW3A 3BQRA 3NYVA 4JQ8A 4YJVA 2X7OA 2XB7A 3Q4ZA 3ZFXA 3N4TA 3MPMA 4I22A 5AP2A 2QODA 4EKKA 3HAVA 5CT7A 3FZOA 2OFVA 5FTQA 4LMUA 4EBWA 4M8TA 4TW9A 3R7EA 4CMOA 3OD6X 2IWIA 1H00A 3AGMA 3E8CA 5EFQA 3WZKA 3FZRA 4JX7A 5IH6A 3RM6A 4DH3A 3HX4A 2XKEA 1UNHA 4M7IA 4GVJA 4AWIA 4EZ7A 2JITA 3BHTA 3ET7A 1FVVA 4DEHA 2V62A 4C57A 3PA3A 4DGOA 3PSBA 5E8VA 1PXOA 2C3JA 3D7ZA 3HRFA 4YZNA 4MYGA 2WIHA 5AA9A 4C35A 4KIOA 4ZZNA 5K0XA 3QWKA 3QTRA 3KCFA 4DGNA 1JNKA 3HV3A 2EXEA 2ITXA 2YWPA 2PE0A 1YHWA 4FOBA 2WO6A 3QA0A 4PTGA 3QLFA 2YAAA 4QMWA 3F88A 4DGGA 3RPOA 3VS1A 3CEKA 4FSYA 4ANSA 2ETKA 3DTWA 2IW9A 2GHGA 2BRNA 4C37A 3W10A 4PDPA 5A3XA 2EB2A 4GK2A 2LGCA 2C68A 5LMAA 3OTUA 4FKLA 4CKIA 4FGBA 3W2PA 4RWKA 2HWPA 4U44A 4XV3A 2BILB 5KZ0A 3FZPA 5L2WA 3V8SA 2VAGA 4KB8A 4Y5QA 5E8ZA 2YIYA 5AA8A 4DH5A 4F9BA 3R2YA 5C03A 4BCJA 2QOQA 2Z7QA 3V8WA 5I0BA 1IA9A 5CF6A 3IDPA 4IHPA 5GINE 3R83A 3FI4A 2GTMA 2X1NA 4QP1A 3F3ZA 5HO6A 4QNAA 3TJCA 3IPHA 4FC0A 3UPXA 2E9PA 2XRUA 5HNBA 4WRGA 3S95A 1URCA 3ROCA 3NVKI 2WEIA 3FQHA 2XK4A 3LLAA 3L9NA 3DBDA 4OAUC 5HE1A 4ANMA 4BKYA 3CQUA 2FGIA 5CQWA 4ACDA 1SVEA 3HMNA 4TYJA 1J7IA 4ZJIA 4E26A 4C4JA 3COHA 1MQ4A 3R00A 3UNJA 4CTCA 3E3BX 5IU2A 2J2IB 4IDTA 4J96A 4D2WA 5IH4A 2NPQA 3FHIA 3QD2B 4TWCA 5DE2A 5AP3A 4TY1A 5HLPA 4AGWA 5J5SA 2Y6OA 5J1VA 4W4VA 3BLHA 4WNPA 2R3JA 5FWKK 3CKWA 4MQ1A 3L8PA 2C5XA 3LM5A 3PWDA 2XIZA 3HMOA 3OS3A 4UXLA 4PL4A 3ALOA 3TT0A 4BDEA 1G8AA 3DNDA 2W4KA 4FV4A 4MH7A 3GXLA 4FODA 3FSFA 1P4OA 3ZO2A 3V5LA 3C1XA 3AOXA 3LE6A 4BCFA 4CT2A 4XOYA 2CN8A 3DFAA 4DLJA 4RQVA 1FVTA 3GU6A 4OUCA 3V5PA 4I6FA 3QD0A 4EC8A 4G3GA 3LJ1A 4YTFA 2GNGA 3ZTXA 2CGUA 4EWHA 3L8SA 1FINA 2JBOA 3CTHA 3Q53A 5LQFA 2PU8A 4WO5A 4XBRA 4N6YA 2PE2A 2C1AA 2IZUA 2UW4A 4O0RA 3OWLA 3Q60A 1SZMA 3RWPA 3S3IA 3R7OA 4BCNA 4QMOA 2QOCA 3FMMA 3LJ2A 1YHSA 5I4NA 2BDWA 3REPA 4YO4A 4AOIA 3WZUA 3OP5A 3MFUA 4AXAA 2O5KA 3MIAA 3WZEA 3P1AA 1YXUA 3I6WA 3KRRA 4OR5A 4C3PA 4PL5A 2VWXA 3KXXA 2YCSA 4FVQA 2X2KA 3ZM4A 1BLXA 5L2IA 4G6OA 2R3HA 4LG4A 2C0TA 2R0IA 3R8UA 4O84A 4J52A 1YOMA 4UEUA 3TXOA 5EHOA 4NL0A 3WYYA 4LGHA 1GZOA 3QCYA 4RX5A 3RINA 3TNHA 1SMHA 4J8NA 5AIKA 1GJOA 2EVAA 4FV7A 1M7NA 4PL3A 1H8FA 1Q5KA 2VTOA 3F5UA 5ETFA 2QO9A 2A2AA 4G17A 3R9OA 2W0JA 5EQPA 5H8BA 5AM6A 3AD5A 5ETAA 1X8BA 2WTWA 1PYXA 3C4XA 3UVPA 4RIYA 5L6PA 4CG9A 1HOWA 1BI8A 2ITWA 1OMWA 4Y95A 2JFMA 3PY1A 4WOVA 4YZBA 1LUFA 3VUTA 4UB7A 2R4BA 2XK9A 3L9PA 4EC9A 2F49A 5FXRA 4DFUA 4JOAA 4G3DA 3BWJA 4TWNA 4GEOA 4CMUA 2P4IA 4GG5A 4NKSA 2BALA 3PIZA 4I6HA 3TACA 3UIBA 3NYOA 4FSWA 2J0JA 4ANNA 4BYJA 4OBOA 2IJMA 2PVYA 3EJ1A 4K77A 4ZTMA 2OJGA 3KF4A 3R8MA 4CT1A 2CLXA 5AUZA 1U59A 1BL7A 5LVLA 3AC3A 2VTNA 4C7TA 3OC1A 4PUZA 3ZLXA 2OH4A 4A07A 1Y91A 3P79A 2VWYA 2W7XA 3EQIA 3IECA 1TVOA 3LFQA 1S9IA 2PZIA 3HZTA 4YJSA 5EM5A 3RTPA 2ZM1A 3T8OA 3FZTA 5KKRB 4EONA 3MVLA 4RZWA 4C38A 1DAWA 3KRWA 5KZIA 4Z7GA 3KA0A 3I4BA 3Q4CA 5DT4A 4AT5A 4ENYA 4Z3VA 3Q9YA 1YDSE 3FKLA 3AXWA 4G31A 3PXRA 1YWRA 4JDJA 4U41A 2PMLX 4JT3A 4MHAA 4F7JA 3FC1X 3ALNA 3EFKA 5IA1A 1KUTA 3PLAE 4EL9A 3WYXA 3BGZA 3W55A 5BUJA 3G6HA 3VAPA 3VQUA 4FX3A 4DFLA 3W18A 4GT5A 3R30A 4F6UA 2R3OA 2WD1A 1BMKA 4FIJA 3ZLYA 3DBQA 5H8GA 2OF2A 3IDBA 3O50A 3NWWA 3RCDA 3MPTA 3DQWA 5ANKA 4FZAB 3FHRA 4LFIA 4BYIA 4FUYA 1IRKA 1PXNA 2QOHA 3R73A 2RSVA 2Z60A 3E7VA 1EH4A 3LPBA 4X3JA 2XNBA 5E8XA 4C2WA 1ZYCA 3DTCA 4BZOA 2OXXA 2ONLC 5HO7A 4FTOA 3SRVB 4FTLA 4A9UA 5FDXA 3OFMA 4YC6A 4L46A 3C0IA 1GIIA 4W4WA 2ITUA 3T3VA 1GIHA 2X7FA 4RC3A 3R8VA 3QKKA 4DTBA 2OXYA 5A9UA 3VS5A 4YO6A 1G5SA 4PTCA 3MA3A 3ORKA 2B7AA 4NZWB 4UMQA 4V04A 4E1ZA 2CCHA 3DXPA 2GTNA 2YCQA 3E87A 4QT1A 5HE0A 3R9DA 4FSMA 3MTLA 4M66A 5L2QA 3MPAA 5M4FA 4IB5A 3CPCA 4O2ZA 3BEGA 3CS9A 3V3VA 5L4QA 3CKXA 3R1QA 2PE1A 3ATSA 5DBXA 5CF4A 3KKVA 2ZVAA 3DBFA 4IZ7A 3K2LA 4EK4A 4O7SA 4ZJJA 3GCPA 3Q5ZA 5JZJA 2RFEA 4PX6A 3Q4UA 2VNWA 3E63A 4TYGA 4F6WA 4HVIA 3HDNA 4FKRA 4C58A 3QL8A 1J3HA 4AZTA 3DU8A 1GAGA 1Q4LA 2ZDUA 5LCKA 4C36A 4RJ8A 2OG8A 3M1SA 3A8XA 3EN5A 5IQDA 3F3UA 2JDSA 4A9YA 3CC6A 4BC6A 1OKWA 3O8PA 3NS9A 3DDQA 3MFSA 4BGHA 4BTKA 3OT8A 4GS6A 4PF4A 4JIAA 4WA9A 2JKMA 4LYNA 4RBLA 3OOGA 5DMZA 5KMKA 2VTQA 3D0EA 1LR4A 3Q9WA 5KBRA 2WIPA 5KMMA 4BDJA 5GIPE 3D15A 2O0UA 3PZHA 4NKAA 4EH9A 3K3IA 4ZMEA 3KRLA 4WUAA 3ATTA 2C0OA 2VWWA 1ZWSA 3DFCB 5M44A 1TQMA 5B2KA 4D5HA 3PYYA 4L9IA 1XH6A 3GQIA 3MIYA 4J95A 4I4FA 3Q6WA 3GU8A 4LRKA 2WTKC 5GIOE 3PP1A 4NJDA 3TIZA 4IJ9A 5I9YA 4O0UA 2R3FA 2P2IA 4U97A 3MN3A 3EH9A 4S32A 5IQEA 2WTCA 3MH1A 3LZBA 4WBOA 3QHWA 5CI7A 4ZLOA 4X2KA 2HW6A 1OL1A 3JVRA 4AOTA 5JFXA 1FQ1B 3AQVA 1E9HA 3KGAA 4DH8A 1IG1A 4OBPA 4MXCA 2JLDA 3PVBA 3L8VA 4JG6A 4YTHA 2FSTX 3QUEA 5J5TA 5JFWA 3HECA 5KCVA 2VTSA 5LCJA 1KE9A 3ZUUA 1YDRE 4C8BA 3GC8A 4YBJA 2PUIA 4BCIA 4EYMA 2A4LA 1OL6A 1XH8A 1NVQA 4EOPA 4E4XA 2P33A 2ZV9A 4C33A 5LVPA 5D11A 5J9YA 1RE8A 4YZDA 4GH2A 4DT8A 4AOJA 4DHFA 2VX1A 3NCZA 4C34A 1VYWA 4KS8A 5KHXA 3BU6A 1KOAA 4UX9A 4II5A 3DV3A 5AR4A 4O38A 5IUIA 3VS0A 5HD4A 1LP4A 1WVYA 3WILA 5IEYA 1Y8GA 3L1SA 4J97A 4PMPA 4AQCA 5CALA 2QNJA 3OBJA 3ULZA 4TNDA 4IAIA 3U54A 1ZOGA 4ZEGA 1REKA 1GY3A 2ITQA 4D4SA 4IEBA 3FEGA 1CDKA 3GEQA 2CGXA 4JXFA 4XG8A 5A6OA 3I1AA 5DA3A 1B38A 3DT1A 3SXSA 4DGLC 2CGWA 5DRBA 2W1FA 4Z16A 2X8DA 3LQ5A 4ASEA 4C3RA 4F1TA 1OUYA 4FK3A 4MXAA 4BTFA 4A06A 3EN7A 1V0PA 2CGVA 2OIDA 4BWXA 2PZRA 4F9YA 2JD5A 4EOLA 3BHVA 5KHWA 5F4NA 4MXOA 3PTGA 4R77A 2WTVA 3FYKX 4I0TA 5HVKA 3FJQE 1JKSA 5FXQA 3P7BA 4FT0A 1XQZA 3PY3A 3AD6A 3BELA 3ORTA 3DBCA 5ICPA 4RT7A 4BI2A 4C4HA 3SG9A 2PVLA 3UYSA 4MCVA 3PE2A 3TKUA 3KCKA 4QRCA 3HAMA 2GFCA 2R9SA 2YZAA 3G2FA 4KS7A 4FV3A 3D2KA 4AT3A 3RK9A 3DAEA 4LRMA 3BE9A 3UOLA 4F7SA 3ENMA 4C4EA 5F9EA 4YMJA 4EWQA 5FRIA 4FKVA 3MDYA 1OL5A 4GMYA 4IAKA 1YWVA 4DTKA 4MD9E 1URWA 2UZEA 5KMJA 3W2OA 4GVAA 2XEZA 4JL9A 4JBPA 2J5EA 2J7TA 5K5NA 2OW3A 4JR3A 4CQGA 4D2TA 3UIMA 2XJ0A 4RJ3A 1AD5A 3DJ6A 5EM8A 4IIRA 4MQ2A 3GCSA 1H0WA 2C6IA 3QQGA 4ZY6A 1UNGA 2J4ZA 4EH4A 4TL0A 4EUTA 1P5EA 3IQ7A 4ARKA 1U5RA 5IZFA 3AMBA 2QD9A 3C9WA 4DITA 3QQUA 4EH2A 4FL2A 4U45A 3QTIA 1K2PA 5BQ0A 4U9AA 3GC0A 3D5WA 5T6KA 2OZAA 4G3FA 4XLVA 1WVWA 3BHYA 3A7IA 3TV6A 2YWVA 4B0GA 3EQGA 2R3IA 4C61A 3NW5A 4NTTA 4EQCA 4LGDA 3MY0A 2G1TA 4ASDA 2H6DA 2REIA 2ZM3A 3QX4A 1OB3A 2UZLA 4R3CA 5HVJA 2UVXA 3D7TB 4BBMA 1HCLA 4EOJA 3THBA 3BBTB 4U0IA 4BDIA 5EM7A 2CKPA 4JBVA 5HX6A 2Y6MA 3ZRMA 2RGPA 4RIWA 2W1ZA 1ZOEA 1F0QA 3G33A 4IWQA 3NMUF 3QXOA 5IMXA 3E3PA 4O0WA 4CFWA 2WQNA 4JR7A 5C01A 5DG5A 3VUDA 1J7UA 3SVVA 4PRJA 2V5QA 1Q3DA 3UG1A 5CAVA 1OL2A 3MH0A 4TYEA 1FMKA 3LCDA 5GJGA 2VWBA 4LGGA 3FPQA 2PVMA 3OF0A 4K18A 4HGSA 3ZDUA 4HGLA 4DEBA 3CBLA 3HL7A 5HBEA 5M53A 4F64A 3NIEA 5HG7A 2R3QA 4L01A 3U8WA 4FSQA 1OKVA 3D5UA 2HZNA 2QU6A 3R71A 4F7LA 5EYKA 3OXZA 4BL1A 4U3ZA 4ALUA 1KV1A 3QC9A 4IM3A 4O1PA 3FI2A 3HP2A 3FAAA 2JEDA 3ZZWA 3NSZA 4CRSA 2HIWA 2OBJA 4AZFA 3NUYA 5I9XA 1DS5A 3Q52A 2IVSA 4L6QA 3GCUA 5J7BA 5M57A 1GIJA 2OJJA 4F9CA 2R3GA 2VUWA 3UP2A 3DKCA 4QYFA 3I0QA 3OY3A 1FPUA 3HRCA 3R04A 5F20A 5HIEA 2JFLA 5BPYA 3GFEA 1E1VA 4IFGA 4O22A 3GC7A 4Q5HA 1S9JA 2J51A 3UIUA 4RPVA 2OIBA 3EL8A 3ORIA 1SVHA 2YM4A 2ITNA 4LM5A 3SQQA 3VRYA 3LFNA 2VTLA 2BFYA 3ZEPA 5C9CA 4QMTA 4FTKA 4H1JA 3ZEWA 4F1MA 5HG9A 2XJ2A 5FQDC 3C4WA 5G6VA 3UVQA 4BI1A 2X39A 5CU6A 3QRIA 4KKEA 4CMTA 1F5QA 5IQGA 4IZAA 3AC8A 5GZ8A 4GKHA 3ELJA 4B7TA 5AM7A 4XLIA 3FLQA 4OTGA 5JK3A 3LLTA 4G2FA 3TV4A 3VW6A 4CZYB 4JLCA 5B0XA 3ZHPC 4YP8A 3QA8A 5M07A 2CKOA 3S1HA 4QO9A 2QLQA 4QMMA 3KRJA 4J71A 1ZAOA 4X6RA 2VV9A 5CT0A 2G2HA 1QMZA 2X6EA 1LEZA 4JAIA 5FG8A 4EH6A 2C6KA 2P2HA 4FZDB 2V7OA 4V0GA 5E8SA 3MFTA 3I0OA 4Z55A 4AW1A 1KE8A 3KN6A 1JWHA 4KWPA 2J50A 4I94A 4ACGA 3EQDA 4N57A 4BDAA 3VF8A 2EXMA 1XBCA 1U5QA 4YLJA 3W2CA 2JKOA 4ANQA 3HMIA 3UQCA 3ZDIA 1O6YA 3RMFA 4FVPA 3DKFA 4D4RA 3QZHA 2GS2A 4O6LA 4ITIA 4I5HA 5JZNA 3RALA 3FKOA 5AUYA 4F0GA 3ZO3A 4ZMFA 4YJOA 3GP0A 1W0XC 4ZTSA 2UW8A 3KXGA 3B8RA 4BTJA 4F1OA 5M4CA 4TRLA 4BZDA 4E6AA 1NW1A 3O8TA 1G8SA 5H8EA 5CSPA 5D12A 5DLSA 5CU3A 3ACKA 1H27A 4NM0A 4YSMA 1W83A 3F5GA 1VEBA 3D2IA 3F6XA 4NEUA 2VN9A 3UC3A 2RFDA 3D83A 2WMTA 2H96A 5EQYA 4XRLA 5J87A 3Q2JA 4O82A 1PW2A 4JX3A 4O1OA 3RHXA 3P0MA 4FT7A 2YZLA 1XWSA 2V22A 3R7VA 2W99B 4H3QA 4BBFA 3WOWA 3CTJA 3RK7A 5A54A 1QL6A 2GNIA 4RIWB 4G5PA 5AUVA 3PPZA 5ANJA 3O96A 5M08A 2F7XE 3O23A 3MVJA 4TYHB 4HVSA 3NDMA 4D2VA 5HE2A 2C5VA 4EK6A 5HTBA 1UU3A 2G01A 2ZV8A 4RX7A 1QCFA 3EKNA 5HU9A 2W5AA 1H28A 4ACCA 3QYWA 2YCRA 4E5BA 4GL9A 4WBBB 4I23A 4FUXA 2Q0NA 4AGCA 4C59A 1PXJA 4QTDA 4L7FA 4BCOA 3SG8A 2GHLA 5ANIA 3QRTA 4DEGA 2V55A 1W98A 5HLNA 5JGAA 3UZTA 3U9NA 2J0KA 4PP9A 2BMCA 2QVSE 4PMTA 4YZ9A 2WELA 2WTIA 4IB0A 4XV9A 5E91A 4GUEA 3KF7A 3BWFA 5CTPA 2YDKA 3QCXA 2IVUA 4C0TA 3O2MA 5J9LA 5CSWA 1BKXA 1PMVA 5HD7A 5ITAA 4OW8A 1J91A 1XBBA 2P55A 3G0FA 4KAOA 1K9AA 4QOXA 3HV4A 3C51A 2F4JA 5T3QA 3OWJA 3ZRLA 5LMBA 5ACKA 4CFUA 4DC2A 5HVYA 1BI7A 5DEWA 4BKJA 5HOAA 5K4IA 3WBLA 4FEWA 4WUNA 3OROA 3A7JA 4S31A 5JRSA 4FKIA 2YAKA 3R2BA 4N70A 3WE4A 5C26A 5HTIA 3LFFA 4RJ7A 4YTIA 2ZYBA 1ZMVA 2GMXA 3KB7A 3KULA 4ZSJA 2B9FA 4E20A 5EDPA 4U43A 2PHKA 2UZOA 4DYMA 4RLKA 1ZARA 3QRKA 4RWIA 4AZWA 4B4LA 4V01A 2ZAZA 4J53A 3R9NA 5EW3A 4HGEA 3K5VA 4MKCA 3FXZA 1LPUA 1YW2A 4HYHA 4IE9A 2ZV7A 4X2FA 5AV0A 4YPDA 2AC3A 4JG8A 4UV0A 5EYMA 2AUHA 1O9UA 5TO8A 3KK8A 3F5PA 5DYJA 2EWAA 4G34A 4EHVA 5FBOA 3FKNA 3WIKA 4ACHA 1OBDA 4HOKA 4E4NA 3NUAA 4KSQA 5HQ0A 2VTMA 2UZTA 3IW5A 5GJFA 2BTSA 3V5WA 4ORKA 3QBNA 2VWVA 4F09A 4I20A 3CIKA 4OLIA 4GIIA 4CG8A 4I24A 4XV1A 3O8UA 1W84A 4O0SA 5C8MA 5TOZA 3KREA 2R0UA 4FNXA 4E4MA 5DGZA 5CAPA 5IA2A 2X4ZA 2PVKA 3TKIA 3V01A 1PXPA 1T46A 3ITZA 2G2IA 4ZP5A 5D7VA 2DS1A 3F9NA 3AT3A 3B2TA 2YM5A 3HV7A 3VN9A 4ZZOA 2GHMA 5FUTA 4C4FA 4YUQA 1H1WA 4GFOA 3QQHA 2GNJA 4IZ5A 3LHJA 5FM3A 2W1HA 2JKQA 4FIHA 3ZYAA 2PL0A 2BDJA 4FEUA 4EJNA 5CSHA 4NM7A 5I3RA 4NIFA 4TN6A 2HW7A 1PMUA 3SAYA 4O0YA 3VJNA 3WZDA 3KC3A 2OFUA 3LOKA 4FVRA 5DI1A 5KX8A 3A7GA 3GT8A 3VBWA 4IACA 5CXZA 4CYJA 3AT2A 5EKOA 4D2PA 3QD4A 4LI5A 2YN8A 3OWKA 4IW0A 2I7QA 3QRJA 2VTAA 4U6RA 3NCGA 1JOWB 1JKLA 2WMQA 3JUHA 4GK3A 3ERKA 5C1QB 4AT4A 2PK9A 2ZDTA 4B99A 2GQRA 3QF9A 1YI4A 5A14A 4ONAA 3GCQA 3ACJA 2YLEA 3SOAA 2J90A 2I6LA 1FBNA 4I5CA 2F57A 1VJYA 3EN6A 2YFXA 4I5PA 4CFFA 3OBGA 1RJBA 4FSUA 4RZVA 3VS2A 3ZSGA 2R5TA 5D9HA 2VTHA 1CKIA 2SRCA 3A4PA 3DK7A 3CPBA 4NW5A 5GHVA 3FMHA 3HLLA 3MYGA 2PVNA 3IDCA 4EH3A 3LQ8A 4M12A 1I09A 2W17A 3F3WA 4Y72A 4YJRA 3O0GA 3QKLA 4PMMA 4RG0A 3UO4A 5JRQA 3ODYX 2FUMA 4Q9SA 4BDCA 3RJCA 3QHRA 2PUPA 4FKUA 1WBSA 3F3TA 4QMYA 3E5AA 3IG7A 3DXNA 4RWLA 3EIDA 3KY2A 4FR4A 4CZUA 2OLCA 4R7BA 3ZC5A 3G51A 3PXFA 2C3LA 3FLYA 3P23A 2RL5A 4PQNA 2WQOA 3W8LA 5BX0A 1B6CB 5M09A 4LOQA 3PJ8A 3TJDA 4OTPA 3FL5A 4BFMA 5A4TA 5L2SA 3DB8A 4GSBA 3DKGA 2X81A 4I6BA 3SC1A 3C4FA 2QOBA 2C6OA 1WFCA 2VWUA 3QGYA 5CNNA 3E62A 1CKJA 3P4KA 2UVYA 4GJ3A 4UALA 1ND4A 4R8QA 4IMYA 4DA5A 2RFSA 3WARA 2WGJA 1OVEA 5CS6A 4YC8A 5BVDA 3S4QA 5DEYA 4JAJA 4JDHA 5EI6A 2WMBA 2XKCA 4I0SA 5ETIA 4MD8E 2BRGA 3UOHA 4K2RA 1KE6A 3I60A 2GPHA 2E9VA 2FO0A 1KE7A 3BLQA 2G9XA 1WBPA 2HZ0A 2PMOX 2OI4X 5CEOA 3C5IA 2VTRA 4X2JA 4BF2A 5I9ZA 3P86A 1FOTA 5C4KA 5GNKA 4NWMA 4FKPA 3O7LD 4FZFB 3GQLA 4D55A 2XK7A 2Y8OA 3H9RA 3HEGA 2A0CX 2ERKA 4RMZA 3F2AA 3PFQA 4RX9A 2PWLA 4F7NA 2GNFA 4OTQA 4PPAA 4E93A 4MBJA 4Y46A 4O86A 4ITHA 3FPMA 4BTMA 3QTUA 2AYPA 2X4FA 3KMMA 4FT9A 4CFXA 4UN0C 1JLUE 3BYMA 4F65A 1WBWA 2A1AB 4OBQA 1JVPP 2JDRA 4QP9A 1IAJA 3R21A 4F70A 4FIEA 4IWPA 2B9JA 3OY1A 4BHZA 3FC2A 3O17A 3O71A 4IVDA 3PPKA 4XJ0A 4D0XA 5A4CA 3ORLA 4ZLZA 4FKWA 1H01A 3OG7A 5CAQA 1CTPE 1U46A 5CF5A 4YLLA 5KMNA 3FZ1A 1ZYLA 4CZTA 4CCBA 1DAYA 1HCKA 2GQGA 3HMMA 4E6DA 2UZWE 4RX8A 2PMNX 2B4SB 4H39A 4YJQA 5J7HA 2I0VA 4IX5A 4PDOA 3R8PA 3TNWA 5BVFA 1JBPE 3G0EA 4O0TA 2B52A 4BCMA 4AW2A 5A6NA 4ASZA 3QGWA 1XBAA 2WQBA 4X2GA 4E8AA 4NIFB 5E1EA 3EYGA 5DVRA 2WAJA 3N51A 4L7SA 1KWPA 2WPAA 3Q04A 4Z9LA 4XX9A 5A4LA 3ZC6A 2VO3A 5LOHA 5I3OA 4DCEA 3Q32A 4F63A 3EQPA 2QHMA 5KMOA 5IMEA 3CXWA 1SM2A 4IJPA 3SGCA 2VTTA 4QYHA 4YHFA 4YSJA 1YXVA 5CANA 4DFYA 1M17A 3EL7A 4D9UA 2PVHA 3FQEA 3RZBA 1ZXEA 4BB4A 3OT3A 4AUAA 4V05A 5CF8A 3TN8A 1VR2A 4W8DA 2B9HA 3GOKA 3HKOA 4G16A 1SNUA 3UMXA 4PP7A 3PG3A 5BMSA 4HCUA 2Z7LA 4QPAA 3RPVA 1H07A 2OWBA 2QCSA 1T45A 2XYNA 3W33A 3SOCA 1OL7A 1YXXA 2ETRA 1V1KA 3ZM9A 3HUCA 4EHGA 3LFSA 1OECA 4FSNA 4E5AX 5IA0A 2WTDA 5JFSA 2GCDA 4BBEA 3NAYA 3OCSA 4RJ5A 3HP5A 4N6ZA 5KMIA 3P78A 4AU8A 1YI6A 4FTIA 4NFMA 3QLGA 3SXRA 2BTRA 1FGIA 1YOLA 3GCVA 5BUEA 2FYSA 5LARA 3BHUA 3PG1A 4OT5A 5CEPA 5E9EA 3QAME 5IDPA 3Q6UA 3DGKA 4J7BA 1YDTE 4QMQA 2Z02A 2Z7RA 3R01A 4EOKA 3DDPA 3ZSIA 4FKGA 1DI8A 5IA4A 3OCBA 3P7CA 4MNEA 1Q61A 4ITJA 2CN5A 2WXVA 4OTWA 2WNTA 3OHTA 3QALE 4U81A 1H25A 4K8AA 3RCJA 1R0EA 1L3RE 3TKHA 3D14A 1JPAA 2ONLA 3RNIA 1PYEA 3IW6A 5BVEA 4EK3A 3QXPA 3UNKA 3ZZEA 5CNOA 2XK8A 1H1SA 5IEVA 2OKRA 3ULIA 3IS5A 1H08A 2Y7JA 4FTJA 1Y6AA 2WMAA 3MTFA 3QUPA 4IWDA 4K0YA 5AJQA 4FL3A 4CNHA 5IQAA 5C8NA 3OUNB 5CENA 4RRVA 3VO3A 3NRMA 5AEPA 4RIYB 2UZBA 2X2MA 3KVXA 4QPMA 2KULA 4APPA 4C4GA 2PVRA 3FMEA 3MW1A 4HYUA 1V0BA 4O96A 2IW8A 3UDBA 3OW4A 4YHTA 4FNWA 2XNEA 4KSPA 5J1WA 4IZYA 4XH6A 4IX3A 3SD0A 3R8LA 4EOSA 1NY3A 3NW6A 4R6VA 3T9IA 4O7YA 3R7IA 3DPKA 2FA2A 5HZNA 2HOGA 3TDWA 4EJ7A 3OMVA 4U5JA 5LVMA 1VZOA 3BBWA 5M4UA 2BR1A 3FWQA 1UKIA 2WZJA 3JS2A 5AX9A 2QOFA 4FTTA 2EUFB 3IGGA 4NM3A 2VTPA 4WNKA 3EQFA 4FIFA 4F9AA 3I79A 3IGOA 5FGKA 4QYYA 4S30A 5AV2A 2I1MA 3Q4TA 4R1VA 2I0YA 3R0TA 4MXYA 4LL5A 2YM8A 3PXKA 4QPSA 4B6LA 1STCE 4WNMA 3FMDA 1OM1A 5AUTA 4FEVA 4ZTNA 2XRWA 4EHZA 3LMIA 3ANRA 1WVXA 3PJ1A 3QTWA 3EB0A 5HIBA 3BRBA 4ZSGA 1E1XA 4EHEA 1YWNA 3F61A 5CEIA 3RAHA 5EW9A 4UZHA 5CASA 2CNQA 4I21A 1YI3A 4KBCA 3HYHA 4G1WA 3RGFA 3UE4A 3DNEA 1ZMWA 2HK5A 3AC5A 3JXWA 2VRXA 4GIHA 5IPJA 3NUPA 4A4OA 2OXDA 2WMVA 3II5A 3NNUA 3E92A 4ZOGA 4GKIA 5B2LA 3H10A 1PJKA 1Q8WA 3QZIA 4JRNA 4U7ZA 3BGQA 2BAJA 3FL4A 3TNIA 2XBAA 2XF0A 3OXIA 3TIYA 4BCGA 4EH5A 4D0WA 2XBJA 3KXNA 2PMIA 3IOKA 1XH4A 1OPKA 4QMUA 3ZU7A 4CLJA 3UVRA 4J8MA 4DH1A 1QPEA 3C13A 4B8MA 1J7LA 3LCTA 3N4VA 1Q97A 2Q0BA 2YIQA 2C5NA 2RFNA 4ZAUA 4JBQA 2XZSA 5CEQA 3TWJA 3C4ZA 3R9HA 3TL8A 3ZO4A 2WKMA 5AP7A 3ZBFA 4CEGA 4BDKA 2ITPA 5JH6A 4DG2E 3R02A 4RVKA 4OTDA 1M2QA 1R3CA 3V6SA 5EI8A 1Y57A 2O3PA 5IQFA 3GC9A 4FK6A 5ANDA 1CMKE 4K33A 2OSCA 2IW6A 4FNZA 3OW3A 2OIQA 1Q99A 3PE1A 4JDKA 4BCQA 4Y83A 3K5UA 2R3RA 3ZUVA 2XIKA 4DE4A 3P08A 3CY3A 5KNJA 2QURA 2P3GX 3Q9XA 4FIIA 3VVHA 4DT9A 4RSSA 4C3FA 3ZSHA 1XR1A 2QR7A 4GU6A 2XIXA 4L3JA 4BHNA 3CE3A 3V5TA 2IZTA 1OUKA 1U4DA 3AD4A 3MA6A 3F82A 4DEDA 3WF9A 4FE2A 4FYNA 3B2WA 1ERKA 3HVCA 4G5JA 4L00A 5BNJA 1ZY4A 4CYIA 4CSVA 3JVSA 2X8IA 3KL8A 3NX8A 3PP0A 4KIQA 3BE2A 3IW8A 2XNPA 4LUDA 4TYIA 5K0KA 2IVVA 2YITA 4FICA 4RJ6A 2G15A 4O7TA 3M42A 4IB3A 4RLLA 5TKDA 3VW8A 3LCOA 4AGDA 4IAYA 2QG5A 5IQHA 2JDVA 4FOCA 5GZ9A 3PA4A 5L8JA 5E7RA 4IFCA 4AW0A 3LCSA 1Q24A 3ORNA 2OJ9A 1FMOE 3ORPA 3F5XA 4RWJA 3A7FA 1A9UA 3LFCA 1ZY5A 4M3QA 2F7ZE 5H9BA 2X6DA 4D58A 4F0FA 1M52A 4O7NA 4FG8A 4L67A 1Q41A 3DS6A 4ALWA 3AGLA 3LXLA 5D10A 2O65A 4BVUA 3JY0A 1XKKA 4U3YA 4XHKB 1GZNA 4DBXA 3R1NA 5AV1A 4MXZA 2XCKA 5HICA 3SA0A 1AQ1A 3E8DA 4S2ZA 1GNGA 5HCZA 4FV9A 3KN5A 2NO3A 3VS3A 5LJJA 1ZZ2A 3K54A 4QP6A 4R5SA 3PZEA 5AR3A 3WZJA 4BICA 3FV8A 4UWCA 4EH7A 1OIQA 4RVLA 5D41A 4IAAA 4EBVA 3EWHA 3BU3A 4GT4A 3A2CA 2JC6A 2F2UA 2XNOA 2I0EA 3A62A 2BPMA 3A61A 3LFAA 4IM0A 4KIKA 3UZPA 3POOA 4CD0A 2OK1A 4M15A 5IQIA 5HBJA 3LAUA 4MXXA 4XG6A 4MK0A 5CQUA 4L68A 5DHJA 3RHKA 3TM0A 4JQ7A 4PDSA 2HAKA 4IX6A 2Y0AA 3SX9A 2ZJWA 3F2NA 4L42A 4UMTA 5E8YA 3ZFYA 4FKQA 4U40A 4D2RA 1WBNA 3BGPA 1UV5A 4E5WA 3CGOA 3FQSA 5KBQA 4O27B 2WB8A 2WFYA 5K3YA 2VO6A 2DUVA 4LV5A 5FEEA 5FD2A 3DAJA 3DJ5A 3UYTA 4BI0A 5FDPA 3UQFA 2WQMA 3FE3A 3PSDA 3TZMA 2P0CA 3TTJA 2UW6A 4TPTA 3KXZA 2NRUA 3EFWA 3HUBA 4X21A 4RFMA 3MH3A 3NUSA 4GYGA 3WF8A 3GBZA 3MI9A 3MVMA 4E6QA 2WTKB 5F95A 3IO7A 4UXQA 5FTOA 4ZSLA 3L8XA 3GI3A 2JIVA 4UY9A 1KOBA 2RF9A 4BIDA 5JQ8A 3DXQA 2OO8X 4BDDA 1TKIA 3D5XA 5EI2A 3H9FA 3VF9A 2O64A 2W1CA 2BCJA 5M55A 4A9TA 2UW0A 2YA9A 4E73A 4EEVA 2O63A 2XM9A 2BHEA 1OKYA 1Y6BA 5AR7A 5AV4A 5IUHA 2QR8A 5CLPA 5DT0A 1XH9A 3SHEA 2HXLA 5DPVA 2X7GA 4MF1A 1Q8TA 2X8EA 4S33A 3E8EA 5D1JA 1M7QA 4YTCA 3R1YA 3D94A 4AA5A 3QTZA 4MF0A 2YACA 2ESMA 2C30A 2GNLA 4GYIA 5HIDA 4RFZA 1PY5A 1YXSA 2UW7A 3RNYA 4AP7A 3GOPA 3ORXA 2Y4IC 5IEXA 2HY81 5AAFA 4W9WA 3MS9A 2H9VA 1OITA 2YM6A 2W05A 4CTBA 2BFXA 4NT4A 3QRUA 2C3IB 4PY1A 4KD1A 4WIHA 2QO7A 3PXZA 1OPJA 5HE3A 3MFRA 4G6LA 2QI8A 3P9JA 2LAVA 4LMNA 4QQCA 1IEPA 5FM2A 1OI9A 4EKLA 3IOPA 3N9XA 5AAGA 2UW5A 4WG4A 2WMWA 4NUSA 4I0RA 2J5FA 4G6NA 4ZLYA 3EN4A 1OIYA 2XNNA 4ZTRA 3CSVA 4ERKA 2B54A 4JBOA 2OF4A 4GV1A 2RKUA 3FMNA 3AT4A 4O83A 3TZ7A 5J95A 4R7IA 4UWYA 4R1YA 1ZMUA 5HTCA 3D5VA 2CSNA 2IO6A 2WMXA 1WMKA 4NW6A 3ZXZA 2XNGA 4ZIMA 1NVSA 3HA6A 4RIXA 4ZZMA 5DNRA 3W8QA 1UU8A 2VO0A 2G2FA 3QFVA 4BDHA 4FKSA 3FLZA 3WI6A 4JDIA 3BYVA 4ZTLA 4FZ7A 3VHEA 3RAKA 2DYLA 5TE0A 2OZAB 5M51A 2JGZA 1H1PA 3LFEA 1W82A 3S0OA 3DK6A 4HJOA 4J99A 4NFNA 2BZHB 3BKBA 5CAUA 4F4PA 3TZ8A 4EORA 3UP7A 5EK7A 3HRBA 5CZIA 5E8UA 3VUKA 4NSTA 4XP0A 4DTAA 3MY1A 4MVFA 3ZOSA 4AE9A 2QOOA 3VBXA 5DR6A 2VX0A 4FTUA 3SXFA 4EOOA 2PULA 3VRZA 4BRXA 4D4VA 1FVRA 3WIGA 5JGDA 4QMNA 3CQEA 4KBKA 4RFYA 4ZJVA 4KIKB 5AFVA 3NLBA 4M84A 3V5QA 2I40A 5A46A 3RZFA 3PXQA 2B53A 3M2WA 2QKRA 2B9IA 3P7AA 3R6XA 5HBHA 4BGQA 4K11A 4M0ZA 1JQHA 2VX3A 3VUGA 1MUOA 2WMSA 3EYHA 4B8LA 4KABA 1QPCA 1OZ1A 2JIUA 3HDMA 1SNXA 5EH0A 4AN2A 3U6IA 4R78A 4DFBA 5IQCA 2ZMDA 3CGFA 2CDZA 3BIZA 3DAKA 3DK3A 3PJ2A 4CRLA 1OBGA 2R64A
chains in the Genus database with same CATH superfamily
3EQHA 5JT2A 2XA4A 4AXCA 4BWPA 3DLZA 3MV5A 2VWIA 1MP8A 4GJ2A 1SYKA 2E9NA 5K9IA 5M06A 4A4XA 3EMGA 3ZFMA 5E8WA 4OT6A 2CCIA 5I9VA 1G3NA 4FSTA 3QTQA 3JY9A 2CMWA 4FTAA 4E4LA 1ZYSA 3TDVA 1R78A 3MJ2A 4H58A 3GU4A 2F9GA 4M14A 4AF3A 4P2KA 1H4LA 4GUBA 2BRBA 3KQ7A 5IG1A 5AP0A 1H26A 4UYAA 3TNQB 4FT5A 4QTEA 2ZFYA 4UWBA 2Z7SA 5FTGA 1J1CA 4RA5A 3QZGA 4IWOA 3AMAA 4ZS4A 4KA3A 2UZUE 4JVGA 3FDNA 3GUBA 4S34A 5HU3A 5TR6A 1GOLA 3NIZA 1QPDA 4YJNA 5KKRC 3QQKA 4IB1A 5FP5A 4FMQA 4FA2A 4XRJA 2XS0A 4XV2A 3DBEA 2F2CB 4XCUA 2C6DA 4QYGA 4CFVA 5CEKA 4EK5A 3DA6A 3Q3BA 3OCTA 2H8HA 3D4QA 4M13A 5L3AA 2BZIB 3UO5A 3TCPA 3OZ6A 2C4GA 4MAOA 5CYIA 4GFMA 4LQMA 4XEYA 1BUHA 3BYUA 4V0GB 2WTJA 5IF1A 1PF8A 3A60A 3VS4A 2IN6A 4LDTA 4PPBA 3JPVA 3COIA 3G9NA 1XO2B 3E64A 4AE6A 4AA4A 1ZRZA 3TMOA 4DEIA 4YJUA 1F3MC 3AG9A 1OIRA 3FUPA 2R7BA 2E9OA 4L3PA 5DT3A 3FY2A 2VWZA 1YHVA 2V0DA 4FV5A 4U42A 4AA0A 2IG7A 3MESA 4I6QA 1A06A 3Q96A 4EOMA 4M69A 4AZEA 4EZ5A 3QD3A 5EHYA 1IASA 3BQCA 4L8MA 3ZLWA 2B0QA 4FTQA 2OJFE 5K5XA 5LMKC 4U8ZA 4FEXA 3BI6A 4TWPA 4JG7A 2O2UA 4RIXB 4I92A 1RQQA 4X3FC 5CX9A 5AV3A 3CR0A 5DH3A 4ANOA 5KUPA 1DI9A 1JAMA 3COMA 4DFZE 4H36A 3VHKA 4H3BA 5IDNA 2Y4IB 2GFSA 4UYNA 2C69A 4NH1A 4HCVA 2YJRA 2XKDA 3I5NA 5J9ZA 4QMXA 1ZOHA 4G9RA 1IAHA 2NP8A 4X6QC 2Q83A 3QCQA 3NYXA 5JQ5A 1V0OA 3I5ZA 1OIUA 1A48A 4WHZA 2C6EA 4HNFA 4RC2A 3SW7A 5BMMA 2BZJA 2OJIA 4D28A 2HZ4A 3I6UA 4X0MA 2ERZE 3DOGA 2BIYA 3PY0A 3I7CA 3NVMB 5EDQA 3TUCA 3C5UA 1B39A 3G5DA 4TKSA 3DZOA 3TEIA 2C6LA 1UNLA 4QMZA 3G9LX 4X2NA 5JMSA 4HYIA 3RAWA 4CV9A 2ACXA 2Z2WA 4UMRA 2QG7A 4IADA 2RG6A 3L9MA 1SVGA 2XP2A 4FBXA 2YISA 1Y8YA 1IR3A 4QP3A 4C02A 3SRVA 4JQEA 4FTNA 4YBKA 3F7ZA 5LMKA 4IAFA 2WU7A 4J98A 3NUNA 1WAKA 2YDJA 3Q5IA 4QP4A 4X3FA 3UIXA 4D9TA 2HWOA 3HV6A 2UZNA 5BUIA 2BROA 1J1BA 4C2VA 2PZPA 3P5KA 4BIBA 5HX8A 3I7BA 3RK5A 4ACMA 5KE0A 2QKWB 3F66A 3CP9A 3I81A 2WU6A 3PRIA 1Z9XA 4IVBA 2RIOA 4LOPA 5IA5A 4M97A 2JAVA 3RKBA 3ANQA 4YR8A 4WSQA 2BDFA 2C5OA 5DIAA 1R0PA 3DZQA 4FL1A 5BVOA 3TYKA 3TUDA 1PMNA 3BEAA 4M68A 4QQJA 2PVFA 4YPSA 4U80A 4Y85A 4EZ3A 2I0HA 5CSXA 3DKOA 1R1WA 5BVWA 5T68A 2QC6A 2R3NA 2IZSA 3U9CA 3UC4A 3R63A 4R5YA 5HLWA 1JSVA 3E88A 4MBIA 4MWHA 4WRSA 1H1RA 4XP3A 2GDOA 5LXMA 3KULB 4FG9A 2YIXA 3NGAA 4DFNA 4YURA 3SKCA 4P5QA 5F94A 4NCTC 2X9FA 3LJ0A 4EH8A 3AKJA 4IDVA 1MRYA 5ANOA 2R7IA 5CY3A 1ST0A 4QNYA 2XNMA 4KNBA 4PWNA 4FEQA 4FIGA 3QTXA 5AR5A 3F3VA 1YXTA 1OKZA 3O51A 4IC8A 4C62A 2XIYA 5G1XA 3RP9A 2BZKB 5AUUA 3VIDA 4O7VA 4AN3A 2VTIA 3FLWA 5ETCA 2KTYA 4JIKA 3A7HA 4NU1A 4GFGA 5I5ZA 3ENHA 3OXTA 4I4EA 3A99A 3PLSA 4GK4A 5EM6A 2C5YA 2W9ZB 3H30A 4K9YA 2W4OA 1PXMA 3KEXA 2X0PA 3ODZX 4O6EA 5FXSA 4RIOA 3GVUA 4D1SA 4AXEA 3UNZA 3LW0A 4FKOA 1H0VA 4P5ZA 3VBQA 2IPXA 1GZKA 2HYYA 3CJGA 2W9FB 4FKJA 1I44A 4FSRA 4BY9E 3QCSA 4ZS0A 3CCNA 4DG3E 4IBMA 3EOCA 1R39A 4IX4A 2PY3A 5K4JA 3DY7A 3QWJA 2VTJA 2E9UA 2X2LA 2XIRA 4M69B 2XKFA 4BDFA 4USEA 5H3QA 4TWOA 3UJGA 2NRYA 3H0YA 4AS0A 4QD6A 3WE8A 4FV2A 2Y9QA 2JBPA 3UPZA 3R22A 1NA7A 4NCTA 3U55A 3PVUA 4E6CA 3H9OA 2WMRA 4MD7E 5DR2A 4QQ5A 3VWAA 5J79A 2CJMA 3MH2A 3R7UA 3FMJA 4JS8A 2WQEA 3QZFA 4QYEA 1UKHA 5C8KA 4RGJA 5E92A 4OAVB 2X9EA 4L43A 5AP5A 4BDGA 2VGPA 4TNBA 3W2QA 5EOBA 3KMUA 3WF7A 4KUJA 4MNFA 5DWRA 1REJA 2DQ7X 4NYEA 5EQEA 4EK8A 3VUIA 3QX2A 4F9WA 3CD3A 4IC7A 4R7HA 3U87A 4Q2AA 4AGUA 4CFNA 2J0IA 3SW4A 5HESA 5CVHA 5E4HA 4ZK5A 4Y5HA 3FY0A 2QOLA 3UQGA 1UWJA 3BCEA 3F69A 4UMPA 4KBAA 4DEAA 2VNYA 4FSZA 3KFAA 3BYSA 4DFXE 2R3PA 4L53A 4ZTQA 4RC4A 4O7RA 2XVDA 2UUEA 1NXKA 4QTBA 3R8ZA 3W2RA 1YRPA 3U4UA 4I1ZA 4TT7A 5EYDA 4O0VA 4N4SA 3TG1A 3GENA 3CLYA 2W5BA 3DLSA 4NM5A 1TQIA 2C3KA 2XEYA 4CXAA 3OEFX 5LVOA 2C1BA 3H3CA 3MBLA 4X3FB 4BN1A 5BVNA 1Q3WA 3PJ3A 4D1ZA 5GZAA 2BAKA 4DG0E 2VGOA 5EKNA 1G8JA 4QP8A 4RQKA 1W7HA 3OVVA 3RVGA 3GFWA 3VBYA 5LVNA 1GZ8A 2GS7A 3C0GA 3SDJA 4W4XA 4EQUA 1L8TA 2IVTA 1UU7A 3CJFA 5DN3A 2PSQA 1O6KA 4CKRA 3B8QA 3BV2A 2JKKA 3GU7A 2OICA 2CNVA 5HHWA 2Z8CA 4MBLA 3AMYA 2RG5A 4O21A 2NNWB 4OGRA 2VD5A 5HNGA 4HVHA 1KV2A 5BYZA 3E7OA 3PJCA 2WHBA 4YGAA 4QP7A 3S00A 4AX8A 1RW8A 5HI2A 2XANA 3FMKA 1JSUA 5IH5A 3U6JA 2VZ6A 1Z57A 3TNPC 1ZYJA 3KVWA 3A4OX 4GT3A 4BGGA 3RM7A 5EG3A 2PTKA 4I6LA 4DLIA 3OCGA 2PZYA 2WMUA 3PPJA 4P4CA 4Q9ZA 4YJPA 4OTFA 3R1SA 3JR1A 2BRHA 4AG8A 3BU5A 3S2PA 3NPCA 4G3EA 4IVAA 2BIKB 4ID7A 3UOJA 2B55A 3QQJA 5AP6A 3PIXA 5AUXA 3G90X 1XHAA 4W4YA 1ZYDA 2XYUA 3FXWA 5EHLA 4E7WA 3MGYA 4EQMA 4Y73A 5I9WA 2B1PA 4XMOA 1Q8ZA 3ZLSA 4RA4A 2VO7A 4RVMA 1BX6A 3MVHA 4FTCA 3RAIA 4CCUA 1Z5MA 4HVDA 2XJ1A 4R3PA 4F0IA 5LWNA 3F7WA 1XJDA 4Q5EA 2GS6A 3COKA 1DM2A 5AX3A 3AC2A 3BX5A 2ZB0A 3R9RA 1K3AA 2XM8A 3D7TA 5C27A 4DN5A 4I41A 2PUNA 3V5JA 2YABA 2PUUA 3LMGA 4FTRA 3ZXTA 4X7QA 3ID6C 1TZDA 2YERA 3M11A 5HG8A 3GU5A 4FV1A 2FSMX 1CKPA 4H3PA 2UVZA 4IQ6A 4MTAA 4QMLA 4IVCA 2VU3A 3PWYA 2EXCX 3EHAA 4NTSA 3UGCA 4YJTA 4L3LA 2EU9A 4ZSEA 4ZSAA 2HCKA 5GJDA 4ANLA 1NT2A 4XYFA 4ZTHA 2UV2A 5E1SA 1XH7A 3CY2A 4I93A 4QMPA 4F08A 1CSNA 4DAWA 1WBOA 2FB8A 2J0MB 3E8NA 3JYAA 3VJOA 4KKGA 3MB7A 4BCPA 4GW8A 1ZZLA 3POZA 1OPLA 4TZRA 5AR2A 4DHZA 3QQFA 4ALVA 4TXCA 1AGWA 3L9LA 2HXQA 4HGTA 4AN9A 3U6HA 4IAZA 3SV0A 4A4LA 5CU0A 1P14A 3ORMA 2EB3A 2DWBA 3LM0A 4P7EA 4P90A 2XUUA 5FLFA 4QDEA 3FI3A 4G9CA 3NUUA 4L45A 2FSLX 4PMSA 4CQEA 5CSVA 3NNWA 3EFLA 4XNEA 3PVWA 5DFPA 5HNIX 2HY0A 2IZRA 2ZMCA 3KRXA 4FG7A 5FP6A 4JI9A 3VUHA 3PIYA 4FF8A 4KRCA 5DOSA 4DF3A 5CU2A 2W5HA 5DRDA 1VLRA 5I9UA 3EQCA 3MB6A 2PVJA 2XK6A 3V8TA 2BHHA 3C0HA 3RPYA 3UG2A 3D9VA 4I5MA 4HYSA 3R7YA 2YCFA 3AC1A 3NZ0A 3QKMA 1TQPA 2R2PA 2FVDA 4QP2A 3R28A 5HEZA 1PRYA 2CKQA 4MNEB 3ETAA 1OGYA 5FBNC 3UO6A 4BDBA 5AAEA 3PXYA 4YLKA 3W32A 5EYCA 5L6WL 3TTIA 4NK9A 4D2SA 3O7LB 4FZ6A 3QQLA 4FT3A 4O0XA 3DQXA 1WBVA 4WT6A 4EOQA 4DCAA 2W96B 3NEWA 4OTRA 3BHHA 3NNXA 4DDGA 1YKRA 1QPJA 3FBVA 4IH8A 3HGKA 1UWHA 3KXHA 3ZUTA 4H1MA 5E90A 4HW7A 2QOIA 1UU9A 3RI1A 5HG5A 3V04A 5AWMA 2WEVA 4AFEA 5M56A 2C6TA 2A27A 2QOKA 1U54A 3UDZA 3DCVA 3FSKA 3LCKA 5EDRA 3RPSA 4A9RA 4A9SA 4AW5A 4QTAA 2BUJA 2XCHA 3LFDA 3KU2A 5CWZA 5HKMA 4ANBA 3LIJA 5CVGA 2YEXA 3ZS5A 4JJRA 2A19B 4L52A 3LQ3A 3ML1A 3C4CA 2XH5A 3HV5A 5ANGA 3GB2A 1JKKA 2PPQA 4YHJA 3T9TA 4XG3A 5HCXA 4CKJA 4LV8A 2Y4PA 2R3MA 3NUXA 2YIRA 3IKAA 4UBAA 5JFVA 4O7LA 4FV6A 3ZH8A 5B2MA 1JSTA 2ITYA 2J0LA 2QQ7A 5IKWA 5M4IA 4W8EA 4ENXA 5CAOA 1H24A 2OGVA 1WCCA 3CTQA 4USDA 4RJ4A 4O7WA 2W1GA 4FKTA 3PRFA 3ROYA 4ZY4A 4H05A 4UZDA 3V6RA 1LEWA 4WNOA 3U51A 5KO1A 4FI1A 5F1ZA 5EW8A 1ATPE 4O4BB 4AACA 3BV3A 4XG4A 4A7CA 5JSMA 2ZM4A 2R3KA 3KMWA 4LOOA 4WSYA 4XP2A 3FI8A 1JKTA 2W06A 3UMWA 3GNIB 4QMSA 4J1RA 3UTOA 3ZCLA 5JEBA 2YHVA 4D1XA 2FH9A 4M0YA 2QONA 5ANEA 3LKMA 4O81A 3OOMA 3PVGA 3F2RA 4KRDA 2ITZA 4LRJA 1RDQE 2C47A 3TI1A 5HCYA 1BL6A 4I3ZA 3VS7A 2CNUA 1H1QA 4FTMA 4Z7HA 4TYHA 3WF6A 4IM2A 5CXHA 4CLIA 2O8YA 2R3LA 2ZV2A 4FV8A 3OWPA 3BZ3A 4O7ZA 2UW9A 4LL0A 1M2PA 3NYNA 3OUKA 3T3UA 4F78A 4APCA 5EOLA 4BIEA 3W1FA 3VC4A 5KMLA 5AUWA 2OH0E 4XG9A 5HORA 3NNVA 5AIRA 3K3JA 4ERWA 5CZHA 4EYJA 1MQBA 3LXKA 5AADA 4WKQA 2BRMA 3UODA 4FRFA 5JGBA 3NR9A 3OEZA 5L8KA 1M14A 3ZO1A 1WBTA 1CM8A 1YVJA 4PNIA 2J9MA 3MWUA 3BYOA 5BYYA 3EZVA 4XOZA 4CGAA 5AP4A 3V51A 4QTCA 4PNKA 5L8LA 3RBWA 4BR3A 5AMNA 4AZVA 3G15A 1BYGA 3HMPA 3VNTA 2GSFA 4UMUA 4CVAA 1PHKA 3C50A 4YNOA 2AEGA 5CVFA 5IUGA 3VBTA 4MX9A 4XUFA 2ZB1A 4HNIA 5HGIA 2BKKA 4EI4A 4DINA 4XG2A 4D4YA 2ITOA 2BAQA 1UVRA 2QHNA 2QU5A 4NJ3A 3ZBXA 3DJ7A 5ACBC 4DEEA 2HZIA 1M2RA 5IQBA 3QTSA 4M67A 1Q62A 1OGUA 2PZ5A 4YZMA 4DBNA 3TZ9A 1VYZA 4LUEA 5A4QA 5CI6A 3FMLA 4F6SA 1FGKA 3FLNC 3ZMMA 1P4FA 3NAXA 3VQHA 4CV8A 4R3RA 4GCJA 4O2PA 3MSSA 4PPCA 4BWKA 2GQSA 4JRVA 4D5KA 3QC4A 2YM7A 1IA8A 2E2BA 2JAMA 2YDIA 4ASXA 5JN2A 4HZSA 2AC5A 2YLFA 3EQBA 4HPTE 4KINA 1PMEA 2F7EE 2W1EA 1KE5A 5CU4A 3N4UA 2HELA 1Q8UA 2CKEA 4QMVA 4BZNA 3FLSA 3KXMA 2W4JA 2CLQA 4QQTA 2QO2A 4HPUE 1U54B 3PDTA 3EFJA 4FV0A 4WD5A 3VULA 4OTHA 4YNEA 3AC4A 2JDOA 3LXNA 3UDSA 4K1BA 1PKDA 1PKGA 3A8WA 4WG3A 3WF5A 5CEMA 5FEDA 2J6MA 5FEQA 3W0PA 3HNGA 2GNHA 2OU7A 3R7GA 4L44A 4RVTA 2XMYA 4Y8DA 3LVPA 3VUMA 3ZRKA 3NW7A 4MWIA 4N0SA 5HO8A 2QLUA 3TV7A 4YU2A 4USFA 4FNYA 3C4EA 3Q9ZA 4MUQA 2HENA 4IXPA 3LXPA 5L6OA 2GU8A 3RPRA 2C6MA 4AZSA 1Q8YA 2ITVA 2XK3A 2YIWA 4BCKA 1PXKA 3Q2MA 4HCTA 3VONA 4BKZA 3QUDA 4JNWA 4XS2A 5IA3A 4IANA 2H34A 3FYJX 4HZRA 5L2TA 2X0GA 4AFJA 4XBUA 3CD8A 4G3CA 2WOUA 5JKGA 3GGFA 3EN9A 1KSWA 3H4JA 4PV0A 3SLSA 1P2AA 4TTHB 4U79A 1UA2A 3EQRA 3LFBA 2BKZA 5J8IA 4FGRA 3UZRA 3DB6A 4B9DA 4PTEA 4K6ZA 2OZOA 3FXXA 4FYOA 3RWQA 4PDYA 1YOJA 2CPKE 4KIPA 3H0ZA 3QYZA 5H2UA 3BLRA 3PA5A 3QU0A 2WOTA 3OTVA 4W9XA 3VBVA 3BL7A 5D7AA 5IISA 4GRBA 3MJ1A 2CHLA 3FZSA 2V7AA 4DGMA 3EKKA 4DH7A 3UBDA 5AR8A 2BVAA 3VS6A 5LWMA 2ZOQA 2YM3A 5E8TA 1O6LA 4KKHA 4EUUA 1XH5A 1MRVA 2JIIA 3U4WA 4F99A 2ETMA 4C4IA 3W0NA 3IW7A 3EZRA 2UZDA 3W16A 5B7VA 1PXLA 3MY5A 4ZY5A 4EOIA 1ZLTA 3C7QA 1WZYA 3IONA 4OTIA 5C4LA 2ITTA 5AP1A 3BPRA 3PUPA 4AAAA 3E93A 3HA8A 4E3CA 5TF9A 3TUBA 2FSOX 3ORZA 2W1DA 1MRUA 4YC3A 3IW4A 4YZCA 4HVGA 5DR9A 5BVKA 5TT7A 2C0IA 4GG7A 4BCHA 5A4EA 2JDTA 4GU9A 5BYLA 2UZVA 2PYWA 3G6GA 4CFMA 3UOKA 1W8CA 3PSCA 4O91A 2YJSA 1APME 3W0SA 1YQJA 3LMHA 3W2SA 2W1IA 4WG5A 4AXDA 4XG7A 3KK9A 1PXIA 1NVRA 3IK3A 4MEDA 3CQWA 4ZXTA 3ZONA 2UW3A 3BQRA 3NYVA 4JQ8A 4YJVA 2X7OA 2XB7A 3Q4ZA 3ZFXA 3N4TA 3MPMA 4I22A 5AP2A 2QODA 4EKKA 4AAYA 3HAVA 5CT7A 3FZOA 2OFVA 5FTQA 4LMUA 4EBWA 4M8TA 4TW9A 3R7EA 4CMOA 2NYAA 3OD6X 2IWIA 1H00A 3AGMA 3E8CA 5EFQA 3WZKA 3FZRA 4JX7A 5IH6A 3RM6A 4DH3A 3HX4A 2XKEA 1UNHA 4M7IA 4GVJA 4AWIA 4EZ7A 2JITA 3BHTA 3ET7A 1FVVA 4DEHA 2V62A 4C57A 3PA3A 4DGOA 3PSBA 5E8VA 1PXOA 4O4FA 2C3JA 3D7ZA 3HRFA 4YZNA 4MYGA 2WIHA 5AA9A 4C35A 4KIOA 4ZZNA 4QDVA 5K0XA 3QWKA 3QTRA 3KCFA 4DGNA 1JNKA 3HV3A 2EXEA 2ITXA 2YWPA 2PE0A 1YHWA 4FOBA 2WO6A 3QA0A 4PTGA 3QLFA 2YAAA 4QMWA 3F88A 4DGGA 3RPOA 3VS1A 3CEKA 4FSYA 4ANSA 2ETKA 3DTWA 2IW9A 2GHGA 2BRNA 4C37A 3W10A 4PDPA 5A3XA 2EB2A 4GK2A 2LGCA 2C68A 5LMAA 3OTUA 4FKLA 4CKIA 4FGBA 3W2PA 4RWKA 2HWPA 4U44A 4XV3A 2BILB 5KZ0A 3FZPA 5L2WA 3V8SA 2VAGA 4KB8A 4Y5QA 5E8ZA 2YIYA 5AA8A 4DH5A 4F9BA 3R2YA 5C03A 4BCJA 2QOQA 2Z7QA 3V8WA 5I0BA 1IA9A 5CF6A 3IDPA 4IHPA 5GINE 3R83A 3FI4A 2GTMA 2X1NA 4QP1A 3AKKA 3F3ZA 5HO6A 4QNAA 3TJCA 3IPHA 4FC0A 3UPXA 3P5JC 2E9PA 2XRUA 5HNBA 4WRGA 3S95A 1URCA 3ROCA 3NVKI 2WEIA 3FQHA 2XK4A 3LLAA 3L9NA 3DBDA 4OAUC 5HE1A 4ANMA 4BKYA 3CQUA 2FGIA 5CQWA 4ACDA 1SVEA 3HMNA 4TYJA 1J7IA 4ZJIA 4E26A 4C4JA 3COHA 1MQ4A 3R00A 3UNJA 4CTCA 3E3BX 5IU2A 2J2IB 4IDTA 4J96A 4D2WA 5IH4A 2NPQA 3FHIA 3QD2B 4TWCA 5DE2A 5AP3A 4TY1A 5HLPA 4AGWA 5J5SA 2Y6OA 5J1VA 4W4VA 3BLHA 4WNPA 2R3JA 5FWKK 3CKWA 4MQ1A 3L8PA 2C5XA 3LM5A 3PWDA 2XIZA 3HMOA 3OS3A 4UXLA 4PL4A 3ALOA 3TT0A 4BDEA 1G8AA 3DNDA 2W4KA 4FV4A 4MH7A 3GXLA 4FODA 3FSFA 1P4OA 3ZO2A 3V5LA 3C1XA 3AOXA 3LE6A 4BCFA 4CT2A 4XOYA 2CN8A 3DFAA 4DLJA 4RQVA 3PFYA 1FVTA 3GU6A 4OUCA 3V5PA 4I6FA 3QD0A 4EC8A 4G3GA 3LJ1A 4YTFA 2GNGA 3ZTXA 2CGUA 4EWHA 3L8SA 1FINA 2JBOA 3CTHA 3Q53A 5LQFA 2PU8A 4WO5A 4XBRA 4N6YA 2PE2A 2C1AA 2IZUA 2UW4A 4O0RA 3OWLA 3Q60A 1SZMA 3RWPA 3S3IA 3R7OA 4BCNA 4QMOA 2QOCA 3FMMA 3LJ2A 1YHSA 5I4NA 2BDWA 3REPA 4YO4A 4AOIA 3WZUA 3OP5A 3MFUA 4AXAA 2O5KA 3MIAA 3WZEA 3P1AA 1YXUA 3I6WA 3KRRA 4OR5A 4C3PA 4PL5A 2VWXA 3KXXA 2YCSA 4FVQA 2X2KA 3ZM4A 1BLXA 5L2IA 4G6OA 2R3HA 4LG4A 2C0TA 2R0IA 3R8UA 4O84A 4J52A 1YOMA 4UEUA 3TXOA 5EHOA 4NL0A 3WYYA 4LGHA 1GZOA 3QCYA 4RX5A 3RINA 3TNHA 1SMHA 4J8NA 5AIKA 1GJOA 2EVAA 4FV7A 1M7NA 4PL3A 1H8FA 1Q5KA 2VTOA 3F5UA 5ETFA 2QO9A 2A2AA 4G17A 3R9OA 2W0JA 5EQPA 5H8BA 5AM6A 3AD5A 5ETAA 1X8BA 2WTWA 1PYXA 3C4XA 3UVPA 4RIYA 5L6PA 4CG9A 1HOWA 1BI8A 2ITWA 3BL9A 1OMWA 4Y95A 2JFMA 3PY1A 4WOVA 4YZBA 1LUFA 3VUTA 4UB7A 2R4BA 2XK9A 3L9PA 4EC9A 2F49A 5FXRA 4DFUA 4JOAA 4G3DA 3BWJA 4TWNA 4GEOA 4CMUA 2P4IA 4GG5A 4NKSA 2BALA 3PIZA 4I6HA 3TACA 3UIBA 3NYOA 4FSWA 2J0JA 4ANNA 4BYJA 4BJJA 4OBOA 2IJMA 2PVYA 3EJ1A 4K77A 4ZTMA 2OJGA 3KF4A 3R8MA 4CT1A 2CLXA 5AUZA 1U59A 1BL7A 5LVLA 3AC3A 2VTNA 4C7TA 3OC1A 4PUZA 3ZLXA 2OH4A 4A07A 1Y91A 3P79A 2VWYA 1XMLA 2W7XA 3EQIA 3IECA 1TVOA 3LFQA 1S9IA 2PZIA 3HZTA 4YJSA 5EM5A 3RTPA 2ZM1A 3T8OA 3FZTA 5KKRB 4EONA 3MVLA 4RZWA 4C38A 1DAWA 3KRWA 5KZIA 4Z7GA 3KA0A 3I4BA 3Q4CA 5DT4A 4AT5A 4ENYA 4Z3VA 3Q9YA 4O4EA 1YDSE 3FKLA 3AXWA 2IF8A 4G31A 3PXRA 1YWRA 4JDJA 4U41A 2PMLX 4JT3A 4MHAA 4F7JA 3FC1X 3ALNA 3EFKA 5IA1A 1KUTA 3PLAE 4EL9A 3WYXA 3BGZA 3W55A 5BUJA 3G6HA 3VAPA 3VQUA 4FX3A 4DFLA 3W18A 4GT5A 3R30A 4F6UA 2R3OA 2WD1A 1BMKA 4FIJA 1TFFA 3ZLYA 3DBQA 5H8GA 2OF2A 3IDBA 3O50A 3NWWA 3RCDA 3MPTA 4AXFA 3DQWA 5ANKA 4FZAB 3FHRA 4LFIA 4BYIA 4FUYA 1IRKA 1PXNA 2QOHA 3R73A 2RSVA 2Z60A 3E7VA 1EH4A 3LPBA 4X3JA 2XNBA 5E8XA 4C2WA 1ZYCA 3DTCA 4BZOA 2OXXA 2ONLC 5HO7A 4FTOA 3SRVB 4FTLA 4A9UA 5FDXA 3OFMA 4YC6A 4L46A 3C0IA 1GIIA 4W4WA 2ITUA 3T3VA 1GIHA 2X7FA 4RC3A 3R8VA 3QKKA 4DTBA 2OXYA 5A9UA 3VS5A 4YO6A 1G5SA 4PTCA 3MA3A 3ORKA 2B7AA 4NZWB 4UMQA 4V04A 4E1ZA 2CCHA 3DXPA 2GTNA 2YCQA 3E87A 4QT1A 5HE0A 3R9DA 4FSMA 4AQKA 3MTLA 4M66A 5L2QA 3MPAA 5M4FA 4IB5A 2AQXA 3CPCA 4O2ZA 3BEGA 3CS9A 3V3VA 5L4QA 3CKXA 3R1QA 2PE1A 3ATSA 5DBXA 5CF4A 3KKVA 2ZVAA 3DBFA 4IZ7A 3K2LA 4EK4A 4O7SA 4ZJJA 3GCPA 3Q5ZA 5JZJA 2RFEA 4PX6A 3Q4UA 2VNWA 3E63A 4TYGA 4F6WA 4HVIA 3HDNA 4FKRA 4C58A 3QL8A 1J3HA 4AZTA 3AKLA 3DU8A 1GAGA 1Q4LA 2ZDUA 5LCKA 4C36A 4RJ8A 2OG8A 3M1SA 3A8XA 3EN5A 5IQDA 3F3UA 2JDSA 4A9YA 3CC6A 4BC6A 1OKWA 3O8PA 3NS9A 3DDQA 3MFSA 4BGHA 4BTKA 3OT8A 4GS6A 4PF4A 4JIAA 4WA9A 2JKMA 4LYNA 4RBLA 3OOGA 5DMZA 5KMKA 2VTQA 3D0EA 1LR4A 3Q9WA 5KBRA 2WIPA 5KMMA 4BDJA 5GIPE 3D15A 2O0UA 3PZHA 4NKAA 4EH9A 3K3IA 4ZMEA 3KRLA 4WUAA 3ATTA 2C0OA 2VWWA 1ZWSA 3DFCB 5M44A 1TQMA 5B2KA 4D5HA 3PYYA 4L9IA 1XH6A 3GQIA 3MIYA 4J95A 4I4FA 3Q6WA 3GU8A 4LRKA 2WTKC 3NFGB 5GIOE 3PP1A 4NJDA 3TIZA 4IJ9A 5I9YA 4O0UA 2R3FA 2P2IA 4U97A 3MN3A 3EH9A 4S32A