3FI4A

P38 kinase crystal structure in complex with ro4499
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
349
structure length
339
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSKPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping Binding Pocket Volume: Potential Applications towards Ligand Design and Selectivity
rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 105
structure length 339
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fi4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fi4A01
4FL2A 3GUBA 3PRFA 3R9NA 3R63A 1WBTA 4BDAA 4MAOA 4EI4A 2W96B 2BALA 3DNDA 4OT6A 1XHAA 2G15A 4ANOA 1OPKA 2WMAA 1FVVA 3VS2A 5CEMA 1BKXA 3ZXZA 4RVLA 1NT2A 3QKKA 3RZBA 4EJNA 4FOCA 1UKHA 4ZJJA 5LVPA 3P0MA 3S3IA 4CYIA 3A8WA 4DH1A 1UKIA 2O0UA 5D41A 3MPTA 4GYIA 5E8WA 1DI9A 2P33A 3FXZA 3Q4CA 2O5KA 4FTLA 2BDFA 3L9NA 2H9VA 2CKQA 2HZ4A 3N4UA 3ZXTA 1WBVA 3MGYA 4YTFA 4TL0A 5A46A 4O21A 3VBWA 2DWBA 3FMDA 2OIDA 1PMEA 4O0RA 4CT1A 4HGSA 4FA2A 5BNJA 4I93A 4N6YA 3JVSA 3PA3A 4FZDB 3DA6A 3ZUVA 5FDPA 5KKRC 4BL1A 1ZOHA 1GZKA 1R3CA 3CPBA 3EFJA 4BTKA 3JPVA 2UZLA 3LFDA 5GINE 1YQJA 3VS7A 3ORLA 2XF0A 3UVPA 3POOA 3Q32A 4U40A 3H30A 2VV9A 2YM3A 3D7TB 3AC8A 3HV6A 4IE9A 5AUUA 2WMRA 2VWWA 3BGZA 3ORMA 3MSSA 5HG7A 5HOAA 4BI1A 4BZDA 4CMOA 4IBMA 2QLUA 1JWHA 3QUPA 3TXOA 4YR8A 2CGWA 3OT8A 2VTLA 4I24A 3I7CA 4C4JA 1PY5A 2EVAA 4G3EA 5C27A 4N0SA 1WBWA 3S1HA 1MRYA 1Y91A 4OTHA 2CGVA 4BHZA 4JR7A 3V51A 5M4IA 4MKCA 3W2PA 3UMWA 3I1AA 2X4ZA 4G1WA 2IN6A 4IJ9A 3WF5A 4UWYA 5D10A 1R0PA 3RALA 4C61A 3CTHA 5AUWA 3AOXA 1NA7A 2ERKA 1YDTE 4DG2E 2OZAA 4X3JA 3ZRLA 3E62A 1JKKA 3V5PA 4RC3A 1MP8A 3WIGA 3F6XA 5DH3A 5AX3A 5JEBA 4DEGA 3MVHA 4RQKA 1KOBA 3GU6A 3NCGA 4FG9A 3ELJA 4ITJA 5ANKA 4WUAA 5DMZA 3M11A 3R04A 2FVDA 2WQMA 3R2YA 1PYXA 2PMNX 3PWYA 3NNVA 3KRJA 4UALA 1OIUA 1JSUA 4FX3A 3IPHA 1IAJA 4G34A 2PVHA 4F1TA 1KUTA 3FPQA 3FMJA 2LGCA 4EBWA 3AD4A 4ITIA 5CZIA 3PPKA 3QALE 2CKOA 4I20A 3Q3BA 3OBJA 3ZEPA 3R9RA 4CSVA 3QTIA 3DBCA 3EN9A 5CSXA 4N4SA 4CMUA 4ZAUA 3DTCA 3KMMA 3G2FA 2BUJA 2E2BA 3FC1X 4OLIA 5FXRA 3ZOSA 4KB8A 5IQEA 4IAIA 3U9NA 2GNHA 3K2LA 3ZCLA 2UZWE 3OWPA 3AXWA 5D11A 5CXHA 3R1QA 1J91A 3RK5A 4F0IA 5JK3A 2WO6A 2O3PA 1J7UA 4BCKA 3UP7A 4EZ3A 5CI7A 3AC2A 2XKEA 1YXSA 4QMXA 4I41A 3BV3A 3SGCA 2F57A 3UNKA 1LEZA 2PSQA 3IDBA 4GFGA 3CGFA 1PXOA 2CGUA 3PSCA 4L52A 4DLIA 3IGOA 1Z5MA 3NR9A 4NKAA 2F2CB 4JRNA 4UMTA 3THBA 3TDVA 3MH2A 3QCQA 4G5PA 4MXZA 1B38A 2PZYA 4P7EA 4A4OA 2PK9A 4G3GA 4OBQA 2H96A 4FEXA 3QQHA 4JL9A 5BVEA 1UU9A 4FKLA 4RBLA 3TNWA 1O6YA 2VWZA 5FWKK 3ZZWA 4QMZA 2WQNA 4DEHA 4DINA 2IG7A 3OY3A 3LXLA 3VULA 3O23A 3G90X 4D2TA 4R78A 4U0IA 1H25A 3PXRA 4USEA 4DCAA 3QTSA 2C69A 2QI8A 4I4FA 5KNJA 3Q4ZA 4YO6A 4C37A 2GTMA 3FXXA 4RC4A 3HA6A 4EK5A 3F5GA 4FV1A 4QQJA 4NZWB 5AR8A 2AYPA 3DFCB 4FKGA 4JOAA 4F1OA 4XP0A 1OL5A 5AUTA 5AFVA 2Q83A 3DBEA 3AGMA 1U5QA 4Y46A 5HVJA 2XIKA 2PL0A 4BYIA 5EM5A 3FLQA 4IAKA 4LGGA 2RL5A 3CQEA 3KCFA 4I23A 1PKDA 5J9ZA 4NUSA 3C0GA 1FGKA 4BCGA 4C58A 5IF1A 5L8LA 3DFAA 4QMUA 3QXPA 3ZU7A 4DEEA 3BKBA 2V55A 2ITVA 3V8WA 3NS9A 3WIKA 4AW5A 4NU1A 1L3RE 4LFIA 2GS6A 5AUXA 2C5YA 5ANDA 3ORZA 1XKKA 5ANEA 4BDDA 4GUBA 2J50A 4FIJA 4WG5A 1A9UA 2WTWA 3FZTA 2OF2A 4O0VA 2QOKA 2OH0E 3WF8A 1Q4LA 4FTOA 2UW5A 2OSCA 3GCSA 2XNPA 4FSRA 4PPCA 5IPJA 4J71A 3FKNA 3L8SA 4KKEA 4C38A 2JFMA 3QHWA 1R39A 1DAYA 5LVLA 4RJ6A 3TV7A 4R3CA 2QOHA 3HRBA 3UVQA 4R7BA 1ZY5A 1WFCA 4TNDA 4RRVA 1XBBA 1XH8A 3Q52A 4ZTRA 2F9GA 2VTTA 4FSQA 5EM8A 4HVGA 1VYWA 3LIJA 3LFCA 5HICA 5GZAA 3ZO1A 4D4SA 3IW6A 1G8AA 4R1YA 3ZONA 4ZSGA 2IZUA 3S4QA 5H3QA 2QO9A 3P5KA 4XG9A 2E9UA 4Y5QA 4EHZA 2GQSA 4BWXA 2X7FA 4APCA 4IM0A 3DAKA 5IUIA 1YDRE 2Q0NA 4FKPA 4QTDA 4O27B 4KIPA 5GIOE 3FL4A 4WUNA 2BKKA 3ZFMA 2QODA 4DGMA 2VO7A 3E8NA 3ZUUA 4MD7E 2W9ZB 5HG5A 2B54A 5KCVA 1YOLA 3EHAA 2PY3A 3BGQA 2VWXA 2CLQA 2VTMA 3DZQA 3F3VA 5F9EA 2HXQA 3LPBA 3E63A 4FKIA 5DA3A 5EHLA 3V5JA 5K5XA 2JKKA 1I44A 4AFJA 3FLZA 3U8WA 3UOJA 3N51A 3EZRA 3OP5A 3RPYA 2BRBA 3PIYA 3SX9A 4FV2A 4C02A 4C34A 3VF9A 1ZYLA 4J8NA 5M06A 4W4XA 2PVFA 4J8MA 4EWHA 3ZH8A 4GT5A 3Q6WA 2PUPA 2HW7A 2R3GA 4YJRA 4HYSA 4QYFA 3GENA 3UDBA 3W32A 1WBSA 3MPAA 3N4TA 2GNJA 3FZOA 2HIWA 3I6WA 4C2VA 5JSMA 4IVDA 1YWRA 3AC1A 2NPQA 3COKA 1P14A 3QZFA 3WZUA 4BCPA 4EC8A 1DAWA 3EYGA 1YOMA 2F7XE 3E64A 4PRJA 5L8JA 4K1BA 1OZ1A 3NUSA 4YC6A 4PP7A 4PDPA 5AAEA 4CKJA 4CD0A 1PW2A 5IH4A 2VWYA 4EH6A 5CAVA 4ACHA 1XH4A 1FQ1B 1H1SA 2QNJA 3ZLXA 4JQEA 3DXNA 4WBBB 4B6LA 1LP4A 2QG5A 4D0WA 1KE8A 2GCDA 4TWPA 4E5AX 3F69A 5C1QB 4QMVA 3PY3A 2BRNA 2OK1A 4PWNA 5CY3A 3ZC5A 3PPZA 5FTGA 3KRLA 3LM0A 4L43A 5HI2A 3DU8A 5BYZA 4CV9A 3TACA 3NW7A 2P0CA 3NUYA 5CNOA 3NSZA 3SLSA 5IQAA 5DPVA 5DRDA 3LFQA 1WBNA 1ZARA 1M2PA 2VTQA 4IAFA 4X6QC 2WTKC 3U54A 3KN5A 2OWBA 1H1QA 2FSOX 4CLIA 4GV1A 1V0OA 4L46A 4OTWA 2PU8A 2VTSA 1DS5A 4CFUA 1RW8A 3P4KA 3DK3A 4IZYA 4IVBA 3TN8A 4Z16A 1GJOA 4XG3A 1LUFA 4QP7A 4EKLA 4D2PA 5IUGA 3TIYA 3TKUA 4ZZNA 2AUHA 4ACCA 3FI4A 4TYIA 3O8UA 4IWQA 4FR4A 2P2IA 1XQZA 2BR1A 2Z7SA 2UVXA 2XK9A 2GNIA 4O7YA 2OW3A 4RQVA 3NIZA 5FRIA 4D1XA 1OM1A 3KXGA 4EH4A 3CY3A 3PJ8A 4F4PA 5FG8A 3UNJA 2DQ7X 2PVJA 5DLSA 3TTJA 5EDQA 4A9RA 4DEDA 3TUBA 4BCHA 4FVQA 3FLWA 4FVPA 4OAUC 5FM3A 1OPLA 4LV8A 3S0OA 2GSFA 1Z57A 3NUUA 4TYHB 4PPBA 2G2IA 2CNUA 4JG6A 3ALOA 2IJMA 3HAVA 3SW4A 3NYOA 3C4ZA 4V0GA 5E1SA 5FM2A 3PXFA 4P4CA 3QTQA 3C0IA 5GZ8A 4TNBA 3MA3A 4V05A 3EQIA 2QOOA 3FMKA 3QCYA 2ZV2A 5AA9A 4PTGA 2JKOA 4FSTA 2XNNA 2VU3A 4MNEA 4RVKA 3P7AA 2QLQA 2R9SA 4NWMA 5ETIA 4BVUA 5HQ0A 2YDKA 5BVOA 4J53A 3IKAA 5L6WL 4DH8A 4R1VA 3B2WA 2C5NA 3BGPA 3KEXA 2GHMA 4M69A 1PKGA 3U9CA 1JAMA 4XX9A 3TZMA 3DB8A 4DH5A 2Y4IC 4CEGA 1KSWA 2YFXA 5ETAA 3BYMA 3A2CA 4FNZA 3TZ8A 1UU7A 1YXXA 3NAYA 3HA8A 4FL3A 4JQ7A 1ZXEA 5E8YA 3IW5A 4G6LA 1GIIA 2RFNA 3KULA 3MY0A 3MFUA 3EZVA 4ERWA 4NM5A 2R4BA 3BYSA 3HYHA 3AC3A 5M09A 2ITTA 3CPCA 3PZHA 3CQUA 4R8QA 4RX9A 3VN9A 4XG8A 1Q99A 4U6RA 4UMPA 3ROYA 3ZDUA 3KVWA 4IWPA 3ET7A 3PVUA 5FXQA 1PMUA 2OFVA 5HIEA 3BHTA 4CQEA 5GNKA 3TM0A 1FVRA 3FDNA 5J1WA 3Q53A 4I3ZA 3A7HA 4A4XA 4PMMA 4I92A 2FO0A 4BIDA 3QRTA 4HZSA 4FTRA 5AR2A 4O7SA 3ZO3A 3WARA 5IISA 4OR5A 3BBTB 3DOGA 4DAWA 3R00A 3QBNA 4U79A 1PXJA 2WIPA 3FLSA 3FHIA 4YLLA 3HKOA 4FIGA 4QO9A 5J8IA 4RX5A 3BCEA 5ITAA 3QZIA 4R5YA 2C6MA 2JD5A 3DAJA 2PUNA 4A9YA 3FC2A 2ZM3A 2I6LA 3E7OA 3LFBA 4IM3A 2X7GA 1Q61A 5GJGA 3D5VA 5DT0A 4FT3A 4L00A 3ZEWA 4EOLA 4EQCA 4KIKB 1W7HA 4BDCA 2ETRA 4BBEA 4IHPA 5GIPE 2CN5A 2J7TA 4BCIA 4DE4A 3LZBA 4YMJA 4MWIA 3UP2A 5CSPA 2IVSA 5BVDA 5HORA 4ZIMA 2VO6A 3Q5ZA 1Q8ZA 2BHHA 4Y73A 2G9XA 1Q5KA 4G2FA 4YO4A 3V8SA 5LJJA 4FOBA 5J9YA 4IZ5A 3IW7A 3BELA 5H8EA 3ZM4A 2PE2A 3ZS5A 4CVAA 3UOHA 4BZOA 4RG0A 5JFWA 2R3PA 2RG5A 3RPSA 4F0FA 1RDQE 2UW4A 4XLIA 3TJDA 2X4FA 3OD6X 2J0JA 3U6IA 3T8OA 3EMGA 3V6RA 5H9BA 3JYAA 4YNEA 5JGAA 4QMMA 3NWWA 1ZYDA 3VBVA 4YBJA 3LMHA 5H8BA 2PMIA 3W2OA 1KWPA 5K4JA 2CJMA 3OWJA 3QQKA 4FGBA 4GCJA 5EDRA 3UTOA 4E93A 3C0HA 4MXYA 2YM7A 4IB1A 4OTDA 2ZV8A 5CI6A 5FP5A 4E6DA 4KKHA 1QMZA 3II5A 4FV5A 5IQGA 4O96A 5LMAA 4IDVA 4GH2A 3ID6C 3O7LD 5LVMA 4AT4A 4G31A 2R3FA 4FL1A 2GFCA 2ONLA 1R0EA 2BMCA 1PHKA 5B0XA 4AU8A 3C1XA 1UU3A 2JDRA 4GK3A 1B39A 2XNMA 2XK6A 5F1ZA 3KXNA 3HP2A 3PXKA 4BN1A 5EDPA 1ZOEA 2YZLA 5CS6A 3BBWA 5BX0A 4IXPA 4K18A 3D2IA 2R3QA 3H3CA 3NUXA 5EW3A 1XJDA 4F99A 2F2UA 2VN9A 2W4JA 2WMSA 2GHLA 5AX9A 2XB7A 3ORPA 2JIIA 2BIKB 1SNXA 4NW5A 2ZAZA 4WO5A 2GNGA 2JKQA 3MFTA 2RGPA 2IVUA 4QP1A 2J4ZA 4TN6A 1GIHA 3V5TA 3U51A 4AGWA 5BVWA 3Q9ZA 4I21A 3VS5A 2OH4A 2WEIA 4ONAA 4MXCA 4GJ2A 3ZDIA 3AD6A 3GU4A 4FICA 5HTIA 3BZ3A 4YHJA 4EH2A 4NFNA 4FK3A 4U3YA 3UIBA 4JAJA 2J0LA 2ERZE 2YM5A 3EFLA 4GS6A 3OCBA 4C3PA 4BDGA 2VTRA 2FA2A 2ZMDA 4MQ1A 4L7FA 4PTEA 4ANMA 3CCNA 3MI9A 4RFYA 4AT3A 4O84A 2ZYBA 5IUHA 5HE3A 4GYGA 3NW6A 4O0UA 2OF4A 4GVJA 3R1NA 4RPVA 3ORKA 2QOIA 4CYJA 1LR4A 3EOCA 3GCVA 3MWUA 4LRJA 5HG9A 3VS4A 5HBJA 1Q41A 4R77A 5AIRA 2WB8A 5C4LA 2OI4X 3HUCA 2CMWA 3BEAA 4JIAA 4JX3A 3LOKA 3MFSA 4X6RA 4CLJA 4FZAB 2WU6A 3DV3A 4YC8A 3SDJA 2CNVA 5ETFA 2FYSA 4MXAA 5EFQA 4BDHA 4C59A 5LMBA 2PZRA 4FZ6A 2RKUA 3HV5A 3FEGA 2XBAA 4Y5HA 3RHXA 4BBFA 3HDMA 4EQMA 5FXSA 5HVYA 3DBFA 2PUUA 2VWVA 3BU3A 5DGZA 2BZKB 3RJCA 4I4EA 4AG8A 2ACXA 3QX2A 3DB6A 3QCXA 2C47A 5CU3A 4D58A 3E3PA 4CFFA 2X2LA 2B4SB 2OICA 2Z60A 4NW6A 1OI9A 3KRWA 3A62A 3MTLA 2WMXA 2W1HA 3E5AA 3Q96A 3QQUA 2UZEA 4AN9A 5K4IA 5LWNA 4RWIA 5D12A 3ODYX 5CSWA 3UODA 2GHGA 4ZJIA 3W33A 1U46A 1QPCA 3LVPA 1PF8A 3ORNA 1OITA 4YJNA 4D28A 2IZTA 4M7IA 5M55A 2WQBA 2QHMA 1L8TA 2XNEA 4O22A 2ZDUA 2WMWA 3R02A 4DT8A 4NSTA 1W84A 1PXLA 2YIXA 3LFAA 2PHKA 3PVBA 4BDIA 5JRQA 3MVMA 4DBXA 4FTJA 3QZHA 1ZZ2A 2XK4A 3ITZA 4P2KA 3BWFA 3R7OA 2NNWB 3U6HA 4FEWA 4X2FA 3W8QA 3EQCA 3E92A 3P1AA 1ZMUA 2VTIA 2WHBA 3PG1A 4ZTSA 4S30A 4E7WA 4IAYA 3P9JA 4KKGA 1GAGA 2X2MA 3KU2A 4F6UA 2UVZA 4C36A 2Z7QA 1VYZA 4FT7A 2NO3A 4HVHA 4DFZE 5KHXA 4W4YA 3G9LX 1M7QA 4QNAA 4F9BA 4CFVA 5A4EA 5A4QA 4BZNA 1E1XA 5KE0A 3VBTA 2WTDA 4JS8A 3A60A 4UB7A 3UQFA 3PLAE 3TL8A 2QC6A 1RJBA 5ACBC 4RJ5A 1YRPA 1OVEA 2C0TA 4ZSLA 1OUYA 4O2PA 5CVFA 3RNYA 3C4XA 3MJ2A 2C3KA 2XYNA 3Q5IA 3DK7A 1WVWA 3FYJX 4RIYB 4AXAA 1OMWA 2QONA 3E8CA 4YU2A 3G0EA 3NMUF 3NDMA 3COIA 4BKYA 3WE4A 5C26A 1Q24A 1G8SA 3U55A 4DGOA 5FGKA 1JLUE 1AQ1A 2XUUA 2P4IA 2C0IA 3GOPA 3H0ZA 2W05A 3K3IA 3VRZA 3KC3A 3OTUA 4ANLA 5DHJA 4DT9A 4F6SA 3UO5A 4PDYA 2WQEA 3B2TA 3R8VA 1WVYA 3MDYA 5K0XA 4A7CA 1WZYA 2YWVA 3AC5A 3UO6A 2X8IA 2XK8A 5L2QA 4LOOA 2WTVA 3V6SA 4C0TA 5J5SA 5A3XA 3KMUA 5K0KA 4PNKA 4KABA 3RHKA 5HTBA 3UC4A 5LQFA 5LMKA 3COHA 4V01A 3CS9A 2C0OA 3VRYA 3PPJA 4K9YA 4Z9LA 1XR1A 2EWAA 2OGVA 4AACA 3LKMA 1FMOE 4WNKA 2WMBA 1FOTA 3FLNC 3NYVA 1YWNA 4UZHA 5EYCA 3TKIA 4D1ZA 3BIZA 4R6VA 3BE2A 3KMWA 4RIOA 1Y6AA 3C51A 1APME 2ZDTA 2ZV7A 1WVXA 4KAOA 3N4VA 4GSBA 4MCVA 4DFBA 4TRLA 2OU7A 2XNGA 2XNBA 1YDSE 2UW6A 2C30A 4AZEA 5CU0A 3EQGA 4K2RA 5HTCA 3A4PA 4G5JA 1GY3A 3CR0A 2A4LA 5CU2A 3OF0A 1O9UA 4NKSA 3ANQA 3R01A 2JAMA 5DRBA 4PV0A 3GT8A 1VEBA 3OW4A 3VAPA 3WF7A 3GXLA 4O7NA 3WI6A 3M1SA 2YCSA 3K5VA 4E6CA 3O71A 3A99A 4Q2AA 3VS0A 2BRMA 3VUIA 1PXKA 5IQFA 2YIWA 4GW8A 4II5A 3B8QA 4NT4A 5CYIA 5L2TA 2G1TA 3TZ9A 3TT0A 4NTTA 2XCKA 2J6MA 5KZIA 3S2PA 5AR5A 3WZEA 1MQ4A 4FTAA 4BDKA 1J1BA 2F7EE 1K3AA 3JUHA 3LFFA 4YZDA 4X3FB 4E6AA 3FI3A 4FSZA 4CRLA 3EL7A 5KBQA 4KSQA 3ZYAA 4NJDA 4O7WA 2IZRA 2Y6OA 2GQRA 4UWCA 2R3LA 4FKRA 4RWKA 4C57A 1OL7A 3OCTA 4WD5A 4D4YA 5FTOA 4PQNA 2XKCA 4DG0E 3KK8A 2BDWA 4XBRA 5EG3A 2IW6A 1PRYA 3FBVA 2BZHB 3HV7A 4BDJA 2YLEA 5L6PA 4M14A 5BMMA 2XRUA 3HMOA 5KX8A 3CKWA 2IPXA 3NGAA 3WILA 4FTKA 4FTNA 4V0GB 4RIWA 4R5SA 4RLKA 3G5DA 4BCOA 4LYNA 4CTCA 3HMPA 4B4LA 1H1PA 3D15A 1W82A 2X2KA 4GIIA 3ZZEA 4RLLA 3BYOA 4J97A 5BPYA 4BI0A 3D14A 3F61A 1URWA 2BZIB 5G1XA 2OJGA 3LXPA 3F5PA 4QP2A 3L9LA 1PXNA 3F5XA 4XG2A 1YVJA 3HGKA 3L9PA 3LFEA 5LVNA 4O7VA 4GEOA 4ACDA 1TKIA 2V62A 2SRCA 2GNFA 2ONLC 2UW7A 3F2AA 2EB2A 2OZOA 2R5TA 4HJOA 5AP1A 3ENHA 5J95A 3CC6A 2RF9A 4IFCA 4M15A 4YBKA 5FLFA 5CAOA 2OXYA 3EYHA 3OW3A 4GU6A 4F9YA 4OW8A 1NXKA 5HBHA 2GNLA 4YSMA 2QKRA 4U80A 4TTHB 4GKIA 2C3LA 3P86A 4YLJA 3ANRA 5AUZA 4CFNA 4DEBA 4QP4A 4FEUA 3KRRA 2VGPA 4AP7A 4AOTA 1XH6A 4JBVA 2YISA 4UN0C 3DQXA 5M56A 3AT2A 1KE7A 3DKFA 3LCTA 4JNWA 3OHTA 4NM7A 4RJ8A 4ALUA 3FZSA 3R7UA 4CMTA 3L8VA 4FKWA 5J87A 3O51A 3OBGA 4NM3A 3O17A 1AD5A 3UYSA 5IQDA 3MIYA 1OL1A 3MESA 2R0IA 3VJNA 1GZOA 3W8LA 3FMHA 2WPAA 5FUTA 3A8XA 3DLZA 3DQWA 3EKKA 4PPAA 1Z9XA 3JR1A 2IO6A 3NVMB 1YWVA 4KIQA 4BCMA 2HELA 5D9HA 1ZLTA 4BTMA 4QYYA 5J9LA 2HWPA 2X81A 3PXQA 4AQCA 3P79A 3SHEA 1H8FA 1WCCA 4ZMEA 3D2KA 3DKOA 2RG6A 5E92A 4HGLA 3ZBFA 1SVEA 3EQPA 1YXTA 3VUKA 4AGDA 1GNGA 3EFWA 5AP7A 4YPDA 3DBDA 1PXPA 2HY81 3DJ7A 4IANA 2PVYA 3H4JA 5EQYA 2WAJA 2JDVA 3D4QA 5HLPA 2KULA 5A6NA 3TNPC 2J0KA 2XKDA 4FKTA 1SMHA 3R2BA 5HCYA 4F09A 4EOPA 4GL9A 3BYUA 2A27A 3EFKA 3H9FA 4TYGA 4AOIA 3VHEA 3GFWA 4O6EA 4XRJA 5M08A 2WMTA 3OMVA 3W55A 5AAFA 1ZAOA 3DK6A 4IZAA 3MH3A 3QGWA 1FINA 3QQFA 4F9WA 5C8NA 2YCRA 1S9JA 2YWPA 3ZLSA 4QRCA 4AZTA 3G6HA 2JITA 1CKJA 3OUKA 3SD0A 4QP3A 3UZTA 4BBMA 4DGLC 1YI3A 5HX8A 2OJJA 3DTWA 3OOMA 3KULB 1JKSA 4FIHA 4GFMA 4YGAA 3IDCA 3UNZA 3ZTXA 2O8YA 4F9CA 2E9OA 3K5UA 5AP6A 4C4IA 5BQ0A 4NCTA 1CKIA 4N57A 4Y85A 3TUDA 3Q6UA 4DN5A 5GJDA 5JFVA 1GIJA 1BYGA 4IVCA 3ACKA 3POZA 3QD2B 3QWKA 4MWHA 4ANSA 4PF4A 2CKEA 1YW2A 4EHEA 4BR3A 3PA4A 3AC4A 4AFEA 4C4HA 4DEIA 1A48A 2EUFB 4LL0A 5CZHA 4DFLA 4I6FA 4XS2A 2FSLX 5DR6A 3UGCA 3Q9YA 1H24A 3R8UA 3LM5A 5M53A 4XNEA 1Q8WA 4R3RA 2X9FA 4L42A 4UX9A 2REIA 3KXZA 4RJ4A 4FTMA 5G6VA 3NW5A 4TPTA 2G2FA 2C6IA 2W4KA 3PIZA 3Q9XA 3LW0A 3CTJA 4RJ7A 3MPMA 3MW1A 4C7TA 2I0EA 5A54A 2XJ2A 4JDJA 1A06A 5AV0A 5CEPA 3EJ1A 2WOTA 4TWNA 4ASEA 3OXTA 3FV8A 1E9HA 3F5UA 2B1PA 3IS5A 3PE1A 1SNUA 4J1RA 1W98A 2VD5A 1G5SA 3LCOA 4M68A 4O0XA 1TQPA 3PIXA 3AT3A 4DG3E 4DC2A 2JDTA 2WELA 3MS9A 3UG1A 4QQTA 5HE2A 5DE2A 1OKYA 3GC9A 4QYHA 5KZ0A 3NYNA 3FUPA 5HEZA 4EK4A 3ZM9A 5EKNA 3I6UA 4IAZA 3MB7A 2RSVA 4E4XA 3RMFA 4FNWA 5EKOA 4WBOA 3RM6A 4M67A 4DLJA 3QUEA 5LWMA 5DFPA 5IA5A 2YJRA 4GT4A 4JDIA 4P90A 3BQRA 2UV2A 4CCBA 3GCQA 3G51A 3CJGA 1M17A 2J9MA 3HLLA 3PY1A 4FTQA 4EH5A 2Z7RA 5IA0A 4EOJA 1JSTA 4EOQA 3E8EA 4GK4A 2YLFA 3QX4A 4GKHA 4RX8A 4WNOA 1CDKA 3NYXA 3NNUA 3CGOA 2QOQA 5IA3A 3DDQA 3HL7A 3I0OA 3IONA 3OOGA 4J99A 1EH4A 4Q5HA 5IQBA 1K9AA 1V0BA 2WU7A 3UOKA 2XK3A 1NVQA 1W0XC 4EORA 2FSTX 2VWIA 4NIFB 4LGDA 4FV8A 3LJ1A 3WF6A 3RGFA 5HBEA 3VIDA 2ETMA 3T3UA 3WYXA 2UZVA 2PUIA 2XEZA 4GMYA 5KUPA 1Y8YA 5FD2A 5B2LA 4MBIA 5HNIX 4D9TA 4HNIA 5GJFA 3KXHA 5TOZA 4OTQA 4BFMA 2EXEA 1WBOA 4FV4A 4Q5EA 5EM7A 3CJFA 3E7VA 5AIKA 5E8SA 2HAKA 2HCKA 2BHEA 3RTPA 1KE5A 3DJ5A 3CD8A 2QHNA 4BDEA 3S95A 5CLPA 3VUTA 4USFA 5BVFA 5IDPA 1Q97A 2C68A 5LVOA 4OTFA 5HE0A 2UW8A 4FI1A 2XM8A 2C5XA 4RMZA 5EOLA 4LRMA 3U4UA 4O0SA 4E20A 3AMBA 4XG6A 4FC0A 3NRMA 3ZFXA 5JKGA 2OFUA 5FQDC 1KE9A 4N70A 5CSHA 3KVXA 5EW9A 4XOZA 5DVRA 3WE8A 4ASZA 1PXIA 3RCJA 4JXFA 3FLYA 1H07A 2VTJA 4Z7HA 5LCJA 2IW9A 5HVKA 5CQUA 2IVTA 2FUMA 1FGIA 4TYJA 3RM7A 4C62A 2DUVA 2C1BA 2UZTA 1H01A 2VUWA 1FMKA 4JX7A 5JQ8A 2W1CA 4O6LA 4U81A 5EH0A 3UBDA 4QMWA 4KNBA 4C33A 4E73A 4U97A 2J90A 4TY1A 4EJ7A 1YXUA 4W4VA 1ZMWA 3TJCA 1KE6A 5JQ5A 2YITA 2YCQA 3KL8A 2UW9A 4AE6A 2YIQA 4E4MA 3GCUA 3UIUA 2HZNA 3GGFA 3SG9A 1H28A 4HOKA 4IWDA 4WRGA 3RZFA 4YJVA 4RIYA 3I81A 4YURA 5GHVA 1P5EA 4I5MA 4O1PA 3A7FA 4XJ0A 3I60A 3REPA 3ROCA 3I0QA 5CEQA 5HU3A 5I9XA 3D83A 3Q60A 4JDHA 3KFAA 3OT3A 1VZOA 2BAJA 2OBJA 2CPKE 5HHWA 3T9TA 1W8CA 2RFEA 2YABA 4WSYA 5I9UA 3O8TA 3QTUA 1PYEA 3QQJA 4L9IA 4G3FA 4A9SA 1H0VA 4BTFA 4D55A 4F70A 4IW0A 4CV8A 4KBCA 2XIRA 1ZYCA 4RWLA 5DR9A 3IOKA 2BFXA 3SXSA 5LARA 3D9VA 3GU7A 5K3YA 3BEGA 3R7IA 2J51A 5CF8A 1X8BA 4CG9A 2O2UA 3KF7A 2CNQA 4P5ZA 1OKZA 2QU6A 3O7LB 4ZTQA 3MBLA 5A9UA 1CMKE 4BDFA 4EQUA 5CF6A 4BCFA 4YC3A 3NPCA 3RNIA 5IQCA 4O81A 4ZMFA 3R22A 2ITZA 2WEVA 4HYUA 3I4BA 4W9WA 4EK6A 1IA9A 3LLAA 3ZHPC 3O50A 4ZS4A 1H08A 2ZB1A 4WNPA 4O7ZA 4CG8A 4JVGA 4L6QA 3OC1A 4UMUA 4EK3A 5IA4A 4EH7A 2PMOX 3OVVA 5HCXA 4D1SA 5A4CA 4JIKA 3ZO4A 3EQHA 4I5PA 4CKRA 4IB0A 4XG7A 1YXVA 3DPKA 4ASDA 4PL3A 2BIYA 4IC8A 5I3RA 2R0UA 2R3OA 5HIDA 1URCA 3D7ZA 4QMSA 3Q04A 1OBDA 3N9XA 2BDJA 3DAEA 5ACKA 4RIXB 2HYYA 4JR3A 3DKCA 3OY1A 4AA0A 4ZJVA 5CQWA 5AR4A 4AS0A 4MTAA 2B0QA 2F49A 5TR6A 3HDNA 5DWRA 5CALA 5EW8A 3TEIA 2BKZA 4NTSA 4B0GA 5H2UA 2DS1A 4ZTHA 5E1EA 2R3RA 1DM2A 4MEDA 4UWBA 3OZ6A 4AZSA 4D4RA 1RQQA 1TQIA 3GEQA 3SV0A 2VX0A 3SOCA 3QGYA 3OWLA 1UNHA 3ZRKA 2PZ5A 3PXYA 4JBPA 1Y57A 2W17A 5CT0A 4O0TA 5CENA 2BPMA 2C6TA 4WG3A 4KIOA 3UJGA 3BHHA 4QMLA 3W2CA 4I22A 4BKZA 4MH7A 3QU0A 2WTIA 4MBJA 3HRCA 4C35A 5JH6A 4G9RA 3BPRA 3K3JA 3W2QA 2E9NA 1IEPA 4IFGA 4U43A 1JPAA 4U7ZA 1OIQA 3G9NA 4E26A 4TZRA 2XCHA 4FKSA 4PNIA 4EONA 4K33A 2W5HA 4FKQA 4RJ3A 3TNQB 4AOJA 2C3JA 4M84A 3QA0A 5D7VA 1T45A 5HD7A 5HU9A 3W2RA 1NY3A 3EQRA 4OBOA 2W1GA 4QTBA 3QQLA 4HYHA 4D5HA 5IQIA 3U4WA 3QZGA 5KMLA 2IZSA 3RKBA 5DEWA 1IG1A 1REJA 4O7RA 4FKVA 5A4TA 4X2KA 4QPSA 4ERKA 5DT3A 4Z3VA 1BLXA 1JOWB 3HNGA 2VWBA 4QPAA 2PZPA 4O7LA 2GS2A 3MY5A 2ZOQA 5DI1A 1F0QA 2B9JA 4LOPA 1JKLA 4CTBA 1XBAA 4YJSA 2I0YA 4TYEA 1G3NA 5CNNA 4Z55A 3EH9A 4FF8A 5AV3A 3SW7A 2OO8X 3LCSA 2VNWA 3RAWA 4WA9A 3TNHA 3QRUA 4RVTA 2PTKA 4FKJA 4EOKA 1OL2A 3QLGA 5M51A 1BL6A 3OFMA 5L8KA 4YPSA 3VS1A 3FMLA 3H0YA 3BQCA 3HEGA 3VBQA 3DT1A 3KN6A 4FTIA 5IU2A 1FPUA 4QT1A 1P2AA 5D1JA 4FV0A 5J1VA 3OEZA 3EN6A 3MYGA 3WZDA 4KSPA 5HO7A 2PVNA 3VBYA 4ACGA 4HW7A 4QNYA 4UEUA 4LG4A 4ZLZA 4OBPA 3QUDA 2C6LA 2QKWB 3FZPA 2EB3A 1CM8A 4WKQA 3RK7A 4ZP5A 5IMEA 4KBAA 1SZMA 4L68A 4CZUA 3EWHA 3HUBA 1JVPP 4G6OA 2F7ZE 3FQHA 3V04A 4ANQA 3DDPA 4CT2A 1JKTA 4B9DA 3HP5A 1SVGA 2JEDA 3C4FA 3RPVA 3UC3A 3I7BA 2A1AB 4U44A 4ASXA 4E3CA 3M2WA 2I0VA 3RINA 4I6HA 3RI1A 2I1MA 3QD4A 4EOSA 1OPJA 5BMSA 3ZSIA 3KRXA 3T9IA 3GI3A 2Z02A 4PL5A 5AV1A 4S33A 2B7AA 2HWOA 3HZTA 3DLSA 3COMA 4ACMA 5IG1A 4DBNA 4QTCA 2J5EA 1SM2A 3PUPA 1LEWA 4FTCA 4C4FA 4IX4A 1M14A 1JSVA 4QP9A 2X6DA 3QTWA 1XH7A 5EI6A 5M07A 3QWJA 3BHUA 4U42A 2E9PA 5I4NA 4KRDA 4MXOA 2HY0A 2WOUA 3PYYA 4QMQA 4AW2A 3WYYA 3PP1A 4LL5A 3SRVB 3F88A 4UMQA 3PXZA 3FKOA 2OKRA 5B2MA 3UMXA 5F95A 3QA8A 3NVKI 4WT6A 4BIEA 5KMIA 3NAXA 4FUYA 4Y72A 1UNGA 4AUAA 4O0WA 4D4VA 3EL8A 1OUKA 4UYNA 5FEQA 4GG7A 4CQGA 4XHKB 4TXCA 5C4KA 3WOWA 5EQEA 3TNIA 1KV1A 4J52A 3GNIB 3UG2A 4TW9A 4RA4A 1DI8A 3GQLA 3V01A 2BTSA 2XK7A 1T46A 4B8LA 4IJPA 4H1JA 2QR8A 3OUNB 3RAHA 4L8MA 4EH8A 3QYWA 4ALWA 4B99A 3PY0A 4O38A 4MD9E 4XH6A 4AT5A 4JG8A 4QYEA 1ZZLA 5DR2A 2P3GX 1U54A 3ZUTA 4NEUA 4QMOA 3PA5A 3IW4A 1Q3WA 3TWJA 4JBOA 4AW0A 4AZFA 4H3PA 4YLKA 2XH5A 3MY1A 4K77A 2QQ7A 4PY1A 5TT7A 4BWPA 3GB2A 3QRKA 4A9TA 4EBVA 5KMNA 2EU9A 4H39A 5B2KA 4LQMA 3R7GA 3BLQA 3E87A 3W16A 1J3HA 5F20A 3VVHA 2YN8A 3BX5A 2BAKA 2XIZA 5ICPA 2QU5A 4YUQA 4LOQA 4M97A 3TZ7A 2UW3A 1H1RA 4DEAA 3CSVA 3FQSA 3B8RA 4FTUA 4BI2A 5CX9A 4M69B 3E93A 3Q4TA 5DOSA 2VNYA 2WMVA 3GVUA 2XKFA 3ULZA 2YIYA 4G17A 4S2ZA 4J7BA 3IW8A 2ZJWA 4IIRA 3TCPA 2CHLA 3HMIA 4LUDA 4D2VA 3FI2A 2YHVA 3FYKX 1OKVA 4QD6A 4U3ZA 5CU6A 2JAVA 2ITNA 3F3ZA 4TWCA 3SOAA 5HX6A 3H9OA 4IC7A 2Y6MA 1U4DA 3KK9A 1ZYSA 4CNHA 4U9AA 5ANJA 2YDJA 3TG1A 2ITWA 2W1IA 4A06A 4MX9A 2ITUA 4O83A 4MF0A 2IVVA 3KXXA 2Y4IB 4PMSA 3KKVA 5A14A 3AMYA 2XBJA 4QQ5A 3M42A 3D5UA 4EUTA 4F65A 4XEYA 1CKPA 3MA6A 5BUEA 4DFYA 3FL5A 2WTKB 2BROA 2YAKA 5JFXA 2YEXA 2QD9A 2FSMX 4FSUA 4DTKA 3GC8A 3ACJA 4E4LA 4IX6A 1STCE 2H34A 3LMIA 2JGZA 3LE6A 3ZO2A 3I5NA 3BE9A 3OCGA 2CN8A 2XJ0A 2WMQA 1B6CB 5L2WA 4WSQA 4NJ3A 5TE0A 2VGOA 3R83A 3Q2JA 2H8HA 2X7OA 3NNXA 2PE1A 2GMXA 4M0YA 4C4EA 1CSNA 4FV9A 4F0GA 4F7NA 2PE0A 3FQEA 4USDA 4FT5A 2QOFA 3VS3A 4TWOA 5DEYA 4ZY5A 2R7BA 3LQ5A 2YM8A 2AC5A 2JFLA 3QC4A 4I1ZA 2HZIA 4X0MA 2A19B 4UMRA 3R73A 4M66A 4H05A 4FNYA 2XMYA 3IDPA 4IADA 2QG7A 4AF3A 3A4OX 4BCQA 1ND4A 5JGBA 4DA5A 4KWPA 3FMMA 4G3DA 3QL8A 2G01A 5L2SA 3R7EA 2B9HA 3D5WA 4CRSA 3QHRA 5BYYA 3LQ8A 3OCSA 4AZVA 5FEDA 3ATSA 3FWQA 2R3JA 4J98A 3ZRMA 3W18A 3LAUA 3G6GA 3NIEA 4CGAA 2AC3A 3EN4A 4D2WA 4FGRA 4K8AA 2OJFE 4G6NA 4O91A 2HW6A 4ZK5A 3FSKA 3R71A 4RSSA 4NIFA 4CFWA 2JDSA 4ZSJA 3QTZA 4BDBA 1YKRA 2WTCA 4JJRA 3LCKA 4BB4A 2BAQA 3GFEA 4GT3A 4TYHA 5CU4A 4X2NA 2XRWA 2XIXA 4LM5A 5ETCA 2C1AA 3VUGA 2R2PA 5IEXA 4F6WA 4NM0A 2JDOA 3VS6A 1JBPE 2V7OA 3AG9A 2BTRA 2WXVA 2XA4A 3T3VA 4L3LA 3MH1A 4FEVA 1PMNA 4I6QA 4AN2A 2WIHA 2I40A 3DGKA 5M44A 4H3QA 2W0JA 2GTNA 1Q8UA 4D0XA 3OTVA 3FXWA 3NNWA 4B7TA 1J7LA 1PJKA 3QTRA 4PP9A 5BVKA 4BF2A 5I0BA 5JN2A 3VQUA 4FZFB 5HGIA 5CXZA 4D2SA 3MFRA 3ZSGA 1JQHA 4EZ7A 1YOJA 2OIQA 2YAAA 3K54A 5AWMA 4C4GA 3QCSA 3LFSA 4FZ7A 2J0IA 1S9IA 3IG7A 4QTAA 3VNTA 4K6ZA 3V5QA 2XEYA 2YA9A 3CKXA 4IAAA 4H36A 4YSJA 4L53A 4CFMA 4QYGA 5E91A 4DCEA 3HRFA 3F3UA 3ODZX 4GJ3A 3FY0A 5HNBA 2B55A 2UZDA 4XBUA 4E5WA 3KGAA 3MTFA 4RVMA 4Q9ZA 3R9HA 3UVRA 2YERA 4XOYA 1UWHA 4ARKA 4LRKA 4KS7A 4BYJA 3V8TA 5KBRA 2OXXA 3G15A 3PRIA 5EYDA 1H1WA 1MRVA 4RX7A 4KA3A 3G33A 5FP6A 3SQQA 4EH9A 3QFVA 4EEVA 3TUCA 2R3MA 2B53A 3ZC6A 3VUDA 4JLCA 1NW1A 1MUOA 3QRJA 4G9CA 1OGUA 5AP5A 5EYMA 2QOLA 4EUUA 1ZY4A 5CWZA 5DYJA 4BKJA 3TDWA 5AR3A 3LQ3A 2CDZA 1ZYJA 4JQ8A 4YP8A 4G16A 5IMXA 2PZIA 5EOBA 4IDTA 5FTQA 1J7IA 3FMNA 1PMVA 3CLYA 5HLWA 3AD5A 2XM9A 3LJ0A 2OJIA 4KRCA 3DZOA 5LOHA 5I9VA 2OJ9A 3V5LA 1GZNA 4FSYA 4I0SA 2KTYA 4KBKA 3BI6A 4A07A 3L9MA 4CCUA 5DBXA 5K5NA 4FIEA 4LUEA 3JVRA 3AMAA 3UIXA 4MBLA 5AUVA 3UYTA 3ZSHA 4DF3A 2HK5A 1PXMA 2J5FA 3AT4A 5C8KA 4DFNA 3F2RA 3ALNA 4BWKA 2A2AA 2QOBA 3H10A 4E8AA 2NRUA 2GU8A 4LMNA 4EOOA 4EYMA 5HLNA 3A61A 3ORIA 4W8EA 3I5ZA 3AGLA 4NFMA 5EHOA 5JFSA 4IQ6A 2ZM4A 3QXOA 2ZMCA 5KMKA 5JGDA 3RPRA 2VX3A 2QCSA 3EIDA 5BUIA 5AV2A 2OLCA 3F82A 2DYLA 4IM2A 3R8PA 2OIBA 4EHVA 2WTJA 2IWIA 2PYWA 3DS6A 3CEKA 4YTIA 2ITQA 3ZFYA 5IKWA 5AMNA 3EQFA 3L8XA 4L3JA 4WRSA 3SXFA 3D5XA 2UW0A 3ZLWA 2W4OA 2HXLA 4XP3A 5E90A 3BRBA 2HOGA 1IRKA 2W9FB 3OWKA 3MJ1A 4YHFA 5IEYA 5KKRB 3VF8A 2PULA 5E8UA 4APPA 3C7QA 4S32A 3A7IA 5A6OA 5ANIA 3OXZA 3GQIA 4RZWA 5DG5A 1QCFA 3O8PA 1O6KA 4ZSEA 3UIMA 2PWLA 3SA0A 2GDOA 4YTHA 3HECA 2O64A 3CD3A 3O96A 3FZRA 2YZAA 5CSVA 1M7NA 2OG8A 5CTPA 4FYNA 4RIXA 4NH1A 4HGTA 2J0MB 3OS3A 4ID7A 4QP6A 4I94A 3HMMA 3QD0A 4MK0A 4QQCA 3S00A 4X3FA 3QYZA 5KMJA 3DJ6A 1ATPE 5GZ9A 2VX1A 3RCDA 3QKLA 4IEBA 4D2RA 5C03A 5E8VA 4FG7A 5KO1A 4H3BA 3NUAA 2Y4PA 3F9NA 1OKWA 1ERKA 5CAUA 4EYJA 2C6KA 3CY2A 3RVGA 2R3IA 2V0DA 5C01A 5CAQA 2I7QA 3FAAA 4U8ZA 2C6OA 1IAHA 3FJQE 3CP9A 2JIVA 2X9EA 3BLHA 3OXIA 2W06A 3NCZA 3R8LA 5M4FA 4H1MA 2V22A 3PVWA 5M57A 3HAMA 1BI7A 4GFOA 4MXXA 2C5VA 2WD1A 2VTPA 2PVLA 4DFXE 2R3NA 5AR7A 4JI9A 4ITHA 1H4LA 2B9IA 2GFSA 1FBNA 3PDTA 4FSNA 4L45A 4KUJA 4J95A 1BMKA 3SAYA 5EYKA 1U54B 1SYKA 1BL7A 3R1YA 4PMTA 4MD8E 2JBPA 5M4CA 4KIKA 3ZLYA 2XVDA 3EN7A 3PTGA 2Y7JA 3OROA 2W5AA 4GU9A 2QURA 4GVAA 3VC4A 5J7HA 3QLFA 5AM6A 1U5RA 2R3KA 3R9OA 4F08A 2GQGA 4X2GA 2B52A 3ETAA 5JMSA 2ITPA 4ZTNA 4DH7A 2BCJA 4AZWA 5EI8A 1QPDA 5IZFA 4ZY6A 3BV2A 1UA2A 4HGEA 1ZMVA 2GS7A 3F66A 1OB3A 3E88A 5L4QA 3BU6A 4HZRA 5KMOA 1WAKA 3GU8A 3IQ7A 1XBCA 3SRVA 4EOMA 4O82A 4B8MA 1Q8YA 2Q0BA 1UU8A 4IB5A 4YZNA 3C50A 4JAIA 4AAAA 5L2IA 3F7WA 3SKCA 4MHAA 1H0WA 3BLRA 3PLSA 4HCTA 4AN3A 2UZNA 4YJQA 3DNEA 5C8MA 4QMPA 5AP0A 3TTIA 1IR3A 2CKPA 1AGWA 3DY7A 4IH8A 5LCKA 2OXDA 4A9UA 4BTJA 5E9EA 2WNTA 4UXQA 4HYIA 2VO3A 4OAVB 3FZ1A 1E1VA 4ZTLA 4EC9A 4KD1A 2YM6A 4H58A 4QPMA 4D9UA 3HMNA 4MNFA 1O6LA 4K0YA 4XG4A 3VO3A 1K2PA 3PZEA 5C9CA 3NEWA 3ULIA 4ZLYA 3UQCA 5K9IA 3LMGA 3KCKA 5AADA 2W1EA 4M8TA 3RPOA 4F7LA 3UZPA 2C5OA 1JNKA 4HPTE 4O86A 4NK9A 4Z7GA 1XH5A 2F4JA 5HNGA 4F63A 4QTEA 1J1CA 5A4LA 3RWPA 4C2WA 2WKMA 4RFZA 2JC6A 5HCZA 2PVRA 3O2MA 4Y83A 5EI2A 4OTGA 3UQGA 4BCJA 3BYVA 4NYEA 2C6DA 3NUNA 3PP0A 1QPEA 2YIRA 4FMQA 3C5IA 2Z2WA 5BUJA 1Y8GA 2QR7A 4QMNA 3ATTA 4O0YA 3PWDA 5CT7A 2ITOA 3CQWA 4PUZA 5F94A 3RAIA 4FODA 4L44A 2W1FA 4GG5A 3FKLA 1FVTA 2VWUA 4P5QA 3JS2A 3LXNA 4RT7A 5EM6A 5CVHA 5T6KA 4ZSAA 4BY9E 3O0GA 4S34A 3D7TA 3WZJA 5I5ZA 1BUHA 3ZBXA 4TKSA 2NP8A 2BRHA 5HIBA 3V3VA 4C3RA 1VJYA 3QKMA 4XP2A 3W1FA 2YM4A 2O65A 3QC9A 4HPUE 4XYFA 4C3FA 3TV4A 3MN3A 2WQOA 5JZNA 4UXLA 5CF4A 3BHVA 1XH9A 3KY2A 4GUEA 3G0FA 2XP2A 4FIIA 4XCUA 5HO8A 3WZKA 5D7AA 1YI4A 2XS0A 3VUMA 2ESMA 3FY2A 4BIBA 3U6JA 4YZCA 3RAKA 5ANOA 2CSNA 2VZ6A 3WF9A 3W10A 4A4LA 2QO2A 4M13A 2R64A 4YHTA 3H9RA 4JDKA 2LAVA 1OIRA 1ZOGA 4M0ZA 2PPQA 4X7QA 4LGHA 4ZOGA 4OGRA 4FYOA 3PG3A 3PVGA 2X8EA 2XZSA 3EN5A 4JRVA 5IA2A 4ZEGA 2IW8A 3IECA 3TIZA 1R78A 4RWJA 1XO2B 4FBXA 3R7YA 5IA1A 2WMUA 3LLTA 4PMPA 4ANBA 3QF9A 2YJSA 4BICA 3VBXA 4C8BA 4DGGA 3NLBA 2VTNA 5J79A 3D0EA 2BVAA 2HZ0A 4ZXTA 3RWQA 3F3TA 4FT0A 1Q8TA 2RIOA 2W1ZA 5JZJA 2C6EA 5AEPA 3F7ZA 4MQ2A 3IO7A 1M52A 5AUYA 1CTPE 2XJ1A 3HX4A 4ANNA 5CEOA 3CBLA 1LPUA 2RFSA 3PE2A 3QRIA 3UPXA 4WOVA 3R28A 4OUCA 3UZRA 4Q9SA 2BRGA 4XMOA 3UO4A 1RE8A 5EQPA 3DBQA 5AP3A 3MVJA 4YJPA 4R7HA 1P4FA 3MV5A 4ZTMA 2JIUA 3LJ2A 4FV3A 4FKOA 4F7JA 4XV9A 4HVSA 4R3PA 3NZ0A 3KQ7A 5CAPA 3KREA 2UZBA 2XIYA 4DYMA 4HVIA 5LXMA 3TKHA 4UY9A 3C4EA 3QQGA 3IGGA 1HCKA 1ZRZA 4X3FC 2OZAB 3JXWA 3LCDA 3CXWA 3R0TA 4F64A 1OECA 3KB7A 5KMMA 5E7RA 4F7SA 3R1SA 5E8ZA 4IVAA 2BILB 3FI8A 2I0HA 3EB0A 4FK6A 1ZWSA 4XRLA 3C4CA 4MYGA 4FV7A 4PTCA 2A0CX 5HO6A 4ZY4A 4AWIA 2JBOA 3BWJA 4FTTA 5FBOA 3GP0A 2JLDA 5I9WA 5IH5A 3P23A 2VTHA 5B7VA 4ZZMA 3VQHA 2Z7LA 2HENA 4R7IA 4OTIA 5EHYA 3RBWA 4J96A 4BRXA 5CF5A 4QMTA 5I9YA 4QMYA 5F4NA 2Y9QA 3FE3A 5HE1A 2YCFA 4I0TA 3ZMMA 1R1WA 3L1SA 3TV6A 1H00A 3Q2MA 4FNXA 1YHWA 1BX6A 1YHSA 1Q62A 1V1KA 2V7AA 4BHNA 1IA8A 1NVSA 4I5CA 4QP8A 3R9DA 1OL6A 4YTCA 5HZNA 3QTXA 5TF9A 2W1DA 5CEKA 4AA4A 1IASA 2UZUE 3DXPA 1REKA 4UBAA 3DXQA 4IX3A 2XYUA 5HD4A 2ZM1A 3UE4A 4AA5A 4FSWA 3C4WA 3OG7A 4ZZOA 4NCTC 4ENXA 3MIAA 4KS8A 5IQHA 4PDOA 5FBNC 1NVRA 4FIFA 4E4NA 3WBLA 4L01A 5E8XA 4ZLOA 4I6BA 2VO0A 3FSFA 4AGUA 4AW1A 1F5QA 1H26A 4I5HA 3PJ2A 2UVYA 5EK7A 3ERKA 3MVLA 4PX6A 2EXMA 5HG8A 4BGQA 4L67A 2FB8A 3GBZA 2WZJA 3FHRA 5HESA 3SC1A 1Y6BA 2XNOA 2PVKA 3BU5A 4EWQA 4IB3A 3CIKA 4GIHA 4DITA 1XWSA 2WGJA 4BGHA 4HNFA 3IOPA 3P08A 4YZ9A 4U41A 2R3HA 3PSBA 3UPZA 3EQDA 4PDSA 5DT4A 2B9FA 2VRXA 3RK9A 2ITXA 1YI6A 2FGIA 3FPMA 4HVDA 3E8DA 2G2HA 3CE3A 5AM7A 3P7CA 2PVMA 2Y8OA 5J7BA 1W83A 1HCLA 3U87A 2FH9A 4PL4A 4D5KA 5IEVA 4NL0A 1SVHA 4O7TA 4FG8A 3TI1A 1WBPA 5AP2A 3NX8A 4ORKA 5L6OA 5LMKC 3HVCA 1KOAA 4X21A 4XV2A 2H6DA 3R6XA 1V0PA 3P78A 4ALVA 2BZJA 4U5JA 4UYAA 3VJOA 2CLXA 3C13A 4AX8A 3A7JA 4WG4A 2ETKA 4EOIA 2Y0AA 3OEFX 4W8DA 5DIAA 3R8MA 1UVRA 3E3BX 4ENYA 3PJCA 3UOLA 3DKGA 4U45A 4DH3A 4EK8A 4WIHA 2BFYA 3PJ1A 4X2JA 3ENMA 3LFNA 4WHZA 4CKIA 5BYLA 3PFQA 1H27A 1GOLA 3DCVA 3L8PA 5ANGA 2V5QA 1YHVA 3GC0A 2W99B 3JY0A 4O1OA 4K11A 3GU5A 4IWOA 5H8GA 3C5UA 1Q3DA 2PMLX 2CGXA 4IACA 4EL9A 2X6EA 2CCHA 2QO7A 2ZB0A 4FUXA 4O2ZA 4DGNA 3A7GA 1KV2A 2P55A 5TKDA 3MB6A 2ZVAA 2YACA 4MNEB 1BI8A 3MH0A 4FE2A 3EQBA 1WMKA 2C3IB 4OTPA 3P7BA 4RC2A 5AAGA 4I0RA 4LV5A 3KF4A 4RIWB 3R30A 4M3QA 5AJQA 3HV3A 5I3OA 4S31A 4F9AA 1OBGA 4UV0A 1UV5A 4Y8DA 2ITYA 4W4WA 2P2HA 4LI5A 1MRUA 3ORXA 5IH6A 4W9XA 3F3WA 4HCVA 4YNOA 2RFDA 3V5WA 4CZTA 1M2RA 1GZ8A 1MQBA 4RGJA 1M2QA 1U59A 3PSDA 3PJ3A 1HOWA 4DFUA 3R21A 3QAME 4JBQA 4N6ZA 4TT7A 4AGCA 4E6QA 3EKNA 4MVFA 5AP4A 1VR2A 5CEIA 4JT3A 4CFXA 3W2SA 4MF1A 2EXCX 3GC7A 2JKMA 4YJOA 3VWAA 4DTAA 4ZS0A 2QVSE 4OTRA 1UNLA 4EH3A 5FEEA 4IZ7A 4JG7A 4YZBA 2CCIA 5DNRA 3LHJA 4GK2A 5AA8A 3ORTA 3QD3A 4Y95A 1QPJA 4FV6A 4RZVA 4IX5A 4XV1A 3R8ZA 4OT5A 5CASA 4KINA 4E5BA 5I9ZA 4YJUA 2VAGA 5KHWA 3KXMA 3SXRA 4QOXA 4BCNA 2W5BA 4DTBA 4FT9A 5DN3A 2VTAA 3RP9A 2UZOA 3GCPA 5T3QA 4BGGA 4E1ZA 3C9WA 2VTOA 5J5TA 4FSMA 4F1MA 4GRBA 2C4GA 3VW6A 1TQMA 4UZDA 4BC6A 4EHGA 3JY9A 5FDXA 3I79A 3SVVA 2O63A 3AQVA 5CANA 2WFYA 3NUPA 4L7SA 1QL6A 2W7XA 4RFMA 3IK3A 1UWJA 3SG8A 5T68A 2YDIA 4XLVA 3HV4A 4CXAA 4YJTA 4FKUA 5HKMA 2NRYA 4IMYA 5E4HA 3D94A 4L3PA 3R7VA 2X0GA 3VW8A 4DHFA 5AV4A 2X8DA 3Q4UA 3LXKA 4G3CA 4HCUA 2J2IB 4FEQA 3KA0A 2E9VA 1OIYA 5BVNA 4AE9A 5M4UA 5L3AA 5TO8A 1P4OA 3Q9WA 5JT2A 1F3MC 4FVRA 4WNMA 5IDNA 2ZV9A 2X1NA 1TVOA 2GPHA 3GOKA 3CTQA 4V04A 4EKKA 4EZ5A 2Z8CA 4LMUA 2QOCA 3F2NA 5CVGA 5JRSA 4YZMA 1I09A 4XV3A 5E8TA 3FMEA 3VUHA 4M12A 2X39A 3VHKA 2R7IA 4CZYB 3BHYA 2UUEA 4RA5A 4XUFA
chains in the Genus database with same CATH superfamily
4FL2A 3GUBA 3PRFA 3R9NA 3R63A 1WBTA 4BDAA 4MAOA 4EI4A 2W96B 2BALA 3DNDA 4OT6A 1XHAA 2G15A 4ANOA 1OPKA 2WMAA 1FVVA 3VS2A 5CEMA 1BKXA 3ZXZA 4RVLA 1NT2A 3QKKA 3RZBA 4EJNA 4FOCA 1UKHA 4ZJJA 5LVPA 3P0MA 3S3IA 4CYIA 3A8WA 4DH1A 1UKIA 2O0UA 5D41A 3MPTA 4GYIA 5E8WA 1DI9A 2P33A 3FXZA 3Q4CA 2O5KA 4FTLA 2BDFA 3L9NA 2H9VA 2CKQA 2HZ4A 3N4UA 3ZXTA 1WBVA 3MGYA 3UDTA 4YTFA 4TL0A 5A46A 4O21A 3VBWA 2DWBA 3FMDA 2OIDA 1PMEA 4O0RA 4CT1A 4HGSA 4FA2A 5BNJA 4I93A 4N6YA 3JVSA 3PA3A 4FZDB 3DA6A 3ZUVA 5FDPA 5KKRC 4BL1A 1ZOHA 1GZKA 1R3CA 3CPBA 3EFJA 4BTKA 3JPVA 2UZLA 3LFDA 5GINE 1YQJA 3VS7A 3ORLA 2XF0A 3UVPA 3POOA 3Q32A 4U40A 3H30A 4O4CA 2VV9A 2YM3A 3D7TB 3AC8A 3HV6A 4IE9A 5AUUA 2WMRA 2VWWA 3BGZA 3ORMA 3MSSA 5HG7A 5HOAA 4BI1A 4BZDA 4CMOA 4IBMA 2QLUA 1JWHA 3QUPA 3TXOA 4YR8A 2CGWA 3OT8A 2VTLA 4I24A 3KIOC 3I7CA 4C4JA 1PY5A 2EVAA 4G3EA 5C27A 4N0SA 1WBWA 3S1HA 1MRYA 1Y91A 4OTHA 2CGVA 4BHZA 4JR7A 3V51A 5M4IA 4MKCA 3W2PA 3UMWA 3I1AA 2X4ZA 4G1WA 2IN6A 4IJ9A 3WF5A 4UWYA 5D10A 1R0PA 3RALA 4C61A 3CTHA 5AUWA 3AOXA 1NA7A 2ERKA 1YDTE 4DG2E 2OZAA 4X3JA 3ZRLA 3E62A 1JKKA 3V5PA 4RC3A 1MP8A 3WIGA 3F6XA 5DH3A 5AX3A 5JEBA 4DEGA 3MVHA 4RQKA 1KOBA 3GU6A 3NCGA 4FG9A 3ELJA 4ITJA 5ANKA 4WUAA 5DMZA 3M11A 3R04A 2FVDA 2WQMA 3R2YA 1PYXA 2PMNX 3PWYA 3NNVA 3KRJA 4UALA 1OIUA 1JSUA 4FX3A 3IPHA 1IAJA 4G34A 2PVHA 4F1TA 1KUTA 3FPQA 3FMJA 2LGCA 4EBWA 3AD4A 4ITIA 5CZIA 3PPKA 3QALE 2CKOA 4I20A 3Q3BA 3OBJA 3ZEPA 3R9RA 4CSVA 3QTIA 3DBCA 3EN9A 5CSXA 4N4SA 4CMUA 4ZAUA 3DTCA 3KMMA 3G2FA 2BUJA 2E2BA 3FC1X 4OLIA 5FXRA 3ZOSA 4KB8A 5IQEA 4IAIA 3U9NA 2GNHA 3K2LA 3ZCLA 2UZWE 3OWPA 3AXWA 5D11A 5CXHA 3R1QA 1J91A 3RK5A 4F0IA 5JK3A 2WO6A 2O3PA 1J7UA 4BCKA 3UP7A 4EZ3A 5CI7A 3AC2A 2XKEA 1YXSA 4QMXA 4I41A 3BV3A 3SGCA 4DDGA 2F57A 3UNKA 1LEZA 2PSQA 3IDBA 4GFGA 3CGFA 1PXOA 2CGUA 3PSCA 4L52A 4DLIA 3IGOA 1Z5MA 3NR9A 4NKAA 2F2CB 4JRNA 4UMTA 3THBA 3TDVA 3MH2A 3QCQA 4G5PA 4MXZA 1B38A 2PZYA 4P7EA 4A4OA 2PK9A 4G3GA 4OBQA 2H96A 4FEXA 3QQHA 4JL9A 5BVEA 1UU9A 4FKLA 4RBLA 3TNWA 1O6YA 2VWZA 5FWKK 3ZZWA 4QMZA 2WQNA 4DEHA 4DINA 2IG7A 3OY3A 3LXLA 3VULA 3O23A 3G90X 4D2TA 4R78A 4U0IA 1H25A 3PXRA 4USEA 4DCAA 3QTSA 2C69A 2QI8A 4I4FA 5KNJA 3Q4ZA 4YO6A 4C37A 2GTMA 3FXXA 4RC4A 3HA6A 4EK5A 3F5GA 4FV1A 4QQJA 4NZWB 5AR8A 2AYPA 3DFCB 4FKGA 4JOAA 4F1OA 4XP0A 1OL5A 5AUTA 5AFVA 2Q83A 3DBEA 3AGMA 1U5QA 4Y46A 5HVJA 2XIKA 2PL0A 4BYIA 5EM5A 3FLQA 4IAKA 4LGGA 2RL5A 3CQEA 3KCFA 4I23A 3UDZA 1PKDA 5J9ZA 4NUSA 3C0GA 1FGKA 4BCGA 4C58A 5IF1A 5L8LA 3DFAA 4QMUA 3QXPA 3ZU7A 4DEEA 3BKBA 2V55A 3W0PA 2ITVA 3V8WA 3NS9A 3WIKA 4AW5A 4NU1A 1L3RE 4LFIA 2GS6A 5AUXA 2C5YA 5ANDA 3ORZA 1XKKA 5ANEA 4BDDA 4GUBA 2J50A 4FIJA 4WG5A 1A9UA 2WTWA 3FZTA 2OF2A 4O0VA 2XAOA 2QOKA 2OH0E 3WF8A 1Q4LA 4FTOA 2UW5A 2OSCA 3GCSA 2XNPA 4FSRA 4PPCA 5IPJA 4J71A 3FKNA 3L8SA 4KKEA 4C38A 2JFMA 3QHWA 1R39A 1DAYA 5LVLA 4RJ6A 3TV7A 4R3CA 2QOHA 3HRBA 3UVQA 4R7BA 1ZY5A 1WFCA 4TNDA 4RRVA 1XBBA 1XH8A 3Q52A 4ZTRA 2F9GA 2VTTA 4FSQA 5EM8A 4HVGA 1VYWA 3LIJA 3LFCA 5HICA 5GZAA 3ZO1A 4D4SA 3IW6A 1G8AA 4R1YA 3ZONA 4ZSGA 2IZUA 3S4QA 5H3QA 2QO9A 3P5KA 4XG9A 2E9UA 4Y5QA 4EHZA 4BJJA 2GQSA 4BWXA 2X7FA 4APCA 4IM0A 3DAKA 5IUIA 1YDRE 2Q0NA 4FKPA 4QTDA 4O27B 4KIPA 5GIOE 3FL4A 4WUNA 2BKKA 3ZFMA 2QODA 4DGMA 2VO7A 3E8NA 3ZUUA 4MD7E 2W9ZB 5HG5A 2B54A 5KCVA 1YOLA 3EHAA 2PY3A 3BGQA 2VWXA 2CLQA 2VTMA 3DZQA 3F3VA 5F9EA 4QDEA 2HXQA 3LPBA 3E63A 4FKIA 5DA3A 5EHLA 3V5JA 5K5XA 2JKKA 1I44A 4AFJA 3FLZA 3U8WA 3UOJA 3N51A 3EZRA 3OP5A 3RPYA 2X0PA 2BRBA 3PIYA 3SX9A 4FV2A 4C02A 4C34A 3VF9A 1ZYLA 4J8NA 5M06A 4W4XA 2PVFA 4J8MA 4EWHA 3ZH8A 4GT5A 3Q6WA 2PUPA 2HW7A 2R3GA 4YJRA 4HYSA 4QYFA 3GENA 3UDBA 3W32A 1WBSA 3MPAA 3N4TA 2GNJA 3FZOA 2HIWA 3I6WA 4C2VA 5JSMA 4IVDA 1YWRA 3AC1A 2NPQA 3COKA 1P14A 3QZFA 3WZUA 4BCPA 4EC8A 1DAWA 3EYGA 1YOMA 2F7XE 3E64A 4PRJA 5L8JA 4K1BA 1OZ1A 3NUSA 4YC6A 4PP7A 4PDPA 5AAEA 4CKJA 4CD0A 1PW2A 5IH4A 3AKLA 2VWYA 4EH6A 5CAVA 4ACHA 1XH4A 1FQ1B 1H1SA 2QNJA 3ZLXA 4JQEA 3DXNA 4WBBB 4B6LA 1LP4A 2QG5A 4D0WA 1KE8A 2GCDA 4TWPA 4E5AX 3F69A 5C1QB 4QMVA 3PY3A 2BRNA 2OK1A 4PWNA 5CY3A 3ZC5A 4AAYA 3PPZA 5FTGA 3KRLA 3LM0A 4L43A 5HI2A 3DU8A 5BYZA 4CV9A 3TACA 3NW7A 2P0CA 3NUYA 5CNOA 3NSZA 3SLSA 5IQAA 5DPVA 5DRDA 3LFQA 1WBNA 1ZARA 1M2PA 2VTQA 4IAFA 4X6QC 2WTKC 3U54A 3KN5A 2OWBA 1H1QA 2FSOX 4CLIA 4GV1A 1V0OA 4L46A 4OTWA 2PU8A 4JMQA 2VTSA 1DS5A 4CFUA 1RW8A 3P4KA 3DK3A 4IZYA 4IVBA 3TN8A 4Z16A 1GJOA 4XG3A 1LUFA 4QP7A 4EKLA 4D2PA 5IUGA 3TIYA 3TKUA 4ZZNA 2AUHA 4ACCA 3FI4A 4TYIA 3O8UA 4IWQA 4FR4A 2P2IA 1XQZA 2BR1A 2Z7SA 2UVXA 2XK9A 2GNIA 4O7YA 2OW3A 4RQVA 3NIZA 5FRIA 4D1XA 1OM1A 3KXGA 4EH4A 3CY3A 3PJ8A 4F4PA 5FG8A 3UNJA 2DQ7X 2PVJA 5DLSA 3TTJA 5EDQA 4A9RA 4DEDA 3TUBA 4BCHA 4FVQA 3FLWA 4FVPA 4OAUC 5FM3A 1OPLA 4LV8A 3S0OA 2GSFA 1Z57A 3NUUA 4TYHB 4PPBA 2G2IA 2CNUA 4JG6A 3ALOA 2IJMA 3HAVA 3SW4A 3NYOA 3C4ZA 4V0GA 5E1SA 5FM2A 3PXFA 4P4CA 3QTQA 3C0IA 5GZ8A 4TNBA 3MA3A 4V05A 3EQIA 2QOOA 3FMKA 3QCYA 2ZV2A 5AA9A 4PTGA 2JKOA 4FSTA 2XNNA 2VU3A 3W0MA 4MNEA 4RVKA 3P7AA 2QLQA 2R9SA 4NWMA 5ETIA 4BVUA 5HQ0A 2YDKA 5BVOA 4J53A 3IKAA 5L6WL 4DH8A 4R1VA 3B2WA 2C5NA 3BGPA 3KEXA 2GHMA 4M69A 1PKGA 3U9CA 1JAMA 4XX9A 3TZMA 3DB8A 4DH5A 2Y4IC 4CEGA 1KSWA 2YFXA 5ETAA 3BYMA 3A2CA 4FNZA 3TZ8A 1UU7A 1YXXA 3NAYA 3HA8A 4FL3A 4JQ7A 1ZXEA 5E8YA 3IW5A 4G6LA 1GIIA 2RFNA 3KULA 3MY0A 3MFUA 3EZVA 4ERWA 4NM5A 2R4BA 3BYSA 3HYHA 3AC3A 5M09A 2ITTA 3CPCA 3PZHA 2X0QA 3CQUA 4R8QA 4RX9A 3VN9A 4XG8A 1Q99A 4U6RA 4UMPA 3ROYA 3ZDUA 3KVWA 4IWPA 3ET7A 3PVUA 5FXQA 1PMUA 2OFVA 5HIEA 3BHTA 4CQEA 5GNKA 3TM0A 1FVRA 3FDNA 5J1WA 3Q53A 4I3ZA 3A7HA 4A4XA 4PMMA 4I92A 2FO0A 4BIDA 3QRTA 4HZSA 4FTRA 5AR2A 4O7SA 3ZO3A 3WARA 5IISA 4OR5A 3BBTB 3DOGA 4DAWA 3R00A 3QBNA 4U79A 1PXJA 2WIPA 3FLSA 3FHIA 4YLLA 3HKOA 4FIGA 4QO9A 5J8IA 4RX5A 3BCEA 5ITAA 3QZIA 4R5YA 2C6MA 2JD5A 3DAJA 2PUNA 4A9YA 2A98A 3FC2A 2ZM3A 2I6LA 3E7OA 3LFBA 4IM3A 2X7GA 1Q61A 5GJGA 3D5VA 5DT0A 4FT3A 4L00A 3ZEWA 4EOLA 4EQCA 4KIKB 1W7HA 4BDCA 2ETRA 4BBEA 4IHPA 5GIPE 2CN5A 2J7TA 4BCIA 4DE4A 3LZBA 4YMJA 4MWIA 3UP2A 5CSPA 2IVSA 5BVDA 5HORA 4ZIMA 2VO6A 3Q5ZA 1Q8ZA 2BHHA 4Y73A 2G9XA 1Q5KA 4G2FA 4YO4A 3V8SA 5LJJA 4FOBA 5J9YA 2IEWA 4IZ5A 3IW7A 3W0QA 3BELA 5H8EA 3ZM4A 2PE2A 3ZS5A 4CVAA 3UOHA 4BZOA 4RG0A 5JFWA 2R3PA 2RG5A 3RPSA 4F0FA 1RDQE 2UW4A 4XLIA 3TJDA 2X4FA 3OD6X 2J0JA 3U6IA 3T8OA 3EMGA 3V6RA 5H9BA 3JYAA 4YNEA 5JGAA 4QMMA 3NWWA 3W0NA 1ZYDA 3VBVA 4YBJA 3LMHA 5H8BA 2PMIA 3W2OA 1KWPA 5K4JA 2CJMA 3OWJA 3QQKA 4FGBA 4GCJA 5EDRA 3UTOA 4E93A 3C0HA 4MXYA 2YM7A 4FRFA 4IB1A 4OTDA 2ZV8A 5CI6A 5FP5A 4E6DA 4KKHA 1QMZA 3II5A 4FV5A 5IQGA 4O96A 5LMAA 4IDVA 4GH2A 3ID6C 3O7LD 5LVMA 4AT4A 4G31A 2R3FA 4FL1A 2GFCA 3NFGB 2ONLA 1R0EA 2BMCA 1PHKA 5B0XA 4AU8A 2IF8A 3C1XA 1UU3A 2JDRA 4GK3A 1B39A 2XNMA 2XK6A 5F1ZA 3KXNA 3HP2A 3PXKA 4BN1A 5EDPA 1ZOEA 2YZLA 5CS6A 3BBWA 5BX0A 4IXPA 4K18A 3D2IA 2R3QA 3H3CA 3NUXA 5EW3A 3VONA 1XJDA 4F99A 2F2UA 2VN9A 2W4JA 2WMSA 2GHLA 5AX9A 2XB7A 3ORPA 2JIIA 2BIKB 1SNXA 4NW5A 2ZAZA 4WO5A 2GNGA 2JKQA 3MFTA 2RGPA 2IVUA 4QP1A 2J4ZA 4TN6A 1GIHA 3V5TA 3U51A 4AGWA 5BVWA 3Q9ZA 4I21A 3VS5A 2OH4A 2WEIA 4ONAA 4MXCA 4GJ2A 3ZDIA 3AD6A 4O4FA 3GU4A 4FICA 5HTIA 3BZ3A 4YHJA 4EH2A 4NFNA 4FK3A 4U3YA 3UIBA 4JAJA 2J0LA 2ERZE 2YM5A 3EFLA 4GS6A 3OCBA 4C3PA 4BDGA 2VTRA 2FA2A 2ZMDA 4MQ1A 4L7FA 4PTEA 4ANMA 3CCNA 3MI9A 4RFYA 4AT3A 4O84A 2ZYBA 5IUHA 5HE3A 4GYGA 3NW6A 4O0UA 2OF4A 4GVJA 3R1NA 4RPVA 3ORKA 2QOIA 4CYJA 1LR4A 3EOCA 3GCVA 3MWUA 4LRJA 5HG9A 3VS4A 5HBJA 1Q41A 4R77A 5AIRA 2WB8A 5C4LA 2OI4X 3HUCA 2CMWA 3BEAA 4JIAA 4JX3A 1G8KA 3LOKA 3MFSA 4X6RA 4CLJA 4FZAB 2WU6A 3DV3A 4YC8A 3SDJA 2CNVA 5ETFA 2FYSA 4MXAA 5EFQA 4BDHA 4C59A 5LMBA 2PZRA 4FZ6A 2RKUA 3HV5A 3FEGA 2XBAA 4Y5HA 3RHXA 4BBFA 3HDMA 4EQMA 5FXSA 5HVYA 3DBFA 2PUUA 2VWVA 3BU3A 5DGZA 2BZKB 3RJCA 4I4EA 4AG8A 2ACXA 3QX2A 3DB6A 3QCXA 2C47A 5CU3A 4D58A 3E3PA 4CFFA 2X2LA 2B4SB 2OICA 2Z60A 4NW6A 1OI9A 3KRWA 3A62A 3MTLA 2WMXA 2W1HA 3E5AA 3Q96A 3QQUA 2UZEA 4AN9A 5K4IA 5LWNA 4RWIA 5D12A 3ODYX 5CSWA 3UODA 2GHGA 1TFFA 4ZJIA 3W33A 1U46A 1QPCA 3LVPA 1PF8A 3ORNA 1OITA 4YJNA 4D28A 2IZTA 4M7IA 5M55A 2WQBA 2QHMA 1L8TA 2XNEA 4O22A 2ZDUA 2WMWA 3R02A 4DT8A 4NSTA 1W84A 1PXLA 2YIXA 3LFAA 2PHKA 3PVBA 4BDIA 5JRQA 3MVMA 4DBXA 4FTJA 3QZHA 1ZZ2A 2XK4A 3ITZA 4P2KA 3BWFA 3R7OA 2NNWB 3U6HA 4FEWA 4X2FA 3W8QA 3EQCA 3E92A 3P1AA 1ZMUA 2VTIA 2WHBA 3PG1A 4ZTSA 4S30A 4E7WA 4IAYA 3P9JA 4KKGA 1GAGA 2X2MA 3KU2A 4F6UA 2UVZA 4C36A 2Z7QA 1VYZA 4FT7A 2NO3A 4HVHA 4DFZE 5KHXA 4W4YA 3G9LX 1M7QA 4QNAA 4F9BA 4CFVA 5A4EA 5A4QA 4BZNA 1E1XA 5KE0A 3VBTA 2WTDA 4JS8A 3A60A 4UB7A 3UQFA 3PLAE 3TL8A 2QC6A 1RJBA 5ACBC 4RJ5A 1YRPA 1OVEA 2C0TA 4ZSLA 1VLRA 1OUYA 4O2PA 5CVFA 3RNYA 4O4EA 3C4XA 3MJ2A 2C3KA 2XYNA 4DHIB 3Q5IA 3DK7A 1WVWA 3FYJX 4RIYB 4AXAA 1OMWA 2QONA 3E8CA 4YU2A 3G0EA 3NMUF 3NDMA 3COIA 4BKYA 3WE4A 5C26A 1Q24A 1G8SA 3U55A 4DGOA 5FGKA 1JLUE 1AQ1A 2XUUA 2P4IA 2C0IA 3GOPA 3H0ZA 2W05A 3K3IA 3VRZA 3KC3A 3OTUA 4ANLA 5DHJA 4DT9A 4F6SA 3UO5A 4PDYA 2WQEA 3B2TA 3R8VA 1WVYA 3MDYA 5K0XA 4A7CA 1WZYA 2YWVA 3AC5A 3UO6A 2X8IA 2XK8A 5L2QA 4LOOA 2WTVA 3V6SA 4C0TA 5J5SA 5A3XA 3KMUA 5K0KA 4PNKA 4KABA 3RHKA 5HTBA 3UC4A 5LQFA 5LMKA 3COHA 4V01A 3CS9A 2C0OA 3VRYA 3PPJA 4K9YA 4Z9LA 3PFYA 1XR1A 2EWAA 2OGVA 4AACA 3LKMA 1FMOE 4WNKA 2WMBA 1FOTA 3FLNC 3NYVA 1YWNA 4UZHA 5EYCA 3TKIA 4D1ZA 3BIZA 4R6VA 3BE2A 3KMWA 4RIOA 1Y6AA 3C51A 1APME 2ZDTA 2ZV7A 1WVXA 4KAOA 3N4VA 4GSBA 4MCVA 4DFBA 4TRLA 2OU7A 2XNGA 2XNBA 1YDSE 2UW6A 2C30A 4AZEA 5CU0A 3EQGA 4K2RA 5HTCA 3A4PA 4G5JA 1GY3A 3CR0A 2A4LA 5CU2A 3OF0A 1O9UA 4NKSA 3ANQA 3R01A 2JAMA 5DRBA 4PV0A 3GT8A 1VEBA 3OW4A 3VAPA 3WF7A 3GXLA 4O7NA 3WI6A 3M1SA 2YCSA 3K5VA 4E6CA 3O71A 3A99A 4Q2AA 3VS0A 2BRMA 3VUIA 1PXKA 5IQFA 2YIWA 4GW8A 4II5A 3B8QA 4NT4A 5CYIA 5L2TA 2G1TA 3TZ9A 3TT0A 4NTTA 2XCKA 2J6MA 5KZIA 3S2PA 5AR5A 3WZEA 1MQ4A 4FTAA 4BDKA 1J1BA 2F7EE 1K3AA 3JUHA 3LFFA 4YZDA 4X3FB 4E6AA 3FI3A 4FSZA 4CRLA 3EL7A 5KBQA 4KSQA 3ZYAA 4NJDA 4O7WA 2IZRA 2Y6OA 2GQRA 4UWCA 2R3LA 4FKRA 4RWKA 4C57A 1OL7A 3OCTA 4WD5A 4D4YA 5FTOA 4PQNA 2XKCA 4DG0E 3KK8A 2BDWA 4XBRA 5EG3A 2IW6A 1PRYA 3FBVA 2BZHB 3HV7A 4BDJA 2YLEA 5L6PA 4M14A 5BMMA 2XRUA 3HMOA 5KX8A 3CKWA 2IPXA 3NGAA 3WILA 4FTKA 4FTNA 4V0GB 4RIWA 4R5SA 4RLKA 3G5DA 4BCOA 4LYNA 4CTCA 3HMPA 4B4LA 1H1PA 3D15A 1W82A 2X2KA 4GIIA 3ZZEA 4RLLA 3BYOA 4J97A 5BPYA 4BI0A 3D14A 3F61A 1URWA 2BZIB 5G1XA 2OJGA 3LXPA 3F5PA 4QP2A 3L9LA 1PXNA 3F5XA 4XG2A 1W2DA 1YVJA 3HGKA 3L9PA 3LFEA 5LVNA 4O7VA 4AXEA 4GEOA 4ACDA 1TKIA 2V62A 2SRCA 2GNFA 2ONLC 2UW7A 3F2AA 2EB2A 2OZOA 2R5TA 4HJOA 5AP1A 3ENHA 5J95A 3CC6A 2RF9A 4IFCA 4M15A 4YBKA 5FLFA 5CAOA 2OXYA 3EYHA 3OW3A 4GU6A 4F9YA 4OW8A 4LDTA 1NXKA 5HBHA 2GNLA 4YSMA 2QKRA 4U80A 4TTHB 4GKIA 2C3LA 3P86A 4YLJA 3ANRA 5AUZA 4CFNA 4DEBA 4QP4A 4FEUA 3KRRA 2VGPA 4AP7A 4AOTA 1XH6A 4JBVA 2YISA 4UN0C 3DQXA 5M56A 3AT2A 1KE7A 3DKFA 3LCTA 4JNWA 3OHTA 4NM7A 4RJ8A 4ALUA 3FZSA 3R7UA 4CMTA 3L8VA 4FKWA 5J87A 3O51A 3OBGA 4NM3A 3O17A 1AD5A 3UYSA 5IQDA 3MIYA 1OL1A 3MESA 2R0IA 3VJNA 1GZOA 3W8LA 3FMHA 2WPAA 5FUTA 3A8XA 3DLZA 3DQWA 3EKKA 4PPAA 1Z9XA 3P5JC 3JR1A 4I6LA 2IO6A 3NVMB 1YWVA 4KIQA 4BCMA 2HELA 5D9HA 1ZLTA 4BTMA 2XAMA 4QYYA 5J9LA 2HWPA 2X81A 3PXQA 4AQCA 3P79A 3SHEA 1H8FA 1WCCA 4ZMEA 3D2KA 3DKOA 2RG6A 5E92A 4AQKA 4HGLA 3ZBFA 1SVEA 3EQPA 1YXTA 3VUKA 4AGDA 1GNGA 3BLAA 3EFWA 5AP7A 4YPDA 3DBDA 1PXPA 2HY81 3DJ7A 4IANA 2PVYA 3H4JA 3ML1A 2WAJA 5EQYA 2JDVA 3D4QA 5HLPA 2KULA 5A6NA 3TNPC 2J0KA 2XKDA 4FKTA 1SMHA 3R2BA 5HCYA 4F09A 4EOPA 4GL9A 3BYUA 2A27A 3EFKA 3H9FA 4TYGA 4AOIA 3VHEA 3GFWA 4O6EA 4XRJA 1ST4A 5M08A 2WMTA 3OMVA 3W55A 5AAFA 1ZAOA 3DK6A 4IZAA 3MH3A 3QGWA 1FINA 3QQFA 4F9WA 5C8NA 2YCRA 1S9JA 2YWPA 3ZLSA 4QRCA 4AZTA 3G6HA 2JITA 1CKJA 3OUKA 3SD0A 4QP3A 3UZTA 4BBMA 4DGLC 1YI3A 5HX8A 2OJJA 3DTWA 3OOMA 3KULB 1JKSA 4FIHA 4GFMA 4YGAA 3IDCA 3UNZA 3ZTXA 2O8YA 4F9CA 2E9OA 3K5UA 5AP6A 4C4IA 5BQ0A 4NCTA 1CKIA 4N57A 4Y85A 3TUDA 3Q6UA 4DN5A 5GJDA 5JFVA 1GIJA 1BYGA 4IVCA 3ACKA 3POZA 3QD2B 3QWKA 4MWHA 4ANSA 4PF4A 2CKEA 1YW2A 4EHEA 4BR3A 3PA4A 3AC4A 4AFEA 4C4HA 4DEIA 1A48A 2EUFB 4LL0A 5CZHA 4DFLA 4I6FA 4XS2A 2FSLX 5DR6A 3UGCA 3Q9YA 1H24A 1W2CA 3LM5A 3R8UA 5M53A 4XNEA 1Q8WA 4R3RA 2X9FA 4L42A 4UX9A 2REIA 3KXZA 4RJ4A 4FTMA 5G6VA 3NW5A 4TPTA 2G2FA 2C6IA 2W4KA 3PIZA 3Q9XA 3LW0A 3CTJA 4RJ7A 3MPMA 3MW1A 4C7TA 2I0EA 5A54A 2XJ2A 4JDJA 1A06A 5AV0A 5CEPA 3EJ1A 2WOTA 4TWNA 4ASEA 3OXTA 3FV8A 1E9HA 3F5UA 2B1PA 3IS5A 3PE1A 1SNUA 4J1RA 1W98A 2VD5A 1G5SA 3LCOA 4M68A 4O0XA 1TQPA 3PIXA 3AT3A 4DG3E 4DC2A 2JDTA 2WELA 3MS9A 3UG1A 4QQTA 5HE2A 5DE2A 1OKYA 3GC9A 4QYHA 5KZ0A 3NYNA 3FUPA 5HEZA 4EK4A 3ZM9A 5EKNA 3I6UA 4IAZA 3MB7A 2RSVA 4E4XA 3RMFA 4FNWA 5EKOA 4WBOA 3RM6A 4M67A 4DLJA 3QUEA 5LWMA 3TYKA 5DFPA 5IA5A 2YJRA 4GT4A 4JDIA 4P90A 3BQRA 2UV2A 4CCBA 3GCQA 3G51A 3CJGA 1M17A 2J9MA 3HLLA 3PY1A 4FTQA 4O4DA 4EH5A 2Z7RA 5IA0A 4EOJA 1JSTA 4EOQA 3E8EA 4GK4A 2YLFA 3QX4A 4GKHA 4RX8A 4WNOA 1CDKA 3NYXA 3NNUA 3CGOA 2QOQA 5IA3A 3DDQA 3HL7A 3I0OA 3IONA 3OOGA 4J99A 1EH4A 4Q5HA 5IQBA 1K9AA 1V0BA 2WU7A 3UOKA 2XK3A 1NVQA 1W0XC 4EORA 2FSTX 2VWIA 4NIFB 4LGDA 4FV8A 3LJ1A 3WF6A 3RGFA 5HBEA 3VIDA 2ETMA 3T3UA 3WYXA 2UZVA 2PUIA 2XEZA 4GMYA 5KUPA 1Y8YA 5FD2A 5B2LA 4MBIA 5HNIX 4D9TA 4HNIA 5GJFA 3KXHA 5TOZA 4OTQA 4BFMA 2EXEA 1WBOA 4DHJA 4FV4A 4Q5EA 5EM7A 3CJFA 3E7VA 5AIKA 5E8SA 2HAKA 2HCKA 2BHEA 3RTPA 1KE5A 3DJ5A 3CD8A 2QHNA 4BDEA 3S95A 5CLPA 3VUTA 4USFA 5BVFA 5IDPA 1Q97A 2C68A 5LVOA 4OTFA 3PUFC 5HE0A 2UW8A 4FI1A 2XM8A 2C5XA 4RMZA 5EOLA 4LRMA 3U4UA 4O0SA 4E20A 3AMBA 4XG6A 4FC0A 3NRMA 3ZFXA 5JKGA 2OFUA 5FQDC 1KE9A 4N70A 5CSHA 3KVXA 5EW9A 4XOZA 5DVRA 3WE8A 4ASZA 1PXIA 3RCJA 4JXFA 3FLYA 1H07A 2VTJA 4Z7HA 2XALA 5LCJA 2IW9A 5HVKA 5CQUA 2IVTA 2FUMA 1FGIA 4TYJA 3RM7A 4C62A 2DUVA 2C1BA 2UZTA 1H01A 2VUWA 1FMKA 4JX7A 5JQ8A