4NW6A

Rsk2 n-terminal kinase in complex with 2-amino-7-substituted benzoxazole compound 27
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
309
structure length
302
Chain Sequence
AITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPTFYFDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Ribosomal protein S6 kinase alpha-3
publication title 2-Amino-7-substituted benzoxazole analogs as potent RSK2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 302
sequence length 309
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4nw6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4nw6A01
4GFGA 3DJ5A 5KKRC 4MQ1A 4JG7A 1VYWA 2IZUA 2PZIA 2Y6OA 2YIXA 3QQGA 5C4KA 3KF7A 4FL3A 4WBBB 4BDGA 3UMWA 5F4NA 2G15A 4NTSA 5AA8A 2FB8A 1KE9A 4RJ4A 3UO6A 1H27A 3UQFA 1SVHA 3FMLA 4HCUA 5D10A 2FSTX 4GEOA 3RPOA 3DT1A 2OI4X 2Z60A 4WG3A 2X4FA 4R1VA 4DFUA 3E5AA 4L01A 2WQMA 1UKHA 2OIBA 3L8SA 4UMTA 3VW6A 3O50A 4DH7A 5M4FA 1B6CB 3PVGA 3RK9A 4BI0A 2J7TA 1WBVA 1Q41A 3RTPA 2W9FB 1W84A 5I9WA 3KQ7A 3PG1A 3F61A 4OBOA 5CU2A 4G6LA 3CCNA 5ANOA 1ZYLA 3OUNB 2ZYBA 3AGMA 4AWIA 2YIWA 5TOZA 1AQ1A 2RFSA 2WQBA 4G34A 4CG9A 3Q04A 2YM5A 5JQ8A 2PUIA 4OT6A 3N4UA 3AGLA 4ZP5A 2C6OA 3O71A 2QOQA 2RGPA 2WMXA 4LYNA 4Q2AA 4S34A 5HBEA 2WFYA 3F3VA 5EK7A 4DH1A 4N57A 2QURA 2WZJA 4DEAA 5CF8A 1JOWB 2YCFA 3OOMA 4LUEA 5HIEA 5CTPA 4E7WA 1E1VA 4I5PA 3AD6A 4RMZA 4DAWA 5L2SA 1JBPE 5IDNA 3LCTA 3DKOA 4E6QA 4MNEA 3PY1A 3EYGA 2R2PA 4C8BA 1H1QA 2BAQA 3CPBA 3ZDIA 1WMKA 3GCPA 2RG6A 4OLIA 2WTDA 1PXMA 4FSYA 4UWYA 1S9JA 3ZM4A 4CFMA 3OVVA 3IDPA 3DU8A 3NMUF 5DFPA 4FVPA 3REPA 3V5QA 2ITOA 2WD1A 2RFNA 3FI4A 3MYGA 4PDSA 4RWJA 3R9RA 2ETRA 2V0DA 3AMYA 3PSBA 2PE2A 5DE2A 4PV0A 3TJDA 4BYIA 3LCOA 3Q4CA 5JGBA 4DEEA 4UMUA 4AOIA 1M17A 3LJ2A 1Q61A 2YCRA 3F7WA 4QP2A 3PVUA 4XV9A 4JQ7A 4GL9A 2V62A 3R9DA 5T68A 3LJ1A 2H6DA 4MWHA 4WKQA 4LQMA 4CXAA 2NRYA 1W7HA 1Q4LA 1LPUA 2IZTA 2PMLX 2G01A 3NSZA 3ZC5A 3AC5A 3TTJA 1I44A 4XP0A 4RQVA 2QCSA 1AGWA 3ZDUA 5IA3A 5DYJA 3PIZA 5TR6A 1GIIA 3FI3A 1J3HA 3O2MA 4U8ZA 3Q2JA 4M68A 1WFCA 4IX6A 1UU9A 1XQZA 4X2NA 4YLJA 5BVWA 3B8QA 1CM8A 5EKOA 5E9EA 4AAAA 2X39A 4OBQA 2PHKA 3QF9A 3F5UA 1Q8ZA 5A4EA 3OW3A 2UUEA 2QQ7A 2WMRA 3FKLA 4TN6A 4E93A 4BTFA 3SLSA 5BVOA 2BZIB 3S1HA 4X2KA 1WBSA 3WBLA 2RF9A 3QTUA 5FEDA 2G2IA 1J7UA 4JX3A 1WZYA 4UYAA 4M12A 5HG9A 2QNJA 3P5KA 4A9TA 3G90X 1H4LA 2GS6A 2GHGA 5ICPA 4X3FB 2IW9A 4QOXA 4DFLA 4GV1A 2QU6A 2J9MA 3BWFA 3DBDA 2XH5A 4RC4A 2XF0A 4OR5A 4DCAA 4EOKA 3WARA 2VO0A 3HNGA 4FV0A 3GVUA 4JDIA 4MHAA 3UO5A 5CT7A 4TY1A 2YISA 3MPTA 5A6NA 1NW1A 1JWHA 2XJ0A 2VTQA 5HU3A 5AP6A 2QOKA 1ZMUA 2PYWA 2IJMA 2YLFA 3QQFA 4GUBA 4II5A 5FP6A 3SDJA 2I7QA 4DA5A 4ORKA 3AD4A 2BAKA 2ZV7A 2QD9A 4MBJA 3BU3A 2CGVA 3I5NA 2XKCA 3TZMA 2WO6A 4YMJA 3LW0A 3Q4ZA 2C3IB 3B2TA 4PTEA 4XRJA 3PXKA 1UU8A 1VZOA 3GFWA 4RSSA 5IA2A 3KRWA 4FV9A 3FL5A 4JR3A 3MH1A 4GU9A 4RRVA 1U5QA 4QYYA 4LGGA 4M0YA 5FTOA 3TV7A 2F57A 1UWHA 4IBMA 4O7RA 4IB1A 3LMHA 1ZAOA 3VS7A 4KABA 3IDBA 3DBQA 3OBGA 4FG9A 4LG4A 1H01A 3QCYA 3I0OA 4NCTA 2WTKC 3SD0A 2X8IA 4YSJA 2CGXA 3FAAA 4MWIA 4WBOA 2GTNA 2IW6A 4EOQA 3CS9A 3KXZA 4MK0A 4Z3VA 2QOFA 4BRXA 1T46A 3R22A 5B2MA 4XOYA 2Q0NA 3DXPA 4J53A 3MY0A 3O51A 2W4KA 5CENA 4XLIA 5BVFA 5CALA 1H25A 3ORLA 4XV3A 5J9YA 3FQEA 4EJNA 4MEDA 4F1TA 4L7SA 2PY3A 3TUDA 5BUIA 1FMOE 2W9ZB 3Q32A 4QP3A 4YJVA 5L2QA 1CTPE 4DG3E 3DAEA 4JBOA 4DHFA 1M7QA 5AV1A 1TQMA 4RVKA 3SRVA 3FMKA 3SA0A 3U87A 4L42A 5KMMA 5CWZA 2ZV8A 3LQ5A 4U9AA 3R7YA 3EFLA 3WF6A 5H8GA 2RFDA 3NS9A 3PE1A 2GSFA 4G2FA 4IXPA 1Q8YA 3HUCA 4MXYA 3G5DA 1OIRA 2BAJA 3MFSA 3U4WA 2ZVAA 3PRIA 4R5SA 4QPSA 4E20A 1JKLA 5LCKA 4QQ5A 3E64A 4FKLA 2WMBA 4QP4A 4K33A 3C0IA 5JFWA 3Q5IA 5CLPA 2O3PA 2OJ9A 3LFCA 4FYOA 2BR1A 2VTNA 4IWPA 2XBJA 1J1BA 1O6YA 5GJDA 5DA3A 5D7VA 4NYEA 5IEXA 2PULA 2HY81 3QUPA 5EDPA 2YAKA 4G3CA 5M51A 3MH0A 4BCOA 4JDKA 2R0UA 4LI5A 2C6IA 3L9NA 5LJJA 3PJ3A 4O7ZA 2X2MA 3HMOA 2XEZA 3G9NA 4RQKA 4V0GA 4J95A 5D7AA 3R21A 3DAKA 2VWXA 4MCVA 3IONA 2YM7A 2RKUA 4G3EA 4IZ7A 4G3FA 5CXHA 3S0OA 3K2LA 3RJCA 2PK9A 4A4OA 3KMMA 5ANDA 3TN8A 3EQCA 4D2WA 5JMSA 3EQFA 3GI3A 3QZIA 4RA5A 5HG5A 4XS2A 4FKRA 3UQGA 2OZAA 1MRYA 4QP1A 3UE4A 1IAJA 3UNKA 4GKHA 3OWPA 1F5QA 3LLAA 5EW8A 4A7CA 2ZM4A 3NYVA 4EH6A 4L45A 1U59A 2JC6A 3JVRA 4I4FA 3QX2A 4Y5HA 1WBNA 4RZWA 3BGPA 4XNEA 1R39A 1R78A 2R3JA 1FGIA 3W33A 5BPYA 4MQ2A 2OO8X 3GNIB 3D15A 1O6LA 3KXNA 4Q9ZA 4ZSGA 1NY3A 2BDFA 4QQCA 4BCIA 5CU0A 1XH9A 3NYXA 3I7CA 2QG5A 4P5ZA 5FBOA 3DAJA 3RK5A 3V51A 2GQGA 2HZNA 3ORPA 3PIXA 3WE4A 4DGNA 4DITA 4ZLOA 5DBXA 2J0LA 1HCLA 5LMBA 4OW8A 4E6AA 4PMPA 3QLFA 4NSTA 3ENHA 1Z5MA 1L3RE 5CNOA 4CT2A 3Q6UA 4AA4A 3FZ1A 4KNBA 4W4WA 4IB0A 4AGUA 3CKWA 4BCFA 3W8LA 3VUGA 5K3YA 3K3IA 4IE9A 3W18A 3LM0A 5LWNA 3ZH8A 3BBTB 4Y46A 3FHRA 4JNWA 4JOAA 3SKCA 4ID7A 2UZVA 3QD0A 4BWPA 2OICA 3MGYA 4IIRA 2VTJA 2VX3A 3AC3A 3DQXA 2OXDA 4XP3A 2F2UA 2KTYA 4M0ZA 5AR2A 2E2BA 4KS8A 5L2WA 2WXVA 2XK8A 3VQUA 3Q9WA 4I6BA 2WMWA 4O0VA 2Q0BA 2YJRA 2WAJA 3OWLA 2WTIA 3QD3A 5LWMA 2FYSA 3W8QA 2W1GA 3NNWA 5HVJA 2B9FA 3OROA 4CG8A 3ZUTA 5HG8A 3ZO3A 2C3KA 3AOXA 3ANRA 5EKNA 3IOKA 1X8BA 5H3QA 4M69B 1XH6A 4TW9A 5LVOA 3GU6A 1OKWA 4FTJA 4BBMA 5A14A 3MBLA 4OTFA 2OLCA 4FSNA 4TKSA 1CKJA 1PRYA 4EUUA 4D5KA 5HNIX 5E92A 1W8CA 4APPA 4KWPA 1PXJA 2QOOA 5GIOE 2VV9A 1W82A 3LIJA 2GNFA 2VWYA 4Q9SA 5H8BA 3D2KA 5DT3A 1YHVA 2JIVA 4JX7A 3ORXA 4AACA 2FVDA 2ITTA 3RHXA 5HTIA 4O0SA 3QCXA 1PMEA 3ORKA 4KIPA 4BZDA 2QKRA 4RJ6A 3ORZA 3K3JA 3F5PA 3UJGA 3CTJA 5J95A 2G2FA 1R0EA 2UZEA 2QVSE 4TYJA 4XHKB 2XK3A 5JRSA 3UVPA 2P33A 3OF0A 3R8PA 3VW8A 3COHA 4EOOA 5DEWA 2UW4A 3VUKA 4BBFA 3LKMA 4KKGA 4CSVA 4HGSA 2IPXA 3R30A 2OIQA 5IA5A 3VUIA 5D41A 2DUVA 2CLXA 4IQ6A 4UEUA 5M55A 5KKRB 3LXNA 5ANGA 3JS2A 4BDKA 5M08A 4L6QA 5EI2A 4D9UA 3KXGA 4FTRA 1ZOEA 2EB3A 3LE6A 3A99A 4LOQA 3A4OX 4ACCA 1JQHA 4P7EA 4QYHA 1H0VA 2G2HA 1Q97A 4KAOA 5K5NA 5M53A 4QPAA 3E8CA 3R1YA 2F7XE 5E1SA 4BTJA 2OK1A 4G17A 4IZ5A 3U9CA 3A8WA 3EN9A 3N4TA 4R8QA 3UTOA 3I4BA 2OJJA 4YGAA 4EHVA 4EOLA 4N6ZA 1WAKA 3R7GA 3ZM9A 3FMEA 2GMXA 5F1ZA 4RFYA 4ZTHA 2WOTA 5IU2A 3IW8A 2UV2A 4IM2A 4E8AA 1IAHA 4C33A 4GFOA 5HEZA 3HZTA 2QG7A 3LVPA 4G3GA 4QP8A 3F5GA 2HZ4A 1G5SA 3SVVA 2CSNA 1LP4A 3AT4A 4D28A 4IJPA 2VU3A 4BDFA 4PRJA 4IJ9A 2C0OA 2PL0A 1XWSA 3DTCA 2QI8A 4ZMEA 5KCVA 2XP2A 3MIAA 3G0EA 3WZEA 5FP5A 3UC4A 1Y6BA 1YQJA 4K11A 5JGAA 3LMIA 2OFUA 5A4TA 5JSMA 4ZJJA 3UNJA 4H3QA 4R78A 2Z7QA 3H9OA 3TNWA 1Q3DA 3KRLA 3QRUA 3VJNA 5E90A 4F63A 2XIXA 3R9NA 4ITIA 4F7LA 4FIJA 3L9PA 2XA4A 3LM5A 4YJTA 4E73A 2YZLA 2YM8A 3QD2B 3QHRA 4RPVA 5KNJA 3MFRA 3GUBA 5CEMA 1RJBA 2PVYA 3NVMB 4UXQA 5L6WL 3WOWA 2CKQA 4JQEA 4FIFA 4B7TA 3E7VA 2ONLC 4DINA 4AG8A 4OTWA 4YHFA 1UNLA 4O7SA 2CKPA 5IQEA 3EQGA 5JZJA 4R1YA 4DEHA 3JPVA 2ETKA 5EI8A 4E5BA 1NVQA 2C68A 4EI4A 5BVDA 2VX0A 2QC6A 4RIYB 4L3JA 2IVTA 3WYXA 1MRUA 4HYHA 3DY7A 5BVKA 2YCSA 3A7IA 2EB2A 4OTHA 5AR8A 2XK7A 3MIYA 3FXZA 3ZYAA 4BCMA 3W55A 3GCVA 1OKZA 3HRBA 5DEYA 3D7TB 3ITZA 2RL5A 3G0FA 1YXXA 4TPTA 3V3VA 5I3OA 3V5JA 3PG3A 4ERKA 5KMIA 4FIIA 1JSUA 3F6XA 4A07A 5KBQA 1ZYJA 2J50A 3CY3A 3ZBFA 5CQWA 3D94A 4FKJA 4ALUA 5CAPA 4U3YA 3E62A 4YHJA 4L46A 4EH3A 3SW4A 3UZRA 2ETMA 3R8LA 4BKZA 5EYDA 5ITAA 2PVFA 3Q9ZA 5J87A 2UVYA 2JKQA 4FKSA 3TM0A 2W17A 2YM6A 3KVXA 4EYMA 4ANQA 4C3FA 4DBNA 4EHGA 3HMNA 3EWHA 4RIXA 2C3LA 3FZRA 4YJUA 2OJGA 3KK8A 2BDJA 3P4KA 5HX8A 1YI4A 4QRCA 4YU2A 4RFZA 1EH4A 2HK5A 3RBWA 4D4RA 3ATSA 4F70A 5AAGA 2QOHA 3IO7A 3MPMA 4TWPA 3QCSA 3W2PA 4IAZA 4NL0A 1PXIA 2VGOA 4MKCA 3O17A 2PVKA 4J97A 1M2QA 2IW8A 3PYYA 4HOKA 3G33A 3DJ7A 4IHPA 4IW0A 3TL8A 3A7HA 4ACMA 3RNIA 4C4HA 2VD5A 2WTVA 4MXOA 4RC2A 3R8UA 3GC9A 4JRVA 4YNOA 1BYGA 2PVJA 1G3NA 3QA8A 4M8TA 3IW7A 2XNBA 2IZSA 4ANNA 3BHUA 2VNYA 4MH7A 3EJ1A 5ETFA 5EQYA 3MDYA 4FV7A 3BLHA 3MPAA 2CMWA 5ETIA 5T3QA 3G6GA 4AOJA 3OS3A 4YZNA 3TNHA 3II5A 4TYHB 2PZRA 3BPRA 4TXCA 3CPCA 5A4LA 5JGDA 1OI9A 2OBJA 4JVGA 4P5QA 4C7TA 4BR3A 2X6EA 4L7FA 4P2KA 1B38A 1KE7A 2QLUA 2WTKB 4OBPA 4I22A 4R7IA 1GIJA 4WSYA 5DT0A 4ZTSA 2J90A 4J99A 5HGIA 3ZHPC 4CV9A 5HORA 4UB7A 4Y85A 4X7QA 1H08A 2WIHA 3EL7A 4FTTA 2OH4A 4J7BA 4IM0A 4RFMA 1Q62A 3AC1A 3DBFA 3FXXA 4ZTNA 2R5TA 5HTBA 1XBCA 3MA3A 1R3CA 4BGQA 2HIWA 5IUGA 1WBWA 4PMTA 4C35A 3UC3A 3TKUA 2B7AA 3R2BA 4U5JA 4AW0A 3LFBA 4GT3A 3GU8A 1XH5A 4LRJA 1G8AA 5E4HA 4HZRA 2CKOA 4XRLA 5E8WA 3SV0A 4DN5A 3PA3A 2PTKA 1LR4A 4W4YA 2XM8A 3KB7A 3VHEA 3GOPA 5IH4A 2ITVA 2RSVA 2VTOA 2XNPA 4FV8A 2OW3A 3R0TA 4U3ZA 4D2TA 5CS6A 2QLQA 2YERA 4HVDA 5CEKA 3TXOA 4EHEA 2HW6A 4IDVA 3MN3A 5E8TA 4BDBA 3F9NA 5AP4A 3NZ0A 5AUTA 4Q5EA 2ZAZA 4EYJA 4HJOA 4CRSA 1YDTE 4I93A 4FZ6A 4PF4A 4RIOA 5KMLA 5M09A 5D9HA 5IQFA 5C1QB 5M4IA 3HMPA 1YRPA 1WVWA 3V8TA 1OECA 1JSVA 3FXWA 4RWLA 4AZTA 4GT5A 4N70A 4XX9A 3BIZA 3TEIA 4CFXA 5JK3A 1GZ8A 4BCNA 5L8LA 4DTBA 1P5EA 3O7LB 4FI1A 4U97A 5I9UA 3WZJA 3U6IA 5HE1A 2YAAA 3RZFA 3JR1A 4G6OA 3NW5A 3DTWA 3EZRA 4GJ2A 2CNUA 3ZS5A 4PTGA 5FM2A 2XNMA 2UZBA 4F65A 3NIZA 5TE0A 2X0GA 4XOZA 5C9CA 5K9IA 3H10A 5GNKA 3DB6A 4PUZA 3O0GA 2A0CX 2F49A 1XH8A 2WEIA 3AXWA 2P3GX 2XRUA 5EOLA 2BZJA 3IKAA 4L67A 4OT5A 5CSHA 3QX4A 5CI7A 3E88A 4ACHA 5ANJA 2VWIA 5CF6A 1YOJA 4RX8A 1IRKA 3HMMA 3DNEA 3QRTA 3K54A 4MAOA 3VRYA 4DTKA 2EXMA 2BROA 3D5UA 3QTQA 3EN7A 4ANMA 4UWBA 3KRXA 2X81A 3LFDA 4GK4A 3R7EA 3DK6A 5M06A 3C4WA 3GU7A 4ENXA 1DAWA 4FEUA 2A1AB 3T8OA 5LVNA 1PW2A 4L3LA 3EKNA 5L8JA 4KIKB 2X7GA 3CGOA 3QUDA 4BDJA 4I5HA 1OITA 4MX9A 2YM3A 3Q2MA 2QR7A 4YPSA 1XBBA 4ZSEA 5LMKA 1SVGA 3FY2A 2ITUA 4WHZA 4RBLA 4DGLC 2CKEA 2FSLX 4XYFA 5E8ZA 5HE3A 4RWKA 3ZXTA 4EL9A 3MA6A 4H1MA 4I21A 1ZZ2A 3EQIA 3OY1A 4TYEA 3SHEA 5A54A 4IAKA 4U81A 4BTKA 1DM2A 4H3BA 2BILB 1ZZLA 5DGZA 5AM6A 4C57A 5CAUA 2I6LA 5FM3A 4PTCA 5F9EA 4RVLA 5HICA 1XO2B 1H26A 2OJFE 1OKYA 2IWIA 5FDXA 3TACA 1O9UA 2BTSA 1SMHA 4YJQA 1F0QA 3LCKA 3ZLWA 5LARA 4NM0A 3VIDA 4IFGA 3W10A 5FEEA 2ITWA 4ALVA 4IVAA 5KBRA 4FV4A 3UO4A 4EKKA 3KRJA 4EBWA 3UOKA 5DG5A 4EBVA 3B2WA 3C4EA 3FMNA 4XP2A 3E8EA 4RG0A 1GY3A 3RAIA 3RWQA 3I5ZA 3MS9A 3BU5A 1KWPA 2PMIA 3LFFA 3ORTA 4XMOA 3LXKA 3W32A 4BTMA 3LOKA 3D9VA 4DLIA 4YC6A 1JLUE 3ODYX 3GXLA 4AW2A 3L8XA 1XBAA 3ZO2A 3NUNA 3OOGA 3ZFMA 2YWPA 2REIA 4F7SA 1OB3A 3F88A 5GJGA 5DRDA 4G3DA 1ZXEA 5CU3A 3TCPA 4ZJIA 4QMOA 3SG8A 4DLJA 3VBTA 1BMKA 2C6LA 3U9NA 4QMQA 3G15A 5ANEA 4RIYA 5EYMA 4JG8A 3RWPA 1H0WA 4AZFA 3FDNA 3ROYA 4YZCA 1IG1A 3AMBA 3C5UA 2CDZA 2YDJA 3EOCA 3QC9A 1PKGA 2ITYA 4HGEA 4NFNA 3TTIA 2RFEA 3VJOA 1KOBA 2P4IA 2XK9A 4QMYA 4K9YA 4X21A 2B9JA 2R3RA 2V22A 1YW2A 2W1DA 3DFAA 3KFAA 3MFUA 5HD7A 3RPSA 3UVQA 5K0XA 4BDHA 4XH6A 3ZRKA 3E3PA 4EK6A 4C36A 2QONA 4I23A 4C59A 2W0JA 4FTKA 5IUIA 4AZEA 4CNHA 1J7LA 4RIWB 4YJRA 5EOBA 1ND4A 3TV4A 4J52A 4AGWA 2C0IA 2VO7A 4L44A 5EDQA 3RP9A 4C4FA 4PDOA 5LMAA 3DXNA 5GZAA 2JBOA 4USDA 4Y83A 4AT3A 2BFYA 3EL8A 3HL7A 3NRMA 3VVHA 1DI9A 4XV2A 4BHZA 4NEUA 4AT4A 4IWOA 2C47A 3F82A 2XNOA 2J6MA 3HMIA 5EHYA 5IISA 4HGLA 3CEKA 2YCQA 4KINA 2R3FA 5K5XA 1Q3WA 3BYUA 5AUZA 3CP9A 4ZJVA 4FGBA 3PZHA 4O0YA 1ZMVA 4EOPA 3R00A 2W4JA 3F7ZA 5E8VA 2J4ZA 4PNKA 3FEGA 3ZU7A 3OCTA 2C1BA 3CR0A 3IOPA 4RJ5A 3LXLA 2OXXA 4FL2A 4W9XA 4BDEA 5CVGA 5EHOA 1ZYCA 1IR3A 2Z02A 4FSRA 3P1AA 4F7JA 3CD8A 5I3RA 4QMMA 4I6FA 4WT6A 1Z57A 2O8YA 3NPCA 2XYUA 2UW9A 4GG7A 5IG1A 4FGRA 4L53A 3Q96A 3QU0A 2VTIA 3T3VA 5HZNA 4CLIA 1YI6A 3THBA 1LUFA 2PVNA 3QZHA 3BQRA 2ITXA 5DWRA 2UZTA 4O0UA 3BWJA 4AX8A 2VO3A 4R6VA 1KOAA 2ERKA 2QOLA 3OCSA 4JQ8A 4P4CA 5HCXA 4B4LA 1U4DA 3NUPA 1PXLA 1G8SA 3QGWA 4BCGA 3GC7A 2F9GA 4ZZMA 5LVLA 1YDRE 5EDRA 5JN2A 3DNDA 4QMZA 4G9CA 5K4JA 4UMPA 3Q9YA 5KMJA 1RDQE 2P55A 2OF4A 2VAGA 3GC0A 4LUDA 4IVBA 5IA0A 4QT1A 4ZS0A 3ET7A 2WMVA 2I0HA 4KS7A 4CCBA 2BZKB 2WTCA 4FTUA 4FV1A 5KHXA 5HE2A 4D2RA 3V01A 4UMQA 1QL6A 4MBLA 1SYKA 4EOIA 4J8MA 4FTMA 2LGCA 2VO6A 2PUPA 3VNTA 4DEIA 3MB6A 1SZMA 2FH9A 3SXFA 5L6PA 4PL4A 1Q5KA 3ORMA 5J5TA 4C34A 3KK9A 5ANKA 4JG6A 5AFVA 2P2IA 3OWKA 4S31A 1V0OA 4UZHA 1YOMA 1BI7A 3DB8A 3RINA 5JH6A 2R3LA 5HCZA 4YO4A 1PXPA 3C4CA 3AG9A 2PSQA 3P7BA 4FTIA 2R7BA 2GHMA 4FSTA 3U51A 4AZWA 4QTEA 2PUNA 2YIYA 4NM5A 2R3GA 5CXZA 4L8MA 2R3QA 4B6LA 2EXEA 1WVYA 3W1FA 4D1ZA 1WBOA 4GIHA 3JUHA 1UNHA 3QZFA 4OTDA 3RAHA 2B9IA 3LFQA 5L2TA 3VF9A 2A4LA 2CGWA 5KHWA 5IQHA 5LVPA 1QPDA 2R0IA 2RIOA 3DQWA 3QQUA 4IX3A 4KD1A 4F6SA 3OT3A 1U54B 4EJ7A 2IG7A 4YBKA 4WIHA 4EC8A 4E4MA 4FV2A 2C6EA 2IVSA 4W8DA 3ENMA 3DZQA 1CKIA 2CN8A 4DGGA 4FBXA 2XKDA 4PDPA 3ZLXA 3R2YA 3H0ZA 4FA2A 4OTRA 3TUBA 3EQRA 4R5YA 3CSVA 3COMA 3GU5A 2YDIA 2WU7A 1OMWA 3FWQA 4IDTA 2PZYA 4NIFB 4KSQA 3ZRLA 4PP9A 2VGPA 4K8AA 4QMLA 3WIGA 5E91A 4PPAA 4X0MA 4FKIA 4I5MA 2X1NA 1K3AA 3BEGA 3LJ0A 4X6RA 5AIKA 3ZONA 1ZWSA 4I20A 5IF1A 5F95A 5AV0A 3ROCA 4ZIMA 2O0UA 3FLYA 4FKVA 4KBAA 4WSQA 4F6WA 3P9JA 3UP7A 3FMDA 5IEVA 2GTMA 2YA9A 3PXQA 3S00A 4AZSA 5BNJA 2QKWB 3D14A 3MY5A 2PU8A 4C4EA 3FL4A 2ZV9A 3LFAA 4FG8A 4NCTC 2VTRA 3F69A 3KVWA 5EW9A 3GU4A 5KE0A 3VBXA 1YWNA 4C3PA 5IMEA 1A48A 3MJ1A 4M14A 5AP2A 4O83A 1YHSA 4WG5A 5TKDA 3H3CA 3DOGA 4KIKA 3KN5A 4QTCA 2I0EA 3EN6A 4ZMFA 3BLRA 3ZSGA 4CMUA 2F7ZE 5IQBA 3R7VA 1JKTA 2V5QA 2YEXA 4J1RA 2QOCA 2OFVA 3CBLA 5HOAA 1XHAA 4NFMA 4F1OA 3HEGA 5BMMA 3QKLA 2GQRA 5C4LA 3EMGA 2OG8A 4EZ7A 3MVJA 3QC4A 4FV3A 1FBNA 1YXVA 3KMWA 4WUAA 3EQHA 3FLZA 4O0WA 1SNXA 3MVMA 4M7IA 4RZVA 4TWOA 3BU6A 5JFSA 1URWA 1PY5A 1H28A 4BFMA 2JLDA 4JAJA 1P14A 4JDHA 4FT7A 4XG6A 5DRBA 4D4YA 5AV4A 5EFQA 5CX9A 4USFA 5HO8A 4FYNA 3ZC6A 4EK5A 2YIQA 4Z7HA 5L2IA 5GJFA 3IW6A 3IGGA 2GU8A 3PJ2A 5DN3A 5AJQA 3JYAA 3VAPA 1YDSE 2QO9A 3CTHA 4E4XA 4F08A 2Z2WA 3GC8A 5LCJA 3DJ6A 3VHKA 2XJ2A 3V5PA 5ETCA 3UYSA 4J96A 2QO7A 5HCYA 1M7NA 2GNGA 3NCGA 4I24A 3C4FA 4UALA 4I92A 4D58A 2BHEA 5FTQA 4GW8A 5GZ8A 2VNWA 2JAMA 1FMKA 2JITA 1B39A 3BE9A 2BDWA 3OHTA 4CRLA 3QBNA 2EUFB 4CMTA 3QRJA 3CGFA 4DGMA 5JFVA 5IDPA 2B52A 1BL6A 4DF3A 3DK7A 3ZRMA 4O6LA 1OBDA 4QMUA 4E5AX 3AC8A 3CTQA 3ANQA 4QMWA 4CFVA 3U6HA 2W1ZA 3PIYA 4HGTA 4ASEA 1TVOA 2VZ6A 4K2RA 1TQPA 3Q60A 4CVAA 3CQWA 4CFUA 1YVJA 5CEQA 2VTTA 3KCFA 2QHMA 1PF8A 4WO5A 4FKOA 3D5XA 3W2CA 3BYOA 1OGUA 3FZPA 4QYEA 4RJ8A 2W4OA 3VO3A 2HENA 4JJRA 5CSWA 4ZS4A 3LZBA 4Y5QA 4R3RA 5K4IA 3VUHA 5EH0A 5EYCA 3PJ1A 5HKMA 1ATPE 3F2AA 1GZKA 1M14A 3DS6A 5M4CA 3I79A 4GUEA 3QZGA 4XBRA 1GZNA 4EH7A 3NUYA 3U54A 4MBIA 2R64A 4YBJA 4PDYA 3FV8A 3ID6C 2BMCA 3R8MA 2YZAA 4RLLA 2W99B 5DOSA 4CFFA 5IQIA 4UY9A 2HAKA 4AE6A 2IVVA 3L1SA 4LMUA 3FLNC 2B1PA 2C6TA 4BKJA 4O27B 4CKRA 3VUMA 3QQKA 2JEDA 1MQBA 4MNFA 2NP8A 2PUUA 1QMZA 3UIMA 2DYLA 3TT0A 2ZB1A 2WMTA 4IX5A 4AA5A 1W83A 4FKTA 4HCTA 4AP7A 1NVRA 3R7UA 3BHHA 3FLWA 3I81A 4AXAA 3LAUA 5BVEA 3NNXA 4FKQA 4F9BA 3EB0A 4ANOA 1OVEA 2W5BA 3H4JA 3R28A 5D1JA 3P78A 3R9HA 3U8WA 4QNYA 2XK4A 5TF9A 1L8TA 3M1SA 2ZB0A 1GIHA 5AM7A 3BYMA 2VTAA 3MVLA 4ZTRA 4K77A 4R77A 4UMRA 3IGOA 1DAYA 2X7OA 3KMUA 4X3FA 3DZOA 5CEIA 3ZSIA 3V6SA 4FKUA 4EH9A 4XG3A 2JFMA 4KRDA 5FWKK 4WRGA 4DH8A 5KMNA 3NUAA 1JKSA 2WPAA 4FL1A 4PP7A 5A4CA 3KULB 3A7GA 3RGFA 1Z9XA 3RVGA 1Q8WA 1P4OA 3PVWA 4FIEA 5H8EA 2CGUA 2QU5A 4UN0C 2C5XA 1ZYDA 3GGFA 2ONLA 5ACBC 4EOJA 3HVCA 1GJOA 5E7RA 3COIA 3QD4A 5EM8A 2UW5A 4BZNA 5I9VA 3FC2A 4R3CA 4FC0A 3HKOA 5AR3A 3D5WA 2UZDA 4BI1A 3PSCA 2FA2A 4G5PA 4QTAA 4FOBA 3G9LX 3H30A 4L9IA 1YKRA 3POZA 3DKCA 3U4UA 3OCGA 3Q4TA 5AUXA 3G2FA 4GG5A 3C13A 2OSCA 4FICA 4F6UA 1YHWA 1H1RA 2W1HA 4APCA 4KUJA 4FT9A 1R1WA 4PMSA 4HYIA 5DIAA 4A4XA 2R3NA 4O7WA 2QO2A 1PMVA 3KXHA 5DPVA 4FE2A 1KE6A 4NTTA 1UVRA 4O7VA 3C7QA 4RX9A 1OIQA 3Q3BA 4FK3A 2GCDA 1KE8A 2OGVA 5EYKA 2G9XA 2B54A 2CLQA 3R73A 4IM3A 2UW7A 4BICA 4RX5A 3C9WA 2ERZE 4V04A 4ERWA 3TDWA 2UW3A 4TYGA 4L3PA 4N6YA 4EWQA 1W98A 3HAVA 5GIPE 3B8RA 5JEBA 1S9IA 3OEZA 4HZSA 2JDOA 4WA9A 3FZTA 3QWJA 4D5HA 1OUYA 1SNUA 2J0JA 1OM1A 1A06A 2VWVA 3MI9A 3ZBXA 4O22A 3GQLA 5JFXA 3BRBA 2WELA 2GQSA 3NNVA 2GHLA 4J71A 1T45A 2I40A 4NIFA 5CI6A 5CF4A 5BUEA 4W4VA 4CT1A 3AD5A 3KRRA 3R63A 5AV3A 4TWNA 5E8YA 1UWJA 4M13A 3L8VA 3TNIA 4DYMA 2Y4IC 3M11A 4O1OA 5EQEA 3TG1A 3BZ3A 3OCBA 3I6UA 4Z16A 4IACA 1OPJA 5IMXA 3HP5A 1MQ4A 4QPMA 2E9PA 5AMNA 4A06A 2QHNA 3GEQA 4FG7A 1Q8TA 3TIZA 4Y73A 5CY3A 4BHNA 3FMJA 3PP1A 3R7IA 1PMNA 2YHVA 2Z7SA 3QTRA 5CVFA 4B99A 4D4SA 2YWVA 4M84A 3DBEA 4XBUA 3LLTA 3F3WA 2JAVA 5HNGA 5DR2A 3ZEWA 5HLPA 2WEVA 3NVKI 4CLJA 2XJ1A 4I1ZA 4O1PA 4F1MA 4Y8DA 3IW5A 3PA5A 3V6RA 4IWQA 2GNLA 4BCJA 4FT3A 3ZOSA 3RI1A 4AN9A 5L6OA 2UZOA 3FZOA 5FTGA 5AP3A 3NYNA 4GJ3A 3QALE 2KULA 1OIYA 4S30A 3ULZA 2ZM3A 3F3UA 2AUHA 2XIZA 3BBWA 3S4QA 4MXCA 3P7CA 1IA8A 2C3JA 5FXSA 5HD4A 5A4QA 2C5VA 1J91A 3EQDA 4NKAA 3VS4A 4QYGA 3EN5A 3FUPA 4ASZA 4CGAA 4KRCA 4CCUA 3WI6A 5EM6A 2WKMA 4GT4A 4DT9A 3MSSA 2P0CA 5EM5A 3D5VA 5HHWA 4AA0A 1QPJA 4GVJA 3R7OA 2PVMA 3BV3A 3UMXA 2XS0A 3BV2A 4CD0A 4OAUC 3TDVA 3GFEA 4ZXTA 1JSTA 1ZMWA 3A7FA 4X6QC 4LOPA 3PP0A 4JBPA 4JL9A 3UOHA 4DG2E 3UZTA 4HYUA 4PNIA 2UW6A 4ZSAA 2PWLA 4F9WA 4M97A 4D1XA 5KMOA 3ZMMA 4ASXA 3SGCA 3ERKA 4M3QA 2C5OA 4H3PA 3OXTA 1LEWA 1H8FA 4ZOGA 5DI1A 3BCEA 4U45A 4QMSA 3D83A 4AN3A 4CZTA 2BKZA 5F20A 4ZLYA 4O21A 5JQ5A 2UZNA 4O0TA 5AR4A 3GCUA 3NCZA 2XVDA 3Q52A 4FSWA 4F99A 4YURA 1Q24A 3Q4UA 4LV5A 3TNPC 1P4FA 5AUVA 4DFYA 2C5NA 2C0TA 5AAEA 3RCDA 5C8NA 3HV5A 5M07A 3CQUA 3PJ8A 2BRHA 2UZLA 1FVVA 1Q8UA 4TTHB 5FLFA 4M69A 4GVAA 3IS5A 5EHLA 4HW7A 4N0SA 5I9ZA 1QPEA 1FVRA 2V7AA 3EHAA 4IZYA 3FY0A 3LQ3A 3UOLA 5FBNC 3PLAE 2PVLA 4FSUA 3R83A 3BHTA 2AC5A 3EQPA 3M2WA 2C69A 2W1IA 3FYJX 4YZMA 2I0YA 2GPHA 4XG4A 2JD5A 2PMNX 3WF9A 4FSZA 1YWVA 2WU6A 3ZZWA 4E4NA 2JGZA 3HDNA 4ZSLA 2BFXA 3VS2A 4EKLA 4FZ7A 4EZ3A 2BKKA 2X2KA 4H58A 3U6JA 2OF2A 4FKGA 3C5IA 3E7OA 4O38A 3UDBA 3ULIA 3LQ8A 4GH2A 2OH0E 3NX8A 1OZ1A 3QKMA 5LVMA 4H05A 1PJKA 4JAIA 4X2GA 4H36A 2XKEA 4KB8A 1V1KA 1XKKA 4DE4A 5H9BA 3FQHA 4L00A 4S32A 1BX6A 4AS0A 2FSMX 3HV6A 2O63A 4HNIA 1CMKE 1Y91A 5B7VA 3DLSA 2FGIA 4ZZOA 2Z7LA 4QMTA 4AGCA 3P7AA 1YWRA 3I1AA 1OL5A 4F64A 3HV3A 4YHTA 4BIDA 3W16A 3NUXA 4FZFB 4IAAA 4LGHA 4M15A 4C62A 4FNXA 4NK9A 2PMOX 4V05A 1RE8A 3EN4A 3OG7A 5DH3A 5J79A 5E8UA 4XG8A 2W5AA 3FZSA 5AV2A 5AIRA 4XV1A 1WVXA 3I6WA 3QTWA 4QMVA 1PXNA 2PVHA 1FINA 2X9FA 3ETAA 4YTCA 4FSQA 3A62A 2DWBA 4G9RA 3V8SA 5BVNA 1REKA 4H39A 1Y8GA 2VWWA 3NUUA 3V5WA 4I0TA 5CAVA 3ORNA 4MYGA 4IAYA 4U41A 5IA1A 4FVQA 4DGOA 3SOAA 4FTNA 4XJ0A 1OL2A 3HX4A 4D4VA 3BYVA 3DA6A 3UVRA 2UZWE 2JFLA 4JLCA 1Q99A 2JBPA 3VQHA 3OY3A 4BDCA 5L4QA 3MVHA 3OXIA 3ZLYA 3KGAA 5CNNA 3I60A 4CZYB 4I41A 3VS5A 3HLLA 4F09A 2VRXA 3CC6A 5CAOA 3QCQA 3KA0A 4EK4A 3TJCA 5CF5A 5IZFA 4PPCA 3DGKA 4RGJA 2XCKA 4B0GA 3QQHA 2W05A 2XEYA 4U43A 3ZSHA 3NIEA 3EKKA 4OTIA 1PHKA 5AX9A 5CZIA 2R3OA 4FEVA 2F2CB 3PVBA 3HDMA 5L8KA 4FNZA 1PYXA 3S95A 5KUPA 1ZYSA 3ZLSA 2YABA 2XRWA 4FSMA 3D2IA 3QAME 4FVRA 3WF5A 3WYYA 4E26A 4JT3A 4FEWA 3PXFA 4YC8A 4C2VA 3UNZA 2VUWA 3SC1A 2UW8A 2VWZA 4LMNA 2J0KA 1H1PA 4YPDA 4KKEA 4ANSA 4C4JA 4HPTE 3TUCA 5HTCA 4FOCA 4NM7A 2HW7A 3H9RA 4HNFA 3OEFX 3ZO1A 3Q6WA 4BWXA 3ACKA 5AAFA 5HLNA 4AZVA 5LMKC 2W1EA 4L68A 2ESMA 5HIBA 4GK3A 4USEA 3ZXZA 4PQNA 5I5ZA 3IECA 2BRBA 1Y6AA 3FMHA 1TKIA 4RWIA 3F3ZA 2A2AA 4ARKA 3NW7A 2HYYA 5HO6A 2SRCA 3SX9A 1H24A 1JPAA 2UVZA 4IX4A 4NKSA 3D7TA 5AX3A 2QODA 3EYHA 3RNYA 2WIPA 4LRKA 3ZTXA 3C4ZA 4FTOA 4BCPA 4W4XA 3NAXA 2YJSA 5HNBA 3F5XA 2VN9A 4W9WA 2JKMA 4HYSA 2Y0AA 3OT8A 4QP6A 3UP2A 5M56A 2Q83A 3G51A 4KSPA 3BELA 3E63A 4H1JA 4IEBA 4WRSA 4N4SA 4K18A 3E8DA 5HBHA 4E3CA 3PWYA 2X6DA 4FF8A 2HY0A 2XMYA 4MD8E 5AP5A 4ZY6A 2WB8A 4ZSJA 2XKFA 5AP0A 3IG7A 4ZTMA 4GS6A 2I0VA 4BDIA 3FLQA 3TWJA 2QR8A 4U6RA 3R04A 3NLBA 4KKHA 2GS7A 4DFXE 5AADA 5JRQA 2BCJA 3PPKA 2Y6MA 4QYFA 4O7TA 5LQFA 5FXQA 4D0WA 4QQTA 4DEBA 2ACXA 4WOVA 3MFTA 4QMXA 3UPXA 4FK6A 4IAIA 2BRNA 4PWNA 5J5SA 3CD3A 3PLSA 3QYWA 5E8SA 3W2SA 5BYYA 3COKA 4I0SA 2W1FA 4O0XA 4CQGA 3CJGA 3R01A 5J9LA 2CNQA 2XIKA 5AEPA 3QKKA 4C02A 4PMMA 2ZJWA 1BKXA 3F66A 3GENA 3HV7A 3LCDA 1WCCA 4FIHA 4WG4A 4EQUA 4EQMA 4FEXA 2XNEA 3H9FA 4XG9A 5HQ0A 2GFCA 3KL8A 4FNYA 3HP2A 2Z8CA 4UX9A 4TYHA 2NPQA 5IH6A 2IVUA 3BI6A 3T9TA 3JY9A 2C6DA 2ITNA 4W8EA 3V5LA 4EOMA 1OL1A 4BI2A 1BI8A 4NU1A 5HG7A 4TL0A 5HVKA 3LFEA 2O2UA 3M42A 1FGKA 2XZSA 4ZEGA 4L52A 2B0QA 1CDKA 2PVRA 3R02A 4RVTA 4AFEA 2P2HA 2UVXA 4FX3A 1IA9A 5AR5A 1JAMA 4O7YA 5AWMA 5AA9A 4AFJA 4NM3A 5FRIA 4LRMA 3FHIA 5I9YA 3C50A 3F3TA 4ITHA 3TKIA 2CNVA 3ZFYA 4C38A 1U5RA 3C1XA 3FI2A 4RC3A 4E4LA 2JKOA 3MH2A 5D12A 2J5EA 1OPLA 4FIGA 4YSMA 3P0MA 3DXQA 3JVSA 1A9UA 3RALA 4D55A 4O0RA 4DFNA 3E3BX 4BBEA 3LMGA 4ZY4A 3LXPA 4E6DA 3F2NA 4I6HA 3ELJA 3IW4A 3R8VA 3E8NA 3LFNA 4EK8A 5I0BA 3C0HA 4CKJA 2C4GA 4F4PA 1UU7A 5DR9A 1AD5A 1V0PA 3TV6A 4TT7A 3L9LA 4FTQA 5JZNA 1PXOA 1IEPA 2EU9A 2Y4IB 3GB2A 3RKBA 2PPQA 3WILA 4D2PA 4XEYA 3PUPA 2GDOA 4M66A 4XUFA 4R3PA 4KIOA 2E9UA 3RHKA 3KREA 2OKRA 4CYIA 4I6QA 1V0BA 3AT3A 4EZ5A 4QO9A 1ZOHA 4YJNA 4HVSA 1ZRZA 2YM4A 3AT2A 5BYZA 3C0GA 5AUYA 3VC4A 3PRFA 3TNQB 1URCA 5A9UA 1OL7A 3OTUA 3MTFA 1BL7A 4IB3A 4KBCA 3VUTA 4CMOA 4IH8A 2YITA 2W06A 1DI8A 3KXMA 3PXYA 4GCJA 3VBQA 2X8DA 2PZPA 3POOA 4BN1A 4BWKA 4MD9E 3L9MA 4I5CA 1XR1A 2ZOQA 2OIDA 3O8PA 4D2SA 5J7HA 1YI3A 2VTMA 3D0EA 4F9YA 2BIKB 4YZBA 3RM7A 2C30A 2FSOX 3WIKA 3OBJA 4RVMA 4DG0E 4GKIA 3HRCA 5A46A 5BUJA 5HLWA 4MXZA 2WTJA 3RPRA 5E8XA 2HZIA 2XK6A 4G1WA 4OTQA 4DBXA 4F7NA 5FEQA 1SVEA 2HWOA 4JDJA 4MXAA 5CU4A 5M44A 3FQSA 4QTBA 2ITQA 1PKDA 3HRFA 1KUTA 1XJDA 2XBAA 2W5HA 4ENYA 4I4EA 5DHJA 4DEGA 5LOHA 3BQCA 5IQCA 5K0KA 2J5FA 2NRUA 3GBZA 2OJIA 3CXWA 4WD5A 2ITZA 3UPZA 3JY0A 4YZDA 1M52A 4F0FA 4FT0A 2EXCX 4C2WA 5A3XA 5A6OA 4NWMA 3VRZA 3K5UA 4DH3A 2E9OA 4JRNA 4KIQA 4CFWA 4D0XA 3GCSA 1ZY4A 2HWPA 3E92A 3PFQA 4O7LA 3FKNA 3NDMA 2WQEA 2YFXA 4O82A 2ITPA 3QTXA 5C03A 4EQCA 3BGZA 3QA0A 3ZO4A 1H07A 3EZVA 1XH7A 4FR4A 4RIXB 1UV5A 3BHVA 2ZMDA 4QQJA 5HIDA 3KEXA 3TI1A 3A2CA 3KXXA 2YDKA 3VBVA 4AT5A 4ALWA 4AN2A 4J98A 2XIRA 4FEQA 2AC3A 4FV6A 3R1QA 5J1WA 2BRMA 4G31A 5DT4A 4YNEA 3HECA 2WMSA 3W2QA 3OUKA 4PX6A 1SM2A 3SXSA 3NR9A 1UKIA 3UGCA 3O7LD 2O64A 4B8LA 4BGHA 3ACJA 3UG2A 2JDTA 1KSWA 4IWDA 3NWWA 2J51A 1O6KA 2UW0A 4U79A 4C4GA 4PL5A 3QTIA 4TNBA 4CFNA 1I09A 1U46A 2WTWA 2GS2A 1APME 3DV3A 5DNRA 2R9SA 4GFMA 2WMAA 3QWKA 4FZAB 5TO8A 3PY0A 2H8HA 3IK3A 3TIYA 3FPMA 2HCKA 4GYIA 4IB5A 4R7HA 2H34A 5DMZA 4EC9A 4GRBA 3GP0A 4FMQA 5J7BA 3DFCB 2CCHA 3V04A 4EHZA 2WOUA 3PE2A 3QRIA 3VS6A 3E87A 4ZLZA 2YACA 4QP7A 4I3ZA 1JKKA 1VJYA 2HZ0A 1RW8A 3E93A 4TRLA 5C27A 3OW4A 5B0XA 2A19B 4ZY5A 3CE3A 5BMSA 3BLQA 4O86A 3UOJA 4HVHA 3ATTA 3PZEA 1WBPA 2C6MA 4KA3A 5FXRA 5GZ9A 4MF1A 5BYLA 4C4IA 3UBDA 4YZ9A 2JDVA 4BYJA 4QD6A 3O8UA 5DLSA 3WZKA 4YTIA 1H00A 2VTHA 5CASA 3PDTA 3FSKA 5FQDC 3CJFA 5J9ZA 3IPHA 3QL8A 5E1EA 2Z7RA 5FDPA 4E5WA 1MUOA 4OUCA 4G16A 1OL6A 2R3KA 4BVUA 4BCHA 3P79A 2JIUA 4EORA 2H9VA 3V8WA 5TT7A 3C4XA 4XLVA 3OD6X 4IMYA 4F0GA 4AQCA 3KU2A 5ETAA 4ASDA 3PA4A 4LL5A 4LL0A 1PXKA 3T9IA 3KCKA 4RIWA 4BDDA 3NUSA 3RAKA 4EUTA 1MP8A 4AE9A 1MRVA 3NYOA 4B9DA 5CVHA 4RJ3A 4LGDA 5EG3A 2XUUA 3MV5A 4AU8A 4DH5A 4WNOA 3I7BA 4Y95A 3UIXA 3MWUA 3QYZA 4D9TA 4AGDA 4LV8A 2PZ5A 3FSFA 4IC8A 2B4SB 3P23A 1CSNA 4CKIA 1KE5A 2BPMA 3FC1X 2WHBA 4PY1A 5I9XA 3MTLA 5KZIA 3QFVA 1FVTA 5BQ0A 5G1XA 1PMUA 3C51A 2E9VA 2VTPA 3LHJA 1E9HA 5JKGA 1NVSA 1OPKA 2PE0A 2CHLA 3G6HA 5B2KA 4U44A 4ACDA 3FLSA 4BIEA 3EH9A 4WUNA 5C01A 4MD7E 2BIYA 4JBVA 4O6EA 3SG9A 5FG8A 4UZDA 1YOLA 3ORIA 3BX5A 4BF2A 2Y8OA 2JKKA 3KKVA 4S33A 3KN6A 5CZHA 3FBVA 3R6XA 3PTGA 1OKVA 5EW3A 3VF8A 4YR8A 2XNGA 3BHYA 4IZAA 3H0YA 4IC7A 4U7ZA 5D11A 4GYGA 3A60A 3S3IA 3VULA 4AF3A 5IQDA 2PE1A 3UIBA 3AC2A 3QXOA 3DKFA 4NJ3A 2FUMA 5FD2A 1JVPP 2X2LA 4O2ZA 3QXPA 3KY2A 4JS8A 2BRGA 4FUYA 4WNKA 4FT5A 5CQUA 5LXMA 5AR7A 5C26A 4EH4A 4TNDA 5H2UA 4BZOA 4LM5A 4U40A 1ERKA 1F3MC 2R3IA 3UYTA 3PWDA 3SOCA 3DBCA 3MJ2A 4X2FA 4BCQA 5CAQA 3D4QA 1W0XC 3ZEPA 2B53A 4HPUE 4BB4A 2VWBA 2W96B 1RQQA 3DDPA 2VWUA 4YUQA 3LCSA 3GCQA 4U80A 3RMFA 1M2RA 5DVRA 2E9NA 4EK3A 4OAVB 3CLYA 2O65A 3QTSA 1LEZA 2BHHA 2HXLA 5HI2A 5IKWA 4C0TA 4AOTA 4C58A 3DCVA 1QCFA 2C6KA 2J0MB 4G6NA 4GK2A 5B2LA 3OP5A 3RAWA 4S2ZA 4U0IA 4HVIA 3ZFXA 4UXLA 2WGJA 1WBTA 4FV5A 3UQCA 4YTHA 5M57A 4Z9LA 3HA6A 5KMKA 3MW1A 3TZ8A 4IVDA 4RA4A 1DS5A 4JXFA 1OIUA 4BY9E 2QOBA 2O5KA 4MF0A 5HE0A 4OGRA 2VTSA 2ZDUA 2HELA 2H96A 4IAFA 3EFJA 4X3FC 5G6VA 1U54A 4X2JA 2YN8A 3PPJA 4DEDA 4QMNA 3AC4A 2X9EA 1R0PA 2R7IA 3TZ9A 3NAYA 2WMQA 4AW5A 4BCKA 5HO7A 4O7NA 3IQ7A 3D7ZA 5HBJA 4BL1A 2ZV2A 4IFCA 4EH2A 4F9AA 4TWCA 2B55A 4DC2A 3AMAA 5EQPA 5M4UA 3OXZA 4FKPA 4LFIA 2YLEA 5CT0A 4FZDB 4CTCA 4UWCA 4ACGA 3VN9A 3BYSA 4D1SA 5CEPA 4F9CA 2ZDTA 2WQOA 5FGKA 4EOSA 4WNMA 3QUEA 4WNPA 4YJOA 4CV8A 1HOWA 3OC1A 1ZY5A 2XIYA 3ALOA 4JR7A 2BVAA 4BKYA 2CPKE 3QLGA 2BTRA 5CU6A 3WF8A 3RPYA 1P2AA 1YXSA 2XYNA 4EEVA 4MNEB 4CQEA 3CKXA 4C61A 3VUDA 3OTVA 3O8TA 3O96A 3OZ6A 4O96A 5KX8A 4FNWA 3R1SA 3NW6A 4I0RA 4AUAA 1KV2A 3DLZA 4TYIA 4ZAUA 3TZ7A 4DCEA 4PL3A 5J1VA 2GFSA 1K2PA 4G5JA 4NW6A 3VWAA 3O23A 4FTCA 3WZDA 4FODA 1GZOA 4QTDA 2WQNA 5CSXA 2B9HA 4BGGA 2YIRA 4ZK5A 3ZCLA 4DT8A 5BX0A 4NH1A 1K9AA 3GOKA 3FJQE 3RZBA 1BUHA 2JDSA 4ANBA 3SAYA 2DQ7X 3BE2A 3JXWA 1STCE 2W1CA 3A61A 4XG2A 3WE8A 4X3JA 5IA4A 3F2RA 1CKPA 2JDRA 1KV1A 3EIDA 3FE3A 4ZTLA 3KF4A 4GIIA 3ZUUA 1GNGA 4Y72A 3EFWA 1YXTA 2UZUE 3RK7A 4GMYA 3W2RA 2OXYA 1ZARA 3VS3A 4AW1A 2GNHA 1OUKA 3S2PA 3UODA 2EVAA 4M67A 3QRKA 4ONAA 2WMUA 4UBAA 3FMMA 4DFZE 5IEYA 3RCJA 3PY3A 1M2PA 3NGAA 2W7XA 2IZRA 1YXUA 2QOIA 3FPQA 2RG5A 3ZUVA 5CEOA 4NT4A 3CIKA 1VYZA 1Y57A 4IVCA 5ANIA 5KZ0A 3SQQA 3DPKA 2BALA 2V55A 3UIUA 3Q9XA 3R9OA 4DTAA 2BZHB 2C5YA 2Y7JA 4QP9A 3PSDA 3RM6A 2NNWB 2F4JA 4JBQA 1ZOGA 4GU6A 4YJSA 4ZTQA 1XH4A 4R7BA 3ODZX 4YO6A 4I94A 4BDAA 4YLLA 4BIBA 4ZZNA 2Y9QA 1JNKA 5JT2A 3MESA 4C3RA 3K5VA 3UZPA 4FTAA 3A4PA 3P08A 3HYHA 4NJDA 2J0IA 4FUXA 4NW5A 3EQBA 3Q53A 4C37A 2IO6A 3QHWA 4PPBA 3W2OA 3QQJA 4TZRA 1J7IA 3FI8A 5IQGA 1VEBA 1HCKA 3QQLA 5IQAA 3VS0A 4EWHA 2R3PA 2HXQA 2CN5A 4ITJA 5KO1A 4RLKA 4RX7A 3VS1A 4BC6A 4MVFA 3MB7A 4QMPA 2X8EA 2OWBA 4IADA 1H1WA 2IN6A 3BEAA 4K6ZA 4YC3A 4D2VA 5L3AA 5C8MA 3Q5ZA 3V5TA 5C8KA 5J8IA 3OWJA 1BLXA 4GSBA 3BGQA 2VX1A 5CANA 4IANA 4OTGA 3UG1A 2ZM1A 3MY1A 5CSPA 5AP1A 5AP7A 5F94A 4RT7A 1REJA 4MXXA 2JIIA 5HX6A 5IPJA 4EH8A 1GAGA 1FOTA 3IDCA 4U42A 2NO3A 1FQ1B 5T6KA 1H1SA 4YJPA 3RPVA 5ACKA 3DKGA 3HGKA 3LPBA 4K1BA 2HOGA 3I0QA 2R3HA 3HA8A 3NEWA 5HVYA 4CTBA 4V01A 5EM7A 1GOLA 3QTZA 4MTAA 4FTLA 3PXRA 4NZWB 3T3UA 3N9XA 5HESA 3HAMA 3SXRA 1Y8YA 2GNJA 1FPUA 3HUBA 4CZUA 4UYNA 3DK3A 1J1CA 1PYEA 1UA2A 5EI6A 4J8NA 3R1NA 4CYJA 2ZMCA 4YLKA 4O84A 1NT2A 3BKBA 2XB7A 4EONA 2AYPA 1OBGA 2GNIA 3SRVB 1UNGA 3VBWA 2V7OA 4ANLA 2EWAA 2R4BA 4XG7A 5AUUA 5GHVA 1VR2A 2A27A 4E1ZA 3R71A 3CY2A 4O81A 2FO0A 3WF7A 3N51A 2C1AA 3ALNA 4OTPA 4YP8A 3U55A 4B8MA 4K0YA 3P86A 4NUSA 3A7JA 4Q5HA 1NA7A 1IASA 3OFMA 3QGYA 1NXKA 4P90A 4F0IA 4Z55A 3R8ZA 2F7EE 4L43A 4A4LA 4JIAA 4A9UA 4EH5A 4JIKA 3GT8A 3FYKX 3VBYA 2I1MA 5HU9A 2BUJA 4QNAA 5GINE 1E1XA 1QPCA 2CCIA 3CQEA 1ZLTA 3KULA 4A9SA 1TQIA 5IUHA 4E6CA 2R3MA 3ZZEA 4CEGA 3N4VA 5DR6A 3WZUA 2XM9A 4KBKA 4V0GB 3PPZA 4RJ7A 2LAVA 2XNNA 2WNTA 2X7FA 2X4ZA 2Y4PA 3GQIA 4HCVA 4YTFA 3A8XA 4JI9A 5IH5A 2DS1A 3HV4A 3FKOA 3MH3A 3SW7A 5FUTA 4DFBA 5CSVA 3EFKA 5CYIA 3TKHA 5I4NA 2OZOA 2G1TA 3OMVA 4Z7GA 3NNUA 2CJMA 3PXZA 4FKWA 4O2PA 3KC3A 4UV0A 2J2IB 4HVGA 3AQVA 3PJCA 4A9YA 2OU7A 4XCUA 1UU3A 3L8PA 4A9RA 3DDQA 2OZAB 2VTLA 3LFSA 2XCHA 4O91A 4LOOA 5AUWA
chains in the Genus database with same CATH superfamily
4GFGA 3DJ5A 5KKRC 4MQ1A 4JG7A 2IEWA 1VYWA 2IZUA 2PZIA 2Y6OA 2YIXA 3QQGA 5C4KA 3KF7A 4FL3A 4WBBB 4BDGA 3UMWA 5F4NA 2G15A 4NTSA 5AA8A 2FB8A 1KE9A 4RJ4A 3UO6A 1H27A 3UQFA 1SVHA 3FMLA 4HCUA 5D10A 2FSTX 4GEOA 3RPOA 3DT1A 2OI4X 2Z60A 4WG3A 2X4FA 4R1VA 4DFUA 3E5AA 4L01A 2WQMA 1UKHA 2OIBA 3L8SA 4UMTA 3VW6A 3O50A 4DH7A 5M4FA 1B6CB 3PVGA 3RK9A 4BI0A 2J7TA 1WBVA 1Q41A 3RTPA 2W9FB 1W84A 5I9WA 3KQ7A 3PG1A 3F61A 4OBOA 5CU2A 4G6LA 3CCNA 5ANOA 1ZYLA 3OUNB 2ZYBA 3AGMA 4AWIA 2YIWA 5TOZA 1AQ1A 2RFSA 2WQBA 4G34A 4CG9A 3Q04A 2YM5A 5JQ8A 2PUIA 4OT6A 3N4UA 3AGLA 4ZP5A 2C6OA 3O71A 2QOQA 2RGPA 2WMXA 4LYNA 4Q2AA 4S34A 5HBEA 2WFYA 3F3VA 5EK7A 4DH1A 4N57A 2QURA 2WZJA 4DEAA 5CF8A 1JOWB 2YCFA 3OOMA 4LUEA 5HIEA 5CTPA 4E7WA 1E1VA 4I5PA 3AD6A 4RMZA 4DAWA 5L2SA 1JBPE 5IDNA 3LCTA 3DKOA 4E6QA 4MNEA 3PY1A 3EYGA 2R2PA 4C8BA 1H1QA 2BAQA 3CPBA 3ZDIA 1WMKA 3GCPA 2RG6A 4OLIA 2WTDA 1PXMA 4FSYA 4UWYA 1S9JA 3ZM4A 4CFMA 3OVVA 3IDPA 3DU8A 3NMUF 5DFPA 4FVPA 3REPA 3V5QA 2ITOA 2WD1A 2RFNA 3FI4A 3MYGA 4PDSA 4RWJA 3R9RA 2ETRA 2V0DA 3AMYA 3PSBA 2PE2A 5DE2A 4PV0A 3TJDA 4BYIA 3LCOA 3Q4CA 5JGBA 4DEEA 4UMUA 4AOIA 1M17A 3LJ2A 1Q61A 2YCRA 3F7WA 4QP2A 3PVUA 4XV9A 4JQ7A 4GL9A 2V62A 3R9DA 5T68A 3LJ1A 2H6DA 4MWHA 4WKQA 4LQMA 4CXAA 2NRYA 1W7HA 1Q4LA 1LPUA 2IZTA 2PMLX 2G01A 3NSZA 3ZC5A 3AC5A 3TTJA 1I44A 4XP0A 4RQVA 2QCSA 1AGWA 3ZDUA 5IA3A 5DYJA 3PIZA 5TR6A 1GIIA 3FI3A 1J3HA 3O2MA 4U8ZA 3AKLA 3Q2JA 4M68A 1WFCA 4IX6A 1UU9A 1XQZA 4X2NA 4YLJA 5BVWA 3B8QA 1CM8A 5EKOA 5E9EA 4AAAA 2X39A 4OBQA 2PHKA 3QF9A 3F5UA 1Q8ZA 5A4EA 3OW3A 2UUEA 2QQ7A 2WMRA 3FKLA 4TN6A 4E93A 4BTFA 3SLSA 5BVOA 2BZIB 3S1HA 4X2KA 1WBSA 3WBLA 2RF9A 3QTUA 5FEDA 2G2IA 1J7UA 4JX3A 1WZYA 4UYAA 4M12A 5HG9A 2QNJA 3P5KA 4A9TA 3G90X 1H4LA 2GS6A 2GHGA 5ICPA 4X3FB 2IW9A 4QOXA 4DFLA 4GV1A 2QU6A 2J9MA 3BWFA 3DBDA 2XH5A 4RC4A 2XF0A 4OR5A 4DCAA 4EOKA 3WARA 2VO0A 3HNGA 4FV0A 3GVUA 4JDIA 4MHAA 3UO5A 5CT7A 4TY1A 2YISA 3MPTA 5A6NA 1NW1A 1JWHA 2XJ0A 2VTQA 5HU3A 5AP6A 2QOKA 3W0MA 1ZMUA 2PYWA 2IJMA 2YLFA 3QQFA 4GUBA 4II5A 5FP6A 3SDJA 2I7QA 4DA5A 4ORKA 3AD4A 2BAKA 2ZV7A 2QD9A 4MBJA 3BU3A 2CGVA 3I5NA 2XKCA 3TZMA 2WO6A 4YMJA 3LW0A 3Q4ZA 2C3IB 3B2TA 4PTEA 4XRJA 3PXKA 1UU8A 1VZOA 3GFWA 4RSSA 5IA2A 3KRWA 4FV9A 3FL5A 4JR3A 3MH1A 4GU9A 4RRVA 1U5QA 4QYYA 4LGGA 4M0YA 5FTOA 3TV7A 2F57A 1UWHA 4IBMA 4O7RA 4IB1A 3LMHA 1ZAOA 3VS7A 4KABA 3ML1A 3IDBA 3DBQA 3OBGA 4FG9A 4LG4A 1H01A 3QCYA 3I0OA 4NCTA 2WTKC 3SD0A 2X8IA 4YSJA 2CGXA 3FAAA 4MWIA 4WBOA 2GTNA 2IW6A 4EOQA 3CS9A 3KXZA 4MK0A 4Z3VA 2QOFA 4BRXA 1T46A 3R22A 5B2MA 4XOYA 2Q0NA 2XARA 3AKKA 4J53A 3DXPA 3MY0A 3O51A 2W4KA 5CENA 4XLIA 5BVFA 5CALA 1H25A 3ORLA 4XV3A 5J9YA 3FQEA 4EJNA 4MEDA 4F1TA 4L7SA 2PY3A 3TUDA 5BUIA 1FMOE 2W9ZB 3Q32A 4QP3A 4YJVA 5L2QA 1CTPE 4DG3E 3DAEA 4JBOA 4DHFA 1M7QA 1G8JA 2AEGA 5AV1A 4FJVA 1TQMA 4RVKA 3SRVA 3FMKA 3SA0A 3U87A 4L42A 4DHJA 5KMMA 5CWZA 2ZV8A 3LQ5A 4U9AA 3R7YA 3EFLA 3WF6A 5H8GA 2RFDA 3NS9A 3PE1A 2GSFA 4G2FA 4IXPA 1Q8YA 3HUCA 4MXYA 3G5DA 3W0SA 1OIRA 2BAJA 3MFSA 3U4WA 2ZVAA 3PRIA 4R5SA 4QPSA 4E20A 1JKLA 5LCKA 4QQ5A 3E64A 4FKLA 2WMBA 4QP4A 4K33A 3C0IA 5JFWA 3Q5IA 5CLPA 2O3PA 2OJ9A 3LFCA 4FYOA 2BR1A 2VTNA 4IWPA 2XBJA 1J1BA 1O6YA 5GJDA 5DA3A 1VLRA 5D7VA 4NYEA 5IEXA 2PULA 2HY81 3QUPA 5EDPA 2YAKA 4G3CA 5M51A 3MH0A 4BCOA 4JDKA 2R0UA 4LI5A 2C6IA 3L9NA 5LJJA 3PJ3A 4O7ZA 2X2MA 3HMOA 2XEZA 3G9NA 4RQKA 4V0GA 4J95A 4O4CA 5D7AA 3R21A 3DAKA 2VWXA 4MCVA 3IONA 2YM7A 2RKUA 4G3EA 4IZ7A 4G3FA 5CXHA 3S0OA 3K2LA 3RJCA 2PK9A 4A4OA 3KMMA 5ANDA 3TN8A 3EQCA 4D2WA 5JMSA 3EQFA 3GI3A 3QZIA 4RA5A 5HG5A 4XS2A 4FKRA 3UQGA 2OZAA 1MRYA 4QP1A 3UE4A 1IAJA 3UNKA 4GKHA 3OWPA 1F5QA 3LLAA 5EW8A 4A7CA 2ZM4A 3NYVA 4EH6A 4L45A 1U59A 2JC6A 3JVRA 4I4FA 3QX2A 4Y5HA 1WBNA 4RZWA 3BGPA 4XNEA 1R39A 1R78A 2R3JA 1FGIA 3W33A 5BPYA 4MQ2A 2OO8X 3GNIB 3D15A 1O6LA 3KXNA 4Q9ZA 4ZSGA 1NY3A 2BDFA 4QQCA 4BCIA 5CU0A 1XH9A 3NYXA 3I7CA 2QG5A 4P5ZA 5FBOA 3DAJA 3RK5A 3V51A 2GQGA 2HZNA 3ORPA 3PIXA 3WE4A 4DGNA 4DITA 4ZLOA 5DBXA 2J0LA 1HCLA 5LMBA 4OW8A 4E6AA 4PMPA 3QLFA 4NSTA 3ENHA 1Z5MA 1L3RE 5CNOA 4CT2A 3Q6UA 4AA4A 3FZ1A 4KNBA 4W4WA 4IB0A 4AGUA 3CKWA 4BCFA 3W8LA 3VUGA 5K3YA 3K3IA 4IE9A 3W18A 3LM0A 5LWNA 3ZH8A 3BBTB 4Y46A 3FHRA 4JNWA 4JOAA 3SKCA 4ID7A 2UZVA 3QD0A 4BWPA 2OICA 3MGYA 4IIRA 2VTJA 2VX3A 3AC3A 3DQXA 2OXDA 4XP3A 2F2UA 2KTYA 4M0ZA 5AR2A 2E2BA 4KS8A 5L2WA 2WXVA 2XK8A 3VQUA 3Q9WA 4I6BA 2WMWA 4O0VA 2Q0BA 2YJRA 2WAJA 3OWLA 2WTIA 3QD3A 5LWMA 2FYSA 3W8QA 2W1GA 3NNWA 5HVJA 2B9FA 3OROA 4CG8A 3ZUTA 5HG8A 3ZO3A 2C3KA 3AOXA 3ANRA 5EKNA 3IOKA 1X8BA 5H3QA 4M69B 1XH6A 4TW9A 5LVOA 3GU6A 1OKWA 4FTJA 4BBMA 5A14A 3MBLA 4OTFA 2OLCA 4FSNA 4TKSA 1CKJA 1PRYA 4EUUA 4D5KA 5HNIX 5E92A 2XAOA 1W8CA 4APPA 4KWPA 1PXJA 2A98A 2QOOA 5GIOE 2VV9A 1W82A 3LIJA 2GNFA 2VWYA 4Q9SA 5H8BA 3D2KA 5DT3A 1YHVA 2JIVA 4JX7A 3ORXA 4AACA 2FVDA 2ITTA 3RHXA 5HTIA 4O0SA 3QCXA 1PMEA 3ORKA 4KIPA 4BZDA 2QKRA 4RJ6A 3ORZA 3K3JA 3F5PA 3UJGA 3CTJA 5J95A 2G2FA 1R0EA 2UZEA 2QVSE 4TYJA 4XHKB 2XK3A 5JRSA 3UVPA 2P33A 3OF0A 3R8PA 3VW8A 3COHA 4EOOA 5DEWA 2UW4A 3VUKA 4BBFA 3LKMA 4KKGA 4CSVA 4HGSA 2IPXA 3R30A 2OIQA 5IA5A 3VUIA 5D41A 4DDIA 2DUVA 2CLXA 4IQ6A 4UEUA 5M55A 5KKRB 3LXNA 5ANGA 3JS2A 4BDKA 5M08A 4L6QA 5EI2A 4D9UA 3KXGA 4FTRA 1ZOEA 2EB3A 3LE6A 3A99A 4LOQA 3A4OX 4ACCA 1JQHA 4P7EA 4I6LA 4QYHA 1H0VA 2G2HA 1Q97A 4KAOA 5K5NA 5M53A 4QPAA 3E8CA 3R1YA 2F7XE 5E1SA 4BTJA 2OK1A 4G17A 4IZ5A 3U9CA 3A8WA 3EN9A 3N4TA 4R8QA 3UTOA 3I4BA 2OJJA 4YGAA 4EHVA 4EOLA 4N6ZA 1WAKA 3R7GA 3ZM9A 3FMEA 2GMXA 5F1ZA 4RFYA 4ZTHA 2WOTA 5IU2A 3IW8A 2UV2A 4IM2A 4E8AA 1IAHA 4C33A 4GFOA 5HEZA 3HZTA 2QG7A 3LVPA 4AXEA 4G3GA 4QP8A 3F5GA 2HZ4A 1G5SA 3SVVA 2CSNA 1LP4A 3AT4A 4D28A 4IJPA 2VU3A 4BDFA 4PRJA 4IJ9A 2C0OA 2PL0A 1XWSA 3DTCA 2QI8A 4ZMEA 5KCVA 2XP2A 3MIAA 3G0EA 3WZEA 5FP5A 3UC4A 1Y6BA 1YQJA 4K11A 5JGAA 3LMIA 2OFUA 5A4TA 5JSMA 4ZJJA 3UNJA 4H3QA 4R78A 2Z7QA 3H9OA 3TNWA 1Q3DA 3KRLA 3QRUA 3VJNA 5E90A 4F63A 2XIXA 3R9NA 4ITIA 4F7LA 4FIJA 3L9PA 2XA4A 3LM5A 4YJTA 4E73A 2YZLA 2YM8A 3QD2B 3QHRA 4RPVA 5KNJA 3MFRA 3GUBA 5CEMA 1RJBA 2PVYA 3NVMB 4UXQA 5L6WL 3WOWA 2CKQA 4JQEA 4FIFA 4B7TA 3E7VA 2ONLC 4DINA 4AG8A 4OTWA 4YHFA 1UNLA 4O7SA 2CKPA 5IQEA 3EQGA 5JZJA 4R1YA 4DEHA 3JPVA 2ETKA 5EI8A 4E5BA 1NVQA 2C68A 4EI4A 5BVDA 2VX0A 2QC6A 4RIYB 4L3JA 2IVTA 3WYXA 1MRUA 4HYHA 3DY7A 5BVKA 2YCSA 3A7IA 2EB2A 4OTHA 5AR8A 2XK7A 3MIYA 3FXZA 3ZYAA 4BCMA 3W55A 3GCVA 1OKZA 3HRBA 5DEYA 3D7TB 4BJJB 3ITZA 2RL5A 3G0FA 1YXXA 4TPTA 3V3VA 5I3OA 3V5JA 3PG3A 4ERKA 5KMIA 4FIIA 1JSUA 3F6XA 4A07A 5KBQA 1ZYJA 2J50A 3CY3A 3ZBFA 5CQWA 3D94A 4FKJA 4ALUA 5CAPA 4U3YA 3E62A 4YHJA 4L46A 4EH3A 3SW4A 3UZRA 2ETMA 3R8LA 4BKZA 5EYDA 5ITAA 2PVFA 3Q9ZA 5J87A 2UVYA 2JKQA 4FKSA 3TM0A 2W17A 2YM6A 3KVXA 4EYMA 1TZDA 4ANQA 4C3FA 4DBNA 4EHGA 3HMNA 3EWHA 4RIXA 2C3LA 3FZRA 4YJUA 2OJGA 3KK8A 2BDJA 3P4KA 5HX8A 1YI4A 4QRCA 4YU2A 4RFZA 1EH4A 2HK5A 3RBWA 4D4RA 3ATSA 4F70A 5AAGA 2QOHA 3IO7A 3MPMA 4TWPA 3QCSA 3W2PA 4IAZA 1ST4A 1PXIA 2VGOA 4NL0A 4MKCA 3O17A 2PVKA 4J97A 1M2QA 2IW8A 3PYYA 4HOKA 3G33A 3DJ7A 4IHPA 4IW0A 3TL8A 3A7HA 4ACMA 3RNIA 4C4HA 2VD5A 2WTVA 4MXOA 4RC2A 3R8UA 3GC9A 4JRVA 4YNOA 1BYGA 2PVJA 1G3NA 3QA8A 4M8TA 3IW7A 2XNBA 2IZSA 4ANNA 3BHUA 2VNYA 4MH7A 3EJ1A 5ETFA 5EQYA 3MDYA 4FV7A 3BLHA 3MPAA 2CMWA 5ETIA 5T3QA 3G6GA 4AOJA 3OS3A 4YZNA 3TNHA 3II5A 4TYHB 2PZRA 3BPRA 4TXCA 3CPCA 5A4LA 5JGDA 1OI9A 2OBJA 4JVGA 4P5QA 4C7TA 4BR3A 2X6EA 4L7FA 4P2KA 1B38A 1KE7A 2QLUA 2WTKB 4OBPA 4I22A 4R7IA 1GIJA 4WSYA 5DT0A 4ZTSA 2J90A 4J99A 5HGIA 3ZHPC 4CV9A 1OGYA 5HORA 4UB7A 4Y85A 4X7QA 1H08A 2WIHA 3EL7A 4FTTA 2OH4A 4J7BA 4IM0A 4RFMA 1Q62A 3AC1A 3DBFA 3FXXA 4ZTNA 2R5TA 5HTBA 1XBCA 3MA3A 1R3CA 4BGQA 2HIWA 5IUGA 1WBWA 4PMTA 4C35A 3UC3A 3TKUA 2B7AA 3R2BA 4U5JA 4AW0A 3LFBA 4GT3A 3GU8A 1XH5A 4LRJA 1G8AA 5E4HA 4HZRA 2CKOA 4XRLA 5E8WA 3SV0A 4DN5A 3PA3A 2PTKA 1LR4A 4W4YA 2XM8A 3KB7A 3VHEA 3GOPA 5IH4A 2ITVA 2RSVA 2VTOA 2XNPA 4FV8A 2OW3A 3R0TA 4U3ZA 4D2TA 5CS6A 2QLQA 2YERA 4HVDA 5CEKA 3TXOA 4EHEA 2HW6A 4IDVA 3MN3A 5E8TA 3AKJA 4BDBA 3F9NA 5AP4A 3NZ0A 5AUTA 4Q5EA 2ZAZA 4EYJA 4HJOA 4CRSA 1YDTE 4I93A 4FZ6A 3KIOC 4PF4A 4RIOA 5KMLA 5M09A 5D9HA 5IQFA 5C1QB 5M4IA 3HMPA 1YRPA 1WVWA 3V8TA 1OECA 1JSVA 3FXWA 4RWLA 4AZTA 4GT5A 4N70A 4XX9A 3BIZA 3TEIA 4CFXA 5JK3A 1GZ8A 4BCNA 5L8LA 4DTBA 1P5EA 3O7LB 4FI1A 4U97A 5I9UA 3WZJA 3U6IA 5HE1A 2YAAA 3RZFA 3JR1A 4G6OA 3NW5A 3DTWA 3EZRA 4GJ2A 2CNUA 3ZS5A 4PTGA 5FM2A 2XNMA 2UZBA 4F65A 3NIZA 5TE0A 2X0GA 4XOZA 5C9CA 5K9IA 3H10A 5GNKA 3DB6A 4PUZA 3O0GA 2A0CX 2F49A 1XH8A 2WEIA 3AXWA 2P3GX 2XRUA 5EOLA 2BZJA 3IKAA 4L67A 4OT5A 5CSHA 3QX4A 5CI7A 3E88A 4ACHA 5ANJA 2VWIA 5CF6A 1YOJA 4RX8A 1IRKA 3HMMA 3DNEA 3QRTA 3K54A 4MAOA 3VRYA 4DTKA 2EXMA 2BROA 3D5UA 3QTQA 3EN7A 4ANMA 4UWBA 3KRXA 2X81A 3LFDA 4GK4A 3R7EA 3DK6A 5M06A 3C4WA 3GU7A 4ENXA 1DAWA 4FEUA 2A1AB 3T8OA 3W0RA 5LVNA 1PW2A 4L3LA 3EKNA 5L8JA 4KIKB 2X7GA 3CGOA 3QUDA 4BDJA 4I5HA 1OITA 4MX9A 2YM3A 3Q2MA 2QR7A 4YPSA 1XBBA 4ZSEA 5LMKA 1SVGA 3FY2A 2ITUA 4WHZA 4RBLA 4DGLC 2CKEA 2FSLX 4XYFA 5E8ZA 5HE3A 4RWKA 3ZXTA 4O4DA 4EL9A 3MA6A 4H1MA 4I21A 1ZZ2A 3EQIA 3OY1A 4TYEA 3SHEA 5A54A 4IAKA 4U81A 4BTKA 1DM2A 4H3BA 2BILB 1ZZLA 5DGZA 5AM6A 4C57A 5CAUA 2I6LA 5FM3A 4PTCA 5F9EA 4RVLA 5HICA 1XO2B 1H26A 2OJFE 1OKYA 2IWIA 5FDXA 3TACA 1O9UA 2BTSA 1SMHA 4YJQA 1F0QA 2AQXA 3LCKA 3ZLWA 5LARA 4NM0A 3VIDA 4IFGA 3W10A 5FEEA 2ITWA 4ALVA 4IVAA 5KBRA 4FV4A 3UO4A 4EKKA 3KRJA 4EBWA 3UOKA 5DG5A 4EBVA 3B2WA 3C4EA 4F78A 3FMNA 4XP2A 3E8EA 4RG0A 1GY3A 3RAIA 3RWQA 3I5ZA 3MS9A 3BU5A 1KWPA 2PMIA 3LFFA 3ORTA 4XMOA 3LXKA 3W32A 4BTMA 3LOKA 3D9VA 4DLIA 4YC6A 1JLUE 3ODYX 3GXLA 4AW2A 3L8XA 1XBAA 3ZO2A 3NUNA 3OOGA 3ZFMA 2YWPA 2REIA 4F7SA 1OB3A 3F88A 5GJGA 5DRDA 4G3DA 1ZXEA 5CU3A 3TCPA 4ZJIA 4QMOA 3SG8A 4DLJA 3VBTA 1BMKA 2C6LA 3U9NA 4QMQA 3G15A 5ANEA 4RIYA 5EYMA 4JG8A 3RWPA 1H0WA 4AZFA 3FDNA 3ROYA 4YZCA 1IG1A 3AMBA 3C5UA 2CDZA 2YDJA 3EOCA 3QC9A 1PKGA 2ITYA 4HGEA 4NFNA 3TTIA 2RFEA 3VJOA 4BJJA 1KOBA 2P4IA 2XK9A 4QMYA 2XANA 4K9YA 4X21A 2B9JA 2R3RA 2V22A 1YW2A 2W1DA 3DFAA 3KFAA 3MFUA 5HD7A 3RPSA 3UVQA 5K0XA 4BDHA 4AXDA 4XH6A 3ZRKA 3E3PA 4EK6A 4C36A 2QONA 4I23A 4C59A 2W0JA 4FTKA 5IUIA 4AZEA 4CNHA 1J7LA 4RIWB 4YJRA 5EOBA 3TYKA 1ND4A 3TV4A 4J52A 4AGWA 2C0IA 2VO7A 4L44A 5EDQA 3RP9A 4C4FA 4PDOA 5LMAA 3DXNA 5GZAA 2JBOA 4USDA 4Y83A 4AT3A 2BFYA 3EL8A 3HL7A 3NRMA 3VVHA 1DI9A 4XV2A 4BHZA 4NEUA 4AT4A 4IWOA 2C47A 3F82A 2XNOA 2J6MA 3HMIA 5EHYA 5IISA 4HGLA 3CEKA 2YCQA 4KINA 2R3FA 5K5XA 1Q3WA 3BYUA 5AUZA 3CP9A 4ZJVA 4FGBA 3PZHA 4O0YA 1ZMVA 4EOPA 3R00A 2W4JA 3F7ZA 5E8VA 2J4ZA 4PNKA 3FEGA 3ZU7A 3OCTA 2C1BA 3CR0A 3IOPA 4RJ5A 3LXLA 2OXXA 4FL2A 4W9XA 4BDEA 5CVGA 5EHOA 1ZYCA 1IR3A 2Z02A 4FSRA 3P1AA 4F7JA 3CD8A 5I3RA 4QMMA 4I6FA 4WT6A 1Z57A 2O8YA 3NPCA 2XYUA 2UW9A 4GG7A 5IG1A 4FGRA 4L53A 3Q96A 3QU0A 2VTIA 3T3VA 5HZNA 4CLIA 1YI6A 3THBA 1LUFA 2PVNA 3QZHA 3BQRA 2ITXA 5DWRA 2UZTA 4O0UA 3BWJA 4AX8A 2VO3A 4R6VA 1KOAA 2ERKA 2QOLA 3OCSA 4JQ8A 4P4CA 5HCXA 4B4LA 1U4DA 3NUPA 1PXLA 1G8SA 3QGWA 4BCGA 3GC7A 2F9GA 4ZZMA 5LVLA 1YDRE 5EDRA 5JN2A 3DNDA 4QMZA 4G9CA 5K4JA 4UMPA 3Q9YA 5KMJA 1RDQE 2P55A 2OF4A 2VAGA 3GC0A 4LUDA 4IVBA 5IA0A 5BV3A 4QT1A 4ZS0A 3ET7A 2WMVA 2I0HA 4KS7A 4CCBA 2BZKB 2WTCA 4FTUA 4FV1A 5KHXA 5HE2A 4D2RA 3V01A 4UMQA 1QL6A 4MBLA 1SYKA 4EOIA 4J8MA 4FTMA 2LGCA 2VO6A 2PUPA 3VNTA 4DEIA 3MB6A 1SZMA 2FH9A 3SXFA 5L6PA 4PL4A 3UDZA 4JMQA 1Q5KA 3ORMA 5J5TA 4C34A 3KK9A 5ANKA 4JG6A 5AFVA 2P2IA 3OWKA 4S31A 1V0OA 4UZHA 1YOMA 1BI7A 3DB8A 3RINA 5JH6A 2R3LA 5HCZA 4YO4A 1PXPA 3C4CA 3BL9A 3AG9A 2PSQA 3P7BA 4FTIA 2R7BA 2GHMA 4FSTA 3U51A 4AZWA 4QTEA 2PUNA 2YIYA 4NM5A 2R3GA 5CXZA 4L8MA 2R3QA 4B6LA 2EXEA 1WVYA 3W1FA 4D1ZA 1WBOA 4GIHA 3JUHA 1UNHA 3QZFA 4OTDA 3RAHA 2B9IA 3LFQA 5L2TA 3VF9A 2A4LA 2CGWA 5KHWA 5IQHA 5LVPA 1QPDA 2R0IA 2RIOA 3DQWA 3QQUA 4IX3A 4KD1A 4F6SA 3OT3A 2X0PA 1U54B 4EJ7A 2IG7A 4YBKA 4WIHA 4EC8A 4E4MA 4FV2A 2C6EA 2IVSA 4W8DA 3ENMA 3O5AA 3DZQA 1CKIA 2CN8A 4DGGA 4FBXA 2XKDA 4PDPA 3ZLXA 3R2YA 3H0ZA 4FA2A 4OTRA 3TUBA 3EQRA 4R5YA 3CSVA 3COMA 3GU5A 2YDIA 2WU7A 1OMWA 3FWQA 4IDTA 2PZYA 4NIFB 4KSQA 3ZRLA 4PP9A 2VGPA 4K8AA 4QMLA 3WIGA 3UDSA 5E91A 4PPAA 4X0MA 4FKIA 4I5MA 2X1NA 1K3AA 3BEGA 3LJ0A 4X6RA 5AIKA 3ZONA 1ZWSA 4I20A 5IF1A 5F95A 5AV0A 3ROCA 4ZIMA 2O0UA 3FLYA 4FKVA 4KBAA 4WSQA 4F6WA 3P9JA 3UP7A 3FMDA 5IEVA 2GTMA 2YA9A 3PXQA 3S00A 4AZSA 5BNJA 2QKWB 3D14A 3MY5A 2PU8A 4C4EA 3FL4A 2ZV9A 3LFAA 4FG8A 4NCTC 2VTRA 3F69A 3KVWA 5EW9A 3GU4A 5KE0A 3VBXA 1YWNA 4C3PA 5IMEA 1A48A 3MJ1A 4M14A 5AP2A 4O83A 1YHSA 4WG5A 5TKDA 3H3CA 3DOGA 4KIKA 3KN5A 4FRFA 2I0EA 3EN6A 4QTCA 4ZMFA 3BLRA 3ZSGA 4CMUA 2F7ZE 5IQBA 3R7VA 1JKTA 2V5QA 2YEXA 1TFFA 4J1RA 2QOCA 2OFVA 3CBLA 5HOAA 1XHAA 4NFMA 4F1OA 3HEGA 5BMMA 3QKLA 2GQRA 5C4LA 3EMGA 2OG8A 4EZ7A 3MVJA 3QC4A 4FV3A 1FBNA 1YXVA 3KMWA 4WUAA 3EQHA 3FLZA 4O0WA 1SNXA 3MVMA 4M7IA 4RZVA 4TWOA 3BU6A 5JFSA 1URWA 1PY5A 1H28A 4BFMA 2JLDA 4JAJA 1P14A 4JDHA 4FT7A 4XG6A 5DRBA 4D4YA 5AV4A 5EFQA 5CX9A 4USFA 5HO8A 4FYNA 3ZC6A 4EK5A 2YIQA 1ST0A 4Z7HA 5L2IA 5GJFA 3IW6A 3IGGA 2GU8A 3PJ2A 5DN3A 5AJQA 3JYAA 3VAPA 1YDSE 2QO9A 3CTHA 4E4XA 4F08A 2Z2WA 3GC8A 2NYAA 5LCJA 3DJ6A 3VHKA 2XJ2A 3V5PA 5ETCA 3UYSA 4J96A 2QO7A 5HCYA 1M7NA 2GNGA 3NCGA 4I24A 3C4FA 4UALA 4I92A 4D58A 2BHEA 5FTQA 4GW8A 5GZ8A 2VNWA 3UDTA 2JAMA 1FMKA 2JITA 1B39A 3BE9A 2BDWA 3OHTA 4CRLA 3QBNA 2EUFB 4CMTA 3QRJA 3CGFA 4DGMA 5JFVA 5IDPA 2B52A 1BL6A 4DF3A 3DK7A 3ZRMA 4O6LA 1OBDA 4QMUA 4E5AX 3AC8A 3CTQA 3ANQA 4QMWA 4CFVA 3U6HA 2W1ZA 3PIYA 4HGTA 4ASEA 1TVOA 2VZ6A 4K2RA 1TQPA 3Q60A 4CVAA 3CQWA 4CFUA 1YVJA 5CEQA 2VTTA 3KCFA 2QHMA 1PF8A 4WO5A 4FKOA 3D5XA 3W2CA 3BYOA 1OGUA 3FZPA 4QYEA 4RJ8A 2W4OA 3VO3A 2HENA 4JJRA 5CSWA 4ZS4A 3LZBA 4Y5QA 4R3RA 5K4IA 3VUHA 5EH0A 5EYCA 3PJ1A 5HKMA 1ATPE 3F2AA 1GZKA