1GJOA

The fgfr2 tyrosine kinase domain
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
298
structure length
280
Chain Sequence
ELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARREQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords FIBROBLAST GROWTH FACTOR RECEPTOR 2
publication title The Fgfr2 Tyrosine Kinase Domain
rcsb
source organism Homo sapiens
total genus 83
structure length 280
sequence length 298
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2001-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1gjoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1gjoA01
5CENA 2B9FA 4BCJA 3FLNC 1ZOEA 3RM7A 4F7SA 1GOLA 3UDBA 3UVRA 1JKKA 3KRJA 1ZMUA 2G1TA 4I0RA 5AM6A 3ORTA 2WNTA 3FZRA 2GPHA 3OXTA 4Y72A 2WTKB 5T68A 3SW4A 3EWHA 2J0MB 3KN6A 5LMAA 3COKA 3ZYAA 2J0IA 4NW5A 1FVRA 4HCTA 5EKNA 1GNGA 2VRXA 2Q0BA 4TYIA 4F99A 3BYOA 1M14A 2AC5A 4TWPA 5AA8A 2YDJA 4XLVA 2A2AA 3BLRA 3LJ2A 4G31A 4OTWA 5D11A 4DGLC 3UYSA 3LQ8A 3RJCA 4NIFB 4FIHA 1G8AA 4QO9A 1PMNA 3I4BA 1JQHA 4DHFA 3O51A 3LFCA 3QRUA 3K3IA 3RKBA 3MN3A 2OXYA 2WIHA 4EONA 3SG8A 3ULIA 5HQ0A 2EUFB 3G6HA 4G3FA 4O6EA 4QP2A 5FBOA 1IG1A 4QOXA 4QP6A 2J5FA 4MNEB 3LMIA 2ZVAA 3IDBA 4O0SA 1ND4A 3HMIA 2YABA 4IE9A 4KWPA 4YLLA 3VF9A 4F1MA 2E9OA 3SOAA 3V5PA 1MRYA 4TYGA 1LEWA 4E26A 2F2UA 2CHLA 3AXWA 2G9XA 4H3QA 1IASA 3EJ1A 3E8NA 4MF1A 5EH0A 2XKDA 3AMAA 1PMVA 1ZWSA 3QF9A 1PW2A 2E9PA 2PK9A 1GZKA 1KE8A 5I9UA 3WZEA 2W0JA 2ZMDA 2VWIA 3EQDA 3C50A 3MSSA 2C6DA 3OEZA 1WBSA 3PPZA 4FV0A 4WUAA 4XH6A 5LWNA 4MD9E 2Y8OA 4W8EA 5LVNA 3MA6A 2VTMA 2CPKE 4MXZA 4W8DA 5J7BA 3E8EA 4ALWA 5K5NA 3P7CA 1Y8YA 2VAGA 4Y46A 1Q97A 3F3ZA 3QQGA 3MH0A 3O96A 5AV2A 4L3PA 4AA0A 3F3TA 1A9UA 1HOWA 3Q60A 3DB8A 4E5AX 4HNFA 4GIIA 1WCCA 4O21A 3R8PA 1ZYJA 1YI6A 4C4FA 2F49A 3FMLA 2X2LA 1XH8A 4I6HA 4PRJA 2J0KA 3POZA 5E8TA 4F7LA 4CKRA 2YM7A 4GEOA 5H8EA 1NXKA 3R7GA 3SQQA 4F63A 1UU9A 1REKA 4C36A 3OTVA 3Q4CA 1Y57A 3FC2A 5TT7A 4EORA 4AQCA 5BVEA 2JKMA 3EN7A 1OIUA 3BI6A 5CT7A 4EH8A 3MFRA 3OWKA 5AMNA 2JGZA 3HV5A 5AP1A 5ACBC 4CKJA 3GC0A 3JPVA 3KKVA 4ACGA 1OIYA 2EXCX 2B52A 2JBPA 2X1NA 2OG8A 1W83A 4G1WA 5DGZA 4QP9A 5CT0A 4R8QA 3W32A 3KXHA 4EEVA 1OIQA 4L01A 5L2IA 4C3RA 1QL6A 4GK3A 5FP5A 3L8XA 3F2NA 3DFAA 2XA4A 3R0TA 4BCHA 4YHTA 4U6RA 4Y5HA 1V0BA 2XK3A 3NNXA 1F3MC 3EQHA 3GEQA 3PWYA 4B4LA 3L8VA 3R8UA 3DGKA 2F7ZE 4RIWB 4PP7A 2X8IA 3H30A 5AWMA 3RPVA 5HNBA 5KMOA 3D7ZA 4D58A 3PIYA 2JIIA 4HW7A 3R04A 3ZFMA 4CG8A 3RMFA 4YJOA 4CG9A 4YZCA 3ORXA 2JKQA 3EQGA 2AYPA 2PVKA 3FUPA 3KCKA 3C1XA 4C57A 1V0OA 3PUPA 1GZOA 3HA8A 3RAIA 4RZVA 3OY1A 1K2PA 4I21A 5J9ZA 4NCTC 3WZDA 2WMRA 3W2CA 5CEKA 5GZ9A 4AGWA 3M11A 3OCSA 4GKIA 4FUXA 3UBDA 4F9CA 2XKCA 3EN9A 3RI1A 5AM7A 5E8ZA 4O7NA 4I4EA 4C3PA 4EQMA 4KSQA 4EJ7A 4C35A 3GQLA 2OICA 2WOTA 4G17A 3QGYA 3P0MA 4WBBB 3UZPA 1PF8A 1R3CA 3BX5A 4U79A 3MGYA 4N6YA 4I5HA 3TJCA 4IX4A 1OBGA 4YBJA 1FBNA 1H1QA 5E1SA 2O64A 4G9CA 3NNVA 4FR4A 3EKNA 3S3IA 3UIUA 3V5QA 2ITQA 2Y0AA 4UYAA 3E63A 3VUHA 2OXXA 4YTCA 5E8UA 4ZZOA 2QOIA 2I0VA 3BE2A 2W1DA 1JBPE 2BTRA 3Q3BA 2J90A 3GOKA 3I0OA 4JG8A 3UGCA 3VW6A 5E8XA 4FGRA 3VAPA 2RFEA 5IDNA 3QQLA 3ZFYA 4NH1A 5D9HA 4QMPA 5AEPA 2R7IA 4O0TA 3T3UA 1OKVA 3VBTA 5M4CA 4F1TA 2GNFA 1UU7A 2R64A 3GUBA 3W2OA 3TTIA 1FMOE 2HENA 3FZSA 3CD3A 4OLIA 2J9MA 5ANOA 4H36A 3UP2A 3OUKA 3P5KA 4FSWA 4H3BA 1E9HA 2GS6A 4FTLA 2ZDUA 4D2TA 1M2RA 2ZB1A 2YZLA 1F0QA 5FQDC 1Q62A 4O1PA 4P5QA 4I6BA 4BCNA 5CLPA 4FK3A 3Q4UA 4UMRA 3NYOA 4MVFA 3ET7A 1TQMA 1J1BA 5TKDA 2C0OA 2QC6A 2OF2A 4FKLA 3E8DA 4PPAA 3UTOA 4ZAUA 1BMKA 3ZUVA 3RCDA 4FZFB 3GI3A 4K1BA 3ZCLA 3DJ7A 3VHEA 3FL5A 4F70A 2G2IA 2OJFE 4EOSA 4PNKA 4O7SA 2QI8A 1XHAA 4AACA 1UA2A 1OPLA 1KOAA 2BAKA 1REJA 4IAIA 3VRZA 5CAQA 1PYEA 3QXOA 3E88A 3NGAA 2JDSA 3VIDA 3DA6A 2CLQA 4EH7A 5AUYA 3R2YA 4EH5A 4V0GB 5JRSA 5DWRA 4S32A 3FMNA 3OT3A 5IQCA 4A4XA 3OOMA 4B8MA 5KMMA 4HNIA 4IH8A 2QO7A 5BQ0A 4QRCA 2GMXA 5KBQA 3QZFA 5EYMA 3NIEA 3RGFA 4AE9A 3OEFX 1IR3A 1OKZA 3I5ZA 4LL5A 4PNIA 3PLAE 4L44A 4KRDA 3DAKA 4GH2A 3MTFA 2GNIA 3DDQA 4HGTA 3QLGA 1VJYA 1NVSA 2X7OA 4TYEA 2F57A 4PQNA 1YXUA 2C0IA 3FKLA 3OS3A 3TIZA 2QHNA 3WYYA 2Z2WA 3NX8A 3VS4A 4WNOA 3LCTA 4F7NA 4ZSAA 4R7IA 5BVOA 3UIMA 4FTJA 4HYUA 3GB2A 5H8GA 2WTCA 3Q6UA 1YXVA 4WNPA 5HE0A 4UMUA 4O22A 2NPQA 2XK9A 4BCOA 4U8ZA 5FTQA 2UZTA 2HOGA 4RIXA 4DEHA 2SRCA 4YJRA 2FO0A 4PTCA 1W0XC 3P4KA 2Q0NA 3A7HA 5CF8A 5K9IA 1WAKA 3NUAA 2OF4A 3FZ1A 4MCVA 2VU3A 3II5A 3HMPA 3AC8A 2VTAA 2XNNA 3KMMA 4KIPA 2BKZA 5H8BA 1BL7A 3QCQA 3B2TA 4N6ZA 3V6RA 4DE4A 4DA5A 3KULA 3JS2A 1PHKA 3NSZA 4U43A 4R6VA 4PMMA 4QMQA 3HKOA 2RFSA 4XMOA 5E8VA 5KKRC 2X8EA 4E6DA 3CGFA 2HZ4A 4L67A 4BBFA 3DFCB 4GK4A 3ZEPA 4IC8A 3NUSA 3EQFA 5HCYA 3Q9ZA 2PZRA 2GCDA 2P2HA 3CEKA 5T3QA 4EYJA 4IACA 4JBQA 2OZAA 2R7BA 3FLYA 4ZTMA 3QHRA 4TYJA 2I0EA 4GFGA 4CFFA 1GIHA 5AA9A 4IVDA 3NUUA 3SLSA 3F9NA 2OH0E 3WBLA 2W5HA 2X39A 3QTZA 4BZNA 3EMGA 3MS9A 3R8VA 4RWLA 4LRMA 2VTHA 3GGFA 4RC4A 5GJDA 2GFCA 3DTCA 3HMNA 1G8SA 3OTUA 4L3JA 5DIAA 5CF4A 3DLZA 3S95A 4DH8A 2E2BA 4IVCA 3M42A 5HVKA 4MYGA 3PJCA 1UKIA 4QD6A 3W33A 3O23A 1SNUA 4ORKA 3KREA 2GTNA 5EYDA 3F66A 3C0GA 4PY1A 4FIGA 5D41A 4QTDA 5ICPA 2FSLX 4K9YA 4Q9ZA 5CQUA 5FWKK 4WBOA 2IZSA 3FI8A 1QCFA 3PJ1A 2XIKA 4IM0A 2CGUA 4Z7HA 3UNJA 2UZNA 4JAIA 3V8SA 3IW7A 2HWOA 1LUFA 4FVPA 4JNWA 3GENA 5I0BA 3AT4A 3HDMA 3PE2A 4PMTA 4QMLA 3OG7A 4DEBA 2VWZA 4GVJA 3AD5A 4PX6A 3F82A 5AJQA 1JNKA 3AOXA 1H4LA 5LVOA 4BTMA 3KMUA 4BHNA 2XBAA 4O0RA 4EYMA 4B7TA 2W05A 3EL8A 4LFIA 2P55A 5HO8A 5J95A 4KUJA 2VTLA 2BRMA 3CC6A 4L9IA 4V01A 4PMPA 3EFLA 4IDTA 3W2QA 5L2QA 3D2IA 2W1EA 2VX0A 1JKLA 3EL7A 4OTHA 4D9UA 4H58A 3BBWA 3BQRA 3V8WA 3EZVA 2PMOX 2QG5A 5E1EA 4YNEA 3JY9A 4RLKA 4ZMFA 2ITNA 4A07A 2GFSA 3R7UA 5HLWA 4FL3A 4FTTA 1JKTA 4U80A 4I0TA 4E1ZA 3A99A 1MQBA 3EB0A 4BI0A 3Q52A 4TKSA 4D1XA 3QZHA 2QLQA 4IX6A 4YJSA 4ACMA 1W7HA 5HVYA 4D4VA 3KULB 2B9HA 3EKKA 2PMLX 3LZBA 1QPEA 4IWQA 4UZDA 2HZ0A 4FTNA 4E6CA 3RINA 3GBZA 2PVMA 3QUPA 3UZTA 5BX0A 4TYHA 1PXLA 4RFMA 4YHJA 2CSNA 3FE3A 3UNZA 3OP5A 2FYSA 4BTKA 1WBTA 4L7SA 3RHXA 2LGCA 3W2SA 5FM2A 4FA2A 1DAWA 4IMYA 3TZMA 4F6UA 3EQBA 1KE6A 4ANLA 3A61A 3GFWA 4FIIA 5EM6A 3P9JA 2ERZE 2IZUA 3DCVA 3NDMA 3W8QA 1BI7A 4EUTA 1L8TA 4AZWA 3NYVA 1I09A 3E7OA 5AP7A 3D15A 4L46A 4O7WA 3FL4A 3HUCA 1FINA 2R2PA 3OF0A 4GT4A 4DH7A 3PXRA 4BY9E 1AQ1A 2BDWA 3CLYA 2JIVA 3OROA 3FHIA 2ZJWA 5AP2A 3PXFA 1CTPE 3O8UA 4GS6A 5EOLA 2VTTA 4QP4A 2C6EA 2PVLA 3VRYA 1OM1A 5CEPA 4XG6A 3DBQA 3MPAA 1YOLA 2W06A 3IPHA 4XP0A 5JMSA 3NLBA 3CR0A 4XLIA 4JBVA 2CNUA 4I3ZA 1ZZ2A 4BL1A 5JFWA 4E73A 3LLAA 4O82A 3MVHA 3MESA 4EOIA 4F9AA 1YVJA 3QTXA 2P4IA 1DS5A 2QKWB 3IG7A 2W9ZB 4I5MA 4IM2A 4LUEA 2Y4IC 4X3FB 5EW9A 4EZ3A 4X2GA 3UO4A 5JEBA 2C68A 4P4CA 3BGZA 4JJRA 5CU4A 4WD5A 5HG9A 4AW1A 2C47A 2C3IB 3D4QA 1SVHA 4FV7A 5GNKA 3Q9YA 3IDPA 4D2PA 4KNBA 3A62A 3EN6A 1CSNA 1R1WA 3NS9A 4G34A 3NCGA 1SVEA 1PXIA 4KS7A 5HBJA 1WBNA 3ZO3A 4C02A 3R21A 5HORA 1FGKA 3ETAA 3ID6C 4QYFA 2J7TA 4QMNA 3D0EA 3LMGA 3W2RA 1FVTA 4OAUC 4NL0A 2YM6A 2RG5A 3CGOA 4CZYB 5FBNC 3V8TA 3R9HA 4M69A 5M08A 5KUPA 2XM9A 1STCE 5AR5A 4Q5EA 4BGHA 4EH2A 1WBVA 3TUBA 3U9CA 4FBXA 3LQ5A 2W1ZA 2WIPA 3QRKA 4LG4A 5EM5A 5HIBA 4FTAA 3F3UA 4ZSJA 4HYHA 4UY9A 1R0PA 1UU3A 4C2WA 2J6MA 2H34A 3ZM4A 2J51A 4W4WA 4WNMA 2JDRA 3FLZA 4LRKA 5KMKA 5HG8A 3IK3A 4FEVA 3O50A 3TI1A 4U9AA 2BZIB 4GG5A 5IA0A 5AAGA 4C0TA 2XYNA 5IQGA 5M07A 2OWBA 1QMZA 1WVXA 2VX3A 2XUUA 4TYHB 2ZM3A 5AP5A 1K9AA 3QA8A 2F7XE 5C9CA 3I1AA 5KHXA 5IQEA 4YZNA 5E9EA 1OKYA 3UMXA 3PVGA 2CJMA 3BPRA 3ALOA 2QOOA 3E7VA 4IHPA 3GCQA 2VUWA 2J5EA 4GYGA 2H9VA 3F5PA 3BLHA 4RZWA 2BHHA 2BTSA 3NNUA 5DEYA 4MWIA 2WMVA 2IPXA 3VS0A 4ZP5A 2BROA 3TXOA 4GK2A 3AT2A 3RAHA 2VN9A 3ENHA 3R02A 3GCPA 4G3EA 5ANIA 2BIKB 5IDPA 3WF7A 2WMWA 3WIGA 4AZEA 4BF2A 5AV1A 4CV9A 3QYWA 5E92A 4EK6A 1QPDA 5IQDA 2OFVA 3MY1A 4IB3A 1TKIA 4FKUA 2PWLA 3OUNB 5CASA 4EK3A 5A9UA 3R30A 4HGSA 4OT5A 3JR1A 1NT2A 5IEXA 3QD4A 4BCPA 4LMNA 3SHEA 1OI9A 2ZV9A 2VTNA 3AC5A 4UWYA 4A4LA 3BGPA 5HHWA 4EOQA 4BWPA 5J7HA 4QPAA 4M68A 4BKZA 1PXKA 4YJQA 1S9IA 4ZS4A 1B38A 1WFCA 4ZLYA 2A1AB 1OMWA 4IFCA 4EOMA 2BAQA 1YHVA 2YIWA 4JIAA 2GHMA 5JH6A 5K4JA 5LJJA 3QRIA 2OFUA 3FMJA 2WPAA 3GOPA 2PZIA 2CN8A 4WIHA 3ZS5A 1P2AA 4APPA 4BB4A 4XS2A 4BCMA 3KRWA 5J1WA 1DI8A 4BZDA 3LCDA 4WRSA 4EUUA 3VJNA 4Z16A 3KRLA 4M67A 4D5KA 3UOLA 4NU1A 4YR8A 4M69B 2UUEA 5A46A 3AMYA 1SNXA 2QOQA 4FI1A 2C3KA 2C5YA 3AC3A 4XBRA 2UW4A 4FTOA 3GT8A 4NFNA 4RPVA 4E5WA 2G01A 1GAGA 3UQGA 3C5IA 3ORLA 4D4RA 2EU9A 1B39A 1MUOA 3O71A 4FKGA 3HL7A 4EC8A 4NM3A 2E9UA 4ITJA 2W1HA 4CCBA 1NW1A 3CTHA 3ALNA 1URCA 4J99A 2UZWE 3VUKA 3UVPA 5CZIA 2W4OA 4L52A 4X2KA 2XMYA 3IW4A 4QTAA 3W2PA 2W5AA 2VTPA 3NWWA 3QD3A 4J1RA 1W8CA 3HP2A 3VBQA 5G1XA 1W82A 3WF8A 2PUUA 5IQBA 4E5BA 2WMXA 4IAKA 4QMWA 4IB5A 3TNQB 3TKUA 4W9WA 4A9SA 1OL5A 3KC3A 2UW9A 1OUKA 4FICA 4O2PA 4PWNA 4TT7A 4ZSEA 3WYXA 4BCGA 4S2ZA 1U59A 3QCXA 5AR3A 3TT0A 5AP6A 5AR7A 4DYMA 4FF8A 3HAVA 2PZ5A 3HRFA 1PKDA 3C5UA 2R9SA 2Z7LA 2W99B 4MD8E 3K5VA 3FI2A 3RALA 2CCIA 4OTRA 3OW4A 3V3VA 5IH6A 2Y9QA 3TN8A 5LCKA 2XNPA 3VNTA 3D5UA 5L3AA 2IZTA 2X4FA 3ROCA 5DYJA 3R1QA 2C5NA 3MY5A 3UJGA 2R3KA 4Y5QA 4A9YA 4PF4A 5EK7A 5KCVA 3R8ZA 4NZWB 2WTKC 3VUDA 3F5XA 4ZTLA 4J98A 4AFJA 2YIQA 5AAEA 4CQGA 4Y8DA 2H8HA 5FUTA 5IA4A 5GIPE 3Q96A 3HAMA 4RVLA 4FV2A 3MB6A 3R7OA 3FZOA 2HZNA 3DTWA 4EZ7A 2OBJA 5EM8A 2OJGA 4X7QA 5AV0A 2B53A 2QCSA 2QNJA 3LCKA 3PY1A 4NWMA 4R7HA 5B2LA 4BVUA 3D7TA 5TF9A 1MP8A 2RG6A 3DBEA 3ENMA 4JX7A 5HIDA 1AD5A 3RTPA 4F7JA 1G5SA 1OECA 4M8TA 3FXWA 3JUHA 3PIZA 4LGHA 4PPCA 4F6SA 3U55A 2QKRA 4FV4A 3DNDA 4FV9A 3O8TA 3QD0A 1Z5MA 3IOPA 4FTIA 1SZMA 2VNYA 2UW7A 4XV1A 2EVAA 3QTQA 3PXYA 2RFNA 4UALA 4X2JA 4YP8A 1YHSA 1JOWB 2RGPA 3VUGA 3ZBFA 4F1OA 3S0OA 3RK7A 2WAJA 2YISA 4QTCA 5C1QB 4FSUA 4QTEA 4ZTRA 2B7AA 1XO2B 3GCSA 2YJRA 3QUEA 4HYIA 4IZ5A 3CTQA 1ZLTA 4ID7A 2P2IA 3ZUTA 2WQMA 4AX8A 4WKQA 1J1CA 4S31A 5HD7A 4FV8A 4DLJA 3UODA 5DOSA 2C1AA 4AGDA 2YCQA 1R78A 2VZ6A 4RX5A 2B1PA 5IMXA 5IQFA 3SXSA 3ANRA 2ETKA 2R3LA 4O96A 4ANQA 1VZOA 3W10A 3BHTA 3T9TA 2Z8CA 2GQGA 3ZDUA 4DF3A 4R1YA 4CSVA 4DTBA 3L9PA 5KZ0A 4O7LA 5HU9A 2WU7A 4EKLA 4ZSLA 3QCYA 4WG5A 3G2FA 4EH3A 3TNWA 5C27A 4EL9A 4H39A 4CYJA 3MB7A 5M4IA 4UBAA 3TM0A 2V7AA 5E91A 2CMWA 3M2WA 3HX4A 2UVXA 2PVRA 3GU7A 3OCTA 4DLIA 2Y4PA 5D7VA 3WARA 3LPBA 4RMZA 3UE4A 4OTFA 4LOPA 2YA9A 4EI4A 3N51A 4KRCA 4JDJA 2OK1A 3OCGA 4M66A 4L53A 4RJ5A 5IA2A 4LOOA 1XBAA 4JR7A 1YWVA 5ETAA 1HCKA 4NFMA 2YM8A 4IAZA 3TV4A 3PFQA 1YI3A 3KMWA 5JGAA 1U46A 3LLTA 3WOWA 3VBWA 4AZSA 2VV9A 4RT7A 2QONA 5M56A 1IAHA 3VS3A 3F5GA 4NM7A 5EDPA 5E8YA 4QPSA 4BGGA 2YLEA 4C4IA 1JSVA 3RM6A 3ZMMA 5CEQA 3DT1A 4YU2A 4GV1A 4FUYA 4I6QA 3D2KA 2VO6A 4UXQA 4U5JA 3WF9A 3Q2JA 2G15A 3KA0A 3LCOA 3LFDA 4P2KA 2WMAA 1U54A 4OR5A 5E8SA 4D2SA 4E3CA 1FVVA 3SA0A 4HPTE 3GCVA 3FZPA 1OVEA 4C4GA 4EOOA 3NUXA 5HD4A 2B9JA 4XBUA 4MWHA 2HELA 3QBNA 2ZYBA 5IF1A 3UPZA 3I5NA 4IEBA 4W4VA 5AX9A 1YKRA 4JS8A 2HYYA 3AG9A 4YC3A 4GFOA 1ATPE 4S34A 5C01A 4D28A 4I41A 3S00A 4WT6A 2AUHA 3FV8A 3BHVA 4I20A 4AOIA 2YDKA 2YEXA 4AS0A 5DT4A 1NVQA 3RVGA 3IW5A 1GIJA 3RBWA 3R8LA 4UEUA 3DK6A 3TKIA 5HG7A 1YDTE 5CU3A 4F4PA 4U7ZA 4AP7A 3F69A 3SXFA 3LXNA 3RK5A 2BAJA 4GU9A 4HZRA 3U9NA 5D7AA 2ERKA 4J95A 3G9LX 4JG6A 4RA4A 1YDSE 4QP8A 4NKSA 3QRTA 4FTUA 4XG2A 2PE1A 4Z55A 4BIBA 2WXVA 3FMDA 3P79A 2Y6OA 4GW8A 4YZ9A 4BC6A 5HU3A 1UVRA 3TDWA 5ANJA 3Q5ZA 4RBLA 2JFMA 3QRJA 4I92A 4UYNA 5EYKA 3VS2A 2A19B 4BDEA 5CAPA 5K3YA 3ELJA 3PPJA 1RDQE 3R1YA 4XJ0A 2YLFA 4HVIA 2CGXA 5F95A 3LFAA 5LMKA 4FMQA 3VO3A 4J96A 1OITA 1H00A 2I0YA 3HV3A 4FV6A 5FXQA 5HEZA 4AA4A 4EQCA 4Z3VA 5M53A 3SGCA 4PDYA 3QTUA 3ZO2A 3BEGA 4JI9A 2WB8A 2VO0A 3UC4A 3CTJA 3MPMA 2UVYA 4NUSA 4IZ7A 4JDHA 3T8OA 1Q8TA 3R01A 1MQ4A 4F9YA 2DUVA 2NO3A 5EDQA 3OXZA 4L42A 4ZS0A 3ORZA 4KS8A 1ZYCA 1UV5A 5CVFA 3I7BA 5CU6A 5HE1A 3O7LD 3RPYA 1IEPA 3MYGA 1B6CB 4K0YA 4GU6A 5DA3A 4CFWA 3LOKA 5BUEA 5HX6A 2BCJA 2QO2A 3HNGA 4JT3A 2NNWB 4FKQA 4XUFA 3DK7A 4F0FA 1VEBA 3PPKA 3PYYA 4FNWA 4C4EA 3PRFA 1OL1A 3ZONA 4U3YA 5JK3A 2UZEA 4S33A 3ZXTA 3U4UA 3MFSA 1U54B 2BUJA 1Q8UA 4ACDA 3OXIA 3V51A 3PZHA 4AZFA 5CVHA 5K5XA 4QMXA 4XG9A 2DQ7X 3H9RA 5AP4A 3JXWA 5M4FA 2B4SB 4R77A 4G3CA 1O9UA 3DAEA 4BZOA 2PPQA 3KK9A 3UOHA 3UNKA 4FSQA 4YLKA 4QMUA 3HA6A 5DHJA 3ZLXA 4WUNA 4DITA 3FMKA 4IANA 2XIYA 5CY3A 5D12A 3U51A 2J2IB 2IW9A 2XB7A 5J79A 4N4SA 5EI8A 5L8LA 3QWJA 2FSMX 2VWVA 1WMKA 4G5JA 4QT1A 5AX3A 4IW0A 3FYKX 3WI6A 4BDCA 3IONA 3DDPA 4M97A 4RVTA 5A4QA 3HRBA 4DGGA 1ZOGA 4XG7A 4Y73A 2HXQA 3C4CA 4DT9A 2V22A 3UQFA 4R3CA 4HCVA 4RC2A 5FLFA 4FTRA 1NA7A 2UW3A 4ZZMA 3DJ6A 4OUCA 3KL8A 4HVDA 4YTHA 4PDSA 3DK3A 4FC0A 4MXXA 2W1IA 3M1SA 4RG0A 3R8MA 3RPRA 4YUQA 5CANA 2ETRA 4MK0A 1MRVA 3BU3A 1YWRA 3LIJA 3CQEA 3ZXZA 3RHKA 3IOKA 4DGMA 3P08A 1OPJA 2ESMA 1PKGA 5IQIA 3A4OX 4EHEA 4FK6A 2EWAA 3DKCA 2R3JA 4EOLA 1BL6A 3R1SA 4IX3A 4LL0A 5L2SA 3KVWA 3S1HA 3TUDA 1OBDA 2CNQA 4AN3A 3E87A 2YCSA 1QPCA 4G2FA 4EOKA 4C58A 3V01A 5DE2A 3OY3A 4FTMA 2WTDA 2VWXA 3ORPA 4FZAB 4FYNA 4YZDA 2UVZA 1ZARA 2J50A 3LVPA 4BBMA 1EH4A 4TWOA 1YWNA 1ZAOA 3DAJA 1ZRZA 2XBJA 3CP9A 4J7BA 5FXSA 3R9RA 5EKOA 1TQIA 1H0VA 5FTGA 2PMIA 1UWJA 2B54A 5JFSA 2C6IA 2F2CB 5KO1A 5HCXA 2ONLC 3DOGA 4HPUE 3D5WA 4JL9A 3CS9A 4MXAA 2X4ZA 1Y91A 4XCUA 2V62A 4V05A 5HCZA 3TNHA 4CTBA 3SXRA 4N70A 4JLCA 5HZNA 4I93A 5LXMA 4QMMA 5AP3A 3SG9A 1URWA 5L4QA 4OAVB 2LAVA 3A60A 3N9XA 5KZIA 3OMVA 4MX9A 2PL0A 3GC9A 2OJ9A 3PIXA 4PL3A 3NRMA 4I5PA 5DT0A 3PY3A 5EFQA 1SYKA 3W18A 5K0XA 5EQEA 3U54A 2HIWA 3UZRA 4QYYA 2E9NA 4BI1A 4DFUA 3DBFA 3FAAA 3FEGA 5HO7A 4YBKA 5B0XA 3U8WA 2PVYA 1M17A 4WSQA 4MD7E 3VS5A 4C7TA 3NR9A 2BMCA 3H0YA 3PA4A 1ZOHA 5ANDA 4UX9A 3QXPA 5AFVA 3NW6A 3OW3A 4NK9A 1H1SA 3MV5A 4YTFA 2ZMCA 2FH9A 2XNBA 4FOBA 4BTJA 5BVDA 5J9LA 1PXPA 3ACKA 3FMHA 3PP0A 4FV3A 3FXXA 5KMIA 3T3VA 5L2TA 4R5YA 2HW7A 3C4ZA 3IS5A 4RJ7A 1Z9XA 3K5UA 4WG3A 3ZH8A 3G15A 3GU6A 4CXAA 1KWPA 3PJ8A 5HNIX 3T9IA 4O7TA 3OBJA 4CVAA 4AE6A 4AN2A 3O2MA 5L6WL 5DT3A 4CKIA 4D4YA 3I60A 3NW5A 2R3PA 2UZVA 3E5AA 3FLSA 4YLJA 4CZUA 4HYSA 3A7FA 5AUTA 3F7WA 3KCFA 4JBOA 4XOZA 3HMOA 4FTQA 4YO4A 4IC7A 3SAYA 5FEQA 4ANNA 2UZLA 4D4SA 5J9YA 3N4UA 2UZBA 2YIYA 4GCJA 4TWNA 1XBCA 3HDNA 2PULA 1QPJA 5C4LA 3VF8A 4USDA 3VHKA 3ZZWA 4FKWA 4MQ2A 3UOKA 4AGCA 2OIBA 5CALA 2JDVA 3GQIA 4M0ZA 4F6WA 4ASZA 4BWKA 2GU8A 4ACHA 4ZSGA 5M51A 4RFYA 3QKLA 4EWHA 1LP4A 4ZJVA 4FKSA 4RWJA 3ZHPC 3MY0A 3BWFA 4TZRA 3VQHA 5HICA 2IVUA 4GT5A 3QHWA 4ASXA 2YWVA 3LCSA 1OL7A 2NP8A 5BVNA 5HGIA 1M2QA 1RE8A 4CGAA 3OD6X 4X3JA 5C8NA 4RIXB 4BCFA 4F0GA 1X8BA 5KMJA 4CLIA 3G51A 4UZHA 3L9LA 2CN5A 4YJNA 4CT1A 2QR7A 4NJ3A 3EQPA 4W9XA 4AF3A 5C8KA 2O63A 5IUGA 3DZOA 5A6OA 3PA5A 3L9NA 3QQHA 5HVJA 3BELA 3QC4A 3OVVA 2X7GA 4G5PA 1H1WA 5BNJA 4IB0A 1H24A 3LFQA 4OGRA 4J97A 5DG5A 2Z60A 4LRJA 4JQEA 3ULZA 3UIBA 2EB2A 4GYIA 4YMJA 4XV9A 5I5ZA 3FSFA 1YHWA 3UYTA 1T45A 2OZAB 2X9EA 3R71A 3C0HA 3RP9A 4APCA 2XYUA 4YHFA 5JZJA 4YGAA 3A2CA 3OCBA 5J5TA 3BGQA 2X8DA 3AMBA 4QMZA 4WRGA 5F4NA 3C51A 2ZAZA 5M4UA 4KKHA 2ITWA 3IDCA 1M7QA 3R6XA 4MBJA 4XG4A 3HUBA 4QP3A 2XIRA 4OTPA 3TDVA 4U0IA 4CFNA 4OTDA 1KE9A 4C33A 4O1OA 3G0EA 4JDIA 2GHLA 3LXKA 3NEWA 4G16A 3TZ8A 5CEMA 2C5OA 4QYEA 3SW7A 3E93A 3BYMA 2R0IA 5A4CA 4HZSA 2FUMA 4A9UA 3DKOA 4X3FC 3EYHA 3HEGA 4PDOA 5EM7A 3N4VA 4D55A 2F4JA 3VC4A 3I79A 5C03A 5B7VA 2X9FA 4HOKA 4FT9A 2WMQA 5DRBA 2QOHA 4IX5A 4XEYA 1IA8A 3KU2A 4TNDA 4WHZA 3QC9A 3PG1A 3TJDA 4E6AA 2R3FA 2PMNX 3CPCA 3MA3A 3Q9XA 3B8QA 4MHAA 2W9FB 4IWDA 3TKHA 2WTVA 5HLNA 3PVBA 4HCUA 4QNYA 3BE9A 4C34A 3O0GA 3L9MA 2WMSA 3PSBA 4XG8A 5HE3A 3ZRMA 1WVWA 4X21A 4DH1A 4IB1A 4QTBA 3L1SA 3O7LB 1UWHA 4B8LA 1M7NA 1PMEA 2AC3A 5CAOA 3P23A 3ORMA 1APME 4X0MA 1PRYA 2XKFA 4RWIA 5I3OA 2BRGA 3MIYA 3H4JA 5CEIA 5HE2A 3RPOA 4O91A 5A4LA 3MH1A 2RSVA 2ITZA 4K11A 4ITHA 5BVFA 1J3HA 1XWSA 3ZBXA 4DFZE 3ZRKA 2W7XA 4O38A 4D5HA 2CKEA 3REPA 3VVHA 1K3AA 3ERKA 2R3MA 4HGLA 4LV5A 4OTGA 3H0ZA 2YCRA 3IQ7A 2XEZA 4QYGA 1XBBA 1Q61A 5HESA 4UN0C 4NM0A 4CT2A 3NPCA 4EWQA 1KSWA 1TQPA 4I22A 3B2WA 3LFSA 2V0DA 1ERKA 3BV3A 1VR2A 2W4KA 3U6HA 2Y4IB 1J7UA 1CKJA 4CFMA 3A8WA 3MI9A 1HCLA 4AFEA 5BUIA 5D10A 4QMVA 3S2PA 3FQEA 4L6QA 2XIZA 3NVKI 3W55A 4ZMEA 4GT3A 2XJ2A 3CKXA 5E8WA 3FBVA 3MFUA 4EOJA 3PA3A 5LMBA 4AAAA 1YW2A 5HG5A 3I0QA 5JFVA 2XNEA 2ZV8A 3FC1X 5IG1A 5EQPA 3OOGA 4CEGA 4FKRA 1UNHA 2IVSA 4M7IA 5GJGA 4IAYA 2VO7A 3ZSHA 4AA5A 3R28A 3ZDIA 1XQZA 3EQRA 4O0UA 2QLUA 4MEDA 2CCHA 3QZGA 3IKAA 4E4NA 4FT7A 1OB3A 2PZYA 2V55A 2XK7A 2CLXA 4O0YA 4BIDA 4USEA 5KHWA 2VNWA 3FY0A 5CI7A 1Q3WA 5DN3A 3F2AA 5F9EA 4KAOA 3GU4A 5CZHA 3VULA 5I9YA 3GVUA 4FGBA 2OJIA 3FI4A 4XHKB 4IFGA 3MFTA 4MKCA 1ZYSA 4C38A 3RWQA 2W1FA 5HKMA 4M15A 5KE0A 4O81A 3KN5A 3QKKA 4AUAA 4EH6A 2QR8A 3GNIB 5B2MA 5L2WA 2PVFA 3BCEA 4RJ3A 2O5KA 4DEAA 1BX6A 4NTTA 2YM4A 3DPKA 3C4WA 4ZTNA 3SVVA 2XEYA 2YAAA 3OWJA 4H1JA 4IXPA 3FDNA 1H28A 3KGAA 2O2UA 4O0XA 3RAWA 3TIYA 4AZTA 1PXNA 2BFYA 4XRJA 4ZLOA 2GHGA 5CNNA 2OIDA 2YJSA 2CGWA 4M84A 3PSCA 2J4ZA 3ZEWA 2XRWA 4C62A 5ANEA 5AUUA 4PL5A 1Q8ZA 3R7IA 1I44A 4EJNA 2F9GA 2WFYA 4DT8A 4WSYA 2YERA 4KIKA 2IW6A 4FSZA 4YNOA 2WMTA 2UW0A 3CXWA 3VW8A 3D9VA 5CF6A 2XM8A 4IWOA 5GZ8A 3FYJX 2HK5A 3FY2A 1MRUA 3GXLA 5AV3A 3BEAA 2OH4A 4CRSA 4RVKA 3RCJA 4O27B 2YACA 2BR1A 4ZEGA 4D1ZA 3MPTA 4B0GA 4RX9A 3BRBA 4EK4A 4EHZA 3LXLA 1ZY4A 5HI2A 5I9WA 2PU8A 5BMMA 4PMSA 2QODA 4AT3A 4BDIA 4KABA 2YWPA 2BRBA 4LOQA 2Z02A 3FLQA 3TZ9A 3G90X 2R3GA 4ZTHA 2WU6A 4R1VA 3QX4A 3QLFA 5AP0A 2ZM1A 2XCKA 1H8FA 3OWPA 4MTAA 4NKAA 3ZO4A 3SC1A 4CFXA 4PTEA 1R39A 1JLUE 4BDJA 3G9NA 3FKNA 4R78A 3F3WA 2B0QA 5EHOA 3TCPA 3VBYA 2PUIA 3LAUA 4YJUA 4FSTA 5EG3A 2VTSA 4X2FA 3LJ0A 4Q9SA 4FT0A 3LM5A 2F7EE 3OWLA 2WELA 3JVRA 4DG3E 2WGJA 3HRCA 2O8YA 4MNEA 4UMQA 3UVQA 4BCKA 4BR3A 3CIKA 4ANMA 2QOBA 4EHGA 3RZFA 3ATSA 1JPAA 3Q04A 4I0SA 3SV0A 3OFMA 2GS7A 3MJ2A 4ITIA 3F6XA 4XNEA 1YXXA 2XRUA 4WNKA 1YOMA 1JKSA 3UMWA 3QALE 2FB8A 4DEEA 4PP9A 3FMMA 4FNZA 4JRNA 4QQCA 4KBKA 4U44A 4YO6A 3QUDA 3KXGA 3Q6WA 4WG4A 4AOJA 4BYIA 2ZV2A 4DAWA 4RWKA 3KK8A 4XP3A 5DVRA 2VWUA 4FEQA 4FKOA 1GZ8A 5IEYA 5DEWA 3QTRA 2C5XA 3OC1A 4OT6A 5KMLA 4H3PA 4FE2A 5JN2A 3KXXA 3EIDA 4A4OA 3SDJA 4KKEA 5IU2A 3KXNA 1WBOA 4AGUA 4KIQA 1BLXA 1DI9A 2CKQA 2ITTA 4FV1A 2GS2A 3HZTA 3WE4A 1YI4A 4C2VA 1XH6A 4C4JA 1PXJA 3C9WA 4FTCA 2R3QA 4F9BA 3BWJA 4RQKA 4R3PA 5FD2A 3EQCA 3CCNA 3CBLA 4DG0E 5DR6A 5A4EA 3HVCA 2OI4X 5CEOA 1H08A 1WZYA 5LVMA 4KIKB 2X7FA 4O7ZA 2OU7A 1U5QA 4K2RA 4ASDA 1IAJA 3VQUA 1PJKA 1SM2A 4FEUA 4U40A 1P14A 3ZU7A 4YSJA 5IH5A 2QOCA 1OGUA 5CXHA 5ETFA 3N4TA 1WVYA 2IG7A 2ITYA 1DM2A 5AADA 2WTWA 5DI1A 3FWQA 1V1KA 2JBOA 3QYZA 4O7YA 4JQ7A 3JVSA 3TEIA 2VTOA 4FZ7A 5ITAA 3F2RA 4I5CA 1JAMA 2XP2A 3VUIA 2OW3A 4QQ5A 5KX8A 2NRUA 3K54A 2WQNA 2VTIA 2XNMA 4Y95A 1FGIA 2BIYA 3AQVA 4YC8A 3ZLWA 4NT4A 5AR4A 4QMOA 5HOAA 2YFXA 4GFMA 4O0WA 4PTGA 4AU8A 1W98A 3QQKA 3QTSA 2PY3A 4BFMA 4EHVA 3MIAA 5AUWA 4ANSA 3AC2A 2FSOX 2W17A 4D2WA 4RIWA 5BMSA 3UQCA 4FKPA 3WE8A 2OIQA 3FSKA 5FP6A 5IKWA 4CZTA 2XH5A 4F9WA 1Z57A 3KXMA 3LXPA 4GSBA 1FPUA 4R5SA 3SD0A 3ZFXA 1TVOA 5IQHA 2QU5A 3MTLA 4FEWA 4IQ6A 4JVGA 1XH5A 2GNGA 4TNBA 5IEVA 4C61A 4DEDA 4TTHB 5GJFA 1BKXA 3NVMB 1J7IA 2G2FA 5GIOE 4O2ZA 2WO6A 2I40A 5ACKA 5CI6A 3HLLA 3U6JA 3CSVA 3Q9WA 3WZUA 5ETCA 4FT5A 3GC7A 2DYLA 2QQ7A 5DPVA 2QVSE 3VBXA 4M12A 5M06A 1H07A 5CAVA 5J5SA 3GU8A 2X6DA 4NCTA 4YPDA 4GG7A 4IBMA 4RLLA 4TL0A 3MH2A 4EH4A 4DH3A 4FOCA 3IGOA 2WQBA 3GP0A 2FGIA 4M3QA 3IECA 2VO3A 5AUVA 3D5XA 5EI6A 4QQTA 1V0PA 3CE3A 3IW8A 2ITVA 3P7BA 4IAAA 5CU0A 3UOJA 3PTGA 3R7YA 4ALVA 4CFUA 2ITPA 3V5LA 3D94A 4G9RA 3COIA 2OJJA 4FSYA 3C4XA 2PTKA 3P7AA 3UG1A 1E1XA 4FG7A 3UC3A 5JZNA 2ITUA 5F1ZA 2WTJA 4L00A 4RQVA 1GJOA 3D7TB 3PWDA 3MVJA 4E7WA 5JKGA 1G3NA 2RL5A 2HW6A 3MWUA 4LM5A 3EFKA 4HJOA 4XP2A 5IZFA 3I6WA 1Y6BA 5CSXA 4QMTA 3ZLYA 1XR1A 3VUMA 2C30A 4IADA 4ENYA 5HBEA 4K8AA 3COHA 3EN4A 4OTIA 3V6SA 3LFNA 4DFLA 4W4XA 5J87A 3PXKA 4CCUA 3KVXA 3FPQA 1UNLA 2VD5A 5AUZA 4EH9A 4BTFA 5CSWA 4EK5A 4YC6A 1E1VA 3RWPA 4D2RA 3A7GA 5AIRA 3PDTA 3G33A 3V04A 3ZTXA 4BDKA 3BIZA 2PVJA 3L8PA 2BDJA 3BU6A 4Z7GA 5EQYA 2A27A 2GSFA 5T6KA 3H9FA 2E9VA 3W1FA 1O6KA 1RW8A 3QQUA 4I23A 4K18A 3WIKA 3E92A 4G3GA 3DBDA 4DGNA 5L8KA 4L68A 4TWCA 4AW2A 4MH7A 4FT3A 4C4HA 1H26A 5I4NA 1YRPA 2C69A 2C5VA 4JRVA 3R9DA 4RJ4A 3ZUUA 2FSTX 4U41A 4V0GA 2J0JA 4XYFA 2WTIA 1BYGA 4ZY4A 4YJPA 5C4KA 2XK8A 4JBPA 2JLDA 5DR2A 2YHVA 2HZIA 3DBCA 3GCUA 5HTCA 3WZJA 2BALA 4FV5A 4WA9A 4ZJIA 2GQRA 3R00A 4BDAA 2I7QA 5H2UA 3NZ0A 4BI2A 4KKGA 2R0UA 1LR4A 4IVAA 4YZBA 4PPBA 3QKMA 2PZPA 3RAKA 5IISA 5M57A 4IVBA 3ZM9A 4LUDA 3DY7A 1T46A 4KA3A 5IA5A 5A3XA 3QX2A 3TL8A 5KBRA 4Q2AA 1Q41A 2XS0A 2IZRA 4TPTA 3QA0A 2GQSA 2GNHA 2BILB 3HGKA 3R22A 3TG1A 4C37A 4GVAA 3KEXA 3E62A 2XK4A 4U97A 3PZEA 3NNWA 4FNXA 4ZIMA 3F88A 2W1CA 2IO6A 3NMUF 3FLWA 2WOUA 2QHMA 3I6UA 2PHKA 5TOZA 2C3JA 2BZJA 4JQ8A 3S4QA 3SKCA 4CLJA 4N57A 4ZY6A 1DAYA 5A54A 3EN5A 4ONAA 3ORKA 5HO6A 2BZKB 5FDXA 2C6TA 3VS6A 4YURA 2BKKA 2XF0A 3HYHA 1YDRE 4IAFA 3RK9A 5LARA 4QYHA 3FKOA 3HP5A 3HECA 3COMA 4PV0A 4UMTA 5JQ5A 4OTQA 2XIXA 3QQFA 3BQCA 1XJDA 4QMYA 4CQEA 3E3BX 3V5JA 4FG8A 2RIOA 3MBLA 3DZQA 4TY1A 5CS6A 2IVVA 3UO6A 1YXTA 4OBQA 4ANBA 4NM5A 3DXQA 4AG8A 2HWPA 2VGPA 5CTPA 1KV1A 1S9JA 3QL8A 3ZLSA 2PUNA 3KB7A 2X81A 3AD6A 4ENXA 4RFZA 2QOLA 4NW6A 2B9IA 5G6VA 4DBNA 2ONLA 3TNIA 5H9BA 5HBHA 2Z7QA 3KXZA 3DLSA 3ORIA 1O6LA 5FEDA 4UV0A 3MH3A 4BBEA 2R3OA 4AWIA 3TZ7A 1OIRA 4CMOA 4AZVA 5TE0A 5BPYA 1A06A 4U42A 2ZOQA 4JR3A 5CX9A 4D1SA 3K2LA 4BKYA 2C6MA 5LMKC 5AV4A 4ARKA 3CPBA 5DFPA 4B99A 1A48A 2C1BA 5CYIA 3KY2A 3HMMA 4DCAA 2VWWA 1SMHA 4JAJA 4KSPA 1XKKA 3FI3A 1XH9A 3NW7A 2W1GA 4RJ8A 5F94A 4AW0A 2EXMA 2BDFA 3ZC5A 3CJGA 4XOYA 1Y6AA 5B2KA 4ZK5A 3KQ7A 3VJOA 2P33A 4X6RA 3DQXA 2ETMA 4Z9LA 1J91A 1KE5A 3OZ6A 4QMSA 3TNPC 2FVDA 3I7CA 3QGWA 4LGDA 2W96B 5IMEA 5LWMA 4MQ1A 4RX8A 1JVPP 4E4XA 2DS1A 4PDPA 3Q4TA 3WF6A 4CV8A 4EQUA 3EYGA 4ZLZA 5M44A 3IW6A 3ACJA 4RSSA 3WILA 2VTQA 3FPMA 2P3GX 1KOBA 3SX9A 2YZAA 2JIUA 2KTYA 3Q2MA 1ZMVA 4GJ2A 4YZMA 4K33A 4BDBA 4DFBA 3B8RA 2PVNA 1CKIA 4KB8A 1GY3A 1CM8A 2FA2A 2J0LA 4QP1A 4XRLA 5CWZA 3A8XA 2QURA 3A4PA 4FSNA 1ZYDA 2YAKA 4E4MA 2JD5A 3ZSGA 5KKRB 1M52A 2GNLA 2UV2A 4A06A 2XNOA 4JX3A 5DBXA 3W16A 1YQJA 3POOA 4DCEA 2XK6A 5E4HA 2XNGA 3MJ1A 1GZNA 3U6IA 3MDYA 3SOCA 4F08A 4BDDA 5BYLA 1Q8WA 4G6LA 2YM3A 3PVUA 2WD1A 1Q5KA 3EHAA 2WEIA 2JFLA 2C3LA 1YXSA 3WF5A 4BWXA 4DEIA 4JDKA 5DMZA 5J1VA 3QTWA 5EI2A 3EFJA 1OKWA 5BVKA 4KD1A 3SRVA 3TACA 3F3VA 2C6OA 2RF9A 5HNGA 2BVAA 2DWBA 2OZOA 3H10A 4E93A 1NVRA 4A7CA 1OPKA 4FVQA 4CYIA 4G3DA 4EK8A 3LFEA 2QOFA 4YTIA 2V7OA 3C4EA 3ZRLA 4L3LA 3LM0A 3P78A 3R2BA 2ZB0A 4QNAA 5BYYA 5AIKA 4FEXA 4FIJA 4YJVA 2JITA 3QCSA 2R3HA 5L8JA 5TO8A 3LQ3A 1BUHA 4J53A 2ZDTA 1PMUA 3QFVA 3PG3A 2C6KA 3H3CA 4D2VA 4DFXE 3LKMA 4QQJA 3UIXA 3O8PA 5AUXA 5FRIA 3W8LA 5JT2A 1OZ1A 2R3IA 4IIRA 5FDPA 2UW8A 4G6NA 4MXYA 1J7LA 1H1RA 3DV3A 4WOVA 4DH5A 2PYWA 3R7EA 3Q5IA 3P1AA 4HVSA 4FYOA 4S30A 1P5EA 4J52A 2NRYA 2Y6MA 3DS6A 5LVLA 3VN9A 4FSMA 4FZ6A 4KBAA 2CKOA 4RA5A 4BIEA 2R4BA 4LGGA 4DTKA 1LPUA 3E8CA 2XZSA 4AT5A 4EC9A 4J71A 3AGLA 5IPJA 3BKBA 3QAME 5FM3A 4BDFA 1H0WA 2C6LA 5HTBA 3D14A 1F5QA 3NCZA 4JXFA 3LFFA 4RIYA 4QP7A 2OXDA 4ZY5A 2YITA 5DH3A 5EDRA 2ITXA 3THBA 4X3FA 3DXPA 3DXNA 2P0CA 4JOAA 4BKJA 2ACXA 2GDOA 2JDOA 4R3RA 4DC2A 3ITZA 4D0WA 2QG7A 5C26A 5ANKA 3PLSA 5CQWA 3KRXA 1JSUA 3ODZX 2WMUA 2WQEA 2IWIA 3PJ2A 5HLPA 2PE0A 5E90A 3OT8A 4CMUA 5LVPA 3BV2A 4AXAA 3I81A 4HGEA 3NAYA 4I94A 4FVRA 3FQSA 1IRKA 4FTKA 4ZTQA 3ZSIA 4Y85A 2O3PA 5BUJA 1KV2A 4FKIA 3AGMA 4LYNA 4L43A 4X6QC 4II5A 2A0CX 2QO9A 1ZY5A 3BHHA 3DNEA 4NTSA 2PVHA 1YOJA 2ITOA 4O86A 4RGJA 2X2KA 5LQFA 3A7JA 1U4DA 4I1ZA 3LFBA 4A9TA 4UXLA 5JFXA 2CKPA 2O65A 3R83A 4DFYA 4E6QA 3K3JA 2OO8X 3Q53A 1R0EA 2XJ0A 4TW9A 5A14A 3SRVB 4CTCA 3NUPA 1CKPA 4DBXA 5GZAA 3AT3A 3BBTB 3DQWA 4BCIA 3C13A 3GU5A 1KUTA 3PXZA 5E7RA 5LOHA 2JDTA 3KRRA 3G0FA 4GRBA 4KIOA 4GIHA 4M14A 5K0KA 3PRIA 1Q99A 4YJTA 5D1JA 5DNRA 4ALUA 1XH7A 4AOTA 4RJ6A 4CMTA 5IA3A 3ODYX 2WMBA 2X6EA 4C59A 4W4YA 4DEGA 4UWBA 5AAFA 3VS7A 3ATTA 2W5BA 3O17A 4PL4A 5EHLA 3PJ3A 4GUEA 4GKHA 2XCHA 2WQOA 4IJ9A 2ZM4A 4RRVA 2HCKA 4ACCA 3CQWA 3C7QA 4FKVA 4WO5A 5JGDA 3F7ZA 5CSPA 3ZO1A 1ZXEA 4O7VA 2YCFA 5CVGA 3BYVA 4ZXTA 4DINA 4C8BA 3KF7A 3FHRA 4U81A 4FKTA 2QD9A 1OL6A 3NUNA 3PXQA 2PUPA 5IQAA 4H1MA 4J8MA 2BHEA 3FXZA 4V04A 4XX9A 4LV8A 2OLCA 2UZUE 5JQ8A 5I3RA 2A4LA 2V5QA 3D83A 3DB6A 4E20A 3VWAA 3QD2B 3BU5A 2X0GA 4U45A 3U4WA 4BDGA 3C0IA 3MVMA 3F61A 4RIYB 2BFXA 5FG8A 4CFVA 5GHVA 3RZBA 3BHUA 3F5UA 3QU0A 3C4FA 3E64A 5HIEA 3UP7A 4EBVA 4O84A 1OUYA 3UG2A 4ANOA 4D9TA 4FKJA 2VGOA 1WBWA 4E4LA 1M2PA 1FQ1B 3PVWA 4K77A 3EFWA 2HXLA 3WZKA 5JRQA 5FXRA 3TV7A 5IA1A 3JYAA 4TXCA 4O83A 3FQHA 4USFA 4R7BA 3OBGA 5IUHA 4ASEA 3HV7A 1Q24A 5KNJA 3RNIA 3R9OA 2JEDA 2Y7JA 4FIEA 4O7RA 1UKHA 2HAKA 3P86A 4K6ZA 5DR9A 4P5ZA 3IGGA 4IWPA 2BZHB 3U87A 4B9DA 4BYJA 2B55A 4H05A 2HY0A 2KULA 3Q4ZA 4IDVA 2O0UA 2Z7RA 4FSRA 3IO7A 4HVHA 1H27A 4EZ5A 4BICA 5K4IA 1H1PA 2OSCA 3AC4A 2XJ1A 5DLSA 4NYEA 4J8NA 5AR8A 2OKRA 3R63A 4I6FA 4X2NA 2W4JA 4LMUA 4FL1A 2R3RA 4U3ZA 3RPSA 4DN5A 4CRLA 4RX7A 4UMPA 5ETIA 2JKOA 3QZIA 3ZC6A 1ZYLA 5H3QA 3GC8A 4F09A 2WHBA 1CMKE 4ERWA 5I9ZA 5EHYA 5FGKA 4IM3A 4I4FA 3Q32A 1XH4A 4RC3A 3UO5A 1GIIA 1LEZA 1RQQA 4JIKA 4IJPA 5F20A 3V5TA 5L6PA 1PYXA 4HVGA 4CD0A 4F65A 2OGVA 1H25A 4A9RA 4XG3A 4EKKA 5LCJA 4C3FA 5AR2A 4L7FA 4M13A 3QTIA 4GMYA 4LQMA 4LI5A 2I1MA 4OBOA 2JC6A 4BRXA 4MXOA 3ROYA 4IZYA 3VUTA 4DGOA 4ZTSA 1NY3A 5KMNA 4MF0A 1JSTA 3BZ3A 1ZZLA 3AD4A 3CD8A 2VWYA 3CJFA 4KBCA 3CQUA 2XVDA 4MAOA 4UWCA 4RIOA 3CKWA 4EOPA 5DRDA 4ZJJA 5M55A 3EH9A 2H96A 4P90A 1P4FA 5M09A 2XKEA 3NAXA 3R1NA 3ZZEA 4D0XA 4GL9A 5FEEA 2EXEA 1JWHA 2RKUA 2YM5A 4BHZA 2WKMA 4QPMA 1BI8A 1U5RA 3BHYA 5A4TA 5I9VA 2YIRA 3TTJA 1Q3DA 2RFDA 1ZMWA 3LW0A 4O0VA 5C8MA 2BPMA 3ZOSA 3R9NA 2JAMA 5ANGA 3KFAA 4F0IA 4F64A 4BN1A 1UNGA 5EW3A 2IW8A 1Q8YA 5GINE 3BYUA 3HV6A 1WBPA 4IZAA 3EZRA 3NIZA 4DFNA 4CNHA 2HY81 2CDZA 2QU6A 4KINA 4M0YA 3JY0A 3LMHA 2Q83A 4NEUA 2JAVA 5CSVA 5TR6A 1PXMA 4FNYA 3V5WA 4AT4A 3GFEA 5A6NA 3PY0A 4L45A 5CU2A 5BYZA 2I6LA 3LJ1A 3BLQA 2REIA 5FTOA 3VS1A 5J8IA 3R7VA 4NIFA 1P4OA 2Z7SA 3RNYA 5JGBA 4BDHA 5CF5A 3FZTA 1W84A 4G6OA 3TV6A 3H9OA 3NYXA 2I0HA 3TUCA 4ERKA 2YN8A 4FG9A 4MBIA 4DTAA 2IN6A 4Y83A 3L8SA 2UW5A 3KF4A 4YPSA 4AW5A 3E3PA 5CSHA 2YIXA 1VYWA 3NUYA 4GUBA 2BRNA 4ZZNA 2WEVA 2GNJA 3PP1A 3CY2A 4FX3A 5HTIA 4P7EA 4ZOGA 2VWBA 2CNVA 3R73A 3DKGA 1O6YA 2R3NA 1UU8A 3FJQE 4TN6A 4MNFA 4OBPA 4GJ3A 4UB7A 3MW1A 4BGQA 2PSQA 4NSTA 5JSMA 4DG2E 4MXCA 1IA9A 1PXOA 2UZDA 3DKFA 3OHTA 4E8AA 3PSDA 2UZOA 1AGWA 5CNOA 1VYZA 5IH4A 1Q4LA 5EYCA 3D5VA 3AC1A 5I9XA 4O6LA 4YSMA 5IUIA 3UPXA 3PE1A 2IVTA 2VTRA 4Q5HA 4FL2A 2C0TA 4TRLA 3MVLA 1RJBA 2BRHA 5L6OA 3VBVA 3HV4A 2G2HA 3DU8A 4FIFA 4L8MA 3QQJA 4NJDA 2C4GA 4AN9A 4XV3A 2VTJA 1OL2A 3ORNA 3EQIA 3G5DA 5BVWA 4BCQA 2UW6A 5CXZA 4I24A 3A7IA 2QOKA 3ANQA 4EBWA 2VX1A 3LE6A 4XV2A 1Y8GA 1H01A 4RVMA 3G6GA 2H6DA 3BYSA 2GTMA 2R5TA 3NYNA 1KE7A 3QWKA 4JG7A 1SVGA 1FOTA 5EW8A 3EOCA 4B6LA 5CAUA 2ZV7A 2YDIA 3TWJA 2CGVA 4FZDB 2WZJA 2PE2A 2JKKA 3LHJA 3CY3A 1CDKA 4OW8A 5HX8A 4N0SA 1PY5A 2EB3A 3FMEA 4PUZA 5EOBA 4FODA 2IJMA 4MBLA 1FMKA 2X2MA 3DJ5A 1L3RE
chains in the Genus database with same CATH superfamily
5CENA 2B9FA 3AKJA 4BCJA 3FLNC 1ZOEA 3RM7A 4F7SA 1GOLA 3UDBA 3UVRA 1JKKA 3KRJA 1ZMUA 2G1TA 4I0RA 5AM6A 3ORTA 2WNTA 3FZRA 2GPHA 3OXTA 4Y72A 2WTKB 5T68A 3SW4A 3EWHA 2J0MB 3KN6A 5LMAA 3COKA 3ZYAA 2J0IA 4NW5A 1FVRA 4HCTA 5EKNA 1GNGA 2VRXA 2Q0BA 4TYIA 4F99A 3BYOA 1M14A 2AC5A 4TWPA 5AA8A 2YDJA 4XLVA 2A2AA 3BLRA 3LJ2A 4G31A 4OTWA 5D11A 4DGLC 3UYSA 3LQ8A 3RJCA 4NIFB 4FIHA 1G8AA 4QO9A 1PMNA 3I4BA 1JQHA 4DHFA 3O51A 3LFCA 3QRUA 3K3IA 3RKBA 3MN3A 2OXYA 2WIHA 4EONA 3SG8A 3ULIA 1ST0A 5HQ0A 2EUFB 3G6HA 4G3FA 4O6EA 4QP2A 5FBOA 1IG1A 4QOXA 4QP6A 2J5FA 4MNEB 3LMIA 2ZVAA 3IDBA 4O0SA 1ND4A 3HMIA 2YABA 4IE9A 4KWPA 4YLLA 3VF9A 4F1MA 2E9OA 3SOAA 3V5PA 1MRYA 4TYGA 1LEWA 4E26A 2F2UA 2CHLA 3AXWA 2G9XA 4H3QA 1IASA 3EJ1A 3E8NA 4MF1A 5EH0A 2XKDA 3AMAA 1PMVA 1ZWSA 3QF9A 1PW2A 2E9PA 2PK9A 1GZKA 1KE8A 5I9UA 3WZEA 2W0JA 2ZMDA 2VWIA 3EQDA 3C50A 3MSSA 2C6DA 3OEZA 1WBSA 3PPZA 4FV0A 4WUAA 4XH6A 5LWNA 4MD9E 2Y8OA 4W8EA 5LVNA 3MA6A 2VTMA 2CPKE 4MXZA 4W8DA 5J7BA 3E8EA 4ALWA 5K5NA 3P7CA 1Y8YA 2VAGA 4QDVA 4Y46A 1Q97A 3F3ZA 3QQGA 3MH0A 3O96A 5AV2A 4L3PA 4AA0A 3F3TA 1A9UA 1HOWA 3Q60A 3DB8A 4E5AX 4HNFA 4GIIA 1WCCA 4O21A 3R8PA 1ZYJA 1YI6A 4C4FA 2F49A 3FMLA 2X2LA 1XH8A 4I6HA 4PRJA 2J0KA 3POZA 5E8TA 4F7LA 4CKRA 2YM7A 4GEOA 5H8EA 1NXKA 3R7GA 3SQQA 4F63A 1UU9A 1REKA 4C36A 3OTVA 3Q4CA 1Y57A 3FC2A 5TT7A 4EORA 4AQCA 5BVEA 2JKMA 3EN7A 1OIUA 3BI6A 5CT7A 4EH8A 3MFRA 3AKLA 3OWKA 5AMNA 2JGZA 3HV5A 5AP1A 5ACBC 4CKJA 3GC0A 3JPVA 3KKVA 4ACGA 1OIYA 2EXCX 2B52A 2JBPA 2X1NA 2OG8A 1W83A 4G1WA 5DGZA 4QP9A 5CT0A 4R8QA 3W32A 3KXHA 4EEVA 1OIQA 4L01A 5L2IA 4C3RA 1QL6A 4GK3A 5FP5A 3L8XA 3F2NA 3DFAA 2XA4A 3R0TA 4BCHA 4YHTA 4U6RA 4Y5HA 1V0BA 2XK3A 3NNXA 1F3MC 3EQHA 3GEQA 3PWYA 4B4LA 3L8VA 3R8UA 3DGKA 2F7ZE 4RIWB 4PP7A 2X8IA 3H30A 5AWMA 3RPVA 5HNBA 5KMOA 3D7ZA 4D58A 3PIYA 2JIIA 4HW7A 3R04A 3ZFMA 4AXDA 3RMFA 4YJOA 4CG8A 4YZCA 4CG9A 3ORXA 2JKQA 3EQGA 2AYPA 3W0SA 2PVKA 3FUPA 3KCKA 3C1XA 4C57A 1V0OA 3PUPA 1GZOA 3HA8A 3RAIA 4RZVA 3OY1A 1K2PA 4I21A 5J9ZA 4NCTC 3WZDA 2WMRA 4O4FA 3W2CA 5CEKA 5GZ9A 4AGWA 3M11A 3OCSA 4GKIA 4FUXA 3UBDA 4F9CA 2XKCA 3EN9A 3RI1A 5AM7A 5E8ZA 4O7NA 4I4EA 4C3PA 4EQMA 4KSQA 4EJ7A 4C35A 3GQLA 2OICA 2WOTA 4G17A 3QGYA 3P0MA 4WBBB 3UZPA 1PF8A 1R3CA 3BX5A 4U79A 3MGYA 4N6YA 4I5HA 3TJCA 4IX4A 1OBGA 4YBJA 1FBNA 1H1QA 5E1SA 2O64A 4G9CA 3NNVA 4FR4A 3EKNA 3S3IA 3UIUA 3V5QA 2ITQA 2Y0AA 4UYAA 3E63A 3VUHA 2OXXA 4YTCA 5E8UA 4ZZOA 2QOIA 2I0VA 3BE2A 2W1DA 1JBPE 2BTRA 3Q3BA 2J90A 3GOKA 3I0OA 4JG8A 3UGCA 3VW6A 5E8XA 4FGRA 3VAPA 2RFEA 5IDNA 3QQLA 3ZFYA 4NH1A 5D9HA 4QMPA 5AEPA 2R7IA 4O0TA 3T3UA 1OKVA 3VBTA 5M4CA 4F1TA 2GNFA 1UU7A 2R64A 3GUBA 3W2OA 3TTIA 1FMOE 2HENA 3FZSA 3CD3A 4OLIA 2J9MA 5ANOA 4H36A 3UP2A 3OUKA 3P5KA 4FSWA 4H3BA 1E9HA 2GS6A 4FTLA 2ZDUA 4D2TA 1M2RA 2ZB1A 2YZLA 1F0QA 5FQDC 1Q62A 4O1PA 4P5QA 4I6BA 4BCNA 5CLPA 4FK3A 3Q4UA 4UMRA 3NYOA 4MVFA 3ET7A 1TQMA 1J1BA 5TKDA 2C0OA 2QC6A 2OF2A 4FKLA 3E8DA 4PPAA 3UTOA 4ZAUA 1BMKA 3ZUVA 3RCDA 4FZFB 3GI3A 4K1BA 3ZCLA 3DJ7A 3VHEA 3FL5A 4F70A 2G2IA 2OJFE 4EOSA 4PNKA 4O7SA 2QI8A 1XHAA 4AACA 1UA2A 1OPLA 1KOAA 2BAKA 1REJA 4IAIA 3VRZA 5CAQA 1PYEA 3QXOA 3E88A 3NGAA 2JDSA 3VIDA 3DA6A 2CLQA 4EH7A 5AUYA 3R2YA 4EH5A 4V0GB 5JRSA 5DWRA 4S32A 3FMNA 3OT3A 5IQCA 4A4XA 3OOMA 4B8MA 5KMMA 4HNIA 4IH8A 2QO7A 5BQ0A 4QRCA 2GMXA 5KBQA 3QZFA 5EYMA 3NIEA 3RGFA 4AE9A 3OEFX 1IR3A 1OKZA 3I5ZA 4LL5A 4PNIA 3PLAE 4L44A 4KRDA 3DAKA 4GH2A 3MTFA 2GNIA 3DDQA 4HGTA 3QLGA 1VJYA 1NVSA 2X7OA 4TYEA 2F57A 4PQNA 1YXUA 2C0IA 3FKLA 3OS3A 3TIZA 2QHNA 3WYYA 2Z2WA 3NX8A 3VS4A 4WNOA 3LCTA 4F7NA 4ZSAA 4R7IA 5BVOA 3UIMA 4FTJA 4HYUA 3GB2A 5H8GA 2WTCA 3Q6UA 1YXVA 4WNPA 5HE0A 4UMUA 4O22A 2NPQA 2XK9A 4BCOA 4U8ZA 5FTQA 2UZTA 3W0PA 2HOGA 4RIXA 4DEHA 2SRCA 4YJRA 2FO0A 4PTCA 1W0XC 3P4KA 2Q0NA 3A7HA 5CF8A 5K9IA 1WAKA 3NUAA 2OF4A 3FZ1A 4MCVA 2VU3A 3II5A 3HMPA 3AC8A 2VTAA 2XNNA 3KMMA 4KIPA 2BKZA 5H8BA 1BL7A 3QCQA 3B2TA 4N6ZA 3V6RA 4DE4A 4DA5A 3KULA 3JS2A 1PHKA 3NSZA 4U43A 4R6VA 4PMMA 4QMQA 1ST4A 3HKOA 2RFSA 4XMOA 5E8VA 5KKRC 2X8EA 4E6DA 3CGFA 2HZ4A 4L67A 4BBFA 3DFCB 4GK4A 3ZEPA 4IC8A 3NUSA 3EQFA 5HCYA 3Q9ZA 2PZRA 2GCDA 2P2HA 3CEKA 5T3QA 4EYJA 4IACA 4JBQA 2OZAA 2R7BA 3FLYA 2XAMA 4ZTMA 3QHRA 4TYJA 2I0EA 4GFGA 4CFFA 1GIHA 5AA9A 4IVDA 3NUUA 3SLSA 3F9NA 2OH0E 3WBLA 2W5HA 2X39A 3QTZA 4BZNA 2XANA 3EMGA 3MS9A 3R8VA 4RWLA 4LRMA 2VTHA 3GGFA 4RC4A 5GJDA 2GFCA 3DTCA 3HMNA 1G8SA 3OTUA 4L3JA 5DIAA 5CF4A 3DLZA 3S95A 4DH8A 2E2BA 4AXEA 4IVCA 3M42A 5HVKA 4MYGA 3PJCA 1UKIA 4QD6A 3W33A 3O23A 1SNUA 4ORKA 3KREA 2GTNA 5EYDA 3F66A 3C0GA 4PY1A 4FIGA 5D41A 4QTDA 5ICPA 2FSLX 4K9YA 4Q9ZA 5CQUA 5FWKK 4WBOA 2IZSA 3FI8A 1QCFA 3PJ1A 2XIKA 4IM0A 2CGUA 4Z7HA 3NFFB 3UNJA 2UZNA 4JAIA 3V8SA 3IW7A 2HWOA 1LUFA 4FVPA 4JNWA 3GENA 5I0BA 3AT4A 3HDMA 3PE2A 4PMTA 4QMLA 3OG7A 4DEBA 2VWZA 4GVJA 3AD5A 4PX6A 3F82A 5AJQA 1JNKA 3AOXA 1H4LA 5LVOA 4BTMA 3W0RA 3KMUA 4BHNA 2XBAA 4O0RA 4EYMA 4B7TA 2W05A 3EL8A 4LFIA 2P55A 5HO8A 5J95A 4KUJA 2VTLA 2BRMA 3CC6A 4L9IA 4V01A 4PMPA 3EFLA 4IDTA 3W2QA 5L2QA 3D2IA 2W1EA 2VX0A 1JKLA 3EL7A 4OTHA 4D9UA 4H58A 3BBWA 3BQRA 3V8WA 3EZVA 4FRFA 2PMOX 2QG5A 5E1EA 4YNEA 3JY9A 4RLKA 4ZMFA 2ITNA 4A07A 2GFSA 3R7UA 5HLWA 4FL3A 4FTTA 1JKTA 4U80A 4I0TA 4E1ZA 3A99A 1MQBA 3EB0A 4BI0A 3Q52A 4TKSA 4D1XA 3QZHA 2QLQA 4IX6A 4YJSA 4ACMA 1W7HA 5HVYA 4D4VA 3KULB 2B9HA 3EKKA 2PMLX 3LZBA 1QPEA 4IWQA 4UZDA 2HZ0A 4FTNA 4E6CA 3RINA 3GBZA 2PVMA 3QUPA 3UZTA 5BX0A 4TYHA 1PXLA 4RFMA 4YHJA 2CSNA 3FE3A 3UNZA 3OP5A 2FYSA 4BTKA 1WBTA 4L7SA 3RHXA 2LGCA 3W2SA 5FM2A 4FA2A 1DAWA 4IMYA 3TZMA 4F6UA 3EQBA 1KE6A 4ANLA 3A61A 3GFWA 4FIIA 5EM6A 3P9JA 2ERZE 2IZUA 3DCVA 3NDMA 3W8QA 1BI7A 4EUTA 1L8TA 4AZWA 3NYVA 1I09A 3E7OA 5AP7A 3D15A 4L46A 4O7WA 3FL4A 3HUCA 1FINA 2R2PA 3OF0A 4GT4A 4DH7A 3PXRA 4BY9E 1AQ1A 2BDWA 3CLYA 2JIVA 3OROA 3FHIA 2ZJWA 5AP2A 3PXFA 1CTPE 3O8UA 4GS6A 5EOLA 2VTTA 4QP4A 2C6EA 2PVLA 4LDTA 3VRYA 1OM1A 5CEPA 4XG6A 3DBQA 3MPAA 1YOLA 2W06A 3IPHA 4XP0A 5JMSA 3NLBA 3CR0A 4XLIA 4JBVA 2CNUA 4I3ZA 1ZZ2A 4BL1A 5JFWA 4E73A 3LLAA 4O82A 3MVHA 4O4EA 4EOIA 3MESA 4F9AA 1YVJA 3QTXA 2P4IA 1DS5A 2QKWB 3IG7A 2W9ZB 4I5MA 4IM2A 4LUEA 2Y4IC 4X3FB 5EW9A 4EZ3A 4X2GA 3UO4A 5JEBA 2C68A 4P4CA 3BGZA 4JJRA 5CU4A 4WD5A 5HG9A 4AW1A 2C47A 2C3IB 3D4QA 1SVHA 4FV7A 5GNKA 3Q9YA 3IDPA 4D2PA 4KNBA 3A62A 3EN6A 1CSNA 1R1WA 3NS9A 4G34A 3NCGA 1SVEA 1PXIA 4KS7A 5HBJA 1WBNA 3ZO3A 4C02A 3R21A 5HORA 1FGKA 3ETAA 3ID6C 3KIOC 4QYFA 2J7TA 4QMNA 3D0EA 3LMGA 3W2RA 1FVTA 4OAUC 4NL0A 2YM6A 2RG5A 3CGOA 4CZYB 5FBNC 3V8TA 3R9HA 4M69A 5M08A 5KUPA 2XM9A 1STCE 5AR5A 4Q5EA 4BGHA 4EH2A 1WBVA 3TUBA 3U9CA 4FBXA 3LQ5A 2W1ZA 2WIPA 3QRKA 4LG4A 5EM5A 5HIBA 4FTAA 4AXFA 3F3UA 4ZSJA 4HYHA 4UY9A 1R0PA 1UU3A 4C2WA 2J6MA 2H34A 3ZM4A 2J51A 4W4WA 4WNMA 2JDRA 3FLZA 4LRKA 5KMKA 5HG8A 3IK3A 4FEVA 3W0QA 3O50A 3TI1A 4U9AA 2BZIB 4GG5A 5IA0A 5AAGA 4C0TA 2XYNA 5IQGA 5M07A 2OWBA 1QMZA 1WVXA 2VX3A 2XUUA 4TYHB 2ZM3A 5AP5A 1K9AA 3QA8A 2F7XE 5C9CA 3I1AA 5KHXA 5IQEA 4YZNA 5E9EA 1OKYA 3UMXA 3PVGA 2CJMA 3BPRA 3ALOA 2QOOA 3E7VA 4IHPA 3GCQA 2VUWA 2J5EA 4DDIA 4GYGA 2H9VA 3F5PA 3BLHA 4RZWA 2BHHA 2BTSA 3NNUA 5DEYA 4MWIA 2WMVA 2IPXA 3VS0A 4ZP5A 2BROA 3TXOA 4GK2A 3AT2A 3RAHA 2VN9A 3ENHA 3R02A 3GCPA 4G3EA 5ANIA 2BIKB 5IDPA 3WF7A 2WMWA 3WIGA 4AZEA 4BF2A 5AV1A 4CV9A 3QYWA 5E92A 4EK6A 1QPDA 5IQDA 2OFVA 3MY1A 4IB3A 1TKIA 4FKUA 2PWLA 3OUNB 5CASA 4EK3A 5A9UA 3R30A 4HGSA 4OT5A 3JR1A 1NT2A 5IEXA 4LV7A 3QD4A 4BCPA 4LMNA 3SHEA 1OI9A 2ZV9A 2VTNA 3AC5A 4UWYA 4A4LA 3BGPA 5HHWA 4EOQA 4BWPA 5J7HA 4QPAA 4M68A 4BKZA 1PXKA 4YJQA 1S9IA 4ZS4A 1B38A 1WFCA 4ZLYA 2A1AB 1OMWA 4IFCA 4EOMA 2BAQA 1YHVA 2YIWA 4JIAA 2GHMA 5JH6A 5K4JA 5LJJA 3QRIA 2OFUA 3FMJA 2WPAA 3GOPA 2PZIA 2CN8A 4WIHA 3ZS5A 1P2AA 4APPA 4BB4A 4XS2A 4BCMA 3KRWA 5J1WA 1DI8A 4BZDA 3LCDA 4WRSA 4EUUA 3VJNA 4Z16A 3KRLA 4M67A 4D5KA 3UOLA 4NU1A 4YR8A 4M69B 2UUEA 5A46A 3AMYA 1SNXA 2QOQA 4FI1A 2C3KA 2C5YA 3AC3A 4XBRA 2UW4A 4FTOA 3GT8A 4NFNA 4RPVA 4E5WA 2G01A 1GAGA 3UQGA 3BLAA 3C5IA 3ORLA 4D4RA 2EU9A 1B39A 1MUOA 3O71A 4FKGA 3HL7A 4EC8A 4NM3A 2E9UA 4ITJA 2W1HA 4CCBA 1NW1A 3CTHA 3ALNA 1URCA 4J99A 2UZWE 3VUKA 3UVPA 5CZIA 2W4OA 4L52A 4X2KA 2XMYA 3IW4A 4QTAA 3W2PA 2W5AA 2VTPA 3NWWA 3QD3A 4J1RA 1W8CA 3HP2A 3VBQA 5G1XA 1W82A 3WF8A 2PUUA 5IQBA 4E5BA 2WMXA 4IAKA 4QMWA 4IB5A 3TNQB 3TKUA 4W9WA 4A9SA 1OL5A 3KC3A 2UW9A 1OUKA 4FICA 4O2PA 4PWNA 4TT7A 4ZSEA 3WYXA 4BCGA 4S2ZA 1U59A 3QCXA 5AR3A 3TT0A 5AP6A 5AR7A 4DYMA 4FF8A 3HAVA 2PZ5A 3HRFA 1PKDA 3C5UA 2R9SA 2Z7LA 2W99B 4MD8E 3K5VA 3FI2A 3RALA 2CCIA 4OTRA 3OW4A 3V3VA 5IH6A 2Y9QA 3TN8A 5LCKA 2XNPA 3VNTA 3D5UA 5L3AA 2IZTA 2X4FA 3ROCA 5DYJA 3R1QA 2C5NA 3MY5A 3UJGA 2R3KA 4Y5QA 4A9YA 4PF4A 5EK7A 5KCVA 3R8ZA 4NZWB 2WTKC 3VUDA 3F5XA 4ZTLA 3W0MA 4J98A 4AFJA 2YIQA 5AAEA 4CQGA 4Y8DA 2H8HA 5FUTA 5IA4A 5GIPE 3Q96A 3HAMA 4RVLA 4FV2A 3MB6A 3R7OA 3FZOA 2HZNA 3DTWA 4EZ7A 2OBJA 5EM8A 2OJGA 4X7QA 5AV0A 2B53A 2QCSA 2QNJA 3LCKA 3PY1A 4NWMA 4R7HA 5B2LA 4BVUA 3D7TA 5TF9A 1MP8A 2RG6A 3DBEA 3ENMA 4JX7A 5HIDA 1AD5A 3RTPA 4F7JA 1G5SA 1OECA 4M8TA 3FXWA 3JUHA 3PIZA 4LGHA 4PPCA 4F6SA 3U55A 2QKRA 4FV4A 3DNDA 4FV9A 3TYKA 3O8TA 3QD0A 1Z5MA 3IOPA 4FTIA 1SZMA 2VNYA 2UW7A 4XV1A 2EVAA 3QTQA 3PXYA 2RFNA 4UALA 4X2JA 4YP8A 1YHSA 1JOWB 2RGPA 3VUGA 3ZBFA 4F1OA 3S0OA 3RK7A 2WAJA 2YISA 4QTCA 5C1QB 4FSUA 4QTEA 4ZTRA 2B7AA 1XO2B 3GCSA 2YJRA 3QUEA 4HYIA 4IZ5A 3CTQA 1ZLTA 4ID7A 2P2IA 3ZUTA 2WQMA 4AX8A 4WKQA 1J1CA 4S31A 5HD7A 4FV8A 4DLJA 3UODA 5DOSA 2C1AA 4AGDA 2YCQA 1R78A 2VZ6A 4RX5A 2B1PA 5IMXA 5IQFA 3SXSA 3ANRA 3UDSA 2ETKA 2R3LA 4O96A 4ANQA 1VZOA 3W10A 3BHTA 3T9TA 2Z8CA 2GQGA 3ZDUA 4DF3A 4R1YA 4CSVA 4DTBA 3L9PA 5KZ0A 4O7LA 5HU9A 2WU7A 4EKLA 4ZSLA 3QCYA 4WG5A 3G2FA 4EH3A 3TNWA 5C27A 3AKKA 4EL9A 4H39A 4CYJA 3MB7A 5M4IA 4UBAA 3TM0A 2V7AA 5E91A 2CMWA 3M2WA 3HX4A 2UVXA 2PVRA 1W2DA 3GU7A 3OCTA 2Y4PA 5D7VA 4DLIA 3WARA 3LPBA 4RMZA 3UE4A 4OTFA 4LOPA 2YA9A 4EI4A 3N51A 4KRCA 4JDJA 2OK1A 3OCGA 4M66A 4L53A 4RJ5A 5IA2A 4LOOA 1XBAA 4JR7A 1YWVA 5ETAA 1HCKA 4NFMA 2YM8A 4IAZA 3TV4A 3PFQA 1YI3A 3KMWA 5JGAA 1U46A 3LLTA 3WOWA 3VBWA 4AZSA 2VV9A 4RT7A 2QONA 5M56A 1IAHA 3VS3A 3F5GA 4NM7A 5EDPA 5E8YA 4QPSA 4BGGA 2YLEA 4C4IA 1JSVA 3RM6A 3ZMMA 5CEQA 3DT1A 4YU2A 4GV1A 4FUYA 4I6QA 3D2KA 2VO6A 4UXQA 4U5JA 3WF9A 3Q2JA 2G15A 3KA0A 3LCOA 3LFDA 4P2KA 2WMAA 1U54A 4OR5A 5E8SA 4D2SA 4E3CA 1FVVA 3SA0A 4HPTE 3GCVA 3FZPA 1OVEA 4C4GA 4EOOA 3NUXA 5HD4A 2B9JA 4XBUA 4MWHA 2HELA 3QBNA 2ZYBA 5IF1A 3UPZA 3I5NA 4IEBA 4W4VA 5AX9A 1YKRA 4JS8A 2HYYA 4MUQA 3AG9A 4YC3A 4GFOA 1ATPE 4S34A 5C01A 4D28A 4I41A 3S00A 4WT6A 2AUHA 3FV8A 3BHVA 4I20A 4AOIA 2YDKA 2YEXA 4AS0A 2ZFYA 5DT4A 3TMOA 1NVQA 3RVGA 3IW5A 1GIJA 3RBWA 3R8LA 4UEUA 3DK6A 3TKIA 5HG7A 1YDTE 5CU3A 4F4PA 4U7ZA 4AP7A 3F69A 3SXFA 3LXNA 3RK5A 2BAJA 4GU9A 4HZRA 3U9NA 5D7AA 2ERKA 4J95A 3G9LX 4JG6A 4RA4A 1YDSE 4QP8A 4NKSA 3QRTA 4FTUA 4XG2A 2PE1A 4Z55A 4BIBA 2WXVA 3FMDA 3P79A 2Y6OA 4GW8A 4YZ9A 4BC6A 5HU3A 1UVRA 3TDWA 5ANJA 3Q5ZA 4RBLA 2JFMA 3QRJA 4I92A 4UYNA 5EYKA 3VS2A 2A19B 4BDEA 5CAPA 5K3YA 3ELJA 3PPJA 1RDQE 3R1YA 4XJ0A 2YLFA 4HVIA 2CGXA 5F95A 3LFAA 5LMKA 4FMQA 3VO3A 4J96A 1OITA 1H00A 2I0YA 3HV3A 4FV6A 5FXQA 5HEZA 4AA4A 4EQCA 4Z3VA 5M53A 3SGCA 4PDYA 3QTUA 3ZO2A 3BEGA 4JI9A 2WB8A 2VO0A 3UC4A 3CTJA 3MPMA 2UVYA 4NUSA 4IZ7A 4JDHA 3T8OA 1Q8TA 3R01A 1MQ4A 4F9YA 2DUVA 2NO3A 5EDQA 3OXZA 4L42A 4ZS0A 3ORZA 4KS8A 1ZYCA 1UV5A 5CVFA 3I7BA 5CU6A 5HE1A 3O7LD 3RPYA 1IEPA 3MYGA 1B6CB 4K0YA 4GU6A 5DA3A 4CFWA 3LOKA 5BUEA 5HX6A 2BCJA 2QO2A 3HNGA 4JT3A 2NNWB 4FKQA 4XUFA 3DK7A 4F0FA 1VEBA 3PPKA 3PYYA 4FNWA 4C4EA 3PRFA 1OL1A 3ZONA 4U3YA 5JK3A 2UZEA 4O4BB 4S33A 3ZXTA 3U4UA 3MFSA 1U54B 2BUJA 1Q8UA 4ACDA 3OXIA 3V51A 3PZHA 4AZFA 5CVHA 5K5XA 4QMXA 4XG9A 2DQ7X 3H9RA 5AP4A 3JXWA 5M4FA 2B4SB 4R77A 4G3CA 1O9UA 3DAEA 4BZOA 2PPQA 3KK9A 3UOHA 1OGYA 3UNKA 4FSQA 4YLKA 4QMUA 3HA6A 5DHJA 3ZLXA 4WUNA 4DITA 4I6LA 3FMKA 4IANA 2XIYA 5CY3A 5D12A 3U51A 2J2IB 2IW9A 2XB7A 5J79A 4N4SA 5EI8A 5L8LA 3QWJA 2FSMX 2VWVA 1WMKA 4G5JA 4QT1A 5AX3A 4IW0A 3FYKX 3WI6A 4BDCA 3IONA 3DDPA 4M97A 4RVTA 5A4QA 3HRBA 4DGGA 1ZOGA 4XG7A 4Y73A 2HXQA 3C4CA 4DT9A 2V22A 3UQFA 4R3CA 4HCVA 4RC2A 5FLFA 4FTRA 1NA7A 2UW3A 4ZZMA 3DJ6A 4OUCA 3KL8A 4HVDA 4YTHA 4PDSA 3DK3A 4FC0A 4MXXA 2W1IA 3M1SA 4RG0A 3R8MA 3RPRA 4YUQA 5CANA 2ETRA 4MK0A 1MRVA 3BU3A 1YWRA 3LIJA 3CQEA 3ZXZA 3RHKA 3IOKA 4DGMA 3P08A 1OPJA 2ESMA 1PKGA 5IQIA 3A4OX 4EHEA 4AAYA 4FK6A 2EWAA 3DKCA 2R3JA 4EOLA 1BL6A 3R1SA 4IX3A 4LL0A 5L2SA 3KVWA 3S1HA 3TUDA 1OBDA 2CNQA 4AN3A 3E87A 2YCSA 1QPCA 4G2FA 4EOKA 4C58A 3V01A 5DE2A 3OY3A 4FTMA 2WTDA 2VWXA 3ORPA 4FZAB 4FYNA 4YZDA 2UVZA 1ZARA 2J50A 3LVPA 4BBMA 1EH4A 4TWOA 1YWNA 1ZAOA 3DAJA 1ZRZA 2XBJA 3CP9A 4J7BA 5FXSA 3R9RA 5EKOA 1TQIA 1H0VA 5FTGA 2PMIA 1G8JA 1UWJA 2B54A 5JFSA 2C6IA 2F2CB 5KO1A 5HCXA 2ONLC 3DOGA 4HPUE 3D5WA 4JL9A 3CS9A 4MXAA 2X4ZA 1Y91A 4XCUA 2V62A 4V05A 5HCZA 3TNHA 4CTBA 3SXRA 4N70A 4JLCA 5HZNA 4I93A 5LXMA 4QMMA 5AP3A 3SG9A 1URWA 5L4QA 4OAVB 2LAVA 3A60A 2X0PA 3N9XA 5KZIA 3OMVA 4MX9A 2PL0A 3GC9A 2OJ9A 3PIXA 4PL3A 3NRMA 4I5PA 5DT0A 3PY3A 5EFQA 1SYKA 3W18A 5K0XA 5EQEA 3U54A 2HIWA 3UZRA 4QYYA 2E9NA 4BI1A 4DFUA 3DBFA 3FAAA 3FEGA 5HO7A 4YBKA 5B0XA 3U8WA 2PVYA 1M17A 4WSQA 4MD7E 3VS5A 4C7TA 3NR9A 2BMCA 3H0YA 3PA4A 4JMQA 1ZOHA 5ANDA 4UX9A 3QXPA 5AFVA 3NW6A 1TFFA 3OW3A 4NK9A 1H1SA 3MV5A 4YTFA 2ZMCA 2FH9A 2XNBA 4FOBA 4BTJA 5BVDA 5J9LA 1PXPA 3ACKA 3FMHA 3PP0A 4FV3A 3FXXA 5KMIA 3T3VA 5L2TA 4R5YA 2HW7A 3C4ZA 3IS5A 4RJ7A 1Z9XA 3K5UA 4WG3A 3ZH8A 3G15A 3GU6A 4CXAA 1KWPA 3PJ8A 5HNIX 3T9IA 4O7TA 3OBJA 4CVAA 4AE6A 4AN2A 3O2MA 5L6WL 5DT3A 4CKIA 4D4YA 3I60A 3NW5A 2R3PA 2UZVA 3E5AA 3FLSA 4YLJA 4CZUA 4HYSA 3A7FA 5AUTA 3F7WA 3KCFA 4JBOA 4XOZA 3HMOA 4FTQA 4YO4A 4IC7A 3SAYA 5FEQA 4ANNA 2UZLA 4D4SA 5J9YA 3N4UA 2UZBA 2YIYA 4GCJA 4TWNA 1XBCA 3HDNA 2PULA 1QPJA 5C4LA 3VF8A 4USDA 3VHKA 3ZZWA 4FKWA 4MQ2A 3UOKA 4AGCA 2OIBA 5CALA 2JDVA