2A19B

Pkr kinase domain- eif2alpha- amp-pnp complex.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
273
structure length
263
Chain Sequence
AHTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLINRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
total genus 82
structure length 263
sequence length 273
chains with identical sequence C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2a19B02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2a19B01
4AOIA 1TVOA 2WMUA 3HDNA 4HYSA 3ZDIA 4PY1A 4O86A 3FXXA 4NFMA 3A4OX 1GJOA 3QCSA 4CFNA 4GT5A 3BQRA 1NVQA 1YOLA 3CEKA 5CAUA 1W0XC 3UVQA 5CYIA 3ZEPA 4APCA 4BI1A 4J95A 3CQUA 1H26A 3RHXA 4BDGA 4XP0A 5IQDA 3LJ2A 4RX5A 5ETFA 4PPAA 3CTQA 4IFCA 4AUAA 4G3FA 5F9EA 2ITWA 2YDKA 2AC5A 3UC4A 3CTHA 1FQ1B 3G9LX 1QPCA 1XBCA 2WEVA 3QLFA 3OY1A 3I79A 4FZDB 3S00A 2W96B 3EQGA 4P7EA 1YOMA 4I6BA 3VS3A 4DEHA 2C3KA 3QQUA 4KBKA 5DEWA 3W2QA 4MF0A 3M1SA 4LUDA 4GYGA 2JDSA 3DDPA 4H05A 4BDFA 4R7BA 1YI4A 1CKJA 1OUKA 1Q8TA 2Q0BA 3R7IA 3VHEA 4DLIA 3DB8A 4O84A 4QO9A 3PRIA 4ANOA 1R0EA 3R7EA 4FTTA 4W8DA 2Y7JA 2O64A 3LFQA 2VAGA 2BAQA 4RIOA 2Z2WA 3IK3A 3VUTA 3KREA 4IX6A 1OL1A 1UWHA 5F1ZA 3UQGA 2PUNA 4OBQA 3AT4A 2WOTA 3SXFA 1B6CB 4EOQA 4KIOA 4IAZA 3K5UA 4Q5HA 2QONA 2VD5A 3D14A 2C6DA 3HDMA 2VWBA 4L7SA 1ZY4A 3LXNA 5CU4A 5AA9A 4YJQA 3VW8A 5CEQA 4Z55A 3RNIA 3K3JA 4EOKA 1OKYA 1I09A 1UNHA 1Q3WA 4UEUA 1R78A 5HI2A 1IA8A 4QYGA 3V5PA 4ZJIA 3ZMMA 4RFYA 2CGUA 4RVLA 4XCUA 4BIDA 3A61A 3FQEA 5AEPA 1YQJA 3PPKA 5IU2A 3G90X 1I44A 2FB8A 3CY3A 4WSQA 1JOWB 4E6AA 5IA1A 3SRVB 4FKWA 4DAWA 3FLZA 3KULA 4KRCA 2PULA 3IG7A 4GG7A 4ALVA 1A9UA 4HGSA 3D94A 3NAYA 4IEBA 3QTRA 4UMTA 4WIHA 3SKCA 1U4DA 4A06A 5CT0A 4MD8E 4DGLC 3EQIA 4C61A 3R9DA 4G16A 4B8LA 4PPBA 4RX8A 5KNJA 2ZM4A 3RPVA 4YJRA 4PMSA 4ANLA 3R01A 4FSMA 3ORKA 3OUNB 4EK8A 3MS9A 1IAJA 2OIDA 3LIJA 2VTOA 1UA2A 1Q8WA 2ERKA 4IC8A 5EM8A 2BMCA 1WBVA 5EYKA 3GEQA 2W4JA 1LEWA 4XLVA 4BCMA 4HCUA 2J0MB 1OECA 1RW8A 5HO6A 2ONLA 4DH1A 3JR1A 4O82A 2YM3A 3Q4CA 3KF7A 2J7TA 4GV1A 1JLUE 3MVMA 4AX8A 5DI1A 5BX0A 1JSTA 1O6LA 4GFOA 3RCDA 2G2IA 4YLJA 4DH7A 3ZEWA 2Z7RA 2P0CA 3OZ6A 4IVCA 3F5XA 3VUDA 4S32A 2VO6A 3ZH8A 4YNEA 4H36A 5JGAA 4PRJA 4U5JA 2VTJA 2CNQA 2BZKB 5IQHA 2R3HA 3F6XA 5IA4A 1H00A 5DT4A 3E88A 4CV9A 2Q83A 3EYHA 4NU1A 4R3CA 4R8QA 4KSQA 4JG6A 4PF4A 4JDKA 4EHZA 3MSSA 3QQFA 3F7ZA 3IW4A 3V5TA 2PVLA 4FTQA 5FD2A 1GZKA 4UWYA 2ITOA 4BCHA 2PYWA 5T68A 1KE6A 4RC4A 2YIXA 3PWYA 4BBMA 5JZJA 4FEUA 4BIEA 3C5UA 3F69A 3NAXA 3HRFA 4I0RA 3DZOA 4E93A 4FSWA 5HO7A 1AQ1A 5C8KA 4YHJA 4C36A 1FVVA 4DCEA 4EZ5A 3I6UA 1OITA 4ZXTA 1U54B 3EOCA 4BGGA 5FXSA 3TCPA 4G1WA 4IW0A 4FKRA 4AGCA 3GBZA 3ZSGA 4W9WA 4E6QA 4NFNA 5CAOA 4UV0A 3HMIA 1QCFA 5I9WA 4N4SA 5BVEA 5A4CA 2VO3A 4OTIA 4TWPA 4U41A 5CNOA 3H4JA 3MH3A 3BLHA 3FLNC 3OD6X 2P55A 2HZ0A 1YDRE 1NA7A 2WQNA 4EK6A 5E8YA 5AA8A 2GFCA 3R1QA 3TL8A 1VYWA 5EKNA 4IDTA 1BL6A 5LVLA 3KRWA 5C26A 4CSVA 2XNBA 3KB7A 4HZRA 3W1FA 3E3PA 1BKXA 4PMMA 5L2IA 2W17A 2XM8A 4CTCA 4TNBA 4J52A 3VHKA 3L8XA 4CCBA 3A7IA 4ASZA 3D5VA 4IAKA 4ZJVA 5HORA 3NYOA 4HOKA 3QD4A 2BUJA 2XMYA 4BRXA 5B2KA 4O1OA 5J87A 4JT3A 1FVTA 2BAKA 3E93A 2OGVA 3C4CA 4OTGA 4YR8A 1V0PA 3O51A 2C6IA 5FXRA 1NVSA 1WFCA 1PF8A 3BGZA 2O65A 4L3JA 4TWOA 4WHZA 3S95A 4DFLA 3IDPA 1JSUA 3UIMA 3MTFA 3ZLXA 4J8MA 1ERKA 3PJ1A 5FEDA 3O8UA 3HAMA 2OXDA 3PSDA 3KXMA 5HLPA 4OTFA 3R8PA 5E92A 2X7FA 3OCGA 5IMXA 2VTQA 4TRLA 4HZSA 3F3UA 5IQGA 4XP3A 4QQJA 2OICA 3C7QA 2WMBA 3PJ8A 2UZVA 2OJIA 5AUXA 5AX9A 1Q61A 3C0HA 4IMYA 3VUMA 2XK7A 4OR5A 3U8WA 2XBJA 4IDVA 2HYYA 4IZAA 2R7IA 3O0GA 2VWVA 1ZMVA 4ARKA 1PRYA 3C5IA 2JKKA 3LQ5A 5M55A 3GT8A 4RIYA 5J79A 4I5PA 3GB2A 5DBXA 3UGCA 4CMTA 4QQ5A 2W5AA 5IQBA 4IB3A 2WTDA 4U6RA 2WTCA 1OBDA 3DXQA 3RK7A 3V6RA 4L53A 3VBYA 4RZWA 5CSXA 4IVDA 2HIWA 1OPKA 3R83A 5M4IA 3V01A 3C13A 1OPLA 2QO7A 3E63A 4WNOA 4Y72A 4ZY6A 5CF6A 2QG7A 3UZPA 2HY81 3EQDA 2ITXA 4E20A 3FBVA 4BTMA 2X81A 4QTCA 4D2WA 1DAYA 3FLQA 4ZTNA 4CZTA 4YZDA 3WF6A 3D4QA 2XJ0A 4OUCA 4A9RA 3DZQA 3TN8A 2WD1A 4TN6A 3A2CA 4USDA 1NW1A 3ATTA 3F3ZA 4KIKB 5IQCA 3A8WA 3VS6A 2FSLX 4QPAA 2QOQA 4UMUA 4FICA 4O96A 4ACGA 3BV2A 4FG9A 2HOGA 5HD4A 2JDRA 2IVVA 4EOPA 2QOHA 3Q9XA 4RGJA 5GJGA 4IWDA 2OJGA 3QD0A 4ZSLA 1Q4LA 2YLFA 3EIDA 4D58A 4YJVA 4XMOA 2WMRA 5HE1A 3D5XA 4RSSA 2OKRA 4S34A 4YSMA 4EUUA 4IC7A 2GU8A 4CFFA 2W4OA 2C4GA 3GU4A 4M15A 4YZ9A 1Q99A 3RZBA 5CVHA 5ANJA 5L2TA 2XH5A 5LCJA 2VTMA 3OCBA 4PDPA 3T9TA 5AR8A 2QG5A 4F65A 3KQ7A 2FSTX 3Q52A 1GZNA 3R21A 4V0GA 4FVQA 5EKOA 3ALOA 3RJCA 4ACHA 2OZOA 2GQRA 3VUIA 1CMKE 3EN5A 4YJSA 2RG6A 3ORZA 5JRSA 4FTIA 2DUVA 4FV0A 5FP5A 1IA9A 2QOFA 3G9NA 5LARA 3R9RA 4LV8A 4CQEA 2C3LA 3NUXA 3DNEA 2HENA 4H39A 3SD0A 3GC7A 1XH4A 3JXWA 2QD9A 3FZ1A 3OS3A 2J0JA 2YDIA 4LL5A 2ZM1A 5CTPA 3LPBA 4C59A 3LJ1A 5M4FA 5KMOA 2VWIA 3ERKA 4TYHB 3SXSA 4DBNA 4FTAA 4ANMA 5KUPA 5E9EA 3POOA 1PMVA 2PVJA 2CN8A 1P2AA 1UNGA 2RIOA 1OIRA 2BAJA 4K2RA 5EDQA 2ZYBA 4I24A 4GH2A 1KV2A 4FK6A 3ATSA 3AXWA 2WQBA 3EZRA 1W98A 4Y8DA 1FMOE 4S2ZA 3NCZA 5LVPA 2V7AA 2VZ6A 5AV1A 2GCDA 4DEDA 1XBBA 2YHVA 2XK9A 4DEAA 4U80A 2WMQA 2C5NA 5D10A 3NR9A 2CCHA 3TM0A 4DFZE 3I0QA 1K2PA 3KVXA 4BZOA 2JFMA 4RC2A 4M69A 4RRVA 2XNNA 4USEA 3MVHA 4G3CA 2H8HA 1GIIA 3WYYA 4E5WA 2XP2A 4O2PA 5CEKA 3D7ZA 2XJ1A 3GOKA 3LXPA 4HPUE 3DBCA 3OHTA 3PRFA 2X6DA 2RF9A 4BHZA 3DK7A 5DR9A 3R28A 5CF5A 4XLIA 1J7IA 3CS9A 5E8ZA 4AT5A 1QPDA 2OXXA 3GC9A 5TF9A 3C4EA 2PHKA 2WZJA 3FLSA 5FM2A 4AQCA 4EZ7A 4M12A 3AC4A 2YWPA 1PMUA 3NUYA 4I0TA 4RQVA 3EFLA 3PZEA 3PG3A 4QRCA 3PP0A 4RWLA 5HCZA 2XBAA 4O83A 3KXGA 1YDSE 4HNIA 5LMKA 4Z3VA 3EJ1A 3S1HA 1ZOGA 2WHBA 1YHWA 3ACJA 3P4KA 4QMPA 4RA4A 4YJNA 3QCYA 4NM5A 3RZFA 3FMDA 4BBFA 4E4XA 3TKIA 3FI8A 2JKOA 2BVAA 3DTWA 4U7ZA 3BZ3A 2GS6A 4FZ6A 3SW4A 4F6SA 2G2FA 3MV5A 3QL8A 1GAGA 2J0KA 3NVMB 2XEYA 4HVDA 4QMMA 3UG2A 1UVRA 4K11A 4I5HA 4QOXA 5KMMA 4JDHA 3R7UA 4FKTA 4AZVA 1KV1A 1UWJA 4X6QC 4K9YA 4BF2A 4DFXE 3EKNA 4O0YA 3Q9ZA 3SG8A 2EWAA 3COIA 1OPJA 4FZ7A 2GTNA 3UTOA 3CE3A 3MH1A 1Q62A 2BRNA 3QZGA 4JR7A 3VBQA 4YBKA 2UW4A 4FUXA 2X6EA 4CT1A 3QWJA 2DWBA 5KMNA 4O0XA 1JWHA 2ETRA 5CSPA 4WA9A 2CNUA 2FH9A 1MQBA 2OBJA 2QQ7A 3R6XA 2OW3A 4DTKA 2PUPA 1OL5A 3WF9A 3UNJA 3K3IA 3LFEA 2R0IA 3QRIA 3RTPA 1P4FA 2RL5A 3S2PA 4R78A 4EK3A 3ROCA 1VR2A 2JGZA 4C4HA 3L9PA 3V8SA 5FG8A 4GU6A 4UYNA 2AUHA 4NEUA 1A06A 5DWRA 3V5WA 4BL1A 3LKMA 4PDSA 2EVAA 4MCVA 4WNKA 4ZTSA 5KZIA 3ZBXA 3F3TA 3HUBA 2XK6A 2X8DA 1VZOA 2C69A 3NIZA 3FKOA 4FG8A 2R3IA 3MGYA 3PUPA 4I0SA 4TYEA 5C8MA 3MA3A 3ZLYA 5CU0A 5JFWA 2R3FA 2EXMA 3KMMA 5JSMA 3ZM4A 2OF4A 2ONLC 4BICA 3ZO1A 3D5UA 2VX1A 3PWDA 4F9BA 2FGIA 2F4JA 4GFMA 2UVYA 3I7BA 3R1SA 2BRHA 1OKZA 3KCKA 3BE2A 3D9VA 3SRVA 3TNQB 4E73A 5JK3A 3ZFXA 3GCVA 4G9CA 1GIHA 3QTUA 1EH4A 3FSKA 1GZOA 4JX7A 4YBJA 4FTNA 4DEGA 3E7VA 4GG5A 5EHOA 3CY2A 1R39A 5CQWA 3R7YA 4M67A 4FGRA 4H3PA 5T3QA 2IVSA 4L68A 5IDPA 4DG2E 2UZDA 2BZHB 3NUPA 4RJ4A 4BYIA 4NW6A 1Y57A 3SG9A 5IQEA 4X7QA 3VF8A 1NY3A 3PA4A 3HMMA 3CD3A 4UMQA 4E4LA 1PY5A 4YC8A 3KK8A 2R3GA 4WUAA 4CQGA 3DBEA 4ZTQA 3NW6A 4JDJA 3A7HA 5EK7A 1S9IA 4JXFA 2KTYA 3M42A 5HU9A 2XA4A 4EH2A 2V62A 5DE2A 2XKDA 3C1XA 2BCJA 5ANKA 3CD8A 5EW8A 3WZKA 2OJFE 4I94A 4F1TA 3PVWA 4BKZA 3SA0A 5HO8A 2W0JA 4UMRA 5M07A 4MTAA 4ITJA 1TKIA 3QFVA 2XKFA 3W8QA 1DM2A 3PY1A 4C38A 5JQ5A 5KHWA 2XM9A 3IGGA 3SOAA 2C5OA 4BVUA 5J9ZA 2QHNA 3C0GA 3NUUA 3LFDA 3ZTXA 4E6DA 2XRWA 1OZ1A 4IADA 4IH8A 4KBAA 4EH7A 3ORTA 1PJKA 1PXIA 3B8RA 2WIPA 4QMWA 3AMAA 2RFNA 1KE8A 3UO5A 5K5NA 5IQFA 3R2BA 5LCKA 4FIEA 4ZY4A 4WBBB 4A7CA 3BWFA 1WZYA 3VO3A 3UOJA 4J7BA 4P4CA 5I9VA 4HYUA 5L6WL 4NIFA 2J9MA 4PV0A 2ZB1A 3R63A 1NVRA 1YI6A 5F4NA 5B0XA 3RWPA 4C02A 5JFVA 4ZZMA 2J5FA 3AT3A 2CGVA 2WQMA 3FMMA 4ERKA 3AGLA 5KBQA 1WMKA 5IDNA 4MF1A 1ND4A 4FL1A 3SQQA 4JIAA 4JI9A 3ODZX 5KHXA 4WOVA 4D4VA 3R1NA 4XG7A 2J4ZA 3G6GA 2YACA 3LMIA 4BCIA 5KE0A 2JEDA 2C5VA 3IQ7A 2PMOX 1JVPP 2OJ9A 2I7QA 5CENA 1Q97A 3V8WA 4AA0A 4RIXA 3GU7A 1W84A 3KY2A 3AMYA 2VV9A 2XK4A 3FXZA 3OOGA 2B7AA 1BUHA 3DAEA 4AW5A 4MXYA 3BHUA 3FAAA 3PY0A 3QZIA 2PVNA 4G5JA 4RVKA 4FNZA 2ZJWA 4QYHA 4D4RA 5EW9A 4DE4A 4AW0A 5AAGA 3B2TA 3EFWA 3LCDA 4LRKA 5AV2A 2H34A 3KL8A 2GSFA 1PKDA 4DC2A 3PDTA 4FGBA 3NYNA 4O6LA 3TUDA 4BHNA 3FZRA 5BYLA 5IUHA 1H8FA 2X1NA 4IX5A 5HBJA 3ID6C 3C51A 1IRKA 5HESA 4FV7A 2ZV2A 1RDQE 3CPBA 1J91A 3B8QA 3PXRA 2VTAA 1ZYSA 2X4FA 4FV6A 2YFXA 3RKBA 2OJJA 4O0TA 4G2FA 1OIQA 5HBHA 2GS2A 4RWKA 4C62A 2Z02A 4QYFA 3NRMA 3R8VA 3O23A 3KN5A 4N70A 4WKQA 4FKJA 3MB7A 3KRXA 2PVFA 1JNKA 3WILA 3A7GA 4I21A 2W4KA 4Z9LA 2IZUA 3JPVA 3ZZEA 4MQ2A 4EQUA 4ID7A 1SZMA 3E64A 2HCKA 4CTBA 1W7HA 3IGOA 2VTPA 3DBFA 3BKBA 4K33A 3P7BA 2NPQA 5DPVA 4AZFA 5DRDA 4NZWB 4E7WA 3ULZA 3WOWA 5FTGA 2R9SA 2I0VA 4IZ7A 2XYUA 4EOIA 3R9HA 4EHEA 4IHPA 4XNEA 5J5SA 2J0IA 4PTGA 4YMJA 3IS5A 3CKXA 4IXPA 3RM6A 3VBTA 1Q3DA 4X2GA 5BPYA 5DMZA 4I41A 3RK9A 4BB4A 4TTHB 4DFBA 3Q2MA 5FP6A 4ITIA 4LG4A 4XV1A 1K9AA 3AC8A 4J98A 4MNEB 2UZUE 3G51A 1M2QA 3PXYA 4WG4A 2VTNA 2HZIA 5JT2A 2BKZA 4ZLOA 2WPAA 2W06A 4FSTA 1QPJA 4F7NA 5CEOA 2UZNA 2ZDUA 3LZBA 3E8NA 4FL2A 4PNIA 2JLDA 3R8LA 3ZOSA 4AN9A 1MQ4A 3MIYA 3TZ7A 3IPHA 3AD5A 3I7CA 4FKGA 4AFEA 2W9FB 2VWYA 3F3WA 3RAIA 4FKVA 4F6WA 4TYIA 4U81A 3R9NA 4O7NA 3FMJA 2RFSA 5F94A 4WRGA 2QO2A 2C6KA 2CLXA 3FQSA 4LI5A 4JBQA 3EQBA 4JJRA 3MY0A 5HG7A 4CLJA 4IVBA 2QR7A 4F0FA 5I0BA 4WD5A 2CJMA 2VRXA 4CD0A 3O17A 2QU5A 4BFMA 4FI1A 3FQHA 3P7CA 4QMSA 4I6FA 1UU8A 4G5PA 4F9YA 1OIUA 4ANNA 2W1DA 2OZAA 3EWHA 3GCUA 4XJ0A 4HVGA 2G15A 1K3AA 4EORA 4YO4A 4E5BA 4PL3A 4NUSA 3CKWA 4ZTRA 1SVGA 4BKJA 5AP1A 3U4WA 3V5LA 5IEXA 5FGKA 3Q4ZA 4C4GA 5KMIA 4N6YA 3I6WA 4YP8A 2W1GA 3F61A 1KOBA 1Z57A 4YJUA 4F7SA 3NLBA 4NYEA 3SOCA 2G9XA 2W1HA 5HE3A 3EL8A 4XG3A 4QMXA 5DFPA 4CFXA 5M51A 4QPSA 2HXQA 2XRUA 3RNYA 3RK5A 4DH5A 3DBDA 5HLWA 1PXNA 3CXWA 4AA5A 4FEXA 2BHHA 4MBLA 3TV7A 5IQAA 4IZYA 5AV0A 3MA6A 1OL6A 3OTVA 3TG1A 1IASA 4DT8A 4UYAA 3FZOA 4EC9A 5GINE 3FLWA 4LGGA 4JAJA 2VTRA 3BYVA 4D2VA 1KUTA 5DH3A 3QXOA 5LMKC 3ANRA 4N6ZA 3KRRA 3W16A 2WTKC 3RPSA 3UP2A 4IAIA 5LVMA 3VS2A 4M13A 2UUEA 4ALUA 3DOGA 4F63A 5DVRA 2WIHA 3W2SA 2WB8A 3I81A 3OG7A 2C6TA 3E7OA 4FKQA 3R71A 4HPTE 1HCLA 5AM6A 3MESA 3RWQA 4ZY5A 2I6LA 4LQMA 4I3ZA 2XIYA 5BMSA 3ZBFA 4YJPA 3NS9A 3ORPA 1JKLA 5E8UA 2JFLA 4Q9ZA 1ZRZA 2AC3A 3R02A 2OLCA 3V04A 1CDKA 3FPQA 4XYFA 4A4OA 3RM7A 5GZ8A 1Q8ZA 2HK5A 4QP2A 2E9UA 1YOJA 2XK8A 3UVPA 3DLSA 2OI4X 3H0YA 4O7ZA 5CXHA 3DKFA 5KMKA 1FOTA 4QMVA 4MXOA 4KIQA 3VF9A 1CKPA 3CTJA 3VULA 3W10A 3II5A 5K9IA 5J7HA 4QMTA 4GT3A 4X0MA 2E9OA 3LXLA 3PE2A 4JOAA 5TKDA 4AT4A 5CAQA 5LVOA 5CZHA 5J5TA 4RVMA 4QD6A 3BHHA 4B6LA 3BRBA 2YIQA 2GS7A 4IM3A 4FV5A 4O81A 2NO3A 4NH1A 3TJCA 5JRQA 4EI4A 3UVRA 1TQMA 2R3RA 3F66A 3TTJA 4M0ZA 3WI6A 2RFDA 4W4XA 4DGNA 4RBLA 1FBNA 5EOLA 5ACBC 4FSRA 2WU6A 5CF4A 3QKMA 4O0WA 4IJPA 3QCXA 1BMKA 3ROYA 3O7LD 4FNYA 4IM2A 5IH6A 4DCAA 4APPA 3L9NA 3PG1A 2BFYA 3FKNA 4PUZA 3A62A 3WBLA 5CU2A 4MXXA 3I5NA 3CQWA 1NXKA 5LMAA 2C6EA 2X7GA 3GFWA 2CGXA 2ITNA 3OVVA 4D2RA 3DBQA 3LW0A 2VX0A 3GENA 3TT0A 4GT4A 1WVWA 3O50A 3PIYA 3ZZWA 1OMWA 2Y4IB 4W8EA 5KMLA 2OXYA 4QT1A 4ASXA 3EN4A 1Q5KA 5AR5A 2C47A 2GTMA 4YLLA 2ZV8A 5E8VA 5FEQA 2CPKE 2W99B 1JPAA 4MD9E 5AUUA 3PYYA 3SGCA 3VS4A 3NW5A 5HG5A 2HWOA 1FGIA 5ANDA 2O5KA 3F5UA 4NKAA 4FOBA 3VUGA 3FPMA 1FPUA 2X2LA 3H9FA 2A19B 5DR6A 4UY9A 5A9UA 5JFXA 3QA8A 2GNLA 2YDJA 4BCNA 4OBOA 1ZY5A 2R64A 3PPZA 1Q8YA 3P1AA 1QPEA 4RJ6A 4DYMA 3FV8A 5EW3A 2Y4IC 4RIWB 3Q5ZA 5C8NA 2W1EA 3RAWA 2YCQA 5LMBA 5F95A 2WTJA 5FRIA 5D9HA 3D7TB 5M53A 5AV4A 4ITHA 2A1AB 4XG9A 2FSOX 5DOSA 4C3RA 1XHAA 5LQFA 3VNTA 4DEBA 3UZTA 5ETAA 1IEPA 4ZTHA 3DQWA 5DT0A 4KABA 2GDOA 4R77A 2ERZE 2WO6A 3QWKA 3OWKA 3LM5A 2EB2A 2F7ZE 3TXOA 1JKSA 3I4BA 3E92A 3OW3A 4Z16A 3P23A 4HGTA 3D2IA 5I9ZA 4EJNA 4CYJA 4L01A 4E6CA 3U9NA 5JKGA 4ENXA 3COKA 2B53A 1YRPA 1HCKA 3BYSA 4G34A 2BR1A 3ZO4A 4EWHA 4RX7A 4G6NA 4NCTA 5GJDA 4EOLA 4DT9A 5CSHA 3H3CA 4FVPA 4F1MA 4JDIA 4B99A 3VC4A 5IPJA 5K4IA 4X6RA 5HE0A 5CAPA 4YNOA 3VBVA 4JQEA 3NUAA 4XP2A 5ICPA 5KCVA 4OAVB 4QNYA 2B9FA 3EZVA 3PXFA 4IBMA 4O0UA 4D2PA 4X3FA 4DTBA 3TUCA 2UW8A 3TEIA 2DYLA 3AG9A 3EQFA 3GU6A 3WZDA 2YAKA 2VTLA 4FUYA 4EOJA 4CKJA 3R30A 3EN6A 1WBPA 5ANGA 4EHVA 3F2RA 3PE1A 3U87A 2H96A 4AW2A 4FKPA 1E1XA 2WQEA 3KXXA 4DBXA 3I1AA 2F9GA 3Q6WA 4HNFA 4GK3A 2YA9A 3ZO3A 3N4VA 4FV9A 3F88A 5EM6A 4CFUA 5J7BA 3S0OA 4W4YA 4D1XA 2OK1A 4U3ZA 5CVGA 3U54A 3UJGA 5CI6A 2NRUA 3FJQE 4XS2A 4NSTA 4ZSJA 4C34A 4FTRA 5EOBA 3QRKA 4GS6A 4MX9A 3BWJA 5FXQA 3RBWA 3T9IA 4F9CA 5HX6A 3HECA 3DKGA 5JEBA 2R3MA 4AXAA 5H2UA 3ET7A 1UU3A 3CBLA 3EYGA 2ITPA 3ALNA 3HV5A 4U8ZA 4DGGA 3Q32A 2CKPA 5HNGA 3BHYA 1ZARA 4L7FA 5BYYA 2VGOA 4I6HA 5I3RA 1H1RA 5GZ9A 4A9TA 3ULIA 2UW3A 3NNWA 3TNPC 2ZMDA 4U0IA 3ZFYA 4R3PA 2O3PA 4KKGA 3MJ1A 1M7QA 3IOPA 4OTPA 4ZZNA 1CTPE 4C4IA 1XR1A 2PZRA 3AQVA 5AUVA 5A3XA 1P14A 4G17A 2PVKA 1QL6A 5CZIA 3DXPA 1Y8YA 3QAME 3UO4A 4ERWA 2XNEA 4BKYA 4BZDA 3QLGA 4EYMA 2F57A 2NNWB 3H9OA 2ZV9A 2A4LA 2GMXA 4PMTA 4FKUA 5LVNA 3A4PA 3IDBA 4MXCA 2OH0E 4BCJA 1WBOA 4FEVA 4TXCA 4PDOA 2PU8A 3FY2A 2XVDA 4AS0A 2F7EE 4AG8A 1KE5A 2EB3A 5AR2A 4GIIA 4EKKA 4UX9A 5EYMA 3AGMA 4NM0A 4H1MA 4XG8A 3KKVA 1XQZA 1JKTA 2O0UA 2XJ2A 3VS7A 1WAKA 4FT9A 5ANOA 1YXUA 2QLQA 3RALA 4JIKA 3KA0A 4KUJA 2BPMA 2VWWA 2XIRA 4OGRA 4H1JA 4MXAA 4FE2A 4O7WA 2VO7A 3BHVA 1IG1A 3OF0A 5KZ0A 4C57A 1ZYDA 1CSNA 3TDWA 3HP5A 3L9LA 4P90A 3S4QA 2J50A 4KSPA 4MYGA 3UZRA 2ZDTA 2YIYA 3FZTA 3DT1A 4ZMEA 1STCE 5AP2A 3R7VA 3A99A 4Q5EA 4UALA 3COHA 2WMXA 2QODA 3P08A 4DHFA 3ZUVA 1UU7A 4NM3A 5EI6A 5AUZA 5H8EA 1NT2A 4BTJA 2P2HA 2C5XA 1RJBA 5B2LA 3QX2A 3ORXA 1REKA 2CKEA 3EN9A 3ANQA 2XUUA 3IO7A 3UE4A 3G0FA 4FT0A 4RA5A 5HX8A 1ZOEA 3R0TA 4QNAA 4Y85A 4D0XA 3C50A 5EQYA 1Y91A 4JX3A 1W82A 2C6LA 3IW6A 3BV3A 4YZMA 1YXXA 1XH9A 2W5BA 3R8MA 4KD1A 5BVWA 3GCSA 4QP3A 3BPRA 2JBPA 1ZMUA 1H07A 1ZAOA 2VTSA 4FZFB 3KFAA 4B9DA 4GKHA 4ORKA 2OFUA 4ONAA 3HMOA 3R00A 5AAFA 4CLIA 4Z7HA 2I1MA 2Y9QA 4IM0A 2EXCX 2OIQA 1B38A 4YTIA 3VS1A 2J0LA 4GMYA 4Z7GA 2XZSA 3C4XA 4A07A 3DPKA 3MFTA 2R3KA 3HL7A 3LE6A 4FF8A 1YWNA 2ITVA 4QPMA 3BU3A 3LMGA 4OLIA 4TY1A 4XV3A 2QI8A 4K8AA 3HMPA 5D12A 2Z8CA 4NM7A 4G3GA 4KS8A 2QOKA 5L3AA 2QOCA 5HGIA 3PP1A 5CVFA 1FVRA 3MTLA 3QD2B 4HCTA 4BZNA 3KN6A 3QF9A 2BZJA 4HJOA 4M14A 3GU5A 3L1SA 2B4SB 3MYGA 4IWQA 4ZP5A 3TIZA 3VRYA 3R73A 4RX9A 4C4FA 4MNFA 3ITZA 5D41A 1MRVA 2BKKA 4PNKA 4JRNA 4I4FA 5CS6A 3NMUF 4AFJA 2ACXA 4PWNA 4O6EA 3BBTB 2BILB 5A14A 4O27B 2BIYA 2CDZA 2PE0A 4BI2A 4CRLA 3U6IA 3TIYA 2HXLA 2JKMA 2B9HA 4RMZA 2WXVA 4F64A 4CXAA 4FTLA 1LUFA 5L6OA 5I9YA 3UYTA 3R8UA 2QHMA 4HGEA 1IR3A 2W1CA 5A54A 5CASA 2R3LA 5HVYA 2PE2A 3AC5A 2FYSA 4FBXA 4M3QA 3UPZA 2XCHA 2Z7SA 4OT5A 3NYVA 3P79A 3PFQA 4WUNA 4PTCA 5JGBA 4TKSA 2OIBA 4C2WA 4U42A 1GNGA 4FTJA 5CEPA 3KEXA 5IF1A 2R3QA 3LLAA 4R3RA 4QP8A 4U97A 4O91A 5FBNC 3C4ZA 3LQ3A 3F2NA 1XJDA 4EL9A 1M7NA 3PXZA 2YM4A 2A0CX 3JS2A 5ANIA 2IJMA 3EQHA 3CC6A 2P2IA 5BVOA 5L8LA 1LPUA 4L3LA 4AP7A 1PYXA 1G5SA 4GIHA 2UZEA 3DNDA 3LMHA 1ATPE 3MVJA 2XNGA 3HEGA 3PSCA 4M66A 5D7VA 5AX3A 2VWXA 3BX5A 3RCJA 4AGDA 4AOTA 5HTCA 3FMHA 4PPCA 4X3JA 3ORNA 3DB6A 4P2KA 3TV4A 4DH3A 4BC6A 4XOZA 3IOKA 3QUEA 4EOSA 4C4JA 4ACCA 1M52A 3F2AA 2XNPA 3D5WA 3MBLA 4O7TA 4EH8A 1JAMA 2YITA 1BLXA 5I9UA 3DJ7A 2X4ZA 4FNWA 2WAJA 2R5TA 2G01A 3D0EA 3HVCA 3D2KA 4ZJJA 2JDTA 3MH2A 4FKOA 4RVTA 2W1ZA 3OW4A 4ZSAA 3T8OA 2Y0AA 4DEEA 5D7AA 1YDTE 4F7JA 3ORIA 3DCVA 4IJ9A 5LJJA 4FV2A 2GHLA 2R2PA 1P4OA 1OI9A 3GVUA 2CGWA 5CU6A 3BI6A 4XBRA 2XKCA 3DAJA 4F6UA 3LXKA 1BX6A 2YM6A 3F5PA 3L8VA 2CSNA 4RWJA 1UKIA 4R1YA 3THBA 1ZOHA 2WFYA 3ZU7A 2Z7QA 5CLPA 3DFCB 3BGPA 4DITA 2O2UA 2ITYA 2XF0A 3LCOA 5HICA 3W32A 4AZTA 4PP7A 5TO8A 3GI3A 4BDBA 2PZPA 3R1YA 4K1BA 2WGJA 1YXTA 3FSFA 2IZTA 5L4QA 2J51A 4I6QA 3LCKA 4E3CA 1T46A 4JBPA 4GK2A 2FA2A 5EI2A 2QNJA 3FC2A 5HIEA 3P86A 3Q53A 3TNHA 3OEFX 4FG7A 5FQDC 3QALE 5AADA 4Q9SA 4YTFA 3FLYA 2XEZA 5AJQA 3Q60A 4YZBA 4ZLYA 3DJ6A 3DLZA 4GCJA 5E8WA 3W2PA 4IX3A 3NYXA 4BDJA 4DG0E 2XNMA 4FX3A 3QTZA 4OT6A 4FVRA 4IE9A 3B2WA 1H4LA 3SVVA 3QQJA 5GJFA 5HCXA 5G1XA 5AR4A 1U54A 3EQCA 3NPCA 3BQCA 3ODYX 4U44A 5EI8A 4J8NA 2W5HA 4XG4A 3TNWA 4GSBA 5M4UA 3PXQA 4FYOA 3MFUA 4DA5A 2EUFB 2GPHA 3OEZA 1S9JA 4KRDA 4LMUA 5HG9A 3ZUTA 3QUDA 4CKRA 3MY1A 5AUTA 4GJ2A 4E1ZA 2J90A 3ZLSA 4RIYB 1GY3A 1UKHA 4J1RA 2QOBA 3H9RA 4RFMA 3G15A 3LFCA 5IEVA 3HLLA 4ZOGA 5EM5A 3RAHA 2I0YA 3UQCA 4FKSA 3EQRA 4EH3A 5EHLA 1M2RA 4KWPA 2UZTA 5HIDA 1W83A 3QQGA 4FOCA 4NTTA 2WMTA 1R0PA 3TTIA 4KKHA 4YUQA 2V7OA 3QTXA 4MXZA 2BHEA 4UMPA 2QC6A 5EYDA 1VEBA 2LGCA 4U3YA 3BBWA 4C3PA 5CY3A 2JAMA 5CU3A 2QU6A 3KC3A 3LJ0A 4M0YA 2C0IA 3VRZA 1U46A 2CKOA 1JQHA 3HAVA 5GHVA 1ZYJA 5HG8A 5BMMA 4UWBA 4L46A 5FDXA 4PX6A 3TACA 4O21A 4WSYA 3MPMA 2GNFA 2QR8A 3HV6A 3O8PA 4O7LA 3Q4UA 3R2YA 3SX9A 2WELA 3TV6A 2JD5A 1OL2A 5BYZA 4RZVA 5TR6A 3PZHA 3MDYA 2YEXA 5FTOA 5TOZA 5ANEA 4FTUA 3SLSA 2RG5A 5AUWA 3QC4A 2R3JA 3BIZA 4CZUA 3PLAE 4JG8A 3OBJA 4KB8A 4PTEA 4RFZA 3UIUA 3RVGA 3QTIA 3WARA 3MI9A 4WG3A 5M09A 1XO2B 2YJSA 2HWPA 1Z9XA 4AE9A 5IQIA 5IMEA 5IA2A 3DQXA 2PTKA 3FMLA 3FHIA 2CKQA 3HV3A 5CEIA 1H01A 2KULA 4V0GB 5F20A 1O6YA 5K4JA 3F82A 4FKIA 4WO5A 3PIZA 4QP7A 2VTIA 3MFSA 2WQOA 3DA6A 2QCSA 4P5QA 5E7RA 5BQ0A 4KIPA 3E8DA 3CIKA 1H28A 3BU6A 1O9UA 4YU2A 3LFFA 3R7OA 4RT7A 5L2SA 3TZMA 5AP7A 4EH5A 5M44A 2OF2A 3OC1A 4RC3A 1YHVA 1SNXA 4U9AA 2C1BA 4EK4A 3HZTA 2NP8A 4GUEA 3TKHA 2OFVA 3HX4A 3ZXTA 4E5AX 3AC1A 3AMBA 4JR3A 4BGHA 5A4EA 3ZRMA 3EH9A 4MKCA 3GQLA 3TNIA 3UMWA 3BELA 5E90A 1M14A 1OVEA 3RGFA 3ZONA 4ANSA 3G6HA 4OBPA 1YW2A 5I9XA 4EOMA 3DTCA 3QXPA 4BCQA 2PL0A 3ENHA 4KIKA 1E1VA 1PXLA 3PTGA 1PXJA 2VUWA 4QMNA 3KCFA 4BTFA 4L6QA 3ZC6A 4FIGA 3QYZA 4UWCA 3Q4TA 2YIWA 1OM1A 5AP4A 2WMWA 3HRCA 4RQKA 4DLJA 2GHMA 3AC3A 3ACKA 5HHWA 3UO6A 4M69B 3ETAA 4MHAA 4C58A 4LMNA 3UNZA 4MBJA 4DGMA 3OXZA 3UQFA 4GU9A 3QZHA 4BIBA 4G31A 2V0DA 1Q24A 4K77A 3CSVA 3PSBA 3VJNA 4ALWA 4FMQA 2C5YA 4A9YA 5BUJA 3POZA 3QZFA 4FZAB 5AIKA 3OMVA 1H25A 5C9CA 4BDCA 4C35A 1KSWA 4YTCA 2YCSA 4MD7E 4E4NA 4O0SA 2IWIA 4Y46A 4ASDA 4M7IA 3E87A 4OW8A 1R3CA 1ZWSA 1PXPA 4W4WA 4QQTA 3BYUA 5JMSA 2BROA 3V5QA 3G33A 2E9NA 5IH5A 5JGDA 3M2WA 2X8EA 1SVEA 1SYKA 5E1EA 5LXMA 2C68A 4F4PA 3F5GA 3PJCA 1XH5A 2W9ZB 3HNGA 5ETIA 2WTKB 3OWPA 4JBVA 4F70A 2YZAA 4FA2A 4XG6A 3SAYA 4GVAA 3N9XA 1F3MC 1UV5A 2UZBA 4L45A 3U51A 5CALA 5DIAA 3EB0A 3LHJA 4BCFA 5M57A 4CEGA 2I0HA 2R4BA 5TT7A 5JQ8A 4TYHA 3N4UA 2WMAA 4CVAA 2R0UA 2R7BA 3NWWA 4EK5A 3IW8A 3QHRA 2WTIA 3A60A 4P5ZA 2C3IB 4IIRA 4WT6A 4GEOA 4OTDA 4B7TA 4BY9E 4BDHA 1PXKA 3V51A 3DDQA 3HA6A 4M8TA 3VQHA 4BCKA 4YURA 3E62A 1WVYA 1AGWA 2NRYA 4RJ3A 4BWXA 4TPTA 3CP9A 3DKCA 4QMZA 1XKKA 2DS1A 1U59A 4I22A 4BTKA 2W1IA 5BUIA 2HY0A 3FXWA 1LP4A 1FINA 3LFBA 4L44A 1G8SA 3MFRA 1YI3A 1YVJA 4CRSA 1WBTA 1UU9A 3QUPA 3TWJA 4GYIA 4EQMA 4EH9A 3DU8A 4CFWA 4JG7A 4LL0A 2JBOA 4M97A 5H3QA 4C7TA 4MAOA 5ITAA 4FK3A 1LEZA 1U5QA 3IDCA 4EC8A 2YM7A 4JBOA 1L3RE 1OKWA 4FL3A 4FYNA 1XH7A 3QYWA 3AD4A 1DI9A 4LUEA 3KMUA 4QP6A 5ETCA 5I5ZA 4ASEA 3WYXA 4CGAA 2WU7A 4NW5A 4BDIA 4EZ3A 2XNOA 3UNKA 1DI8A 2YLEA 4AZSA 3Q04A 3KGAA 5CEMA 4AOJA 2OO8X 2X2KA 3NX8A 4Y5QA 1QMZA 5E8TA 4H3BA 4OTWA 4TNDA 3FC1X 4BR3A 2W05A 3KF4A 3UBDA 3NUSA 3VW6A 3GGFA 5HEZA 1RE8A 2C6OA 4NK9A 2C0OA 3VQUA 4OTQA 3RPRA 4DH8A 1X8BA 3D15A 5C27A 3PPJA 4JNWA 4C37A 3Q6UA 4AGUA 5H8BA 2QVSE 4PL4A 5AP6A 5BVNA 2HW6A 4IWPA 4D4YA 1ZXEA 4KS7A 2JIUA 4QTDA 3C4FA 1YXSA 3QKKA 4DFUA 4G3DA 5M06A 5IISA 1OL7A 1URCA 4D1SA 3A7JA 3I60A 5HKMA 4CCUA 4H3QA 2J5EA 4YSJA 1PYEA 1VYZA 3GC8A 3V5JA 2RSVA 5AFVA 1Y6BA 1PMEA 3ZM9A 4HW7A 2XIKA 5A4QA 2Q0NA 2VN9A 2XIXA 2R3PA 4FT3A 3KVWA 4TW9A 4O7SA 3UOLA 4JRVA 1M17A 2ESMA 3QBNA 1YXVA 4QP9A 1PHKA 4U40A 2GFSA 4NTSA 5AP3A 2CHLA 2O63A 2XKEA 3LQ8A 4O22A 1ZYCA 4ZAUA 2WTVA 5FTQA 1WBWA 4BWPA 4B4LA 5A6NA 1JSVA 4FODA 3VVHA 5CQUA 4NWMA 4ENYA 2ZMCA 3E3BX 4D55A 5M56A 3H0ZA 5GZAA 3QQKA 1PXOA 3PJ3A 4UZHA 3UMXA 3GFEA 4EUTA 4AT3A 4AWIA 2X7OA 5C1QB 3CGOA 5J95A 3TKUA 5B7VA 4RG0A 2QOIA 3E5AA 1GIJA 3MH0A 3CLYA 3K2LA 3WZUA 3QKLA 4GUBA 5M08A 5FUTA 4OTRA 4CZYB 3LLTA 1A48A 5EG3A 5AP5A 3QTSA 4FT5A 4J96A 1XH6A 3OTUA 4L00A 4HGLA 5L8JA 3ZDUA 4C4EA 1R1WA 5GIOE 5EQEA 2Z60A 5KMJA 2VNYA 3CQEA 3HUCA 2XB7A 3HGKA 1ZLTA 3Q9WA 4W4VA 3QRUA 3IONA 2WOUA 5DG5A 2ETKA 4LFIA 3PA5A 5FBOA 4R7IA 3QQHA 3KU2A 4NIFB 1WBSA 3KRLA 3LOKA 2PVRA 3HP2A 4O38A 3N4TA 4XHKB 3SC1A 3PVUA 4DF3A 4DTAA 4PP9A 2UW6A 3WIKA 3KXZA 3OCTA 2UVZA 4AAAA 4EQCA 3NEWA 4N57A 3K5VA 3PVBA 3VUHA 3SW7A 3OBGA 4GFGA 1LR4A 4YJOA 5J8IA 3ZRLA 3GNIB 4QYEA 3HV7A 3Q3BA 2JIVA 2ZAZA 3FMKA 2RKUA 4K6ZA 3FY0A 4LGHA 3OY3A 4ZTLA 2UW0A 4GJ3A 3WF5A 4XUFA 3UOKA 1PXMA 3JVSA 4FIHA 2YISA 2YCFA 3ZC5A 3ZS5A 1Q8UA 4GRBA 3A8XA 3PXKA 3MB6A 2YM5A 1HOWA 4RIXB 4YHFA 3UYSA 5K3YA 3ZYAA 4BCOA 3C9WA 3LFSA 3V6SA 3OROA 4FIIA 4EKLA 4O0RA 1OBGA 5C01A 4L67A 2RGPA 5BUEA 4D5KA 2VWUA 3DY7A 3MW1A 3ZFMA 4ACMA 5L2WA 4U45A 3BEAA 3S3IA 5CF8A 3W2RA 4LOQA 3NNXA 3NVKI 4RPVA 4ANQA 1UNLA 4X2KA 2GNJA 2QOLA 3QRJA 4FIJA 4KA3A 3W8LA 4LYNA 1ZYLA 2AYPA 5EYCA 4J53A 4A9UA 1F5QA 2I0EA 3RHKA 2IZRA 4WG5A 4DG3E 4CFVA 4C0TA 5IA5A 5FDPA 5L8KA 3JUHA 3OUKA 2PZIA 3FUPA 5KKRB 3QTQA 2OH4A 4EOOA 3L9MA 2YABA 4NKSA 2XCKA 2ZVAA 3NNUA 3V3VA 4C8BA 3HKOA 4Y5HA 1MP8A 4YJTA 4F0GA 4F7LA 2PVMA 4IVAA 4GVJA 4MK0A 4XRJA 1PMNA 3OCSA 1IAHA 1BYGA 2YWVA 3GP0A 4AGWA 3FL4A 1REJA 5AMNA 1YKRA 2EXEA 4BDAA 4I23A 3IECA 5HE2A 4J71A 5K0KA 1ZZ2A 2B1PA 1CKIA 2UV2A 3BYOA 3QC9A 3R22A 3AT2A 4YTHA 3RINA 1GZ8A 3ZSHA 1U5RA 2RFEA 2JIIA 2UZOA 4PL5A 3ZXZA 4O7RA 4ZS4A 2ITTA 3NUNA 3ENMA 2BTRA 4QMYA 1O6KA 5EDPA 5J1WA 2X2MA 4QTAA 2F2CB 4U43A 2GQGA 2IVUA 5E4HA 1OIYA 1SM2A 4O7VA 5KKRC 3MPAA 4AN3A 2QO9A 4K0YA 2JDOA 4I4EA 3C0IA 3SDJA 4OAUC 4JQ7A 2FSMX 2IW6A 2UZWE 4YC6A 4ZSGA 4BWKA 4V01A 3ZO2A 3VJOA 2REIA 2VNWA 2C6MA 4U79A 3LFAA 4D9TA 4ZLZA 5E91A 4YPSA 3QHWA 1DS5A 2X8IA 4MWIA 4YO6A 5CAVA 4UXLA 2J2IB 3R8ZA 2B9IA 3QCQA 2HZNA 2ITQA 2IZSA 1BL7A 2BTSA 4KKEA 4Y95A 5FLFA 2WNTA 4JVGA 3T3VA 3LAUA 4LOOA 4YHTA 4J97A 2SRCA 4MQ1A 4IX4A 3HV4A 3TZ8A 3OP5A 4G6OA 2QURA 4LRMA 5IA3A 4E26A 3KK9A 3OFMA 5DNRA 4EYJA 3TI1A 3UOHA 2WEIA 4Q2AA 4CV8A 3HYHA 4LV5A 1FMKA 1L8TA 5HTIA 4MWHA 5AUYA 4XBUA 4CG8A 2PK9A 1B39A 3ELJA 4CT2A 4EJ7A 2IW9A 2Y8OA 3E8EA 4AW1A 4I93A 5A4LA 2W1FA 4JL9A 2DQ7X 3JY9A 3UODA 5A4TA 2QKRA 4QTBA 3CPCA 5CSVA 4BYJA 5KX8A 1Y8GA 1AD5A 3H30A 4PMPA 2OZAB 4FSZA 4XG2A 3ZRKA 4AE6A 5DGZA 4XX9A 5AP0A 4D1ZA 3P5KA 1OUYA 3O71A 3QA0A 3W18A 2WMVA 2PMIA 5K5XA 4X21A 4BN1A 1Z5MA 5CT7A 1XH8A 5D11A 3WE8A 2ZB0A 5I3OA 2EU9A 3KRJA 2VGPA 2H6DA 3REPA 4KBCA 3EFJA 4L9IA 2B0QA 2YJRA 3F3VA 4FV8A 4RLLA 3DXNA 1W8CA 4RJ8A 5CSWA 4AZEA 4G9RA 2OSCA 1G8AA 5KO1A 2VTTA 2X39A 3FI4A 4R7HA 4TZRA 3N51A 3UG1A 3GUBA 3V8TA 3VN9A 2C1AA 1RQQA 3FMNA 3W33A 2XIZA 3PJ2A 4J99A 1KWPA 4TWCA 4Y73A 5DLSA 5DRBA 4MNEA 1SNUA 3WF7A 4BDKA 2WTWA 4TT7A 2PPQA 2OG8A 3DKOA 5HCYA 2YAAA 4II5A 5AIRA 3OT3A 5FEEA 5IZFA 3P78A 5IUIA 2ITZA 3CJGA 4TYGA 3RMFA 4H58A 3NIEA 4EONA 2W7XA 3LCSA 2VTHA 2HELA 2VX3A 5DR2A 3DK3A 4OTHA 4I1ZA 4XH6A 3ZCLA 4D0WA 5C4LA 2CLQA 1WCCA 3FZPA 2BDJA 3UDBA 2I40A 4R1VA 4E4MA 3QU0A 2YERA 3FWQA 2G2HA 4FV3A 2X9FA 4HYIA 4M68A 4PQNA 4F9AA 2PUUA 3HA8A 4JAIA 3COMA 3KULB 4EHGA 4FTOA 5BVFA 2V22A 1APME 4CYIA 3G0EA 3QGYA 2R3OA 4IB1A 4Y83A 2E9VA 3VIDA 4BDDA 4CFMA 4LOPA 4MBIA 3VBXA 3P0MA 4R5SA 3ZSIA 4G3EA 4JQ8A 4GW8A 3MVLA 1H08A 3QQLA 2GNGA 4IAFA 4ZEGA 1URWA 2ITUA 1E9HA 3WF8A 5J9LA 2PY3A 3WIGA 3QD3A 1J7LA 2P4IA 2V5QA 1H1QA 2JDVA 5LWMA 5BVKA 3L8SA 3LFNA 3PVGA 5BVDA 4FC0A 1J7UA 1H1PA 2H9VA 4WNMA 5H8GA 5IKWA 3C4WA 4ZIMA 2VWZA 3A7FA 2CN5A 4QMQA 2GNHA 2PZ5A 5JN2A 2YIRA 3JYAA 3RPYA 4CG9A 3VUKA 4I5MA 4FSQA 4FSYA 4IZ5A 4V05A 4C2VA 4L3PA 2IG7A 5HVJA 2PWLA 4HCVA 3EHAA 2VO0A 4FTMA 5ACKA 3WZJA 5M4CA 2ZM3A 4S33A 4NL0A 3K54A 4FSUA 1YWVA 2XK3A 3Q9YA 3DS6A 4LGDA 4YC3A 4WRSA 3PIXA 3DAKA 4EBVA 3BU5A 3H10A 3MY5A 1MRUA 3TJDA 5LWNA 5EFQA 5C03A 4AACA 5CANA 3EL7A 2IPXA 2P33A 5GIPE 2CMWA 4UBAA 4O7YA 2YN8A 3RAKA 4DFYA 1MUOA 4CNHA 2BRMA 3JY0A 3ORMA 5GNKA 3E8CA 1KE7A 4HVIA 2XS0A 3FE3A 3CGFA 5E1SA 3AC2A 5DN3A 3FL5A 4UZDA 2UW7A 4ZK5A 4LRJA 3EMGA 1XBAA 3SHEA 4BCPA 3VWAA 2UVXA 3DV3A 4RLKA 5B2MA 4DFNA 3JVRA 5FM3A 3IKAA 5CX9A 3AD6A 4CMUA 4KNBA 4IB5A 3FHRA 4QYYA 4YZCA 3GQIA 2A27A 4FKLA 3MIAA 2ZV7A 3OT8A 3UP7A 3UC3A 3FDNA 4BCGA 4IB0A 3GCQA 4G6LA 3W2CA 3M11A 3W55A 1PKGA 1TQPA 1BI8A 2PSQA 4L42A 3FMEA 3ZLWA 5LOHA 2JITA 5HD7A 1KOAA 3ORLA 5JH6A 4QMOA 3T3UA 5L2QA 2CCIA 3L8PA 4L8MA 4D5HA 2FUMA 1V0OA 3BYMA 3KMWA 4I5CA 5CWZA 1H24A 3QX4A 3F7WA 5I4NA 3U6HA 2R3NA 5IUGA 5J9YA 4N0SA 1WBNA 4S30A 5EM7A 4C3FA 2QLUA 2OU7A 4A9SA 3IW7A 3U55A 5AR7A 4YGAA 2F49A 3P9JA 3O2MA 4F9WA 4IWOA 3VS5A 2F7XE 2HW7A 4AA4A 5DEYA 1J1BA 2WKMA 3NSZA 3PY3A 1FGKA 4IQ6A 2Y6MA 3UPXA 4A4LA 5HNIX 2Z7LA 2PE1A 3BE9A 1YHSA 3FKLA 1F0QA 1OB3A 1WVXA 1P5EA 5HU3A 4UB7A 3LVPA 3OWJA 4RWIA 4D9UA 1DAWA 5E8XA 3EFKA 3G2FA 4EH4A 3VAPA 5EH0A 3UIBA 3NW7A 2FO0A 4RJ7A 5HTBA 4USFA 3GXLA 4PDYA 5HNBA 2YCRA 3MJ2A 4D2TA 4XOYA 2C0TA 3I0OA 1M2PA 1SMHA 3KXNA 2QKWB 4IANA 4KAOA 2A2AA 2UW9A 2UW5A 5T6KA 2IO6A 3D83A 4QMLA 4XV2A 2VU3A 1H0WA 4O0VA 2ZOQA 1V1KA 2HZ4A 4QTEA 5C4KA 3BGQA 4JLCA 3KXHA 4X2JA 5CI7A 3OOMA 4FR4A 4UN0C 4FSNA 4X3FB 5JFSA 2GQSA 4BBEA 3HRBA 4I20A 3GCPA 3IW5A 4XRLA 3W2OA 2YZLA 4QMUA 5AM7A 3Q96A 4AZWA 4BI0A 2YM8A 5D1JA 5K0XA 5AR3A 2WMSA 4FEQA 3R9OA 3QRTA 3AOXA 2E9PA 2PVYA 4BDEA 3Q5IA 4NCTC 4RIWA 3U6JA 5DYJA 3DGKA 5EDRA 3NNVA 3FZSA 4DINA 5KBRA 3D7TA 3O8TA 3QTWA 4NJDA 4WBOA 1H27A 3FI3A 1Y6AA 3U9CA 3UIXA 4HVSA 5HZNA 4B0GA 3DFAA 4FNXA 4S31A 4FT7A 4X3FC 5G6VA 5HQ0A 4JS8A 4AN2A 4ZZOA 3VBWA 3ZHPC 1ZMWA 3CR0A 3EQPA 3DJ5A 4TL0A 1G3NA 5HIBA 3SXRA 2BALA 4TWNA 2B9JA 2FVDA 5DA3A 5CXZA 3TDVA 1TQIA 3MWUA 2BRBA 5H9BA 4DEIA 4W9XA 5E8SA 5AV3A 4AU8A 3R04A 1OGUA 4DGOA 4ACDA 2J6MA 1YWRA 2IVTA 4BGQA 4ZTMA 2PMNX 4V04A 4QP1A 4LM5A 3CCNA 2PZYA 3U4UA 3LM0A 4D2SA 2PUIA 2GNIA 5IH4A 3Q2JA 3WE4A 2F2UA 3NCGA 2LAVA 3O96A 3CJFA 4IAAA 4FTKA 4KINA 4L43A 3RP9A 5DHJA 2X9EA 4MVFA 5CNNA 4IACA 3SV0A 5HBEA 5AAEA 5EQPA 4GKIA 4XEYA 4ZSEA 4D4SA 5A6OA 5IA0A 4ZMFA 2G1TA 3OXTA 4FV4A 1PW2A 4YZNA 4O2ZA 4R6VA 4AF3A 2PVHA 3F9NA 5HVKA 2Y6OA 3HMNA 3PLSA 4MEDA 4WNPA 3WZEA 4E8AA 2JAVA 3G5DA 4F08A 3RI1A 5J1VA 1H1SA 4UXQA 4EBWA 4F0IA 5HLNA 4FIFA 1VJYA 2BRGA 4EH6A 3FYKX 4YLKA 3NDMA 1ZZLA 1H1WA 3EN7A 4M84A 5DT3A 4X2FA 4D28A 2UZLA 3P7AA 1KE9A 2Y4PA 2IN6A 4GK4A 2GHGA 3TUBA 4FEWA 2C3JA 3MPTA 4ANBA 4K18A 2B54A 3BHTA 3GU8A 4IAYA 4XV9A 1V0BA 2QOOA 2HAKA 4NJ3A 2OWBA 1J3HA 3QGWA 3NGAA 4F99A 1CM8A 3GC0A 3NZ0A 2BDFA 4QP4A 2B52A 4F09A 2BIKB 4FV1A 1JBPE 4CKIA 2V55A 3BLQA 3PA3A 3RPOA 4GL9A 5TE0A 4TYJA 2IW8A 5HOAA 1JKKA 4I92A 5IG1A 1T45A 3BCEA 2XYNA 3OWLA 1MRYA 2E2BA 4EEVA 4QQCA 4HVHA 3R7GA 2BFXA 1Q41A 3BEGA 2JC6A 2JKQA 4NT4A 3VS0A 2B55A 3LCTA 4A4XA 4IFGA 4L52A 3I5ZA 5A46A 4RJ5A 4B8MA 2X0GA 4DN5A 3GOPA 4C33A 4MH7A 4X2NA 1J1CA 1OKVA 5JZNA 3FEGA 1H0VA 2C30A 4HYHA 2P3GX 4EWQA 3EKKA 3O7LB 3FYJX 4F1OA 3ZUUA 2ETMA 1SVHA 5AWMA 5FWKK 2CNVA 3DK6A 2PMLX 4ZS0A 1GOLA 5BNJA 3OXIA 4FTCA 5IEYA 4YPDA 2BZIB 2O8YA 3BLRA 5EHYA 1BI7A 4CMOA 4R5YA 4O1PA 5L6PA 2BDWA 3FI2A 3TZ9A 3MN3A 1XWSA
chains in the Genus database with same CATH superfamily
4AOIA 1TVOA 2WMUA 3HDNA 4HYSA 3ZDIA 4PY1A 4O86A 3FXXA 4NFMA 3A4OX 1GJOA 3QCSA 4CFNA 4GT5A 3BQRA 1NVQA 1YOLA 3CEKA 5CAUA 4JMQA 1W0XC 3UVQA 5CYIA 3ZEPA 4APCA 4BI1A 4J95A 3CQUA 1H26A 3RHXA 4BDGA 4XP0A 5IQDA 3LJ2A 4RX5A 5ETFA 4PPAA 3CTQA 4IFCA 4AUAA 4G3FA 5F9EA 2ITWA 2YDKA 2AC5A 3UC4A 3CTHA 1FQ1B 3G9LX 1QPCA 1XBCA 2WEVA 3QLFA 3OY1A 3I79A 4FZDB 3S00A 2W96B 3EQGA 4P7EA 1YOMA 4I6BA 3VS3A 4DEHA 2C3KA 3QQUA 4KBKA 5DEWA 3W2QA 4MF0A 3M1SA 4LUDA 4GYGA 2JDSA 3DDPA 4H05A 4BDFA 4R7BA 1YI4A 1CKJA 1OUKA 1Q8TA 2Q0BA 3R7IA 3VHEA 4DLIA 3DB8A 4O84A 4QO9A 3PRIA 4ANOA 1R0EA 3R7EA 4FTTA 4W8DA 2Y7JA 2O64A 3LFQA 2VAGA 2BAQA 4RIOA 2Z2WA 3IK3A 3VUTA 3KREA 4IX6A 1OL1A 1UWHA 5F1ZA 3UQGA 2PUNA 4OBQA 3AT4A 2WOTA 3SXFA 1B6CB 4EOQA 4KIOA 4IAZA 3K5UA 4Q5HA 2QONA 2VD5A 3D14A 2C6DA 3HDMA 2VWBA 4L7SA 1ZY4A 3LXNA 5CU4A 5AA9A 4YJQA 3VW8A 5CEQA 4Z55A 3RNIA 3K3JA 4EOKA 1OKYA 1I09A 1UNHA 1Q3WA 4UEUA 1R78A 5HI2A 1IA8A 4QYGA 3V5PA 4ZJIA 3ZMMA 4RFYA 2CGUA 4RVLA 4XCUA 4BIDA 3A61A 3FQEA 5AEPA 1YQJA 3PPKA 5IU2A 3G90X 1I44A 2FB8A 3CY3A 4WSQA 1JOWB 4E6AA 5IA1A 3SRVB 4FKWA 4DAWA 3FLZA 3KULA 4KRCA 2PULA 1G8JA 3IG7A 4GG7A 4AAYA 4ALVA 1A9UA 4HGSA 3D94A 3NAYA 4IEBA 3QTRA 4UMTA 4WIHA 3SKCA 1U4DA 4A06A 5CT0A 4MD8E 4DGLC 3EQIA 4C61A 3R9DA 4G16A 4B8LA 4PPBA 4RX8A 5KNJA 2ZM4A 3RPVA 4YJRA 4PMSA 4ANLA 3R01A 4FSMA 3ORKA 3OUNB 4EK8A 3MS9A 1IAJA 2OIDA 3LIJA 2VTOA 1UA2A 1Q8WA 2ERKA 4IC8A 5EM8A 2BMCA 1WBVA 5EYKA 3GEQA 2W4JA 1LEWA 4XLVA 4BCMA 4HCUA 2J0MB 1OECA 1RW8A 5HO6A 2ONLA 4DH1A 3JR1A 4O82A 2YM3A 3Q4CA 3KF7A 2J7TA 4GV1A 1JLUE 3MVMA 4AX8A 5DI1A 5BX0A 1JSTA 1O6LA 4GFOA 3RCDA 2G2IA 4YLJA 4DH7A 3ZEWA 2Z7RA 2P0CA 3OZ6A 4IVCA 3F5XA 3VUDA 4S32A 2VO6A 3ZH8A 4YNEA 4H36A 5JGAA 3UDZA 4PRJA 4U5JA 2VTJA 2CNQA 2BZKB 5IQHA 2R3HA 3F6XA 5IA4A 1H00A 5DT4A 3E88A 4CV9A 2Q83A 3EYHA 4NU1A 4R3CA 4R8QA 4KSQA 4JG6A 4PF4A 4JDKA 4EHZA 3MSSA 3QQFA 3F7ZA 3IW4A 3V5TA 2PVLA 4FTQA 5FD2A 1GZKA 4UWYA 2ITOA 4BCHA 2PYWA 5T68A 1KE6A 4RC4A 2YIXA 3PWYA 4BBMA 5JZJA 4FEUA 4BIEA 3C5UA 3F69A 3NAXA 3HRFA 4I0RA 3DZOA 4E93A 4FSWA 5HO7A 1AQ1A 5C8KA 3W0PA 4YHJA 4C36A 1FVVA 4DCEA 4EZ5A 3I6UA 1OITA 4ZXTA 1U54B 3EOCA 4BGGA 5FXSA 3TCPA 4G1WA 4IW0A 4FKRA 4AGCA 3GBZA 3ZSGA 4W9WA 4E6QA 4NFNA 5CAOA 4UV0A 3HMIA 1QCFA 5I9WA 4N4SA 5BVEA 5A4CA 2VO3A 4OTIA 4TWPA 4U41A 5CNOA 3H4JA 3MH3A 3BLHA 3FLNC 3OD6X 2P55A 2HZ0A 1YDRE 1NA7A 2WQNA 4EK6A 5E8YA 5AA8A 2GFCA 3R1QA 3TL8A 1VYWA 5EKNA 4IDTA 1BL6A 5LVLA 3KRWA 5C26A 4CSVA 2XNBA 3KB7A 4HZRA 3W1FA 3E3PA 1BKXA 4PMMA 5L2IA 4MUQA 2W17A 2XM8A 4CTCA 4TNBA 4J52A 3VHKA 3L8XA 4CCBA 3A7IA 4ASZA 3D5VA 4IAKA 4ZJVA 5HORA 3NYOA 4HOKA 3QD4A 2BUJA 2XMYA 4BRXA 5B2KA 4O1OA 5J87A 4JT3A 1FVTA 2BAKA 3E93A 2OGVA 3C4CA 4OTGA 4YR8A 1V0PA 3O51A 2C6IA 5FXRA 1NVSA 1WFCA 1PF8A 3BGZA 2O65A 4L3JA 4TWOA 4WHZA 4DHZA 3S95A 4DFLA 3IDPA 1JSUA 3UIMA 3MTFA 3ZLXA 4J8MA 1ERKA 3PJ1A 5FEDA 3O8UA 3HAMA 2OXDA 3PSDA 3KXMA 5HLPA 4OTFA 3R8PA 5E92A 2X7FA 3OCGA 5IMXA 2VTQA 4TRLA 4HZSA 3F3UA 5IQGA 4XP3A 4AXFA 4QQJA 2OICA 3C7QA 2WMBA 3PJ8A 2UZVA 2AEGA 2OJIA 5AUXA 5AX9A 1OGYA 1Q61A 3C0HA 4IMYA 3VUMA 2XK7A 4OR5A 3U8WA 2XBJA 4IDVA 2HYYA 4IZAA 2R7IA 3O0GA 2VWVA 1ZMVA 4ARKA 1PRYA 3C5IA 2JKKA 3LQ5A 5M55A 3GT8A 4RIYA 5J79A 4I5PA 3GB2A 5DBXA 3UGCA 4CMTA 4QQ5A 2W5AA 5IQBA 4IB3A 2WTDA 4U6RA 2WTCA 1OBDA 3DXQA 3RK7A 2IEWA 3V6RA 4L53A 4FRFA 3VBYA 4RZWA 5CSXA 4IVDA 2HIWA 1OPKA 3R83A 5M4IA 3V01A 3C13A 1OPLA 2QO7A 3E63A 4WNOA 4Y72A 4ZY6A 5CF6A 2QG7A 4DDIA 3UZPA 2HY81 3EQDA 2ITXA 4E20A 3FBVA 4BTMA 2X81A 4QTCA 4D2WA 1DAYA 3FLQA 4ZTNA 4CZTA 4YZDA 3WF6A 3D4QA 2XJ0A 4OUCA 4A9RA 3DZQA 3TN8A 2WD1A 4F78A 4TN6A 3A2CA 4USDA 1NW1A 3ATTA 3F3ZA 4KIKB 5IQCA 3A8WA 3VS6A 2FSLX 4QPAA 2QOQA 4UMUA 4FICA 4O96A 4ACGA 3BV2A 4FG9A 2HOGA 5HD4A 2JDRA 2IVVA 4EOPA 2QOHA 3Q9XA 4RGJA 5GJGA 4IWDA 2OJGA 3QD0A 4ZSLA 1Q4LA 2YLFA 3EIDA 3TMOA 4D58A 4YJVA 4XMOA 2WMRA 5HE1A 3D5XA 4RSSA 2OKRA 4S34A 4YSMA 4EUUA 4IC7A 2GU8A 4CFFA 2W4OA 2C4GA 3GU4A 4M15A 4YZ9A 1Q99A 3RZBA 5CVHA 5ANJA 5L2TA 2XH5A 5LCJA 2VTMA 3OCBA 4PDPA 3T9TA 5AR8A 2QG5A 4F65A 3KQ7A 2FSTX 3Q52A 1GZNA 3R21A 4V0GA 4FVQA 2AQXA 3ALOA 5EKOA 3RJCA 4ACHA 2OZOA 4O4CA 3VUIA 2GQRA 1CMKE 3EN5A 4YJSA 2RG6A 3ORZA 5JRSA 4FTIA 2DUVA 4FV0A 5FP5A 1IA9A 2QOFA 3G9NA 5LARA 3R9RA 4LV8A 4CQEA 2C3LA 3NUXA 3DNEA 2HENA 4H39A 3SD0A 3GC7A 1XH4A 3JXWA 2QD9A 3FZ1A 3OS3A 2J0JA 2YDIA 4LL5A 2ZM1A 5CTPA 3LPBA 4C59A 3LJ1A 5M4FA 5KMOA 2X0OA 2VWIA 3ERKA 4TYHB 3SXSA 4DBNA 4FTAA 4ANMA 5KUPA 5E9EA 3POOA 1PMVA 2PVJA 2CN8A 1P2AA 1UNGA 2RIOA 1OIRA 2BAJA 4K2RA 5EDQA 2ZYBA 4I24A 4GH2A 1KV2A 4FK6A 3ATSA 3AXWA 2WQBA 3EZRA 1W98A 4Y8DA 1FMOE 4S2ZA 3NCZA 5LVPA 2V7AA 2VZ6A 5AV1A 2GCDA 4DEDA 1XBBA 2YHVA 2XK9A 4DEAA 4U80A 2WMQA 2C5NA 5D10A 3NR9A 2CCHA 3TM0A 4DFZE 3I0QA 1K2PA 3KVXA 4BZOA 2JFMA 4RC2A 4M69A 4RRVA 2XNNA 4USEA 3MVHA 4G3CA 2H8HA 1GIIA 3WYYA 4E5WA 2XP2A 4O2PA 5CEKA 3D7ZA 2XJ1A 3GOKA 3LXPA 4HPUE 3DBCA 3OHTA 3PRFA 2X6DA 2RF9A 4BHZA 3DK7A 5DR9A 3R28A 5CF5A 4XLIA 1J7IA 3CS9A 5E8ZA 4AT5A 1QPDA 2OXXA 3GC9A 5TF9A 3C4EA 2PHKA 2WZJA 3FLSA 5FM2A 4AQCA 4EZ7A 4M12A 3AC4A 2YWPA 1PMUA 3NUYA 4I0TA 4RQVA 3EFLA 3PZEA 3PG3A 4QRCA 3PP0A 4RWLA 5HCZA 2XBAA 4O83A 3KXGA 1YDSE 4HNIA 5LMKA 4Z3VA 3EJ1A 3S1HA 1ZOGA 2WHBA 1YHWA 3ACJA 3P4KA 4QMPA 4RA4A 4YJNA 3QCYA 4NM5A 3RZFA 3FMDA 4BBFA 4E4XA 3TKIA 3FI8A 2JKOA 2BVAA 3DTWA 4U7ZA 3BZ3A 2GS6A 4FZ6A 3SW4A 4F6SA 2G2FA 3MV5A 3QL8A 1GAGA 2J0KA 3NVMB 2XEYA 4HVDA 4QMMA 3UG2A 1UVRA 4K11A 4I5HA 4QOXA 5KMMA 4JDHA 3R7UA 4FKTA 4AZVA 1KV1A 1UWJA 4X6QC 4K9YA 4BF2A 4DFXE 3EKNA 4O0YA 3Q9ZA 4LDTA 2EWAA 3SG8A 3COIA 1OPJA 4FZ7A 2GTNA 3UTOA 3CE3A 3MH1A 1Q62A 2BRNA 3QZGA 4JR7A 3PFYA 3VBQA 4YBKA 2UW4A 4FUXA 2X6EA 4CT1A 3QWJA 2DWBA 5KMNA 4O0XA 2XALA 1JWHA 2ETRA 5CSPA 4WA9A 2CNUA 2FH9A 1MQBA 2OBJA 2QQ7A 3R6XA 2OW3A 4DTKA 2PUPA 1OL5A 3WF9A 3UNJA 3K3IA 3LFEA 2R0IA 3QRIA 3RTPA 1P4FA 2RL5A 3S2PA 4R78A 4EK3A 4BJJA 3ROCA 1VR2A 2JGZA 4C4HA 3L9PA 3V8SA 5FG8A 4GU6A 4UYNA 2AUHA 4NEUA 1A06A 5DWRA 3V5WA 2NYAA 4BL1A 3LKMA 4PDSA 2EVAA 4MCVA 4WNKA 4ZTSA 5KZIA 3ZBXA 3F3TA 3HUBA 2XK6A 2X8DA 1VZOA 2C69A 3NIZA 3FKOA 4FG8A 2R3IA 3MGYA 3PUPA 4I0SA 4TYEA 5C8MA 3MA3A 3ZLYA 5CU0A 5JFWA 2R3FA 2EXMA 3KMMA 5JSMA 3ZM4A 2OF4A 2ONLC 4BICA 3ZO1A 3D5UA 2VX1A 3PWDA 4F9BA 2FGIA 4O4EA 2F4JA 4GFMA 2UVYA 3I7BA 3R1SA 2BRHA 1OKZA 3KCKA 3BE2A 3D9VA 3SRVA 3TNQB 4E73A 5JK3A 3ZFXA 3GCVA 4G9CA 1GIHA 3QTUA 1EH4A 3FSKA 1GZOA 4JX7A 4YBJA 4FTNA 4DEGA 3E7VA 4GG5A 5EHOA 3CY2A 1R39A 5CQWA 3R7YA 4M67A 4FGRA 4H3PA 5T3QA 2IVSA 4L68A 5IDPA 4LV7A 4DG2E 2UZDA 2BZHB 3NUPA 4RJ4A 4BYIA 4O4BB 4NW6A 1Y57A 3SG9A 5IQEA 4X7QA 3VF8A 1NY3A 3PA4A 3HMMA 3CD3A 4UMQA 4E4LA 1PY5A 4YC8A 3KK8A 2R3GA 4WUAA 4CQGA 3DBEA 4ZTQA 3NW6A 4JDJA 3A7HA 5EK7A 1S9IA 4JXFA 2KTYA 3M42A 5HU9A 2XA4A 4EH2A 2V62A 5DE2A 2XKDA 3C1XA 2BCJA 5ANKA 3CD8A 5EW8A 3WZKA 2OJFE 4I94A 4F1TA 3PVWA 4BKZA 3SA0A 5HO8A 2W0JA 4UMRA 5M07A 4MTAA 4ITJA 1TKIA 3QFVA 2XKFA 3W8QA 1DM2A 3PY1A 4C38A 5JQ5A 5KHWA 2XM9A 3IGGA 3SOAA 2C5OA 4BVUA 5J9ZA 2QHNA 3C0GA 3NUUA 3LFDA 3ZTXA 4E6DA 2XRWA 1OZ1A 4IADA 4IH8A 4KBAA 4EH7A 3ORTA 1PJKA 1PXIA 3B8RA 2WIPA 4QMWA 3AMAA 2XARA 2RFNA 1KE8A 3UO5A 5K5NA 5IQFA 3R2BA 5LCKA 4FIEA 4ZY4A 4WBBB 4A7CA 2X0QA 3BWFA 1WZYA 3VO3A 3UOJA 4J7BA 4P4CA 5I9VA 4HYUA 5L6WL 4NIFA 2J9MA 4PV0A 2ZB1A 3R63A 1NVRA 1YI6A 5F4NA 5B0XA 3RWPA 4C02A 5JFVA 4ZZMA 2J5FA 3AT3A 2CGVA 2WQMA 3FMMA 4ERKA 3AGLA 5KBQA 1WMKA 5IDNA 4MF1A 1ND4A 4FL1A 3SQQA 4JIAA 4JI9A 3ODZX 5KHXA 4WOVA 4D4VA 3R1NA 4XG7A 2J4ZA 3G6GA 2YACA 3LMIA 4BCIA 5KE0A 2JEDA 2C5VA 3IQ7A 2PMOX 1JVPP 2OJ9A 2I7QA 5CENA 1Q97A 3V8WA 4AA0A 4RIXA 3GU7A 1W84A 3KY2A 3AMYA 2VV9A 2XK4A 3FXZA 3OOGA 2B7AA 1BUHA 3DAEA 4AW5A 4MXYA 3BHUA 3FAAA 3PY0A 3QZIA 2PVNA 1VLRA 4G5JA 4RVKA 4FNZA 2ZJWA 4QYHA 4D4RA 5EW9A 4DE4A 4AW0A 5AAGA 3B2TA 3EFWA 3LCDA 4LRKA 5AV2A 2H34A 3KL8A 2GSFA 1PKDA 4DC2A 3PDTA 4FGBA 3NYNA 4O6LA 3TUDA 4BHNA 3FZRA 5BYLA 5IUHA 1H8FA 2X1NA 4IX5A 5HBJA 3ID6C 3C51A 1IRKA 5HESA 4FV7A 2ZV2A 1RDQE 3CPBA 1J91A 3B8QA 3PXRA 2VTAA 1ZYSA 2X4FA 4FV6A 2YFXA 3RKBA 2OJJA 4O0TA 3VONA 4G2FA 1OIQA 5HBHA 2GS2A 4RWKA 4C62A 2Z02A 4QYFA 3NRMA 3R8VA 3O23A 3KN5A 4N70A 4WKQA 4FKJA 3MB7A 3KRXA 2PVFA 1JNKA 3WILA 3A7GA 4I21A 2W4KA 4Z9LA 2IZUA 3JPVA 3ZZEA 4MQ2A 4EQUA 4ID7A 1SZMA 3E64A 2HCKA 4CTBA 1W7HA 3IGOA 2VTPA 3DBFA 3BKBA 4K33A 3P7BA 2NPQA 5DPVA 4AZFA 5DRDA 4NZWB 4E7WA 3ULZA 3WOWA 5FTGA 2R9SA 2I0VA 4IZ7A 2XYUA 4EOIA 3R9HA 4EHEA 4IHPA 4XNEA 5J5SA 2J0IA 4PTGA 4YMJA 3IS5A 3CKXA 4IXPA 3RM6A 3VBTA 1Q3DA 4X2GA 5BPYA 5DMZA 4I41A 3RK9A 4BB4A 4TTHB 4DFBA 3Q2MA 5FP6A 4ITIA 4LG4A 4XV1A 1K9AA 3AC8A 4J98A 4MNEB 2UZUE 3G51A 1M2QA 3PXYA 4WG4A 2VTNA 2HZIA 5JT2A 2BKZA 4ZLOA 2WPAA 2W06A 4FSTA 1QPJA 4F7NA 5CEOA 2UZNA 2ZDUA 3LZBA 3E8NA 4FL2A 4PNIA 2JLDA 3R8LA 3ZOSA 4AN9A 1MQ4A 3MIYA 3TZ7A 3IPHA 3AD5A 3I7CA 4FKGA 4AFEA 2W9FB 2VWYA 3F3WA 3RAIA 4FKVA 4F6WA 4TYIA 4U81A 3R9NA 4O7NA 3FMJA 2RFSA 5F94A 4WRGA 2QO2A 2C6KA 2CLXA 3FQSA 4LI5A 4JBQA 3EQBA 4JJRA 3MY0A 5HG7A 4CLJA 4IVBA 2QR7A 4F0FA 5I0BA 4WD5A 2CJMA 2VRXA 4CD0A 3O17A 2QU5A 4BFMA 4FI1A 3FQHA 3P7CA 4QMSA 4I6FA 1UU8A 4G5PA 4F9YA 1OIUA 4ANNA 2W1DA 2OZAA 3EWHA 3GCUA 4XJ0A 4HVGA 2G15A 1K3AA 4EORA 4YO4A 4E5BA 4PL3A 4NUSA 3CKWA 4ZTRA 1SVGA 4BKJA 5AP1A 1W2DA 3U4WA 3V5LA 5FGKA 5IEXA 3Q4ZA 4C4GA 5KMIA 4N6YA 3I6WA 4YP8A 2W1GA 3F61A 1KOBA 1Z57A 4YJUA 4F7SA 3NLBA 4NYEA 3SOCA 2G9XA 2W1HA 5HE3A 3EL8A 4XG3A 4QMXA 5DFPA 4CFXA 5M51A 4QPSA 2HXQA 2XRUA 3RNYA 3RK5A 4DH5A 3DBDA 5HLWA 1PXNA 3CXWA 4AA5A 4FEXA 2BHHA 4MBLA 3TV7A 5IQAA 4IZYA 5AV0A 3MA6A 1OL6A 3OTVA 3TG1A 1IASA 4DT8A 4UYAA 3FZOA 4EC9A 5GINE 3FLWA 4LGGA 4JAJA 2VTRA 3BYVA 4D2VA 1KUTA 5DH3A 2XAOA 3QXOA 5LMKC 3ANRA 4N6ZA 3KRRA 3W16A 2WTKC 3RPSA 3UP2A 4IAIA 5LVMA 3VS2A 4M13A 2UUEA 4ALUA 3DOGA 4F63A 5DVRA 2WIHA 3W2SA 2WB8A 3I81A 3OG7A 2C6TA 3E7OA 4FKQA 3R71A 4HPTE 1HCLA 5AM6A 3MESA 3RWQA 4ZY5A 2I6LA 4LQMA 4I3ZA 2XIYA 5BMSA 3ZBFA 4YJPA 3NS9A 3ORPA 1JKLA 5E8UA 2JFLA 4Q9ZA 1ZRZA 2AC3A 3R02A 2OLCA 3V04A 1CDKA 3FPQA 4XYFA 4A4OA 3RM7A 5GZ8A 1Q8ZA 2HK5A 4QP2A 2E9UA 1YOJA 2XK8A 3UVPA 3DLSA 2OI4X 3H0YA 4O7ZA 5CXHA 3DKFA 5KMKA 1FOTA 4QMVA 4MXOA 4KIQA 3BL7A 3VF9A 1CKPA 3CTJA 3VULA 3W10A 3II5A 5K9IA 5J7HA 4QMTA 4GT3A 4X0MA 2E9OA 3LXLA 3PE2A 4JOAA 5TKDA 4AT4A 5CAQA 5LVOA 5CZHA 5J5TA 4RVMA 4QD6A 3BHHA 4B6LA 3BRBA 2YIQA 2GS7A 4IM3A 4FV5A 4O81A 2NO3A 4NH1A 3TJCA 5JRQA 4EI4A 3UVRA 1TQMA 2R3RA 3F66A 3TTJA 3BL9A 4M0ZA 3WI6A 2RFDA 4W4XA 4DGNA 1W2CA 4RBLA 1FBNA 5EOLA 5ACBC 4FSRA 2WU6A 5CF4A 3QKMA 4O0WA 4IJPA 3QCXA 1BMKA 3ROYA 3O7LD 4FNYA 4IM2A 5IH6A 4DCAA 4APPA 3L9NA 3PG1A 2BFYA 3FKNA 4PUZA 3A62A 3WBLA 5CU2A 4MXXA 3I5NA 3CQWA 1NXKA 5LMAA 2C6EA 2X7GA 3GFWA 2CGXA 2ITNA 3OVVA 4D2RA 3DBQA 3LW0A 2VX0A 3GENA 3TT0A 4GT4A 1WVWA 3O50A 3PIYA 3ZZWA 1OMWA 2Y4IB 4W8EA 5KMLA 2OXYA 4QT1A 4ASXA 3EN4A 1Q5KA 5AR5A 2C47A 2GTMA 4YLLA 2ZV8A 5E8VA 5FEQA 2CPKE 2W99B 1JPAA 4MD9E 5AUUA 3PYYA 3SGCA 3VS4A 3NW5A 5HG5A 2HWOA 1FGIA 5ANDA 2O5KA 3F5UA 4NKAA 4FOBA 3VUGA 3FPMA 1FPUA 2X2LA 3H9FA 2A19B 5DR6A 4UY9A 5A9UA 5JFXA 3QA8A 2GNLA 3UDSA 3W0NA 2YDJA 4BCNA 4OBOA 1ZY5A 2R64A 3PPZA 1Q8YA 3P1AA 1QPEA 4RJ6A 4DYMA 3FV8A 5EW3A 2Y4IC 4RIWB 3Q5ZA 5C8NA 2W1EA 3RAWA 2YCQA 5LMBA 5F95A 3AKKA 2WTJA 5FRIA 5D9HA 3D7TB 5M53A 5AV4A 4ITHA 2A1AB 4XG9A 2FSOX 5DOSA 4C3RA 1XHAA 5LQFA 3VNTA 4DEBA 3UZTA 5ETAA 1IEPA 4ZTHA 3DQWA 5DT0A 4KABA 2GDOA 4R77A 2ERZE 2WO6A 3QWKA 3OWKA 3LM5A 2EB2A 2F7ZE 3TXOA 1JKSA 3I4BA 3E92A 3OW3A 4Z16A 3P23A 3W0QA 4HGTA 3D2IA 5I9ZA 4EJNA 4CYJA 4L01A 4E6CA 3U9NA 5JKGA 4ENXA 3COKA 2B53A 1YRPA 1HCKA 3BYSA 4G34A 2BR1A 3ZO4A 4EWHA 4RX7A 4G6NA 4NCTA 5GJDA 4EOLA 4DT9A 5CSHA 3H3CA 4FVPA 4F1MA 4JDIA 4B99A 3VC4A 5IPJA 5K4IA 4X6RA 5HE0A 5CAPA 4YNOA 3VBVA 4JQEA 3NUAA 4XP2A 5ICPA 5KCVA 4OAVB 4QNYA 2B9FA 3EZVA 3PXFA 4IBMA 4O0UA 4D2PA 4X3FA 4DTBA 3TUCA 2UW8A 3TEIA 2DYLA 3AG9A 3EQFA 3GU6A 3WZDA 2YAKA 2VTLA 4FUYA 4EOJA 4CKJA 3R30A 3EN6A 1WBPA 5ANGA 2A98A 4EHVA 3PE1A 3F2RA 3U87A 2H96A 4AW2A 4FKPA 1E1XA 2WQEA 3KXXA 4QDEA 4DBXA 3I1AA 2F9GA 3Q6WA 4AQKA 4HNFA 4GK3A 2YA9A 3ZO3A 3N4VA 4FV9A 3F88A 5EM6A 4CFUA 5J7BA 3S0OA 4W4YA 4D1XA 2OK1A 4U3ZA 5CVGA 3U54A 3UJGA 5CI6A 2NRUA 3FJQE 4XS2A 4NSTA 4ZSJA 3BLAA 4C34A 3W0SA 4FTRA 5EOBA 3QRKA 4GS6A 4MX9A 3BWJA 5FXQA 3RBWA 3T9IA 4F9CA 5HX6A 3HECA 3DKGA 5JEBA 2R3MA 4AXAA 5H2UA 3ET7A 1UU3A 3CBLA 3EYGA 2ITPA 3ALNA 3HV5A 4U8ZA 4DGGA 3Q32A 2CKPA 5HNGA 3BHYA 1ZARA 4L7FA 5BYYA 2VGOA 4I6HA 5I3RA 1H1RA 5GZ9A 4A9TA 3ULIA 2UW3A 3NNWA 3TNPC 2ZMDA 3AKJA 4U0IA 3ZFYA 4R3PA 2O3PA 4KKGA 3MJ1A 1M7QA 3IOPA 4OTPA 4ZZNA 1CTPE 4C4IA 1XR1A 2PZRA 3AQVA 5AUVA 5A3XA 1P14A 4G17A 2PVKA 1QL6A 5CZIA 3DXPA 1Y8YA 3QAME 3UO4A 4ERWA 2XNEA 4BKYA 4BZDA 3QLGA 4EYMA 2F57A 2NNWB 3H9OA 2ZV9A 2A4LA 2GMXA 4PMTA 4FKUA 5LVNA 3A4PA 3IDBA 4MXCA 2OH0E 4BCJA 1WBOA 4FEVA 4TXCA 4PDOA 2PU8A 3FY2A 2XVDA 4AS0A 2F7EE 4AG8A 1KE5A 2EB3A 5AR2A 4GIIA 4EKKA 4UX9A 5EYMA 3AGMA 4NM0A 4H1MA 4XG8A 3KKVA 1XQZA 1JKTA 2O0UA 2XJ2A 3VS7A 1WAKA 4FT9A 5ANOA 1YXUA 2QLQA 3RALA 4JIKA 3KA0A 4KUJA 2BPMA 2VWWA 2XIRA 4OGRA 4H1JA 4MXAA 4FE2A 4O7WA 2VO7A 3BHVA 1IG1A 3OF0A 5KZ0A 4C57A 1ZYDA 1CSNA 3TDWA 3HP5A 3L9LA 4P90A 3S4QA 2J50A 4KSPA 4MYGA 3UZRA 2ZDTA 2YIYA 3FZTA 3DT1A 4ZMEA 1STCE 5AP2A 3R7VA 3A99A 4Q5EA 4UALA 3COHA 2WMXA 2QODA 3P08A 4DHFA 3ZUVA 1UU7A 4NM3A 5EI6A 5AUZA 5H8EA 1NT2A 4BTJA 2P2HA 2C5XA 1RJBA 5B2LA 3QX2A 3ORXA 1REKA 2CKEA 3EN9A 3ANQA 2XUUA 3IO7A 3UE4A 3G0FA 4FT0A 4RA5A 5HX8A 1ZOEA 3R0TA 4QNAA 4Y85A 4D0XA 3C50A 5EQYA 1Y91A 4JX3A 1W82A 2C6LA 3IW6A 3BV3A 4YZMA 1YXXA 1XH9A 2W5BA 3R8MA 4KD1A 5BVWA 3GCSA 4QP3A 3BPRA 2JBPA 1ZMUA 1H07A 1ZAOA 2VTSA 4FZFB 3KFAA 4B9DA 4GKHA 4ORKA 2OFUA 4ONAA 3HMOA 3R00A 5AAFA 4CLIA 4Z7HA 4DDGA 2I1MA 2Y9QA 4IM0A 2EXCX 2OIQA 1B38A 4YTIA 3VS1A 4DHIB 2J0LA 4GMYA