2A19B

Pkr kinase domain- eif2alpha- amp-pnp complex.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
273
structure length
263
Chain Sequence
AHTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLINRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
total genus 82
structure length 263
sequence length 273
chains with identical sequence C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2a19B02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2a19B01
3EHAA 5C26A 4GU6A 4W9WA 5C1QB 4WUAA 4E20A 3GVUA 2IG7A 4F7NA 2ETRA 4BCJA 2H34A 5DT4A 5GHVA 5BUJA 3KRWA 4F99A 4NUSA 2UZEA 5AUWA 4EK5A 4FV5A 4HNIA 3TZ9A 2PVJA 3A8WA 3P5KA 4KBCA 3BV2A 4FL1A 2QKWB 1IAHA 3R04A 4EH6A 3RMFA 4G3DA 1SVGA 3OBGA 1OPKA 1LP4A 3UG2A 4TPTA 3ZYAA 3H0YA 3DKCA 1OIQA 2YDIA 5HE3A 1ZRZA 4HVSA 2OJFE 4Z55A 1O6LA 4QQJA 2JC6A 1U4DA 5I5ZA 4G2FA 4C4IA 2CDZA 3NR9A 4TNDA 4IACA 3QTRA 3BLQA 4FSTA 1XH7A 4BDJA 3N4TA 3GENA 3RWPA 3V51A 5LJJA 3ZFYA 4YZBA 1SNUA 3LMHA 4AGWA 1PMVA 4ANOA 3BLRA 4YJTA 2J0MB 2B55A 2C1AA 4EI4A 4WNPA 3MFUA 5IG1A 3U55A 1SNXA 4RG0A 3LIJA 3MPAA 5K9IA 3MGYA 3TG1A 3VO3A 3NIEA 4HW7A 2HY0A 4RX9A 3ZLYA 1OKZA 3CPBA 3LW0A 4X3FC 3ACJA 5GIOE 4BKZA 3EN7A 3Q5ZA 3DPKA 3PZHA 4PF4A 5IQIA 3ETAA 1PF8A 2BRNA 4HVDA 3HV7A 4CFMA 2OLCA 4OBQA 4PNKA 4H3BA 5M51A 2QHNA 5E8XA 4CXAA 1ZYCA 4X7QA 5DRDA 2F9GA 2VWBA 4TYJA 4FKTA 2WTKB 1KE7A 4XS2A 3Q04A 3HMIA 4OTDA 5KO1A 3BEAA 4LRMA 5EKOA 4BL1A 3I6UA 4JAIA 4DFNA 1YWNA 2W4JA 1PRYA 3UNJA 2F4JA 2JDVA 2UZTA 4D1ZA 4EZ5A 2YACA 4JQ7A 3HRFA 3ZFMA 2OWBA 3DJ5A 2JIUA 4JBOA 4M7IA 2QOIA 4AT3A 3VAPA 4I5HA 3IW7A 4MNEB 3C4XA 1MRUA 1REJA 2VNWA 4ACMA 2WTVA 3NYXA 4UMTA 4EHEA 2J90A 4OGRA 4IWPA 4RQVA 5IA0A 4YNOA 5DPVA 3G33A 3HUCA 5K0XA 5CEMA 3ACKA 4ZP5A 5ACBC 4PMPA 4DH3A 5KMMA 5H2UA 3HZTA 5DR9A 2UZWE 4U44A 4RIWB 3LHJA 5F94A 4P4CA 5BNJA 2OW3A 4RA5A 4I20A 2BIKB 4I1ZA 2XNGA 4BCGA 3TV6A 5FTOA 2QOKA 2XIRA 1KE9A 2J5EA 4E4LA 1L3RE 1STCE 4WBOA 3O17A 4N4SA 4EL9A 3F2NA 4RVKA 3G9NA 1K2PA 3TIZA 3SDJA 4KABA 4II5A 2B54A 1UU7A 2NRUA 5JT2A 4BF2A 2WAJA 3FYKX 4R7HA 4FNXA 4UMRA 3WF8A 3ULZA 5K3YA 1TQPA 4UXQA 4ID7A 3LE6A 4FK3A 4APPA 4HCVA 3FZPA 2VUWA 2UZNA 3PY3A 2YAKA 1M14A 2ZJWA 1OUKA 4L44A 5FWKK 3KXZA 1IASA 1M2PA 1V0BA 3GUBA 3S0OA 3LVPA 4NW6A 4KUJA 2X2KA 4WOVA 2OG8A 3D5VA 3C4FA 5CAOA 3EKNA 5E9EA 2XP2A 4P7EA 4C3PA 2ITNA 2EVAA 1UV5A 4JG7A 4JIKA 4JNWA 4E6AA 4G1WA 5CAPA 5DEWA 2YM3A 1T45A 4LUDA 1XO2B 3QHWA 4AN2A 2UZLA 3AT3A 3TTIA 4G9CA 5CU6A 5CSXA 3W55A 5HLNA 3HL7A 1YOJA 3G0EA 4TZRA 1WBWA 1PHKA 2YZAA 3CD8A 3CEKA 2VV9A 4V0GA 3D14A 2IPXA 2X8DA 3LXLA 2ITZA 4BWPA 4BTJA 4YJRA 3U51A 2YCQA 4CKIA 2X4FA 5AJQA 4J97A 4ZSAA 2FH9A 4O38A 4IJPA 4CCUA 1YWRA 2WEIA 3G51A 5HG9A 4DF3A 1OI9A 3OD6X 1Z57A 3ORXA 2XIXA 2GHLA 2J0KA 2DQ7X 5AR4A 2Y6MA 5AFVA 2UVXA 5KCVA 3JVRA 4F7LA 2H6DA 2JKMA 2PZYA 2QD9A 3DK3A 3F5PA 4V05A 3SA0A 4OBPA 3UOLA 4WT6A 5K0KA 3UJGA 4FSUA 3AD6A 2XBAA 5HIDA 1MQBA 3MPMA 4IAZA 1K9AA 3FHRA 3ALOA 5AEPA 4ASEA 4ZY4A 5J5TA 1JKSA 1E9HA 3PUPA 1VEBA 5CXHA 3VUGA 2C5OA 3NUPA 3VRYA 2J5FA 3TUBA 3CY2A 4RFYA 1J7LA 3C5IA 3FEGA 4DA5A 4FEXA 3MYGA 4IADA 4RLKA 3W2QA 4BYJA 2XK9A 3RNYA 4F63A 5A4EA 2JIIA 4DGGA 4Y5QA 4DTKA 3SOAA 2OGVA 4XG8A 4GK4A 2CN5A 1XH9A 1H24A 2XKEA 3COKA 5JFVA 4FV7A 4GVJA 3IONA 4O91A 3KVXA 3FPQA 3IPHA 4BTMA 1FGIA 3VUTA 4DFZE 2X2LA 2Z2WA 4XP2A 1O9UA 4EONA 5D7AA 1PMEA 4RIYB 2W1EA 5LOHA 1ZMUA 4BKYA 4KS8A 4FIFA 4USDA 4NSTA 4ZMEA 1H28A 2XKFA 3TKHA 5J9LA 3RK9A 3EQCA 2AYPA 4MQ2A 5M57A 2O3PA 4MXOA 4XLIA 4GEOA 4WBBB 3AC4A 3RAWA 4AXAA 4FEVA 3FYJX 2OZAA 2YAAA 3GQIA 3O7LD 5HE0A 4DINA 1LPUA 2OIQA 2C0OA 2QOFA 2YDJA 3LXPA 4I24A 5EYMA 4OBOA 4CYIA 5K4JA 2IW6A 1QMZA 3QLFA 3SG9A 1WAKA 1SYKA 2BAQA 4LL0A 2J2IB 4EZ7A 4UBAA 5CU0A 2A27A 3FPMA 4KAOA 3KF4A 1U5RA 2V0DA 2W0JA 5IUIA 5J8IA 3KVWA 4FTNA 1PXPA 1J7UA 3DJ6A 4H3QA 1BMKA 5L4QA 1ZOEA 3H9OA 3ID6C 2ZVAA 3PA3A 2XJ1A 2OXYA 2OF4A 5AUZA 3WZKA 5DT3A 4DLJA 1M52A 2J9MA 1AD5A 2V62A 3DKFA 1YXXA 2E9OA 4JQEA 3TUCA 3KRJA 1V0OA 3DBFA 3TACA 3MFSA 5CWZA 5C8MA 3R7OA 5ETIA 4F7JA 2ZDTA 4O27B 5D12A 4E6CA 4O84A 3MA6A 3RPSA 2CGVA 5DLSA 3W2RA 3W2CA 4U42A 3GC9A 3ODZX 2UW9A 1EH4A 4IAKA 2PSQA 3FI2A 4H05A 3K5VA 4O2PA 4XJ0A 4A7CA 4ZLOA 3WF9A 5EI6A 3VWAA 3FZSA 4ZSLA 1NVRA 2PUUA 3PJ8A 4E93A 1GIHA 3GP0A 2BZIB 3Q60A 2CSNA 3MB7A 4PL4A 4YZMA 4K0YA 4C4HA 1I44A 2YEXA 4O0WA 4TNBA 2DUVA 3H3CA 4EC8A 1PKDA 2FYSA 3ZS5A 5CSVA 2WNTA 4FT9A 3I1AA 4ALVA 2CN8A 3DAKA 3GC7A 2GQSA 2BZHB 3OWPA 3PFQA 3EYHA 2SRCA 2BTSA 4FTUA 4B4LA 2HWOA 2OBJA 4PDYA 3QWKA 2OSCA 4WD5A 4XG4A 1Q62A 3LJ1A 4BCMA 4GV1A 4DH7A 2GS6A 1XHAA 3MDYA 3KK8A 4X2GA 2BFXA 4AGDA 1LEZA 4RZVA 5L6PA 3MBLA 2YZLA 3CPCA 3DBEA 3QD0A 1IA8A 1APME 2HIWA 1FVVA 2HWPA 1VJYA 3R7VA 2HW7A 4FKSA 1FVTA 4U79A 4IXPA 5AMNA 4CT2A 1Y8GA 3D7TA 1YOMA 2CHLA 4BDBA 2QKRA 4EK4A 4X2KA 4BGQA 2YA9A 4U45A 4NIFA 3R0TA 4GUEA 3UIMA 4Q5EA 3MIAA 4BGGA 5LCJA 2F2UA 2I1MA 3OXTA 5M4CA 3TKUA 2OH4A 3UQCA 4ZMFA 4J95A 3QKMA 3FV8A 2W5BA 4E5AX 3D5WA 4AA0A 2KULA 2Q0NA 2PL0A 3AD5A 4O0UA 1P4FA 3UIUA 3V5QA 5DGZA 2YHVA 4EOSA 4RX8A 2C6KA 4MCVA 4XEYA 2ZMCA 4GYIA 4FE2A 3RGFA 1Y91A 3PZEA 1WBSA 3WF5A 4DT9A 4Z3VA 3PRIA 3ZZWA 3ZCLA 4WUNA 3QTQA 3U6JA 5HHWA 3JR1A 5F9EA 4JG6A 2YIXA 3HDMA 3BBWA 3RZBA 2PMLX 3M1SA 4J8NA 2P2IA 4KKEA 3HRBA 2VX3A 4NZWB 4DGMA 2PVMA 4EHGA 4PPAA 3MH0A 4O0RA 3OFMA 3L9NA 4R3PA 3FMMA 5CNNA 3PG3A 2VTLA 4LM5A 1CM8A 3ZTXA 4HZSA 3LPBA 4FVRA 4D9TA 2PTKA 3PSCA 3FWQA 4QMQA 5L2WA 4BCHA 2OFUA 3PP0A 4YTCA 4UX9A 1H25A 2V7OA 3PY1A 4GH2A 4TWNA 5IQAA 4ZSEA 1JOWB 2OI4X 3COHA 4V04A 1FPUA 5M08A 1GAGA 5J1WA 2Y4PA 2XIZA 4RQKA 3LFDA 2X7FA 2OICA 3H10A 2O65A 3MVLA 4IAYA 2WQMA 2J0JA 4YZ9A 2YWVA 5AP7A 4FR4A 3HMOA 2IN6A 3O2MA 3Q9YA 2R64A 4NKSA 3ZSGA 4BDHA 1WMKA 4TKSA 2R7BA 1XKKA 5J7BA 4X6RA 3PVGA 1M2QA 2W9ZB 3R1SA 3RHKA 4R8QA 4ANSA 5EQYA 2FSOX 3EQFA 4TYHB 4W8DA 4WRSA 4RVTA 4QMSA 4ZTQA 2X1NA 2VZ6A 4MXYA 2BRMA 1PXJA 1PXKA 3SOCA 3VW6A 4F1OA 2GQGA 4YMJA 3A4OX 3GU4A 3KU2A 3QRIA 4TWOA 2EU9A 4OUCA 1SMHA 3DOGA 3MJ1A 1H00A 2QO9A 1Q8YA 3I5NA 3QAME 4KINA 2G2IA 2UZBA 4I6QA 4FG7A 2ZB0A 1J1BA 2PE1A 2IO6A 3QQKA 4FUXA 1URWA 2YM4A 3OWKA 4GJ2A 4QYYA 4QPMA 4U9AA 2YFXA 2H8HA 3O23A 3VHKA 4O1PA 5AAFA 4AZFA 3PIXA 3MY0A 4EBWA 4QMUA 3NW7A 3PPJA 4B8MA 1H1PA 2IVTA 3NCZA 4G6NA 3ZXZA 3OOGA 3AC2A 2VTOA 2CNUA 2UW6A 2WKMA 2A4LA 2BZJA 4D55A 2GNJA 3ET7A 2VX1A 4U97A 5BUIA 1W0XC 2BHHA 5FTGA 1JKTA 3NGAA 4PY1A 5B7VA 3ZRKA 4USFA 4FTIA 4CKRA 3F3ZA 3ZOSA 2W05A 3UO5A 4MH7A 3M2WA 3QRUA 4MBJA 5BVOA 3PXYA 4DBXA 2REIA 5D1JA 2P4IA 5DE2A 1JSVA 4K6ZA 3TZ8A 1ZYJA 3BWJA 5FP5A 4C37A 3TNIA 2HZNA 3UNKA 1KE5A 3GCUA 5IA2A 2QONA 4EWHA 5CF5A 4L45A 5H8BA 5FEDA 2GSFA 4YBJA 5F95A 3VVHA 2W1CA 3CLYA 4CQEA 2YN8A 3QWJA 5J7HA 4FZ6A 5E1EA 5CANA 2JLDA 2WIPA 4W4XA 3PLAE 2WO6A 3ZFXA 2WD1A 4HYHA 3Q52A 1Q61A 3O8UA 3OS3A 5DNRA 5AX9A 2XNOA 3TV7A 3W2OA 4U0IA 5BPYA 5CF8A 5M09A 4BICA 4QQCA 3QX2A 4JT3A 3ANQA 4S30A 2WTKC 5BQ0A 4RWIA 4YC3A 3U9NA 1H8FA 3HV6A 5HVJA 4M69A 5IMXA 5IUGA 4BGHA 5CT7A 4I41A 3ZRMA 5AA8A 3QA0A 4DN5A 3CD3A 4I94A 5HU3A 1P4OA 2R3JA 3BV3A 1PYEA 3EQHA 3FLSA 3NUXA 2W1IA 4E6DA 1Y6AA 4RIOA 4EK3A 4PTGA 5CZHA 2QOLA 2CCHA 5J9YA 2EXEA 2HELA 3Q6UA 4TT7A 1UNHA 3QZFA 5GZ9A 5JRSA 3RHXA 4BDGA 4EHVA 5DMZA 5CYIA 5K5XA 4MXAA 4NWMA 5AR2A 1XH6A 4C02A 3FI8A 1KV1A 5ACKA 3UP7A 5BVKA 3NX8A 4I0TA 2JITA 3FI3A 4IWDA 1ZAOA 2XK6A 5CI7A 5AR5A 1BI7A 3BE9A 4DE4A 3DK6A 5AP5A 3QQUA 4KIQA 5JFXA 4FT7A 4KRDA 5EDRA 3UTOA 2HXLA 2IVVA 3ZONA 2Z7QA 5HE1A 3DLZA 1H1SA 1Q8UA 3OP5A 4YLKA 3QXOA 3THBA 4GUBA 5J1VA 2W1ZA 4C3RA 5I3RA 1IEPA 2CKQA 4CFVA 4FNYA 2C6LA 3TJCA 3CBLA 1YDSE 5JFWA 2VWUA 3EIDA 2XRWA 3IKAA 3KEXA 4Y46A 3EJ1A 4GG7A 2OIBA 3P4KA 3QZIA 3QL8A 4KNBA 4L53A 4M69B 3D5UA 2R3RA 3GNIB 4NK9A 2XYNA 2YJSA 3RBWA 3WZEA 5BVDA 4ARKA 4D9UA 3LJ2A 4TW9A 3QTIA 1KSWA 2CGWA 5ANEA 5HD7A 1UU9A 1J1CA 3AC3A 3L8PA 3MH2A 4OR5A 5DEYA 3S4QA 4EWQA 5C4KA 2YM5A 4F0GA 5AAGA 3RPOA 2ITVA 3LMGA 3QD2B 5I9YA 2YABA 3O71A 3SHEA 4R7BA 4DH1A 2OJ9A 4BCPA 1DI9A 3ALNA 4QNYA 1U59A 5CENA 2X2MA 4FNWA 3V3VA 2VO3A 2GTNA 4GT5A 3G5DA 4C4EA 5F4NA 3VJNA 4C3FA 2A2AA 1Q4LA 3HP5A 4D4SA 2XJ2A 3W8LA 2PZIA 4ZIMA 4KD1A 3VBVA 2DS1A 3B2TA 1E1XA 4V01A 5A3XA 4B8LA 5DYJA 4TYIA 3Q4CA 2HYYA 4NM0A 3E63A 5E92A 5GNKA 2LAVA 3PVUA 2QLQA 2CGXA 5KBQA 4BI0A 5JQ8A 5FQDC 3GU7A 4FV8A 4JBQA 3KRLA 5AUYA 4EOQA 3VBXA 4YHTA 3QRKA 4GFMA 4F6UA 3WZJA 5LWNA 5H3QA 2WQBA 4MYGA 2OJIA 2VTNA 4RJ3A 4FGBA 2O0UA 4N70A 5CEOA 3OXIA 4C4GA 4F08A 3R1NA 1WFCA 3FLWA 2BROA 4BCIA 4MX9A 3PVBA 1MP8A 4C2VA 3P7CA 3UBDA 5E8ZA 4YSMA 5HZNA 4QMNA 4DGLC 1BUHA 1YWVA 4PPBA 5EYDA 1XWSA 2NP8A 4KB8A 3AD4A 5LXMA 3QA8A 2XZSA 4YZDA 2HZIA 1NVSA 3BI6A 2DWBA 3E8NA 1YXVA 5EOLA 2P2HA 3L9MA 4KKGA 3WZUA 3VUKA 3UYTA 5A4CA 3HECA 2CKEA 2VTPA 4O1OA 1VZOA 1ZMVA 3FHIA 4AFEA 2VTAA 2CGUA 4YTFA 1Y57A 4A9UA 3WARA 4I93A 1RQQA 4I5PA 1ZY5A 5FXRA 2QO7A 5E8WA 3HAVA 2C6IA 3O0GA 3TJDA 4CMOA 3AMYA 4LI5A 1JWHA 3R22A 4PPCA 2I0HA 3IGGA 5HICA 2QOOA 3QBNA 1XJDA 4H3PA 1PXMA 4GRBA 4IDTA 1UNGA 4RIXA 2VWYA 5A14A 2W4KA 3QX4A 4MNEA 4FSQA 3UVQA 4NCTC 2GFCA 3EFJA 5EW8A 2YM6A 2GHGA 4DGOA 4BCNA 3ULIA 4ZSJA 5HG8A 2ZV8A 3FC2A 4LV8A 2F7ZE 3ZM4A 2QR8A 3DTWA 5AM7A 3GQLA 5D11A 3BHTA 2OFVA 3M11A 4FF8A 4ZJIA 4E3CA 4RWJA 4FEWA 2AUHA 2ITUA 3C4EA 2FVDA 1HCKA 3HP2A 1P14A 1V1KA 2C3IB 2WGJA 4YHFA 4OTHA 4C57A 1W84A 3UPZA 2Y4IC 2PUPA 3TKIA 4D2SA 3IQ7A 2UW5A 4G5JA 5AUXA 4DFYA 3AG9A 5C03A 1UA2A 3NNXA 4GK2A 4WA9A 1PXNA 5F20A 1BLXA 4FA2A 1JKKA 3T9IA 4EQMA 1NXKA 3EN5A 4DCAA 2FSTX 4F1TA 5A4QA 1R0PA 4DLIA 5FBNC 1YHVA 2WFYA 2IJMA 2WU6A 4AG8A 1GZ8A 2UUEA 2UW0A 3QQLA 4FV4A 3VHEA 2W06A 5CEIA 4FKIA 4BDCA 4F4PA 4LQMA 2XEYA 3E8DA 3P0MA 2C1BA 4LOOA 3DXQA 1L8TA 3LCSA 3ZRLA 3MH1A 3ZSIA 3LLAA 4FZ7A 5HCZA 5ICPA 4OLIA 4GKIA 2XNMA 3VNTA 1XBBA 3GFWA 3JYAA 3Q2MA 5IH5A 3P1AA 3Q53A 4C7TA 3A8XA 3GU5A 2PVYA 5FP6A 4EH2A 5HIEA 3PY0A 3GC8A 2R3FA 4K2RA 3KA0A 4I6BA 1FMKA 4UV0A 1JSUA 5ANIA 4A9YA 1CKJA 2V55A 4XG3A 3L9LA 5BMMA 1PXLA 4L52A 3SKCA 4YLJA 3ZEPA 2OJGA 4C62A 2A0CX 5IF1A 1GIIA 2RIOA 4XOZA 3FLQA 5IQDA 2RFEA 4AWIA 3AXWA 5DIAA 4EORA 4EUUA 4DC2A 3E62A 1VYWA 3QZGA 2R9SA 4ONAA 4YJUA 2VWVA 1JKLA 4UN0C 2VGOA 4RGJA 3R28A 5JEBA 5E8VA 3PIYA 1Q99A 5I9XA 2QLUA 3WF7A 1UU3A 4FTLA 3ELJA 2OK1A 3D94A 4O0YA 3UYSA 4AU8A 5BUEA 4DTAA 2XIYA 4LRJA 1OECA 3EH9A 3KCKA 5AUVA 4HVGA 2R5TA 4RT7A 4ZZMA 3A2CA 5TT7A 2W1HA 3O7LB 5LVPA 4FKPA 4BCKA 4YTIA 4NL0A 3W32A 4IVCA 4U6RA 4LGGA 3OCSA 1WBPA 2QOHA 5JSMA 2WQOA 5KZ0A 5GJFA 3V8TA 1G5SA 5KX8A 4YJQA 5LMBA 5KUPA 2BALA 3PTGA 3OC1A 3OXZA 3FXWA 4C4FA 2GNHA 4BCQA 2J0LA 4FSZA 3II5A 4H39A 4OTRA 4EZ3A 4FYOA 2GNGA 3N51A 1UWJA 4S32A 3ZHPC 3DNEA 4JX3A 2BDFA 5KMKA 4NYEA 3EL7A 1H1RA 2R2PA 3FL5A 3LFQA 4ZEGA 4D2RA 2ONLA 2WELA 2PPQA 3GGFA 4F0FA 5DOSA 2RFDA 4WHZA 4I4EA 1H1QA 2X6EA 2C30A 4BVUA 3E7OA 1DS5A 3QLGA 3BQRA 4X3JA 5AV1A 3BGZA 5IUHA 3MVMA 4IVBA 5EI8A 5CLPA 1XBAA 3VBTA 3LXKA 4E6QA 1XH4A 4IM0A 3DLSA 2CMWA 3TEIA 3S00A 4AA4A 3R63A 2F7EE 2ERZE 3QKKA 5GJGA 5E7RA 2GCDA 3EQDA 3TL8A 3UG1A 2I0EA 2YIWA 5IA4A 1IR3A 3DA6A 3MTFA 3TXOA 3O96A 4Y72A 5HBEA 3QU0A 2VTSA 5DRBA 3MTLA 4IZ7A 4RIWA 5AAEA 4W8EA 1B38A 4UY9A 4Y73A 1KUTA 4GMYA 3HMMA 1ND4A 4OAVB 5FBOA 4ZJVA 4E8AA 4J1RA 3KCFA 4XMOA 1YKRA 3KMMA 3NPCA 2HW6A 4QYHA 4JVGA 4AGUA 2E9VA 3VULA 3LCTA 4AP7A 5HX6A 3AC5A 3R9NA 1UWHA 3ORIA 3DNDA 3OVVA 4DEHA 3KULB 2WHBA 1UKHA 3FXZA 2ZM4A 5JK3A 5M06A 4G6LA 3Q4ZA 4MXXA 4CG9A 3CP9A 5DH3A 5ANOA 1JNKA 2I7QA 5M4IA 2BHEA 2X6DA 5AP4A 3JPVA 4JRNA 4NM5A 4YR8A 4FZDB 4O0XA 2R3IA 3BHYA 3FKOA 5IEYA 5IH6A 3TN8A 2LGCA 1XBCA 4QQTA 1UU8A 2YIYA 3E64A 4LOPA 3P79A 3GCPA 4HOKA 2IZSA 4RMZA 5CF6A 3IOPA 3LJ0A 4QTCA 4B7TA 4KSPA 2B9HA 3FZ1A 3R8PA 2JBOA 3E87A 3OEFX 4S33A 5FDPA 5EQEA 4DH8A 3L8VA 1NVQA 4QMPA 2R3OA 5M56A 4ZTMA 4DBNA 4NJDA 2OU7A 3TWJA 2W9FB 2KTYA 3F88A 3RP9A 3LQ8A 1ZOHA 4IQ6A 5IEVA 1ZOGA 3R73A 2PMIA 3OW3A 5CEKA 5B0XA 4A9TA 3VQUA 2GNLA 3SV0A 5HBJA 4FK6A 2WIHA 3B8QA 4IAAA 1Q3WA 5CSPA 5GIPE 3RK7A 4O7WA 5A4LA 2XKCA 4V0GB 2HXQA 5CS6A 1KWPA 3DZOA 3LZBA 5CNOA 3TV4A 2EWAA 4IB5A 3BYMA 1V0PA 5IA5A 2ITOA 4M15A 4EUTA 3MA3A 4BDEA 5F1ZA 4OAUC 4WRGA 4KWPA 5M4UA 5IQCA 2J6MA 3BELA 4QP2A 3AGLA 3KRXA 4MBIA 5JMSA 4ACGA 2WB8A 5KE0A 5E1SA 1ATPE 2Z7RA 3P08A 2IW8A 4BHZA 5K4IA 4HGTA 2JGZA 2FB8A 4EYJA 4LG4A 4YU2A 2GHMA 4O83A 4FKJA 1O6YA 4RIYA 4I6HA 2CJMA 3WIGA 3V5WA 4MXZA 5FUTA 1GJOA 4YTHA 4FOBA 2QCSA 3ZC6A 1O6KA 5JN2A 4M97A 4ANNA 4HGEA 5HG5A 4KKHA 1B6CB 3OEZA 4G3FA 4OT5A 5HTCA 3NLBA 4BHNA 5HOAA 3BBTB 3F69A 3D2KA 2WXVA 3LFNA 4WG3A 4CCBA 5IQGA 3W18A 2ZV2A 4NKAA 3NEWA 3OW4A 2WQEA 4TXCA 2WTDA 4RSSA 2IVSA 2Y0AA 4LUEA 5CALA 4KRCA 4DT8A 3L8SA 4BDKA 3RKBA 3W8QA 4I0SA 4AW2A 3R21A 4QD6A 5E8TA 4IWQA 3HX4A 3QUPA 4JLCA 3EQRA 2A19B 3V01A 2C6EA 2R3HA 2WMAA 4QYGA 2B9IA 4G3CA 5GZAA 1TQMA 3MB6A 3CCNA 3COIA 4HVHA 4WNMA 4A9RA 1OBGA 4FT0A 1Y8YA 2OJJA 3LM5A 4ACCA 2W96B 3JVSA 1DM2A 1ZXEA 4HCUA 3R9OA 3W2SA 3IOKA 4WSQA 5CXZA 5H9BA 4AZSA 5IA1A 3QD3A 2ITPA 4BZDA 2XK3A 4XV2A 4RC4A 3IW6A 4UYAA 1FOTA 2V5QA 2JDOA 2BFYA 4QP3A 4Y83A 5CQWA 5CAUA 2I0YA 2XEZA 4BRXA 5A6NA 3CR0A 3NUYA 5JGDA 3OZ6A 3P23A 3TNQB 4NU1A 3ROYA 4DG3E 5L6WL 5JFSA 3LQ3A 5HESA 2C0IA 2XYUA 4DCEA 5A54A 3NUAA 3FE3A 1W83A 2WMBA 1M7NA 3ODYX 4YJNA 5D41A 2YDKA 2XUUA 1G8SA 4AW1A 5AR7A 3G2FA 1JSTA 3QYWA 3NAYA 4GFOA 4PDPA 4PP9A 4E7WA 3UOHA 3F3UA 1PXOA 5AV4A 1OL7A 1R0EA 3LFBA 4MBLA 3COMA 4TTHB 5G1XA 3PJ3A 3SW7A 3CQUA 2J7TA 4F6WA 3DBDA 1ZZ2A 3CE3A 3PJCA 4FSMA 3FLNC 4Y5HA 5BYLA 3KGAA 4MVFA 4YSJA 3C51A 4XRJA 2VWWA 4RZWA 3DT1A 3WI6A 4DH5A 3U6HA 2XK4A 1SVHA 4FMQA 3CIKA 4J98A 2G2FA 1BX6A 3OWJA 3D2IA 3VF9A 4J52A 4EOIA 4GW8A 2ZOQA 2HCKA 2R0UA 3F9NA 1J7IA 4FKRA 4AOTA 1U5QA 3GB2A 4QTEA 5AADA 4JR3A 4ZTNA 3BQCA 4KA3A 4BYIA 1REKA 2X7GA 4EHZA 3ZLSA 4UB7A 3OCBA 1OM1A 2FSLX 5CEQA 4DEDA 3ORLA 4DEEA 3TZMA 3ATSA 3C7QA 2QG5A 4IVAA 1GIJA 3K3IA 5EM5A 4YZNA 5DN3A 4Q9ZA 4O7SA 1Z9XA 2PWLA 3DK7A 4FZFB 5BYZA 3NAXA 4E4NA 3F6XA 3QCXA 3A7GA 3FC1X 4H1MA 3FLZA 3WILA 4M68A 3FSKA 3VUHA 4XG6A 2I0VA 3MN3A 4EBVA 3SRVA 2W99B 2YWPA 5T3QA 1IRKA 4AN9A 4C36A 5LVOA 3ZUVA 5HQ0A 5AR3A 3FUPA 3WZDA 4G3EA 3G15A 3BZ3A 4FG9A 3QRJA 4FSNA 1Z5MA 4GFGA 4TWCA 5EDQA 3L1SA 3ZO2A 3EWHA 1WCCA 4EJNA 5HVKA 5EHLA 4CT1A 3DQWA 5KHXA 2JKKA 2Z7LA 4IZ5A 4FOCA 4QMMA 2E2BA 3UQGA 2Y7JA 4J8MA 4XP0A 3Q5IA 1OPJA 4EYMA 3NNUA 4ERKA 2O63A 4GK3A 2C69A 3QQHA 4R5YA 4BBMA 3ZBFA 1MQ4A 2GDOA 1NA7A 2VTQA 3C4CA 4LGHA 5AWMA 3E7VA 4E73A 3E93A 3DJ7A 3C50A 4BDAA 4ALWA 1HOWA 1OB3A 2C3KA 4M0ZA 4CNHA 2XCKA 5FD2A 3IS5A 3OY3A 4NJ3A 4NTTA 3ROCA 5DR6A 3U8WA 5IISA 4P2KA 3O8PA 5I3OA 2G2HA 2P3GX 3MSSA 5FEQA 1OIRA 3KXXA 2XK8A 4P90A 4F9BA 1OKWA 2GS7A 3LCDA 2RL5A 3C0IA 3FKNA 5DT0A 5CTPA 3MVHA 2BAKA 5EG3A 3SXRA 3V6SA 3GU6A 2ZV7A 2OH0E 3F3WA 3KFAA 3P9JA 4GCJA 4LL5A 3MFRA 5JGBA 4JX7A 3A4PA 3ENHA 2QU5A 5BX0A 1YHWA 3DAEA 1M7QA 4QP1A 3OUKA 5IDPA 4U43A 1Q8TA 4CRLA 2RSVA 1CKIA 4I21A 5AM6A 5M07A 3F2RA 4D58A 4L01A 4JG8A 3IK3A 4J7BA 4JL9A 4FTQA 4UMQA 3BHVA 3PWDA 4P5QA 3GXLA 4G17A 3I81A 4QMOA 5TF9A 2RKUA 5DVRA 3EZRA 1YQJA 3UE4A 3UZPA 1W98A 3AC1A 3EL8A 4PNIA 5FXQA 1ZYSA 5L8KA 3W16A 1RE8A 5AV2A 3SAYA 4F6SA 1PW2A 3BGQA 5L8JA 4BBFA 4YLLA 4UZHA 5JQ5A 1H01A 4FKUA 2VTHA 3VJOA 3BU5A 1YI6A 5CASA 3R1YA 4NT4A 3RCJA 3R8LA 5HNIX 1FVRA 2GU8A 3RNIA 4PUZA 4YJSA 2OZAB 5CT0A 2PUIA 4Z7HA 4PQNA 2JKOA 3ZBXA 3L8XA 3VRZA 3D7TB 5AIRA 2GNIA 2G15A 3F5XA 3VIDA 3EQGA 3KY2A 3OUNB 5JKGA 1URCA 5EHYA 2F57A 2VN9A 4B9DA 4CFXA 4BDDA 5CVHA 4O81A 4LRKA 2BVAA 3HA6A 1W82A 2JBPA 3T8OA 4C38A 5AP3A 3R7IA 3RVGA 3NNVA 3CKXA 3QTSA 4FI1A 3OMVA 1OL2A 4QP9A 4FKWA 5HCXA 5CAQA 3HDNA 3SGCA 4I6FA 5M55A 2DYLA 2QOBA 4D28A 1Q97A 5FEEA 4L6QA 2H9VA 2CLQA 4J71A 3RM7A 2C6TA 5I9VA 4DTBA 2IZRA 3IDPA 4FTTA 4DFXE 4CMUA 4BZNA 2PVFA 1IAJA 3IW8A 5EI2A 1YDRE 3R9HA 5FRIA 1MRYA 1Q24A 4OTIA 1NY3A 1BL7A 2J50A 2X81A 4H58A 4OTPA 2WMUA 4RBLA 4UMUA 3NMUF 2EB2A 4ZTHA 4QTBA 4AT5A 4CZTA 3Q2JA 5HEZA 4DEIA 3VS1A 4BC6A 3IECA 3BCEA 4QMZA 4FG8A 3RI1A 3KXMA 1Q8ZA 3OCTA 1WBVA 3D4QA 2G01A 2X8EA 2CNQA 4LYNA 4XV1A 3Q6WA 2R4BA 2YCRA 5EM7A 4ANBA 3LFAA 2W4OA 4PX6A 4PDOA 3WIKA 3ZO4A 2GMXA 4YPDA 3UVRA 1CMKE 1P2AA 5CEPA 2W1DA 1PMUA 1UVRA 3PPZA 4ERWA 2XVDA 5IZFA 3B8RA 2BTRA 3GT8A 3PSDA 4I23A 2BPMA 3DFAA 5KZIA 4EH4A 2R3GA 4YHJA 2RF9A 4OTGA 3CC6A 5CI6A 3RPYA 2PU8A 3U87A 4D4RA 3I60A 3OOMA 2HZ0A 4QYFA 4YC6A 3HMNA 5BVEA 3SD0A 3NS9A 5CZIA 3BGPA 4RJ7A 4FIGA 3PWYA 3FJQE 2BKKA 1ZYLA 4FTCA 5C27A 3IO7A 4ZLZA 4R77A 4XRLA 2AC3A 4BY9E 1TKIA 2QQ7A 4U80A 5EOBA 4EH9A 2PULA 2WOTA 5TR6A 4IBMA 3CKWA 5FXSA 3UPXA 3OTVA 4L67A 2C3JA 3UOJA 1K3AA 4ZS4A 3QTWA 3I7BA 5CY3A 3SXSA 1Y6BA 5KMNA 2ITWA 5IQEA 3PP1A 4XH6A 2B4SB 4JDIA 3GOPA 3UIXA 4RJ5A 3UOKA 3FZRA 4YBKA 3P7AA 4CFUA 4ZSGA 5HG7A 4FICA 2C68A 3TCPA 4ZY6A 3LFCA 4JQ8A 3MI9A 3OTUA 3O51A 1F3MC 3PXRA 3R30A 4XP3A 4EOJA 2UZOA 5GZ8A 5KKRB 3LMIA 3ZUTA 4QPSA 3ORMA 4GS6A 4Y85A 3C0HA 3ITZA 4DAWA 4F09A 1PKGA 3QC9A 4O6LA 3ZC5A 2Z7SA 3TUDA 4E4XA 4ALUA 1YHSA 5EK7A 2C5YA 1Q3DA 2R3LA 4LMUA 2JD5A 4NM3A 5IKWA 4BTFA 3E88A 2Z02A 3NWWA 2R3KA 2X8IA 4FL3A 4GG5A 4FYNA 1U54B 2FGIA 4CKJA 1YXTA 5EHOA 4FEUA 4XV9A 3BU6A 4JR7A 3ANRA 4C2WA 5J95A 2XJ0A 3DXNA 5CX9A 4OTQA 4QYEA 4YC8A 1DAWA 3W10A 2QVSE 3QKLA 1YXSA 2C0TA 4F9AA 2WTIA 5LVMA 4JI9A 1I09A 4PMTA 1H27A 4FKLA 3TNPC 4CD0A 4H36A 3A7IA 3EYGA 3SRVB 4RWKA 3EQBA 3KL8A 4XG2A 3I0OA 4CVAA 4HNFA 4D1SA 4NEUA 3OHTA 4O7TA 4F70A 3FI4A 4YP8A 4EH3A 3UO4A 3MESA 4EQUA 3AC8A 3QTUA 4HPUE 2PY3A 2X39A 4CG8A 4MD8E 1UKIA 4IFGA 4FV0A 4M13A 3K3JA 4D0WA 3W2PA 1QCFA 2RFSA 2UZUE 3NZ0A 4R5SA 4O22A 3RK5A 3DFCB 2XA4A 3SW4A 4BI2A 5LMAA 1S9IA 4JDHA 2X7OA 3QALE 4JBPA 3TDVA 4I0RA 3QC4A 5DA3A 5GJDA 2F7XE 2BDWA 5C01A 4HYIA 1YDTE 5DHJA 3KKVA 1JVPP 4PWNA 4WSYA 3UP2A 5EYCA 2VNYA 2ZM3A 3EQPA 4AW5A 2RGPA 2R3QA 4FIIA 3LCOA 5HCYA 5IU2A 1XQZA 2C6OA 5LMKC 4HZRA 5BVNA 4R7IA 2WQNA 3PDTA 5EW3A 4DITA 4GIIA 1OPLA 3UDBA 3DAJA 3KXGA 3PE1A 2C6MA 3DZQA 3VS2A 5BMSA 4BCFA 4A4LA 4L68A 3AQVA 3DU8A 4ZOGA 3RAKA 5B2KA 5EKNA 3DY7A 4QT1A 5CVGA 4AX8A 4AN3A 3EKKA 3PG1A 4K9YA 3LFFA 2G1TA 3R6XA 4ASDA 4F65A 3TDWA 1ZYDA 2J4ZA 3DCVA 4EOLA 3BE2A 3HKOA 4LFIA 3WBLA 3G6HA 1AQ1A 3DGKA 3HEGA 4I4FA 4XCUA 3RPRA 3FDNA 1WVYA 2PZPA 1OBDA 3F7ZA 3R01A 5KKRC 3IGOA 2GNFA 3PPKA 4QP7A 3HNGA 4CLIA 5FLFA 4FKVA 4RIXB 2X9EA 2JDTA 3CTQA 4FEQA 4CQGA 3N4VA 2WMTA 1OIUA 3HV5A 1GY3A 2C6DA 4CYJA 4UWCA 5J87A 4FZAB 3VBWA 1A06A 1OIYA 5HNGA 1U46A 3ZUUA 5B2LA 4O6EA 4FV1A 4F9CA 2EUFB 4QQ5A 4M8TA 4JJRA 3ZO3A 3TIYA 4MEDA 1JPAA 2PMNX 2V7AA 4FV6A 5C9CA 1H4LA 3R1QA 4N6YA 4RJ6A 5HU9A 4FC0A 4G34A 4HGLA 5DI1A 5HBHA 4EOMA 1VYZA 5KMOA 4GT3A 2HAKA 2EXCX 5GINE 2B9JA 1S9JA 2VWZA 3DB6A 4KIOA 3JY9A 2FA2A 2BRBA 2VTRA 5TO8A 4QNAA 3Q4TA 4AZWA 4IZYA 3QTXA 5HLPA 4AE6A 1H1WA 5A9UA 1OZ1A 4IX3A 2VD5A 4MK0A 4R3RA 3SC1A 4D2TA 2HY81 3S2PA 2VO6A 3VS6A 4DGNA 3GCQA 4UEUA 5E8YA 4LMNA 4NM7A 4CZUA 1G3NA 2PUNA 1RDQE 4FVQA 4GVAA 1IG1A 2XMYA 4IANA 1CSNA 2B52A 2QOQA 1BI8A 2XF0A 3LFEA 3HV4A 4K18A 3NUSA 5CSWA 3Q9XA 5IPJA 3C1XA 3S1HA 3RM6A 5L2SA 2VTTA 2R0IA 1AGWA 2VRXA 2R3NA 4JXFA 3UMXA 4CLJA 3RALA 3CJFA 2XNPA 3HA8A 4AW0A 4PP7A 4PV0A 5KMIA 5E90A 4A06A 3KRRA 4X0MA 3R8UA 4EH8A 4QO9A 3FQSA 1M2RA 3KXHA 3FXXA 2C5NA 2RFNA 3LCKA 4GL9A 1SVEA 4OW8A 4RX7A 2F49A 3MWUA 3TI1A 4EEVA 4IM3A 4O0SA 4BDIA 2XNBA 4FNZA 3QCYA 1UNLA 2BILB 2R3MA 2WMQA 1ERKA 1OMWA 1SM2A 1LEWA 4BTKA 4CTBA 3P78A 4I3ZA 3CQWA 3RAIA 5HTBA 5LVNA 1JQHA 4PTEA 4O96A 3F5GA 3PXZA 4FUYA 1YW2A 4MWIA 4L8MA 5ETAA 3ZO1A 3ZLWA 2VX0A 3PXKA 3U4WA 1X8BA 3K2LA 3NIZA 3VUMA 4I5CA 3JXWA 2X4ZA 2QI8A 4MD9E 3E3PA 4MNFA 4QMVA 3AMBA 3OT3A 4AOJA 4ACDA 3ORPA 4DYMA 3LAUA 2IWIA 2WEVA 5AR8A 3G90X 4PL5A 4Q9SA 1ZZLA 3CQEA 3QQGA 2ZMDA 4NFNA 4ZTRA 5JZNA 2JIVA 4F9WA 3NYVA 3I0QA 5T68A 2YIQA 5D10A 1JLUE 3RINA 3ZDUA 3KMUA 2UVZA 4BBEA 4ENYA 5L3AA 4C0TA 2XNNA 3ZM9A 1HCLA 1W7HA 4ZZOA 4RRVA 4JOAA 1OL1A 3UIBA 2JDRA 3LM0A 2VTJA 4ITJA 3NNWA 3WE8A 1WVWA 4GIHA 4K1BA 4GU9A 2OF2A 4IJ9A 3EZVA 2QC6A 3R8VA 2VU3A 4K33A 3H9FA 3BU3A 3MIYA 2FO0A 1PJKA 5AA9A 1Q5KA 2YLFA 3H0ZA 3HMPA 4E1ZA 1KE6A 3AMAA 4ZTLA 2XRUA 4IB0A 3EFLA 5AV3A 1CTPE 5HE2A 1BKXA 2BR1A 3BHHA 3ZEWA 3VS0A 2O2UA 3T9TA 3QQFA 4IEBA 5C8NA 4TWPA 1OKYA 4N6ZA 4UZDA 4AZVA 5JZJA 2ETKA 4GYGA 5HNBA 3GI3A 2ITTA 3A60A 3CS9A 3EB0A 4Y8DA 5BYYA 3DQXA 1WBNA 4FV3A 3N4UA 5T6KA 2JDSA 3E8EA 4CRSA 4G16A 2CKPA 3DBCA 2UZDA 2W5AA 3R83A 2YISA 2XKDA 1KV2A 2ACXA 3LFSA 4L9IA 3R7YA 4ANLA 4NIFB 4XNEA 5M4FA 5HKMA 5CU2A 4ZLYA 1R39A 1LR4A 4WNKA 1TQIA 1KOBA 3UC3A 5IH4A 4FTRA 4RVMA 3PE2A 4RA4A 4LGDA 2WU7A 4LV5A 5HO6A 4MTAA 4F64A 2EXMA 5I9ZA 4PDSA 4USEA 4PL3A 3O50A 3KXNA 3ZXTA 5HX8A 5EDPA 2BMCA 3PRFA 5LMKA 3PVWA 3D7ZA 2PVKA 3E92A 3PSBA 5HVYA 3NUNA 3FSFA 4GSBA 4TYEA 5ETFA 4XX9A 2VWIA 3TTJA 3C5UA 3F82A 2IW9A 2NPQA 5L6OA 3KF7A 1OVEA 5IEXA 2Y9QA 3BLHA 1GZNA 2PE0A 2BCJA 3MFTA 4HGSA 5C4LA 5BVFA 1ZLTA 4CFWA 5A6OA 4HYUA 3DDPA 1QPJA 2B9FA 4Q2AA 4YJVA 4EK6A 3C13A 1XR1A 1JBPE 4YJPA 3V6RA 1YRPA 4L43A 2GS2A 3DXPA 4ZY5A 5H8GA 3Q9ZA 2QR7A 2OXXA 4QRCA 2ESMA 3SXFA 4EH7A 3FQEA 2FUMA 3KK9A 5H8EA 4GKHA 4L42A 3OROA 4O86A 4C8BA 3WOWA 1RJBA 4H1JA 2WMRA 5LQFA 3E3BX 4U3YA 4AOIA 4K77A 1OITA 3CJGA 4ZJJA 3T3UA 3KQ7A 1PY5A 3P86A 2ZDUA 3PIZA 3DB8A 4O2ZA 3TNHA 3FY2A 2WTCA 4D4VA 3BKBA 3BIZA 3R7GA 4EOKA 3FL4A 3KREA 3SG8A 2CKOA 3LLTA 4EC9A 4ACHA 4M67A 4D0XA 4AZEA 3JY0A 4O21A 2RG6A 3ORKA 3MY1A 3SX9A 3W1FA 3FLYA 2C3LA 1R78A 2C5XA 3ORTA 4Z9LA 4G31A 4IFCA 4E5WA 4MAOA 4QMWA 3R7UA 3ATTA 2CLXA 4X2FA 1J3HA 4RFMA 2UW4A 4IC7A 4M3QA 4X21A 2E9NA 3ORZA 4P5ZA 3GOKA 5BVWA 5AX3A 4QMLA 4RC2A 2JFMA 1TVOA 3H30A 4ZK5A 5JRQA 4BIDA 5EH0A 2GQRA 4OT6A 3REPA 2BAJA 4IWOA 4JDKA 4FKGA 4MXCA 3A62A 3Q3BA 3B2WA 1QPDA 4G6OA 3IG7A 3LKMA 2ERKA 5AP1A 3MH3A 1BL6A 1JAMA 5E8SA 3D83A 1NT2A 3A7JA 4L3LA 5ITAA 3UC4A 2C5VA 3BYSA 3I79A 2OIDA 4YURA 4FT5A 4TL0A 3NW6A 3R2YA 5I0BA 3CSVA 3O8TA 5AP6A 1OGUA 3D0EA 4KBKA 4M84A 4L00A 1FQ1B 2VO0A 3C4ZA 3QRTA 3HV3A 4IE9A 4KIKB 4R6VA 5LCKA 4B6LA 4AAAA 2QURA 2W1FA 5EM6A 4U5JA 1OUYA 3R71A 3MV5A 2F2CB 1KE8A 1YI3A 2OO8X 3L9PA 2QODA 3FMLA 4K8AA 4YO6A 1PMNA 3QXPA 4R3CA 1A9UA 3D5XA 3QHRA 4BIBA 4M14A 4BR3A 2B1PA 2BIYA 4BN1A 4IDVA 5HLWA 3F7WA 2IZTA 4N0SA 5J5SA 3MS9A 4HCTA 4L7SA 5IQBA 1OL6A 2ZYBA 3HLLA 2WMVA 3EN6A 2V22A 3FQHA 3W33A 4IC8A 4C35A 2WOUA 4EOPA 4J99A 3A7FA 2B0QA 2E9PA 4ZXTA 3KN5A 4UALA 3SQQA 3VS3A 4RFZA 5K5NA 2VGPA 5TKDA 5CAVA 1GZOA 4BKJA 5A4TA 4FKQA 3ZSHA 3VS4A 2ZM1A 3FKLA 3FZTA 3OF0A 3HUBA 3PA4A 3VS5A 4FSYA 3T3VA 2HOGA 3PLSA 4JS8A 3F61A 5EYKA 4EOOA 2XK7A 1GOLA 3A99A 5L2QA 2NNWB 5G6VA 3F66A 3C9WA 5ANJA 3U6IA 2WMSA 1GNGA 2XM8A 2WZJA 3FMEA 3SLSA 2W1GA 4X2NA 4XLVA 3TZ7A 1J91A 4FX3A 5HO7A 5I4NA 4OTWA 2XS0A 4XYFA 3BYOA 4R78A 3D15A 4FTMA 4ITHA 2B53A 4FT3A 4DHFA 4CTCA 4QP6A 4YO4A 1Q41A 3CY3A 5I9UA 3VF8A 2W7XA 2ETMA 2A1AB 5CVFA 2J51A 4NFMA 4RJ8A 4IW0A 4EQCA 3R9RA 2C4GA 3VUIA 3R8MA 2UW8A 3RPVA 2VAGA 5FDXA 4PRJA 2Q83A 3HVCA 5L2IA 4RX5A 3Q4UA 5HIBA 2QOCA 3MY5A 5HO8A 4ASXA 2I6LA 2Z8CA 5JH6A 1ZY4A 2XM9A 3KULA 4FSWA 4HJOA 2ZAZA 3VC4A 2ONLC 3FMKA 3RTPA 3R00A 3RJCA 4DFLA 5IDNA 4N57A 4EJ7A 4A4OA 2VWXA 4A4XA 4RC3A 3FY0A 4AE9A 4KBAA 4YJOA 4KS7A 4I22A 4FKOA 3PXFA 4L46A 1YVJA 4DEAA 4UMPA 4CGAA 5CU4A 4DFBA 4DFUA 4G5PA 4YPSA 2ITYA 3NVMB 3QTZA 4GJ3A 2IVUA 3V8SA 4NCTA 4XV3A 4ENXA 2XBJA 3BYVA 4C34A 5HTIA 3ORNA 3BRBA 3I6WA 1FGKA 4QTAA 4JBVA 3IW5A 2QO2A 3A7HA 3GBZA 3QQJA 3GU8A 3V8WA 4CFFA 1H0VA 4YGAA 1OL5A 3GFEA 5D7VA 4W4YA 3MPTA 2VTMA 2W5HA 3G0FA 5DR2A 2GPHA 4IAIA 4NTSA 4FBXA 4I5MA 2G9XA 3V5JA 5DBXA 1FINA 3BPRA 1YXUA 4E4MA 3JS2A 4IH8A 4TYHA 5FTQA 5LVLA 3POOA 4U81A 4X6QC 5KMJA 2WPAA 4D2VA 2PYWA 3G6GA 4X3FA 3UMWA 4ASZA 4DEBA 4D2PA 3QFVA 2AC5A 3KB7A 3CGOA 3NCGA 2YM8A 4A9SA 4D5HA 3C0GA 4CMTA 1IA9A 1W8CA 3QZHA 3ZMMA 4U41A 4BDFA 4W4VA 3BHUA 4M12A 3DKGA 4AQCA 2X0GA 3AGMA 4APCA 3UVPA 4UWBA 4X3FB 4Z7GA 4FIHA 4AA5A 4ZZNA 1U54A 2NRYA 2Y8OA 4YZCA 5AP0A 4DG2E 3NVKI 3LXNA 4D5KA 3RWQA 2ZV9A 1QPEA 2PZ5A 4EKLA 1ZWSA 1H0WA 2ITXA 4UWYA 1DI8A 3RAHA 3HRCA 1YOLA 4E26A 3GCVA 4JIAA 3RZFA 4IHPA 4FTOA 4BIEA 4EKKA 2CCIA 3ZH8A 3R7EA 3UGCA 2P0CA 4HVIA 2BZKB 2HZ4A 2BRHA 2YIRA 3I4BA 3R8ZA 5J9ZA 4TRLA 5KBRA 3OBJA 4IX6A 4R1YA 4ZS0A 4AZTA 4BWKA 4BCOA 2Y6OA 2YLEA 3BX5A 3CTHA 3WYXA 5AUTA 3AT4A 4KIKA 4MKCA 1CDKA 1WBOA 2GFSA 5FGKA 4RLLA 4D4YA 2OKRA 3RCDA 3VW8A 4GT4A 5IA3A 5AIKA 4HPTE 4L3PA 3U9CA 2YCSA 4O82A 4FTAA 3IW4A 3NRMA 4L3JA 4FTKA 1PXIA 3NDMA 4W9XA 3TNWA 4O7RA 3EFWA 2YJRA 2XB7A 3PJ2A 5KHWA 4ZAUA 5CSHA 3R2BA 4WO5A 1ZARA 4O7NA 3EQIA 4FV9A 4NW5A 4S31A 4PTCA 5B2MA 4O7YA 4BB4A 4J96A 4R1VA 3EN9A 4MHAA 4BI1A 3D9VA 4EH5A 1B39A 1M17A 4W4WA 1F5QA 2O64A 3H4JA 4K11A 4WG4A 5E8UA 2Z60A 4U8ZA 3S95A 3BEGA 4IB3A 4IVDA 4FODA 4XBRA 4DEGA 3V5LA 5A46A 3KC3A 5E91A 5HORA 4CFNA 2C47A 3E8CA 1CKPA 3GC0A 3QGWA 4C58A 3TM0A 4KIPA 3TT0A 5CU3A 5AP2A 3WYYA 4MF1A 4S2ZA 4FVPA 2XCHA 2WMWA 1GZKA 5AV0A 3UO6A 2YCFA 3ZZEA 2WTWA 3JUHA 1ZMWA 1F0QA 3NUUA 4MD7E 3FMDA 4M0YA 4M66A 1R3CA 5DWRA 3DBQA 2UW7A 2JEDA 4U7ZA 5D9HA 3AT2A 3FZOA 4L7FA 5KMLA 5EQPA 2O8YA 3IDCA 4ITIA 3H9RA 4U40A 3A61A 1BYGA 5CQUA 4PMSA 3ENMA 2H96A 4XUFA 4F9YA 5IQHA 2O5KA 4JRVA 5HD4A 3UZTA 1R1WA 3I7CA 3QCSA 1WBTA 2HK5A 4FV2A 4PMMA 3CGFA 4CZYB 3ERKA 3OT8A 5FM3A 1OKVA 4TYGA 4X2JA 4ORKA 4RPVA 4O0TA 4UYNA 3PJ1A 1QL6A 2JAVA 4QPAA 3F2AA 5IMEA 5LARA 5HI2A 3QUDA 1PYXA 3AOXA 1Q8WA 4FIEA 2ZB1A 1DAYA 1E1VA 2PVHA 2Q0BA 3R02A 4WIHA 3CXWA 5ANKA 3G9LX 4OTFA 1MUOA 3OCGA 4CV9A 5HGIA 4O7LA 4LOQA 3Q9WA 4QMTA 3PA5A 2X9FA 5J79A 4E5BA 4WG5A 5L2TA 3DTCA 4FTJA 4WNOA 3VBQA 3QD4A 3OY1A 4IAFA 4F0IA 2BUJA 2RG5A 5L8LA 2XNEA 3NSZA 3ZDIA 4A07A 4IZAA 2IZUA 1P5EA 5ANGA 1QPCA 2BRGA 2PVRA 5DFPA 4BZOA 3POZA 5M44A 4C59A 4RJ4A 3K5UA 5M53A 2BDJA 2PHKA 2R7IA 5LWMA 4KSQA 5FM2A 3ZLXA 3GEQA 2OZOA 4AUAA 4I92A 4F1MA 1KOAA 2FSMX 2J0IA 4MWHA 3DDQA 2Y4IB 4QP4A 4ANMA 4D2WA 3FBVA 4QP8A 3UQFA 3P7BA 3QYZA 5EFQA 2CPKE 2P55A 4B99A 4EK8A 3BYUA 5JGAA 4AT4A 4XHKB 3V5TA 3LOKA 5EW9A 4FIJA 2HENA 3EN4A 4C4JA 4YUQA 2PVLA 5CF4A 4QOXA 1LUFA 4F7SA 3U54A 3LQ5A 3OG7A 2E9UA 3VQHA 4FL2A 4JDJA 4S34A 4QMXA 3FMHA 2W17A 4BFMA 3KMWA 2WTJA 5ETCA 2PK9A 2JKQA 2XIKA 4O0VA 1VR2A 3EMGA 2QHMA 1WVXA 4U3ZA 4IM2A 4XG9A 4B0GA 4D1XA 1G8AA 1XH8A 4RVLA 2JFLA 3Q96A 3QCQA 5E4HA 1WZYA 2EB3A 3F5UA 5TE0A 1YI4A 4IX5A 5TOZA 2B7AA 3Q32A 4AS0A 4CEGA 4CV8A 5I9WA 2UVYA 4WKQA 3FAAA 4ANQA 5FG8A 3WE4A 1H26A 5C8KA 1SZMA 3MVJA 1FBNA 4UXLA 3M42A 3IDBA 3PYYA 3R9DA 2P33A 4O7ZA 3FMNA 3ZU7A 4IIRA 3S3IA 2VO7A 4HYSA 3KN6A 3VS7A 3WF6A 4C61A 4Q5HA 4CSVA 5AUUA 3HYHA 3VUDA 5DG5A 2WMXA 3EFKA 3HAMA 2OXDA 4RWLA 2PMOX 3OWLA 4TN6A 2I40A 3QGYA 4DG0E 4J53A 3VBYA 4G3GA 4BWXA 5KNJA 4AGCA 3DS6A 5IQFA 3SVVA 3QUEA 2VTIA 3QF9A 3K54A 2QG7A 2JAMA 3HGKA 3UNZA 4XBUA 1MRVA 4YNEA 3EOCA 2GTMA 1FMOE 2UV2A 3VN9A 3CTJA 2QU6A 3U4UA 1NW1A 2YM7A 3I5ZA 2YERA 3GCSA 3NW5A 4AF3A 4ZTSA 3UZRA 3F3VA 5EM8A 4AFJA 3DV3A 2CNVA 2UW3A 3DKOA 1A48A 2BKZA 4G9RA 4TY1A 2QNJA 4FGRA 4XG7A 2ITQA 3NYNA 4IMYA 2R3PA 2PZRA 3NYOA 4IB1A 3V04A 3C4WA 2PVNA 2YITA 5ANDA 4AACA 1RW8A 1XH5A 4Z16A 3F3TA 4O7VA 3PXQA 2NO3A 3UODA 3BWFA 3N9XA 4Y95A 4MQ1A 4IX4A 3E5AA 4QTDA 3FMJA 3V5PA 4FSRA 1H08A 2PE2A 1H07A 3MJ2A 4QMYA 2XH5A 4JAJA 4C33A 3MW1A 4NH1A 4MF0A 1T46A 4XOYA 2UZVA
chains in the Genus database with same CATH superfamily
3EHAA 5C26A 4GU6A 4W9WA 5C1QB 4WUAA 4E20A 3GVUA 2IG7A 4F7NA 2ETRA 4BCJA 2H34A 5DT4A 5GHVA 5BUJA 3KRWA 4F99A 4NUSA 2UZEA 5AUWA 4EK5A 4FV5A 4HNIA 3TZ9A 2PVJA 3A8WA 3PUFC 3P5KA 4KBCA 3BV2A 4FL1A 2QKWB 1IAHA 3R04A 4EH6A 3RMFA 4G3DA 1SVGA 3OBGA 1OPKA 1LP4A 3UG2A 4TPTA 1VLRA 3ZYAA 3H0YA 3DKCA 1OIQA 1G8JA 2YDIA 5HE3A 1ZRZA 4HVSA 2OJFE 4Z55A 1O6LA 4QQJA 2JC6A 1U4DA 5I5ZA 4G2FA 4C4IA 2CDZA 3NR9A 4TNDA 4IACA 3QTRA 3BLQA 4FSTA 1XH7A 4BDJA 3N4TA 3GENA 3RWPA 3V51A 5LJJA 3ZFYA 4YZBA 1SNUA 3LMHA 4AGWA 1PMVA 4ANOA 3BLRA 4YJTA 2J0MB 2B55A 2C1AA 4EI4A 4WNPA 3MFUA 5IG1A 3U55A 1SNXA 4RG0A 3LIJA 3MPAA 5K9IA 3MGYA 3TG1A 3VO3A 3NIEA 4HW7A 2HY0A 4RX9A 3ZLYA 1OKZA 3CPBA 3LW0A 4X3FC 3ACJA 5GIOE 4BKZA 3EN7A 3Q5ZA 3DPKA 3PZHA 4PF4A 5IQIA 3ETAA 1PF8A 2BRNA 4HVDA 3HV7A 4CFMA 2OLCA 4OBQA 4PNKA 4H3BA 4O4FA 5M51A 2QHNA 5E8XA 4CXAA 1ZYCA 4X7QA 5DRDA 2F9GA 2VWBA 4TYJA 4FKTA 2WTKB 1KE7A 4XS2A 3Q04A 3HMIA 4OTDA 5KO1A 3BEAA 4LRMA 5EKOA 4BL1A 3I6UA 4JAIA 4DFNA 1YWNA 2W4JA 1PRYA 3UNJA 2F4JA 2JDVA 2UZTA 4D1ZA 4EZ5A 2YACA 4JQ7A 3HRFA 3ZFMA 2OWBA 3DJ5A 4BJJB 2JIUA 4JBOA 4M7IA 2QOIA 4AT3A 3VAPA 4I5HA 3IW7A 4MNEB 3C4XA 1MRUA 1REJA 2VNWA 4ACMA 2WTVA 3NYXA 4UMTA 4EHEA 2J90A 4OGRA 4IWPA 4RQVA 5IA0A 4YNOA 5DPVA 3G33A 3HUCA 5K0XA 5CEMA 3ACKA 4ZP5A 5ACBC 4PMPA 4DH3A 5KMMA 5H2UA 3HZTA 5DR9A 2UZWE 4U44A 4RIWB 3LHJA 5F94A 4P4CA 5BNJA 2OW3A 4RA5A 4I20A 2BIKB 4I1ZA 2XNGA 4BCGA 3TV6A 5FTOA 2QOKA 2XIRA 1KE9A 2J5EA 4E4LA 1L3RE 1STCE 4WBOA 3O17A 4N4SA 4EL9A 3F2NA 4RVKA 3G9NA 1K2PA 3TIZA 3SDJA 4KABA 4II5A 2B54A 1UU7A 2NRUA 5JT2A 4BF2A 2WAJA 3FYKX 4R7HA 4FNXA 4UMRA 3WF8A 3ULZA 5K3YA 1TQPA 4UXQA 4ID7A 3LE6A 4FK3A 4APPA 4HCVA 3FZPA 2VUWA 2UZNA 3PY3A 2YAKA 1M14A 2ZJWA 1OUKA 4L44A 5FWKK 3KXZA 1IASA 1M2PA 1V0BA 3GUBA 3S0OA 3LVPA 4NW6A 4KUJA 2X2KA 4WOVA 2OG8A 3D5VA 3C4FA 5CAOA 3EKNA 5E9EA 2XP2A 4P7EA 4C3PA 2ITNA 2EVAA 1UV5A 4JG7A 4JIKA 4JNWA 4E6AA 4G1WA 5CAPA 5DEWA 2YM3A 1T45A 4LUDA 1XO2B 3QHWA 4AN2A 2UZLA 3AT3A 3TTIA 4G9CA 5CU6A 5CSXA 3W55A 5HLNA 3HL7A 3BLAA 1YOJA 3G0EA 4TZRA 3AKLA 1WBWA 1PHKA 2YZAA 3CD8A 3CEKA 2VV9A 4V0GA 3D14A 2IPXA 2X8DA 3LXLA 2ITZA 4BWPA 4BTJA 4YJRA 3U51A 2YCQA 4CKIA 2X4FA 5AJQA 4J97A 4ZSAA 2FH9A 4O38A 4IJPA 4CCUA 1YWRA 2WEIA 3G51A 5HG9A 3AKJA 4DF3A 1OI9A 3OD6X 1Z57A 3ORXA 2XIXA 2GHLA 2J0KA 2DQ7X 5AR4A 2Y6MA 5AFVA 2UVXA 5KCVA 3JVRA 4F7LA 2X0PA 2H6DA 2JKMA 2PZYA 2QD9A 3DK3A 3F5PA 4V05A 4QDVA 3SA0A 4OBPA 3UOLA 4WT6A 5K0KA 3UJGA 4FSUA 3AD6A 2XBAA 5HIDA 1MQBA 3MPMA 4IAZA 1K9AA 3FHRA 3ALOA 5AEPA 1TFFA 4ASEA 4ZY4A 5J5TA 1JKSA 1ST0A 1E9HA 3PUPA 1VEBA 5CXHA 3VUGA 2C5OA 3NUPA 3VRYA 2J5FA 3TUBA 3CY2A 4RFYA 1J7LA 3C5IA 3FEGA 4DA5A 4FEXA 3MYGA 4IADA 4RLKA 3W2QA 4BYJA 2XK9A 3RNYA 4F63A 5A4EA 2JIIA 4DGGA 4Y5QA 4DTKA 3SOAA 2OGVA 4XG8A 4GK4A 2CN5A 1XH9A 1H24A 2XKEA 3COKA 5JFVA 4FV7A 4GVJA 3IONA 4O91A 3KVXA 3FPQA 3IPHA 4BTMA 1FGIA 3VUTA 4DFZE 2X2LA 2Z2WA 4XP2A 1O9UA 4EONA 5D7AA 1PMEA 4RIYB 2W1EA 5LOHA 1ZMUA 4BKYA 4KS8A 4FIFA 4USDA 4NSTA 4ZMEA 1H28A 2XKFA 3TKHA 5J9LA 3RK9A 3EQCA 2AYPA 4MQ2A 5M57A 2O3PA 4MXOA 4XLIA 4GEOA 4WBBB 3AC4A 3RAWA 4AXAA 4FEVA 3FYJX 2OZAA 2YAAA 3GQIA 3O7LD 5HE0A 4DINA 1LPUA 2OIQA 2C0OA 2QOFA 2YDJA 3LXPA 4I24A 5EYMA 4OBOA 4CYIA 5K4JA 2IW6A 1QMZA 3QLFA 3SG9A 1WAKA 1SYKA 2BAQA 4LL0A 2J2IB 4EZ7A 4UBAA 5CU0A 2A27A 3FPMA 4KAOA 3KF4A 1U5RA 2V0DA 2W0JA 5IUIA 5J8IA 3KVWA 4FTNA 1PXPA 1J7UA 3DJ6A 4H3QA 1BMKA 5L4QA 1ZOEA 3H9OA 3ID6C 2ZVAA 3PA3A 2XJ1A 2OXYA 2OF4A 5AUZA 3WZKA 5DT3A 4DLJA 1M52A 2J9MA 1AD5A 2V62A 3DKFA 1YXXA 2E9OA 4JQEA 3TUCA 3KRJA 1V0OA 3DBFA 3TACA 3MFSA 5CWZA 5C8MA 3R7OA 5ETIA 4F7JA 2ZDTA 4O27B 5D12A 4E6CA 4O84A 3MA6A 3RPSA 2CGVA 5DLSA 3W2RA 3W2CA 4U42A 3GC9A 3ODZX 2UW9A 1EH4A 4IAKA 2PSQA 3FI2A 4H05A 3K5VA 4O2PA 4XJ0A 4A7CA 4ZLOA 3WF9A 5EI6A 3VWAA 3FZSA 4ZSLA 1NVRA 2PUUA 3PJ8A 4E93A 3ML1A 1GIHA 3GP0A 2BZIB 3Q60A 2CSNA 3MB7A 4PL4A 4YZMA 4K0YA 4C4HA 1I44A 2YEXA 4O0WA 4TNBA 2DUVA 3H3CA 4EC8A 1PKDA 2FYSA 4AXFA 3ZS5A 5CSVA 2WNTA 4FT9A 3I1AA 4ALVA 2CN8A 3DAKA 3GC7A 2GQSA 2BZHB 3OWPA 3PFQA 3EYHA 2SRCA 2BTSA 4FTUA 4B4LA 2HWOA 2OBJA 4PDYA 3QWKA 2OSCA 4WD5A 4XG4A 1Q62A 3LJ1A 4BCMA 4GV1A 4DH7A 2GS6A 3TMOA 1XHAA 3MDYA 3KK8A 4X2GA 2BFXA 4AGDA 1LEZA 4RZVA 5L6PA 3MBLA 2YZLA 3CPCA 3DBEA 3QD0A 1IA8A 1APME 2HIWA 1FVVA 2HWPA 1VJYA 3R7VA 2HW7A 4FKSA 1FVTA 4U79A 4IXPA 5AMNA 4CT2A 1Y8GA 3D7TA 2A98A 1YOMA 2CHLA 4BDBA 2QKRA 4EK4A 4X2KA 4BGQA 2YA9A 4U45A 4NIFA 3R0TA 4GUEA 3UIMA 4Q5EA 3MIAA 4BGGA 5LCJA 2F2UA 2I1MA 3OXTA 5M4CA 3TKUA 2OH4A 3UQCA 4ZMFA 4J95A 3QKMA 3FV8A 2W5BA 4E5AX 3D5WA 4AA0A 4LDTA 2KULA 2Q0NA 2PL0A 3AD5A 4O0UA 1P4FA 3UIUA 3V5QA 5DGZA 2YHVA 4EOSA 4RX8A 2C6KA 4MCVA 4XEYA 2ZMCA 4GYIA 4FE2A 3RGFA 1Y91A 3PZEA 1WBSA 3WF5A 4DT9A 4Z3VA 3PRIA 3ZZWA 3ZCLA 4WUNA 1XMLA 3QTQA 3U6JA 5HHWA 3JR1A 5F9EA 4JG6A 2YIXA 3HDMA 3BBWA 3RZBA 2PMLX 3M1SA 4J8NA 2P2IA 4KKEA 3HRBA 2VX3A 4NZWB 4DGMA 2PVMA 4EHGA 4PPAA 3MH0A 4O0RA 3OFMA 3L9NA 4R3PA 3FMMA 5CNNA 3PG3A 2VTLA 4LM5A 1CM8A 3ZTXA 4HZSA 3LPBA 4FVRA 4D9TA 2PTKA 3PSCA 3FWQA 4QMQA 5L2WA 4BCHA 2OFUA 3PP0A 4YTCA 4UX9A 1H25A 2V7OA 3PY1A 4GH2A 4TWNA 5IQAA 4ZSEA 1JOWB 2NYAA 2OI4X 3COHA 4V04A 1FPUA 5M08A 1GAGA 5J1WA 2Y4PA 2XIZA 4RQKA 3LFDA 2X7FA 2OICA 3H10A 2O65A 3MVLA 4IAYA 2WQMA 2J0JA 4YZ9A 2YWVA 5AP7A 4FR4A 3HMOA 2IN6A 3O2MA 3Q9YA 2R64A 4NKSA 3ZSGA 4BDHA 1TZDA 1WMKA 4TKSA 2R7BA 1XKKA 5J7BA 4X6RA 3PVGA 1M2QA 2W9ZB 3R1SA 3RHKA 4R8QA 4ANSA 5EQYA 2FSOX 3EQFA 4TYHB 4W8DA 4WRSA 4RVTA 4QMSA 4ZTQA 2X1NA 2VZ6A 4MXYA 2BRMA 1PXJA 1PXKA 3SOCA 3VW6A 4F1OA 3UDSA 2GQGA 4YMJA 3A4OX 3GU4A 3KU2A 3QRIA 4TWOA 2EU9A 4OUCA 1SMHA 3DOGA 3MJ1A 1H00A 2QO9A 1Q8YA 3I5NA 3QAME 4KINA 4BJJA 2G2IA 2UZBA 4I6QA 4FG7A 2ZB0A 1J1BA 2PE1A 2IO6A 3QQKA 4FUXA 1URWA 2YM4A 3OWKA 4GJ2A 4QYYA 4QPMA 4U9AA 2YFXA 2H8HA 3O23A 3VHKA 4O1PA 5AAFA 4AZFA 3PIXA 3MY0A 4EBWA 4QMUA 3NW7A 3PPJA 4B8MA 1H1PA 2IVTA 3NCZA 4G6NA 3ZXZA 3OOGA 3AC2A 2VTOA 2CNUA 2UW6A 2WKMA 2A4LA 2BZJA 4D55A 2GNJA 3ET7A 2VX1A 4U97A 5BUIA 1W0XC 2BHHA 5FTGA 1JKTA 3NGAA 4PY1A 5B7VA 3ZRKA 4USFA 4FTIA 4CKRA 3F3ZA 1ST4A 3ZOSA 2W05A 3UO5A 4MH7A 3M2WA 3QRUA 4MBJA 5BVOA 3PXYA 4DBXA 2REIA 5D1JA 2P4IA 5DE2A 1JSVA 4K6ZA 3TZ8A 1ZYJA 3BWJA 5FP5A 4C37A 3TNIA 2HZNA 3UNKA 1KE5A 3GCUA 5IA2A 2QONA 4EWHA 5CF5A 4L45A 5H8BA 5FEDA 2GSFA 4YBJA 5F95A 3VVHA 2W1CA 3CLYA 4CQEA 1W2DA 2YN8A 3QWJA 5J7HA 4FZ6A 5E1EA 5CANA 2JLDA 2WIPA 4W4XA 3PLAE 2WO6A 3ZFXA 2WD1A 4HYHA 3Q52A 1Q61A 3O8UA 3OS3A 5DNRA 5AX9A 2XNOA 3TV7A 3W2OA 4U0IA 5BPYA 5CF8A 5M09A 4BICA 4QQCA 3QX2A 4JT3A 3ANQA 4S30A 2WTKC 5BQ0A 4RWIA 4YC3A 3VONA 3U9NA 1H8FA 3HV6A 5HVJA 4M69A 5IMXA 5IUGA 4BGHA 5CT7A 4I41A 3ZRMA 5AA8A 3QA0A 4DN5A 3CD3A 4I94A 5HU3A 1P4OA 2R3JA 3BV3A 1PYEA 3EQHA 3FLSA 3NUXA 2W1IA 4E6DA 1Y6AA 4RIOA 4EK3A 2AEGA 4PTGA 5CZHA 2QOLA 2CCHA 5J9YA 2EXEA 2HELA 3Q6UA 4TT7A 1UNHA 3QZFA 5GZ9A 5JRSA 3RHXA 4BDGA 4EHVA 5DMZA 5CYIA 5K5XA 4MXAA 4NWMA 5AR2A 1XH6A 4C02A 3FI8A 1KV1A 4AXCA 5ACKA 3UP7A 5BVKA 3NX8A 4I0TA 2JITA 3FI3A 4IWDA 4DHJA 1ZAOA 2XK6A 5CI7A 5AR5A 1BI7A 3BE9A 4DE4A 3DK6A 5AP5A 3QQUA 4KIQA 5JFXA 4FT7A 4KRDA 5EDRA 3UTOA 2HXLA 2IVVA 3ZONA 2Z7QA 4FJVA 5HE1A 3W0OA 3DLZA 1H1SA 1Q8UA 3OP5A 4YLKA 3QXOA 3THBA 4GUBA 5J1VA 2W1ZA 4C3RA 5I3RA 1IEPA 2CKQA 4CFVA 4FNYA 2C6LA 3TJCA 3CBLA 1YDSE 5JFWA 2VWUA 3EIDA 2XRWA 3IKAA 3KEXA 4Y46A 3EJ1A 4GG7A 2OIBA 3P4KA 3QZIA 3QL8A 4KNBA 4L53A 4M69B 3D5UA 2R3RA 3GNIB 4NK9A 2XYNA 2YJSA 3RBWA 3WZEA 5BVDA 4ARKA 4D9UA 3LJ2A 4TW9A 3QTIA 1KSWA 2CGWA 5ANEA 5HD7A 1UU9A 1J1CA 3AC3A 3L8PA 3MH2A 4OR5A 5DEYA 3S4QA 4EWQA 5C4KA 2YM5A 4F0GA 5AAGA 3RPOA 2ITVA 3LMGA 3QD2B 5I9YA 2YABA 3O71A 3SHEA 4R7BA 4DH1A 2OJ9A 4BCPA 1DI9A 3ALNA 4QNYA 1U59A 5CENA 2X2MA 4FNWA 3V3VA 2VO3A 2GTNA 4GT5A 3G5DA 4C4EA 5F4NA 3VJNA 4C3FA 2A2AA 1Q4LA 3HP5A 4D4SA 2XJ2A 3W8LA 2PZIA 4ZIMA 4KD1A 3VBVA 2DS1A 3B2TA 1E1XA 4V01A 5A3XA 4B8LA 5DYJA 4TYIA 4AQKA 3Q4CA 2HYYA 4NM0A 3E63A 5E92A 5GNKA 2LAVA 3PVUA 2QLQA 2CGXA 5KBQA 4BI0A 5JQ8A 5FQDC 3GU7A 4FV8A 4JBQA 3KRLA 5AUYA 4EOQA 3VBXA 4YHTA 3QRKA 4GFMA 4F6UA 3WZJA 5LWNA 5H3QA 2WQBA 4MYGA 2OJIA 2VTNA 4RJ3A 4FGBA 2O0UA 4N70A 5CEOA 3OXIA 4C4GA 4F08A 3R1NA 1WFCA 3FLWA 2BROA 4BCIA 4MX9A 3PVBA 1MP8A 4C2VA 3P7CA 3UBDA 5E8ZA 4YSMA 5HZNA 4QMNA 3W0RA 4DGLC 1BUHA 1YWVA 4PPBA 5EYDA 1XWSA 2NP8A 4KB8A 3AD4A 5LXMA 3QA8A 2XZSA 4YZDA 2HZIA 1NVSA 3BI6A 4AXEA 2DWBA 3E8NA 1YXVA 5EOLA 2P2HA 3L9MA 4KKGA 3WZUA 3VUKA 3UYTA 5A4CA 3HECA 2CKEA 2VTPA 4O1OA 1VZOA 1ZMVA 3FHIA 4AFEA 2VTAA 2CGUA 4YTFA 1Y57A 4A9UA 3WARA 4I93A 1RQQA 4I5PA 1ZY5A 5FXRA 2QO7A 5E8WA 3HAVA 2C6IA 3O0GA 3TJDA 4CMOA 3AMYA 4LI5A 1JWHA 3R22A 4PPCA 2I0HA 3IGGA 5HICA 2QOOA 3QBNA 1XJDA 4H3PA 1PXMA 4GRBA 4IDTA 1UNGA 4RIXA 2VWYA 5A14A 2W4KA 3QX4A 4MNEA 4FSQA 3UVQA 4NCTC 2GFCA 3EFJA 5EW8A 2YM6A 2GHGA 4DGOA 4BCNA 3ULIA 4ZSJA 5HG8A 2ZV8A 3FC2A 4LV8A 2F7ZE 3ZM4A 2QR8A 3DTWA 5AM7A 3GQLA 5D11A 3BHTA 2OFVA 3M11A 4FF8A 4ZJIA 4E3CA 4RWJA 4FEWA 2AUHA 2ITUA 3C4EA 2FVDA 1HCKA 3HP2A 1P14A 1V1KA 2C3IB 2WGJA 4YHFA 4OTHA 4C57A 1W84A 3UPZA 2Y4IC 2PUPA 3TKIA 4D2SA 3IQ7A 2UW5A 4G5JA 5AUXA 4DFYA 3AG9A 5C03A 1UA2A 3NNXA 4GK2A 4WA9A 1PXNA 5F20A 1BLXA 4FA2A 1JKKA 3T9IA 4EQMA 1NXKA 3EN5A 4DCAA 2FSTX 4F1TA 5A4QA 1R0PA 4DLIA 5FBNC 1YHVA 2WFYA 2IJMA 2WU6A 4AG8A 1GZ8A 2UUEA 2UW0A 3QQLA 4FV4A 3VHEA 4DDGA 2W06A 5CEIA 4FKIA 4BDCA 4F4PA 4LQMA 2XEYA 3E8DA 3P0MA 2C1BA 4LOOA 3DXQA 1L8TA 3LCSA 3ZRLA 3MH1A 3ZSIA 3LLAA 4FZ7A 5HCZA 5ICPA 4OLIA 4GKIA 2XNMA 3VNTA 1XBBA 3GFWA 3JYAA 3Q2MA 5IH5A 3P1AA 3Q53A 4C7TA 3A8XA 3GU5A 2PVYA 5FP6A 4EH2A 5HIEA 3PY0A 3GC8A 2R3FA 4K2RA 3KA0A 4I6BA 1FMKA 4UV0A 1JSUA 5ANIA 4A9YA 1CKJA 2V55A 4XG3A 3L9LA 5BMMA 1PXLA 4L52A 3SKCA 4YLJA 3ZEPA 2OJGA 4C62A 2A0CX 5IF1A 1GIIA 2RIOA 4XOZA 4O4EA 3FLQA 5IQDA 2RFEA 4AWIA 3AXWA 5DIAA 4EORA 4EUUA 4DC2A 3E62A 1VYWA 3QZGA 2R9SA 4ONAA 4YJUA 2VWVA 1JKLA 4UN0C 2VGOA 4RGJA 3R28A 5JEBA 5E8VA 3PIYA 1Q99A 5I9XA 2QLUA 3WF7A 1UU3A 4FTLA 3ELJA 2OK1A 3D94A 4O0YA 3UYSA 4AU8A 5BUEA 4DTAA 2XIYA 4LRJA 1OECA 3EH9A 3KCKA 5AUVA 4HVGA 2R5TA 4RT7A 4ZZMA 3A2CA 5TT7A 2W1HA 3O7LB 5LVPA 4FKPA 4BCKA 4YTIA 4NL0A 3W32A 4IVCA 4U6RA 4LGGA 3OCSA 1WBPA 2QOHA 5JSMA 2WQOA 5KZ0A 5GJFA 3V8TA 1G5SA 5KX8A 4YJQA 5LMBA 5KUPA 2BALA 3PTGA 3OC1A 3OXZA 3FXWA 4C4FA 2GNHA 4BCQA 2J0LA 4FSZA 3II5A 4H39A 4OTRA 4EZ3A 4FYOA 2GNGA 3N51A 1UWJA 4S32A 3ZHPC 3DNEA 4JX3A 2BDFA 5KMKA 4NYEA 3EL7A 1H1RA 2R2PA 3FL5A 3LFQA 4ZEGA 4D2RA 2ONLA 2WELA 2PPQA 3GGFA 4F0FA 5DOSA 2RFDA 4WHZA 4I4EA 1H1QA 1OGYA 2X6EA 2C30A 4BVUA 3E7OA 1DS5A 3QLGA 3BQRA 4X3JA 5AV1A 3BGZA 5IUHA 3MVMA 4IVBA 5EI8A 5CLPA 1XBAA 3VBTA 3LXKA 4E6QA 1XH4A 4IM0A 3DLSA 2CMWA 3TEIA 3S00A 4AA4A 3R63A 2F7EE 2ERZE 3QKKA 5GJGA 5E7RA 2GCDA 3EQDA 3TL8A 3UG1A 2I0EA 2YIWA 5IA4A 3AKKA 1IR3A 3DA6A 3MTFA 3TXOA 3O96A 4Y72A 5HBEA 3QU0A 2VTSA 5DRBA 3MTLA 4IZ7A 4RIWA 5AAEA 4W8EA 1B38A 4UY9A 4Y73A 1KUTA 4GMYA 3HMMA 1ND4A 4OAVB 5FBOA 4ZJVA 4E8AA 4J1RA 3KCFA 4XMOA 1YKRA 3KMMA 3NPCA 2HW6A 4QYHA 4JVGA 4AGUA 2E9VA 3VULA 3LCTA 4AP7A 5HX6A 3AC5A 3R9NA 1UWHA 3ORIA 3DNDA 3OVVA 4DEHA 3KULB 2WHBA 1UKHA 3FXZA 2ZM4A 5JK3A 5M06A 4G6LA 3Q4ZA 4MXXA 4CG9A 3CP9A 5DH3A 5ANOA 1JNKA 2I7QA 5M4IA 2BHEA 2X6DA 5AP4A 3JPVA 4JRNA 4NM5A 4YR8A 4FZDB 4O0XA 2R3IA 3BHYA 3FKOA 5IEYA 5IH6A 3TN8A 2LGCA 1XBCA 4QQTA 1UU8A 2YIYA 3E64A 4LOPA 3P79A 3GCPA 4HOKA 2IZSA 4RMZA 5CF6A 3IOPA 3LJ0A 4QTCA 4B7TA 4KSPA 2B9HA 3FZ1A 3R8PA 2JBOA 3E87A 3OEFX 4S33A 5FDPA 5EQEA 4DH8A 3L8VA 1NVQA 4QMPA 2R3OA 5M56A 4ZTMA 4DBNA 4NJDA 2OU7A 3TWJA 2W9FB 2KTYA 3F88A 3RP9A 3LQ8A 1ZOHA 4IQ6A 5IEVA 1ZOGA 3R73A 2PMIA 3OW3A 5CEKA 5B0XA 4A9TA 3VQUA 2GNLA 3SV0A 5HBJA 4FK6A 2WIHA 3B8QA 4IAAA 1Q3WA 5CSPA 5GIPE 1XMMA 3RK7A 4O7WA 5A4LA 2XKCA 4V0GB 2HXQA 5CS6A 1KWPA 3DZOA 3LZBA 5CNOA 3TV4A 2EWAA 4IB5A 3BYMA 1V0PA 5IA5A 2ITOA 4M15A 4EUTA 3MA3A 4BDEA 5F1ZA 4OAUC 4WRGA 4KWPA 5M4UA 5IQCA 2J6MA 3BELA 4QP2A 3AGLA 3KRXA 4MBIA 5JMSA 4ACGA 2WB8A 5KE0A 5E1SA 1ATPE 2Z7RA 3P08A 2IW8A 4BHZA 5K4IA 4HGTA 2JGZA 2FB8A 4EYJA 4LG4A 4YU2A 2GHMA 4O83A 4FKJA 1O6YA 4RIYA 4I6HA 2CJMA 3WIGA 3V5WA 4MXZA 5FUTA 1GJOA 4YTHA 4FOBA 2QCSA 3ZC6A 1O6KA 5JN2A 4M97A 4ANNA 4HGEA 5HG5A 4KKHA 1B6CB 3OEZA 4G3FA 4OT5A 5HTCA 3NLBA 4BHNA 5HOAA 3BBTB 3F69A 3D2KA 2WXVA 3LFNA 4WG3A 4CCBA 5IQGA 3W18A 2ZV2A 4NKAA 3NEWA 3OW4A 2WQEA 4TXCA 2WTDA 4RSSA 2IVSA 2Y0AA 4LUEA 5CALA 4KRCA 4DT8A 3L8SA 4BDKA 3RKBA 3W8QA 4I0SA 4AW2A 3R21A 4QD6A 5E8TA 4IWQA 3HX4A 3QUPA 4JLCA 3EQRA 2A19B 3V01A 2C6EA 2R3HA 2WMAA 4QYGA 2B9IA 4G3CA 5GZAA 1TQMA 3MB6A 3CCNA 3COIA 4HVHA 4WNMA 4A9RA 1OBGA 4FT0A 1Y8YA 2OJJA 3LM5A 4ACCA 2W96B 3JVSA 1DM2A 1ZXEA 4HCUA 3R9OA 3W2SA 3IOKA 4WSQA 5CXZA 5H9BA 4AZSA 5IA1A 3QD3A 2ITPA 4BZDA 2XK3A 4XV2A 4RC4A 3IW6A 4UYAA 1FOTA 2V5QA 2JDOA 2BFYA 4QP3A 4Y83A 5CQWA 5CAUA 2I0YA 2XEZA 4BRXA 5A6NA 3CR0A 3NUYA 5JGDA 3OZ6A 3P23A 3TNQB 4NU1A 3ROYA 4DG3E 5L6WL 5JFSA 3LQ3A 5HESA 2C0IA 2XYUA 4DCEA 5A54A 3NUAA 3FE3A 1W83A 2WMBA 1M7NA 3ODYX 4YJNA 5D41A 2YDKA 2XUUA 1G8SA 4AW1A 5AR7A 3G2FA 1JSTA 3QYWA 3NAYA 4GFOA 4PDPA 4PP9A 4E7WA 3UOHA 3F3UA 1PXOA 5AV4A 1OL7A 1R0EA 3LFBA 4MBLA 3COMA 4TTHB 5G1XA 3PJ3A 3SW7A 3CQUA 2J7TA 4F6WA 3DBDA 1ZZ2A 3CE3A 3PJCA 4FSMA 3FLNC 4O4CA 4Y5HA 5BYLA 3KGAA 4MVFA 4YSJA 3C51A 4XRJA 2VWWA 4RZWA 3DT1A 3WI6A 4DH5A 3U6HA 2XK4A 1SVHA 4FMQA 3CIKA 4J98A 2G2FA 1BX6A 3OWJA 3D2IA 3VF9A 4J52A 4EOIA 4GW8A 2ZOQA 2HCKA 2R0UA 3F9NA 1J7IA 4FKRA 4AOTA 1U5QA 3GB2A 4QTEA 5AADA 4JR3A 4ZTNA 3BQCA 4KA3A 4BYIA 1REKA 2X7GA 4EHZA 3ZLSA 4UB7A 3OCBA 1OM1A 2FSLX 5CEQA 4DEDA 3ORLA 4DEEA 3TZMA 3ATSA 3C7QA 2QG5A 4IVAA 1GIJA 3K3IA 5EM5A 2ZFYA 4YZNA 5DN3A 4Q9ZA 4O7SA 1Z9XA 2PWLA 3DK7A 4FZFB 5BYZA 2XARA 3NAXA 4E4NA 3F6XA 3QCXA 3A7GA 3FC1X 4H1MA 3FLZA 3WILA 4M68A 3FSKA 3VUHA 4XG6A 2I0VA 3MN3A 4EBVA 3SRVA 2W99B 2YWPA 5T3QA 1IRKA 4AN9A 4C36A 5LVOA