2A19B

Pkr kinase domain- eif2alpha- amp-pnp complex.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
273
structure length
263
Chain Sequence
AHTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLINRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
total genus 82
structure length 263
sequence length 273
chains with identical sequence C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2a19B02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2a19B01
3DKOA 3VRYA 1V0PA 3CIKA 3PZEA 1XHAA 2UZBA 4BZDA 4OTIA 5DVRA 3ZTXA 3PDTA 4DAWA 2JKOA 3HMPA 4NKAA 4YC6A 4KKGA 4KUJA 3BV2A 3QZGA 2XP2A 4ASZA 4FIJA 4QP7A 3PLSA 1PMUA 3GU7A 4OTDA 4PNIA 4BF2A 4F63A 3C0HA 3G90X 4MQ1A 4ZTHA 4XV2A 5M09A 2VAGA 1Y6AA 3CE3A 3SXSA 1IASA 2O2UA 5AUTA 5CAQA 4EC8A 4AN2A 5HIEA 5FDPA 2B0QA 2GU8A 4HYSA 3QC9A 3MJ2A 4XCUA 5JQ8A 1W98A 2B9FA 3Q6UA 2PMNX 5E9EA 1B6CB 1JVPP 3SHEA 3PSDA 5A4LA 4B6LA 4UMUA 5J7HA 1I09A 1KOBA 2WTIA 5CVFA 2HXLA 4AA5A 3E7OA 2AC3A 2E9OA 3NGAA 3D7TB 4FKGA 4AOJA 4C02A 4BCOA 3LFEA 3LZBA 4W4YA 5IDPA 4XLIA 3OUNB 2R5TA 4XBUA 4HYUA 1M17A 2BZHB 4J99A 4BDIA 3VW6A 3QQGA 4FZDB 4BCMA 3HA8A 4AE6A 3FMHA 3BEAA 3ORTA 4FV3A 5FP6A 3S3IA 3W16A 5DN3A 3QHWA 4QMSA 4TN6A 4U6RA 3CPBA 4P2KA 5AV2A 4BKYA 3QQHA 1YWNA 5IA5A 4C58A 5GZ9A 4QMTA 5J7BA 4TWOA 4RVLA 4XG8A 2HXQA 3QGYA 2FA2A 5EM7A 4UMPA 2BKKA 3PA4A 4JG7A 3V5TA 4QP2A 1XR1A 3W8QA 3VBWA 3FKOA 5D41A 4IVCA 3SRVB 4BYIA 2JIVA 4JAJA 5KMJA 5FDXA 3BU6A 2C6KA 5L2QA 3QXOA 1XQZA 3ROYA 3FMMA 3QRJA 2IN6A 2X4ZA 1OKVA 2C3IB 3FUPA 4K2RA 4WHZA 3L9PA 5AMNA 3R9OA 4AE9A 4AWIA 4IZAA 3UOKA 3COIA 4HGEA 5BVNA 5I5ZA 2XYNA 4Y83A 5KNJA 3LQ8A 2WTKC 4CCUA 4KAOA 4U79A 1P5EA 4JAIA 3IDCA 4NTSA 5HTBA 2UW6A 2VTIA 4WT6A 3OCTA 4X21A 1UKIA 1CKJA 4YJUA 3VUIA 4BCIA 5GJDA 4WRSA 5LVNA 4ITIA 1J3HA 3PY3A 4OTPA 3ZBFA 3VRZA 1Y8YA 2I1MA 3GCSA 4AA0A 5CSPA 2WO6A 5H9BA 4APPA 5HLNA 4FIGA 5LMKA 4AX8A 3EQIA 2WTKB 2Y9QA 3MY1A 3RK7A 4XV9A 4QD6A 4NFMA 3G9NA 2CCIA 4GCJA 5D7AA 5C03A 3EYGA 4GRBA 5DRBA 5JRSA 3OUKA 1XH6A 4K1BA 5CNOA 4A9RA 3HDMA 4JDJA 4P90A 4MBJA 2OF2A 5H8EA 3SXRA 3QLFA 1H1QA 4XG4A 3I6WA 4U81A 5A4EA 2R3JA 4WOVA 4X6RA 5KBRA 3QF9A 2QR7A 3MFSA 4Q5EA 2C6EA 5AIRA 3PJ3A 5AUZA 4KNBA 4RIOA 5M06A 4FEVA 3OOMA 1JAMA 2WD1A 3Q2MA 4RVKA 1PW2A 1LP4A 3CR0A 5AAGA 4FTJA 3LCKA 5CSVA 3B8RA 5L6WL 2PE2A 3VUDA 3G15A 4R7BA 4U3YA 3P7BA 4C38A 4RWLA 2HW7A 4RQKA 4ID7A 4AOIA 4QP6A 5CF4A 3TDVA 2FGIA 1YQJA 2IO6A 2HK5A 3IQ7A 3O23A 4I22A 4D2VA 2PY3A 3KQ7A 3ZC5A 3LJ0A 2W1DA 3CGOA 3R28A 5DFPA 2XM8A 4FSWA 4MTAA 4DGOA 3C5IA 3ORLA 4O0UA 4LL5A 4DEGA 4MWHA 3I0QA 4USFA 4OTFA 4KIPA 5CT0A 4HCTA 4HNFA 4O7TA 1XH9A 3ENMA 3D5VA 4LUDA 3FLWA 2YZAA 3QUEA 4RIYA 4UZDA 2XRUA 3QQJA 4Y46A 4DTBA 2V22A 4CVAA 2B7AA 3TUCA 1M7NA 5EW8A 5HHWA 3GEQA 5DT0A 1R3CA 3KRRA 3PE1A 2JGZA 4X2JA 5K3YA 3PRIA 4WO5A 5FXSA 4F6UA 3O50A 3TEIA 4C33A 4C34A 3BU3A 3CBLA 4BDGA 4K11A 2B1PA 4XX9A 2VWBA 5LARA 2O64A 2XK3A 3L9NA 3BKBA 4M0ZA 5L2SA 5EHOA 5HD7A 3Q4TA 5IF1A 3R22A 3ZXZA 4DFYA 3ZRMA 4QMLA 4JBQA 4L3LA 4GMYA 2J6MA 5CU4A 5DPVA 3ZO4A 3ZSIA 3Q60A 1R39A 1UKHA 1QPDA 4FL2A 4GYGA 4RQVA 5BVFA 3C7QA 3G6GA 5M55A 3T3UA 4DFBA 3R1YA 4FKQA 4DT8A 3UODA 2G1TA 1WVYA 4AT3A 3DK7A 3G33A 5LCKA 4FTUA 3DV3A 3NIEA 3QZIA 4N57A 4O7YA 5HI2A 5HE1A 4H39A 4I1ZA 3OWLA 3O2MA 4FV9A 4XV1A 4UWCA 3DFCB 2BPMA 5IQHA 5FM2A 4FKUA 4F64A 2WTCA 5HESA 4LM5A 4FG8A 3ODZX 4XYFA 4W8DA 5FXQA 4I4EA 4BI1A 3QRUA 5HVYA 5H2UA 3A7JA 1O6LA 2C1BA 4LV5A 2HY81 2W4KA 5C8MA 3ZO3A 2ITWA 5DBXA 1EH4A 1U5QA 2FSMX 4KIQA 3Q9ZA 4OT5A 4EH5A 2R3KA 5L8LA 3VWAA 4C7TA 2H6DA 3PWDA 3VJNA 4CKRA 4RA4A 4U44A 2R3FA 4C8BA 2R7IA 3MV5A 5H8GA 1RE8A 4D2RA 4X3JA 4FVQA 4FT9A 3TIYA 3ACJA 4I23A 2X4FA 4IMYA 3DY7A 3VULA 2F2CB 3FZSA 2O0UA 4JX3A 3C51A 3C4WA 4RJ5A 4CT1A 1YOJA 5D1JA 4EK5A 1IA9A 5AUUA 4LFIA 2EB2A 2YIWA 3UVQA 5TF9A 3VAPA 4QTDA 4WNPA 5EHYA 2WEIA 4G5JA 4D2PA 5ETIA 5AAEA 3NNWA 3V5WA 3QCXA 4JBOA 4HCVA 4IWQA 3L9MA 2ZYBA 4O2ZA 3QWJA 2IW6A 4DFZE 5CEMA 3QBNA 3NCZA 4G6NA 4BRXA 3WYYA 5M57A 3HMMA 2W96B 2W5AA 2XS0A 3HP2A 3FEGA 3Q9WA 3LMIA 3R0TA 4GS6A 3F69A 3T8OA 4W4XA 3LHJA 3UE4A 2C5YA 2I0YA 2UW7A 5KMMA 5L6OA 4AGCA 1PMNA 1H0VA 3IGGA 2R0UA 3OEZA 3HRCA 5AR2A 1ZYSA 2R64A 3R9DA 2VGOA 2VTSA 3BYOA 3ATTA 2UZDA 3U4WA 2BFYA 3FYKX 1ZOGA 5F94A 3BX5A 3CKWA 4D4YA 1SVHA 4AW2A 2BZIB 3NW7A 4CV8A 4D28A 2B9HA 3IDBA 5GINE 4GVAA 2GHLA 3EQFA 4BTMA 3H9FA 3DQXA 3I0OA 3TNWA 4CNHA 3OXIA 4AW0A 4QP9A 3BGPA 2UZLA 3ITZA 4JJRA 4BTJA 3HL7A 3BWFA 4FT5A 4EOSA 4MEDA 3MA3A 4BCGA 1ZRZA 4UEUA 4EQUA 5CU0A 2YCSA 4U41A 1E1VA 4DLIA 1JBPE 5M53A 2B54A 3Q4CA 3R6XA 2XIXA 3IGOA 2NO3A 3KXXA 3NW6A 4BZOA 4J53A 3HAVA 5IQEA 5GZ8A 3IW6A 3CLYA 3ZEPA 3QTRA 1ZMUA 3LCSA 3DBEA 3KL8A 3EZRA 4IX6A 4UY9A 2DS1A 1CM8A 4C3PA 1S9IA 2OKRA 4J98A 2QOQA 4CMUA 4F6SA 2E9PA 2WAJA 2X6EA 3EIDA 2YJRA 1URWA 1L3RE 4RX5A 2Z8CA 1U54B 3DTWA 1J1BA 4ZY6A 5ICPA 5KX8A 1ZYJA 2UZOA 4I20A 4WSQA 3UIUA 4FICA 4GIIA 4RVTA 3M42A 3OCBA 4JX7A 3ZHPC 3RPRA 2VTOA 2RFSA 5ANOA 3E3PA 3A7HA 4TWNA 5E1EA 4PL3A 4X6QC 2ITPA 4BCFA 4D58A 4D1XA 4AF3A 3ENHA 5KCVA 2ERZE 3RNIA 4YTIA 4GFGA 3UO6A 2RSVA 3E5AA 3DXQA 1W84A 3H30A 3FL5A 1M14A 3DBCA 4RFMA 5HNBA 3TNPC 2J0JA 4FKIA 3QU0A 4JDHA 4FNZA 5AX9A 4BBFA 5C4LA 4R8QA 3KGAA 2BR1A 4X2GA 5CAVA 5C9CA 3WF9A 2IZSA 5EM8A 5HCZA 3UZTA 3ZLYA 3U6IA 4FKSA 4MF1A 1PXMA 2XEYA 3CEKA 3A4PA 4FV1A 3ULIA 3QTXA 2R7BA 4DA5A 2VX0A 4LV8A 3TKUA 3LPBA 1ZZLA 3PJCA 4WD5A 4XG2A 4WKQA 3E3BX 4FZFB 5E8XA 4IAYA 4NK9A 5AR7A 4FI1A 3OG7A 2FUMA 2QOFA 4QMWA 4M8TA 2B53A 3QKLA 2W1ZA 2OIQA 2YITA 4QOXA 4C4GA 1OIYA 4A9TA 5GNKA 5EKOA 4O1PA 5AP3A 4YZ9A 2YABA 4WRGA 3COMA 2C30A 2X6DA 3CP9A 1DM2A 1QCFA 1T46A 2HAKA 4K18A 3R7IA 2GTNA 4CT2A 3PFQA 2YAAA 4UXQA 4WNKA 4H1JA 3D5WA 4QQTA 3W1FA 1UU3A 2Y4IB 2GHGA 4L43A 1F5QA 4PP7A 3ZCLA 5IKWA 3COHA 4YC3A 1PXKA 3VJOA 5CSWA 4BDFA 2OJFE 3R2YA 5EYCA 3MW1A 1F0QA 4MVFA 1GZNA 4E6AA 3TUBA 1Q3DA 4BDJA 3MY5A 3FXXA 2VU3A 2X8EA 5L2TA 1P14A 3ALOA 5H8BA 5IH4A 2OJJA 5M44A 2XKCA 1PYEA 5E90A 4RWIA 3DDQA 5HGIA 4FNXA 4HJOA 4NM0A 2ONLA 4UYNA 4DGGA 1PJKA 4ONAA 3CGFA 3LCOA 4G9RA 2HY0A 2W1FA 2QKWB 3HRFA 3WE4A 1MRUA 3E8CA 3OCSA 4IAZA 4RJ7A 3FC1X 3NRMA 5DNRA 2CNVA 5AM7A 3KU2A 4FE2A 3PVBA 3ORKA 3PG1A 4L42A 4V04A 2AUHA 2DYLA 2WQMA 3JVRA 3R21A 2P2HA 2ZM1A 4G2FA 2WEVA 4GYIA 3HDNA 2OICA 3BGZA 1K2PA 1JKLA 4ZS0A 3DJ5A 3LW0A 3N9XA 4FIFA 1WBVA 4YBKA 5AUWA 3NNVA 4RJ6A 3TI1A 3R1QA 2BRMA 3AT4A 3R1NA 4P5ZA 4DCEA 4EH6A 1KV1A 5L8KA 2GSFA 3CQEA 4OW8A 2PK9A 5CI7A 4QP8A 4BWKA 3LFQA 1G3NA 4DLJA 3BHUA 5JGBA 5E1SA 4CFUA 1J7UA 3UG1A 3DFAA 3UYTA 4E5AX 5M56A 3F2RA 5KUPA 3PSCA 4DG3E 2HOGA 4BL1A 3FXZA 1U4DA 2UZVA 4J96A 4F70A 3EQPA 3VO3A 5LWNA 1J7LA 3QTSA 4E4MA 2PMOX 3N51A 3NYNA 5BVOA 2NNWB 2WB8A 3WZUA 2I7QA 3ZXTA 3TIZA 4E4XA 4EK8A 3HMNA 2ZV8A 5DA3A 2ONLC 4C37A 3Q3BA 3R73A 4FG7A 2YIQA 2OZOA 2XNPA 4YNOA 3BELA 4EKLA 5BVEA 2C0IA 4O0SA 4ZIMA 4B7TA 4CRSA 1JQHA 2OGVA 4UN0C 3DPKA 1OECA 2ZB1A 3W10A 3LXPA 4AGWA 4BCHA 2QCSA 4AZVA 4BGQA 5BMSA 1ND4A 3DOGA 1FVVA 2GS2A 3SAYA 3N4VA 3DDPA 2JLDA 1FVRA 4FTTA 5DHJA 4I93A 4ZY4A 3AMBA 3MS9A 3HV5A 4F4PA 5CTPA 1TVOA 4JS8A 1GAGA 2W4JA 4WNMA 2JKKA 4FT0A 4CQGA 1R0EA 3ZMMA 1OL1A 1VR2A 4QP4A 4S2ZA 5JKGA 3GQIA 3OHTA 1OIQA 2RL5A 4FX3A 4PRJA 3V6SA 4ASXA 1Q5KA 3UP2A 4NM5A 1V1KA 4TYIA 3QC4A 5F20A 3TKHA 2Z7LA 3OY3A 1URCA 2R3IA 4IB3A 1ZMWA 4M12A 4Y5QA 5LVOA 3ID6C 3D14A 4EWHA 3F5XA 3DU8A 2A19B 3DS6A 5CX9A 4FTLA 3IW5A 2YACA 5HVKA 4PQNA 4CCBA 1JLUE 2R3LA 4FC0A 5HX6A 1YW2A 3MPMA 3WYXA 3CQWA 3W2QA 4MCVA 5EQPA 3HMOA 3PWYA 4IM2A 3JR1A 2F7XE 5AUVA 3LFCA 4V05A 4I6FA 2VTMA 3BYVA 3P7CA 4EH4A 3PPJA 3EN7A 4ZTQA 4EK6A 4YU2A 2ZVAA 5BVDA 4D55A 2ZJWA 2ESMA 4EC9A 5CZIA 2IZRA 2WTDA 4I6HA 2CJMA 2ITZA 3LM5A 3KXNA 3DZQA 1Q4LA 5EHLA 4QMQA 3FQEA 4L68A 3UNZA 3TZ9A 3LXKA 2XKDA 2W1CA 3BBTB 3DK6A 4G3FA 5B2KA 5AR8A 2ZV7A 2IVUA 4XOZA 3I5ZA 4AN3A 2OLCA 1MRVA 3WARA 4O7ZA 4AFEA 2BRNA 5TOZA 2C68A 3QRIA 5LVLA 3IOPA 3O7LB 3OFMA 2H34A 2X7GA 2FSOX 2OH4A 2QG5A 4USDA 2CLXA 4KIKB 2DUVA 4M69B 2ITNA 4BVUA 3BLHA 2DQ7X 2UW0A 2XK6A 3LQ5A 3HX4A 4PDPA 3QUPA 4PTGA 4ANBA 4XNEA 4ZJJA 4QRCA 3ZRLA 5J95A 2ERKA 4O7RA 4FUXA 5F1ZA 4ITJA 3FY2A 4H58A 5AWMA 3PY1A 4B8LA 5EM5A 3VS3A 1KWPA 3C4CA 1CKIA 3Q9XA 2R3PA 3SW7A 3HNGA 3RAHA 1OITA 4GUBA 3WZDA 2CKQA 4FTKA 3TV7A 2PVYA 3EQGA 1R0PA 3OMVA 3I4BA 4NWMA 4ZOGA 2B52A 4IFCA 3OTUA 3DLSA 3KCFA 4NZWB 4ITHA 4B0GA 4E6CA 4EZ5A 4IZYA 3QUDA 2PVHA 4FK6A 3O51A 4S34A 5LWMA 1SMHA 2YWVA 2A0CX 4IWDA 3IK3A 4M15A 4PMSA 4RJ3A 1WCCA 3DAJA 1FINA 5FUTA 4X2FA 2W1GA 4DBXA 3W2RA 2PVRA 4BKZA 3FI4A 4TNDA 5DR9A 3WZEA 1B39A 3K54A 5AX3A 4CD0A 4FTCA 2HWOA 4CG9A 4IX3A 1AGWA 4FSZA 3VHKA 2BRHA 4AG8A 1OGUA 1ZXEA 3AT2A 1FGIA 3AC1A 3ZUVA 4CFMA 4YHTA 4CTCA 4BCQA 3JS2A 3OWKA 1AQ1A 4FG9A 4IDVA 3SXFA 3DA6A 3G0EA 3H10A 1YDSE 3WI6A 4NJDA 2BTRA 5I9YA 2WKMA 5F95A 4CLIA 1BL7A 2BCJA 2VTLA 3DNEA 3MH1A 5A14A 3TZ7A 2CGXA 3HECA 2PVJA 4EHZA 4O7WA 4CKIA 4Z7GA 2X2MA 4CLJA 4I6BA 1PXIA 3O96A 3PUPA 3PA3A 5CENA 5KE0A 3SKCA 1B38A 3TNIA 4BZNA 4ACGA 3HUBA 3NX8A 3RM6A 4DH3A 1G8SA 5I4NA 5HG7A 4D9TA 1OL5A 4GH2A 5FP5A 4C4IA 4IAFA 3UIXA 2GQSA 4PPAA 1PKDA 4ANQA 2HZ4A 3OOGA 1LUFA 3GT8A 5EOBA 4BTFA 4EH9A 2ITYA 5BUEA 5IDNA 2JKQA 5IQCA 2UZNA 5EOLA 1XBAA 3ALNA 3D2KA 4GFMA 4U8ZA 5AUYA 2RG5A 4GFOA 3NR9A 2FVDA 3HV3A 4F99A 4EWQA 5IA0A 4XG6A 1GOLA 5CAPA 4W4VA 2CMWA 3F88A 1IR3A 4BTKA 4YZBA 4BBMA 4L53A 5HO8A 2B9IA 4P4CA 2W7XA 1PRYA 4WG4A 5KMOA 2ZM3A 1DI9A 4GV1A 3DTCA 3QQUA 4RFZA 4O0XA 5K0KA 3V5PA 1NVRA 3PA5A 4ZLYA 5IU2A 2Q83A 4Y73A 4BIDA 4EKKA 3D0EA 1GIJA 2A4LA 4BDAA 2IW9A 5JGDA 3QA8A 4D0XA 1Q8UA 3SRVA 3TNHA 4RX8A 3ZH8A 3C4ZA 4IWPA 4IDTA 4EOLA 3ZSGA 4BCKA 1YDRE 3KVXA 1FMKA 3OW3A 5E91A 3EN6A 4EONA 1VYWA 4JRVA 3OXTA 2C6DA 4O96A 5I0BA 3JVSA 3QX4A 4YTCA 5IEXA 2EWAA 2YCFA 4TL0A 3TDWA 3F7ZA 4LOPA 2VWZA 3MVJA 1OBGA 1SM2A 4FGBA 3HA6A 4D2WA 3EB0A 4NCTC 1XBCA 2X39A 3DNDA 4GK4A 3QQKA 5IQGA 1PXJA 1ZYDA 4KD1A 2ZDUA 4TW9A 4MD9E 3ERKA 1SNUA 4F6WA 1OL2A 3E88A 2IG7A 5CAOA 2J4ZA 1W0XC 2VWYA 5IUIA 5BNJA 2ITVA 4D4RA 3MI9A 3PRFA 5CT7A 1Q3WA 5J5TA 4XUFA 1UU9A 2ZMDA 1VJYA 2OG8A 2XBJA 3FMLA 4RC4A 4ANLA 3M2WA 4BHNA 4O0VA 4XS2A 4J7BA 3BYUA 3F61A 4TPTA 4USEA 3ZEWA 3H9OA 3OCGA 3REPA 1YHSA 2WQOA 4KRDA 4O0RA 3SD0A 2ZDTA 3A60A 3KVWA 4FZ6A 4KBKA 3GBZA 3UDBA 2LGCA 3UMXA 2ZV2A 5E7RA 5ETCA 3RZFA 4HGTA 3C5UA 1YHVA 4DBNA 3LAUA 3NMUF 5JFXA 4ZS4A 3R9RA 4MXZA 3K5VA 3OY1A 5TT7A 4BIBA 4YJNA 2J0IA 4ZZNA 4QMOA 2YIXA 4AW5A 2DWBA 2YLFA 3QA0A 2X2KA 2QVSE 5HE2A 5KZ0A 3UGCA 4DEDA 4EOKA 4LI5A 3ZFMA 2YAKA 4QNAA 4PY1A 5HTIA 3NUNA 2NPQA 3AC8A 4UWBA 3HV6A 3TWJA 4A4LA 4PPCA 3DAEA 1CMKE 3FMNA 3MWUA 3P4KA 1NT2A 4NH1A 3HP5A 4A06A 5DI1A 5BYYA 4O81A 1OI9A 3W2SA 4JBPA 2IPXA 3ACKA 2V7OA 4N6YA 1E1XA 3CD3A 3LLTA 4L52A 1A48A 1OPLA 5GIPE 4N0SA 2VX3A 2YM6A 2BRGA 4K6ZA 5C01A 5TKDA 4ZAUA 3BU5A 1A06A 5IUGA 4IAIA 3AQVA 4WUAA 3LFNA 3LFFA 2J9MA 4ANOA 3UO4A 1H26A 2WOTA 2BRBA 2X9EA 4QPAA 3VF9A 4OTRA 2J51A 1TQMA 2IZUA 4EOIA 2R3GA 5LJJA 2HW6A 4RA5A 4AZTA 4FK3A 4IAAA 2X1NA 4AN9A 3D7ZA 3TZ8A 5IPJA 1NY3A 4O1OA 4QT1A 1CTPE 3AT3A 3K5UA 4B4LA 3GCQA 3C0GA 1VYZA 2B9JA 2UW4A 4O21A 4CFFA 3GVUA 3HYHA 2PU8A 3D83A 4ZXTA 1OUKA 3BHHA 3QCYA 3MA6A 3RTPA 3FXWA 3NNXA 3EL7A 2R3RA 5HBJA 4QMNA 3E7VA 1XH4A 2C6TA 2PZRA 3RPOA 2F4JA 3C4XA 3R7UA 4QMYA 5A6OA 3ZSHA 4UZHA 4FZAB 3W8LA 4X3FA 3D5XA 4YURA 5BQ0A 5LMKC 2C6MA 4PTCA 3E8EA 4X0MA 3R01A 3AOXA 2VWUA 3Q96A 3TNQB 2BDFA 4AFJA 3RWPA 3PTGA 1PY5A 3I5NA 5EYKA 4CFVA 3FMEA 4R1YA 3U87A 4MYGA 1M2RA 3PSBA 2QU5A 3ZZWA 2KULA 4I92A 4EQMA 5E4HA 4Y5HA 2JKMA 3L8SA 5KZIA 2GDOA 4K8AA 2VTHA 4EEVA 4QTAA 4JVGA 1GNGA 3ZRKA 4K77A 5D7VA 4F7LA 2CNQA 4EHEA 1M2PA 1OIUA 4TYHB 5IISA 3F2AA 4YJTA 3NUXA 2OWBA 2OFVA 3RCJA 5EW9A 5L2IA 3KB7A 1BMKA 1RJBA 4GU9A 2ITQA 4IZ5A 3R2BA 3G6HA 1Y6BA 2P0CA 1WFCA 3PPZA 3QKKA 3KXGA 4YPSA 3ZONA 4G6LA 5BUIA 5BYLA 4RZWA 3ZDIA 3TTJA 3LXLA 4D0WA 2VO6A 3OEFX 4MF0A 4YJRA 2QLQA 3SGCA 4ZSLA 1YDTE 4HZRA 4M0YA 5KHXA 3QXPA 4X3FC 4OTWA 3SLSA 4F7JA 4QPSA 3FY0A 4KS8A 4UX9A 2CGWA 5CS6A 2YM7A 3MBLA 5AADA 2BZKB 4MX9A 4OAUC 1W8CA 2C3LA 2PVMA 3RPYA 4FVRA 4IADA 4CMOA 2EUFB 2VWWA 1ZAOA 2UW9A 2WPAA 4Q2AA 3RVGA 3EH9A 4EYMA 2GNJA 3ORIA 5EI2A 4MHAA 4FSQA 3ULZA 1NVSA 4YBJA 1GY3A 4G6OA 3OW4A 4ZTLA 3V04A 3UZRA 5AR5A 4I5HA 3UVPA 3FZRA 1JPAA 4XV3A 4FOCA 4RIYB 3RZBA 3EL8A 4E5BA 3VBQA 1WAKA 2W1EA 4O83A 1ZWSA 4ACDA 4DGMA 3ELJA 4UXLA 3AGMA 5M4FA 4WIHA 2ZAZA 2C6LA 3GP0A 5I9XA 4LL0A 2Z02A 3VHEA 3CS9A 4YJQA 3UNKA 1SZMA 2X81A 3IECA 4S32A 4DTKA 3CC6A 5FTQA 4BI2A 5AFVA 4IE9A 2BDJA 2G2FA 4JDKA 4NIFB 4L01A 3NPCA 3OS3A 4FYOA 5IQFA 2V0DA 2G01A 4XG3A 3QLGA 3KEXA 4LGDA 3FL4A 5HBEA 2WMWA 4NL0A 3GFWA 4AZFA 3KULA 5HU9A 5L3AA 1Q24A 1P2AA 3FLNC 3VS5A 3DAKA 3HMIA 1WBTA 4FVPA 4EYJA 3SVVA 2XKEA 3RPVA 2YM8A 4JOAA 4U7ZA 5CEKA 3EN5A 4A9SA 5AUXA 4GKHA 1XH7A 5CNNA 3Q4ZA 3MTFA 3VS7A 4AACA 4WUNA 1IRKA 1Q8ZA 2VRXA 2I0HA 1LEZA 2YM3A 3PVGA 3RWQA 5FG8A 4Z3VA 4GG5A 1OZ1A 3PY0A 3ZC6A 2CKOA 1U54A 4JNWA 2I0EA 4OLIA 3U9CA 2VWVA 4O7LA 2HENA 4IVAA 2P55A 1PF8A 3LCDA 3S1HA 3U4UA 3CSVA 4IIRA 4ZK5A 1WMKA 1KE8A 3IONA 3VQUA 1UNLA 3FLQA 2E9NA 1JKSA 3O0GA 4MQ2A 3A8XA 2QO7A 3BHVA 2XIZA 4EORA 3DZOA 2WIPA 2OIDA 4V0GA 3GC8A 3MFTA 4JI9A 3PZHA 5E8ZA 3QRKA 3TV6A 3VBXA 5AA9A 4QMZA 5J5SA 4PV0A 1WZYA 2ACXA 4S31A 2C69A 3W18A 1ATPE 2ITOA 3ZUTA 5CEOA 2WMQA 4YNEA 4HVSA 5JFWA 5JZNA 5GHVA 4BBEA 5IEYA 5HG5A 2PUIA 1XKKA 3PJ2A 4NTTA 4F9WA 1GZKA 5BMMA 4XMOA 1H25A 3L1SA 5I9UA 2Y4PA 4MXCA 4PDSA 3VUTA 3P79A 4EUUA 2OSCA 4OR5A 1YOLA 2IVVA 4BDKA 4CQEA 3UP7A 4MWIA 4EUTA 4W9XA 2HIWA 5CZHA 2YJSA 3KCKA 1NXKA 4PL5A 4BGHA 3BHYA 2UUEA 1BKXA 3K3JA 3NYVA 1FVTA 3EOCA 4NW5A 2R3HA 5DH3A 4JRNA 4II5A 5HE3A 4QPMA 2JIIA 3QALE 4YZDA 3GU6A 2V55A 5AP5A 4E7WA 4U45A 4F9CA 3RBWA 2XB7A 3LJ2A 3P08A 4FR4A 5E8WA 4XG7A 1SYKA 3AC4A 5DR6A 4Y85A 2WU7A 4FTMA 2OIBA 3SOCA 1W7HA 3JPVA 2ZOQA 4Z55A 5I9WA 4GW8A 3KKVA 2SRCA 4BDEA 4FNWA 3RAWA 4AU8A 2RFDA 4RIXA 4CEGA 4U97A 4H05A 2WTWA 2WQEA 4KINA 4O2PA 2BUJA 3KN5A 5A4TA 4DEEA 1F3MC 3CY2A 4FTQA 3R7EA 3LQ3A 3R71A 4TYEA 3R7VA 2BALA 4EBWA 1MQBA 5K5NA 2QODA 2QQ7A 3H4JA 2NRUA 3PIXA 3QKMA 3VUHA 2PZYA 1UNHA 3LKMA 3R8PA 4R7IA 1MP8A 3R83A 4A07A 5AA8A 2GNGA 5CXZA 2HZ0A 2F7ZE 4G3GA 4W9WA 3SQQA 3ORPA 4TWCA 1QPEA 4ASDA 4CYIA 3GFEA 4D4SA 3AG9A 4L00A 3QTWA 4FKTA 2GNLA 3ZUUA 3BGQA 1Z57A 3FSKA 4RZVA 4M84A 2JAMA 3CCNA 4BICA 5CF5A 5E8VA 4AAAA 4AA4A 1NA7A 4EOOA 4ZLOA 1XO2B 2XF0A 3I81A 3O8TA 1LEWA 4PMPA 1KE6A 3POOA 2WELA 2UZEA 3LXNA 4M13A 4JG8A 5DGZA 3RNYA 4RBLA 3EHAA 1T45A 4MKCA 2VTNA 4YZCA 1PXOA 5HKMA 4UBAA 3GB2A 2PUNA 3AMYA 2B55A 4O6EA 4EI4A 4IW0A 2R2PA 1KSWA 1OPJA 4F7SA 5EM6A 3Q2JA 1PHKA 4U43A 2HWPA 4A4OA 3TT0A 1ZYCA 4YLJA 5EQYA 4I5MA 2VNYA 1X8BA 2WMBA 4WG3A 3VN9A 2IVTA 4QTCA 4TYJA 5AR3A 1JNKA 5IH6A 4F1MA 4L6QA 4F08A 5CSXA 2GQGA 3ZOSA 2C1AA 4KBAA 3OC1A 5IA2A 2JAVA 3T9TA 4JLCA 2VO7A 4P7EA 1CKPA 3WF6A 4IZ7A 3WE8A 3FHIA 5AEPA 2J5EA 4F9AA 4YMJA 1IA8A 5BX0A 4I24A 4FSYA 1OKYA 4L7SA 2X9FA 4WG5A 1QPJA 4FA2A 3NVKI 3RCDA 3FHRA 4RX9A 2YHVA 4HNIA 2PVKA 2EU9A 3FE3A 3R7GA 4FNYA 5FEEA 4TZRA 5IG1A 2UZUE 3QTIA 3FSFA 4ZSGA 3WF5A 2VN9A 4IC8A 2XMYA 4RRVA 3ANQA 4G5PA 5FM3A 4DE4A 3EFJA 1BI8A 1ZLTA 5CEQA 1BX6A 4KKHA 5FRIA 5L8JA 1BL6A 3HEGA 4W8EA 2OH0E 4E26A 2YIRA 3MIAA 1DS5A 3E8NA 5CU6A 1ZOHA 2C5OA 1YXTA 5E8YA 4IVDA 2GS7A 3R7OA 4ZP5A 3U51A 1YRPA 3ZYAA 3NAYA 1PXLA 4IFGA 5CASA 2PMIA 4R5SA 4HVGA 4U40A 1K3AA 2REIA 2YZLA 2VNWA 4IM3A 2XCKA 4PMTA 3KRWA 2QU6A 2Z7SA 3RKBA 3G0FA 2R3OA 4IX5A 4LRJA 5HLWA 4G1WA 2BIKB 5A3XA 3A4OX 4UWYA 3DCVA 1KUTA 5L4QA 1NVQA 3QTUA 5HNIX 4O82A 4DFLA 4F65A 4C62A 2Y8OA 3LFSA 3DXNA 3F3VA 3FZTA 4KWPA 3P78A 4I5CA 3W33A 5ETAA 3WIKA 3UOJA 4IEBA 1LR4A 2BHHA 4G31A 3C1XA 2FB8A 3IW4A 4C61A 1PXPA 4I3ZA 2PWLA 4YPDA 3UTOA 3K2LA 4MBLA 4BGGA 4RIWA 2X8DA 3RI1A 4QTEA 3D15A 2VX1A 4OTHA 3KFAA 2EVAA 4EOQA 1ZMVA 5K9IA 2W05A 3NS9A 4DCAA 3I1AA 2YIYA 5H3QA 4GT4A 2ITUA 2JFMA 3PP1A 4IXPA 4DH5A 1U59A 3FLYA 1QPCA 4HGSA 2EB3A 4CFNA 4LG4A 5KMNA 4ACCA 1M7QA 4GG7A 3U8WA 1WBOA 3JY9A 1REJA 4Y8DA 2P4IA 3UQFA 4ZTSA 2JBOA 4D2TA 4E93A 4HVHA 4OBPA 5KKRC 5IQBA 1UU7A 3T3VA 5JT2A 4EHVA 1OKZA 5C4KA 2YLEA 3LFDA 3U9NA 5J9ZA 5KMIA 1OPKA 3VS0A 3HAMA 3II5A 3FPQA 5K4IA 3FI3A 1TQPA 5EDRA 3CD8A 2F7EE 1RQQA 4JDIA 4I41A 5HCYA 2OZAA 2PZIA 3UVRA 4CTBA 2PYWA 1KE9A 3NYOA 3CTQA 2A2AA 3VS4A 5HO7A 1W82A 5K0XA 3QFVA 4FMQA 1OB3A 2JEDA 1GIHA 4EJNA 4ENXA 3UQCA 4ZEGA 1V0OA 1H01A 5GJGA 4Q5HA 3U6HA 3LFBA 4IAKA 5AP0A 5KMKA 2YERA 5HZNA 3BQRA 2VWIA 3R02A 4MXYA 4LUEA 5AP1A 3E92A 3P9JA 1YVJA 2WMAA 1H00A 3KRJA 5CVGA 4L8MA 3POZA 1QL6A 2LAVA 4BDCA 3R30A 3H0ZA 1O9UA 4D2SA 4DHFA 5ITAA 4G3DA 4DH7A 3RJCA 5A46A 3R9NA 5HLPA 2PUUA 3WZKA 4BB4A 4RC3A 5J79A 5ANJA 5JFVA 5AP2A 3KRXA 2J0KA 3EYHA 2F2UA 2OBJA 4U42A 4YJOA 2XKFA 3VBTA 4E6QA 4ZTMA 1DAWA 2PVLA 4CV9A 3CPCA 3SG9A 4H3BA 5DLSA 2BZJA 2VO0A 3Q53A 4H36A 4MD8E 4BYJA 5DYJA 3MYGA 2YM4A 4DG2E 4RVMA 2O3PA 3GCUA 3OP5A 4WBOA 2WZJA 3HV4A 5C8KA 3CJGA 3IKAA 3S95A 3VS2A 4OAVB 3BLRA 2QURA 2WOUA 3PXQA 4C3RA 3EFWA 4IVBA 2WHBA 2W06A 4JIKA 2XNOA 3PXRA 2WGJA 4GJ3A 4O0YA 4Z9LA 5TE0A 5J87A 4ANMA 3DGKA 5HICA 5IUHA 2CKPA 2JDSA 2WMTA 4O86A 4FL1A 2BAKA 4RG0A 4FODA 4RT7A 4ZSAA 5AV4A 5IQAA 2I0VA 1DAYA 2WTVA 4R6VA 4YJPA 4Z16A 2JDOA 3QD2B 5DIAA 3MH3A 1UWJA 4FT3A 4C3FA 3VUMA 4Q9SA 4FEXA 2QHNA 4JT3A 3NZ0A 2F9GA 2VTTA 4ENYA 3HLLA 4JQ7A 3W2PA 3Q4UA 2BIYA 3VIDA 3E8DA 4EH8A 2UW5A 3OTVA 4J1RA 5C8NA 2H8HA 3P7AA 4GU6A 3ZS5A 3A7IA 3PG3A 3WBLA 5IA3A 3Q04A 2UVXA 3F2NA 4W4WA 3UPXA 2XNGA 3DBDA 3FLSA 1MQ4A 4CMTA 2Y7JA 5LCJA 3QD3A 4PL4A 2J2IB 2ETRA 2QOOA 4C35A 3TTIA 2BILB 3N4TA 3UJGA 5EFQA 4DGNA 1KOAA 3GGFA 3NIZA 3LLAA 2C47A 4OTGA 4YTFA 4XJ0A 3U55A 3BYMA 4AS0A 5FEQA 2P3GX 3V6RA 1YOMA 2UVYA 3PLAE 3GI3A 5M51A 3F3UA 3D7TA 1VZOA 3DLZA 3UC4A 1KE5A 2BAQA 3SOAA 5IQIA 2ITXA 4HPTE 2W9FB 3IW8A 3IS5A 1FMOE 4KBCA 5FBNC 3ORXA 5B2MA 4R78A 3P23A 5DOSA 4QYFA 2GFSA 2GNFA 3MFUA 4FKWA 4S33A 4DT9A 5ANKA 3GU5A 2BAJA 4FZ7A 4MD7E 3KMWA 3KC3A 3FDNA 1BYGA 4FIIA 4JR7A 3FYJX 4WSYA 2OJGA 3EQDA 4G3CA 5KO1A 3RK9A 2BKZA 2XK7A 4EOJA 5T3QA 1GZOA 5C27A 1Q8YA 4UYAA 1WBPA 1H08A 4RLLA 4FUYA 3L8VA 3RAKA 4FEQA 4TXCA 4BWPA 2C4GA 4MNEB 3N4UA 2BTSA 4N4SA 2P2IA 2QOCA 4UB7A 3QRTA 3ETAA 1OBDA 3OBJA 4IB0A 4ARKA 5HQ0A 4I6QA 3BWJA 1P4FA 5E8TA 4K33A 3OF0A 4HVIA 4J52A 4TYGA 2CDZA 4R3RA 2OK1A 3BEGA 3FMDA 1FPUA 2G2HA 4I0RA 4XP3A 5CY3A 4M7IA 3T9IA 2CNUA 3UQGA 2R9SA 5E8UA 4F9BA 3RINA 3UYSA 3DKCA 2OO8X 3Q5IA 4QYYA 3WF7A 4BIEA 4GL9A 3C4FA 4DEHA 4BHZA 1OVEA 1YXUA 2QLUA 4H1MA 3MIYA 3MPAA 4FEUA 1H8FA 3VNTA 4BI0A 4QYHA 1TQIA 4X2NA 1O6KA 3WZJA 4AZSA 3GOKA 4J71A 2XA4A 3DB8A 3K3IA 4G16A 4IQ6A 4J8NA 3ZBXA 5CALA 2C5XA 1CDKA 3LMGA 3NUAA 3WIGA 3IOKA 5EDPA 3DBQA 3MTLA 4EL9A 3OXZA 3V51A 4FV2A 2Z7QA 4M14A 2XIYA 1S9JA 5CEPA 2WNTA 3NUPA 4IC7A 3MN3A 1BI7A 4NEUA 4QQJA 4YSMA 3FQHA 4O6LA 2HZIA 2VWXA 2XNMA 2XNEA 5EW3A 4JR3A 5AV1A 3E87A 5B7VA 5JQ5A 3QTZA 1HCKA 1UV5A 4C2VA 5JGAA 3RK5A 5JRQA 4EOPA 3RAIA 2GNIA 2VZ6A 3I7CA 2ZV9A 5AIKA 2UW3A 2ZB0A 5ACKA 3R8VA 4ACMA 4ANNA 5D11A 4A9YA 2BHEA 3MH0A 1W83A 2YWPA 3SG8A 4HGLA 3LMHA 3QZFA 4QO9A 5FTGA 2VTAA 4YHFA 4TKSA 4DITA 2XZSA 4XRLA 5CI6A 3F6XA 5CQWA 2Z7RA 2XJ2A 1ZY4A 1IG1A 2W4OA 1FGKA 2QOIA 3ANRA 4G9CA 4GSBA 3BCEA 5A4QA 1ZY5A 2WMXA 4MXAA 3RHXA 3COKA 5DT4A 4CSVA 3UOLA 2CN5A 1XJDA 4PP9A 4KIOA 5CU3A 4YZMA 2C0TA 5HO6A 5GZAA 1UVRA 3FKLA 5AM6A 4FKLA 5T68A 2IJMA 3L9LA 3TL8A 3EQBA 3V8TA 3EN9A 3PXYA 3TV4A 5JMSA 4HVDA 5I3RA 4F1OA 4BWXA 4C4EA 4AP7A 5L2WA 2XK9A 3H0YA 4ZTNA 3QAME 5EI8A 4O7SA 1YI3A 3JXWA 1QMZA 4M3QA 4RC2A 3MY0A 2CLQA 3EZVA 2W17A 3DBFA 4AZEA 1SVEA 4PMMA 4EZ3A 4NYEA 3ATSA 3EWHA 3PJ1A 3AGLA 5DRDA 3TCPA 5AJQA 5DEWA 3CQUA 2NRYA 3EFKA 4TYHA 1YI6A 1A9UA 2C0OA 3OZ6A 3P5KA 2X2LA 3ZM4A 2IZTA 2I40A 4IJ9A 3KREA 3AD4A 3S2PA 2XJ1A 3JUHA 4PTEA 4YJSA 3QCQA 4LGGA 5A9UA 4QMUA 3MGYA 4AGUA 4R77A 2O65A 2XNNA 4RLKA 4AUAA 4QP1A 4NKSA 5L6PA 4KB8A 2OXDA 4ORKA 5FQDC 1GIIA 4HW7A 3RALA 3IDPA 4RGJA 2RGPA 5JZJA 3KXHA 5DEYA 3PIZA 1J7IA 2H9VA 4IBMA 5CWZA 2PL0A 2GQRA 2Q0BA 5M07A 4GT3A 5EYDA 2UVZA 4OUCA 1UA2A 2C6OA 2Z2WA 5KHWA 5GJFA 4LRKA 2W5BA 2WFYA 4IH8A 3PJ8A 4WBBB 2XNBA 4XP2A 4CFWA 4Z7HA 2J90A 2R3NA 3P1AA 3BRBA 5HIBA 3FZOA 3PXKA 4E8AA 2YFXA 4U5JA 1YWRA 3QD4A 2F49A 4FKVA 4IB5A 3SA0A 3GC9A 2CHLA 3QYWA 4FV4A 5EYMA 2QNJA 3KN6A 4GK2A 4IWOA 2VGPA 2JITA 2VUWA 3MFRA 4N6ZA 5EG3A 4DTAA 1OUYA 4M97A 1JKKA 2AYPA 3OBGA 5HOAA 4EH3A 4L44A 4U80A 5FXRA 3V5LA 3DXPA 3I7BA 5IQDA 1R1WA 4OT6A 4E4LA 5CF6A 2QD9A 4XHKB 3R8LA 2PPQA 4RFYA 4H3PA 4E4NA 2FO0A 5F4NA 4DC2A 4E5WA 3PVUA 5E92A 3ZO2A 4ZZOA 2AC5A 4C59A 4J95A 2XK4A 3FMJA 3FWQA 4GUEA 3GENA 4JBVA 2QOBA 4XP0A 3B2TA 3U54A 4R3PA 1GJOA 1PMVA 3TZMA 1JKTA 3F7WA 3ZLWA 4B9DA 4RPVA 3OWJA 3BE2A 4HZSA 3NWWA 3ZU7A 3KF7A 1YXSA 2VTPA 2XRWA 4FIEA 4J97A 4YO6A 4XOYA 2QO9A 3V8SA 2RFNA 4PNKA 1BLXA 5HVJA 4H3QA 3DJ6A 2YA9A 4NIFA 4F09A 2VTQA 3BHTA 4OGRA 4PX6A 4BDDA 3L8XA 3PP0A 3C50A 5HG9A 3R00A 3W55A 3OWPA 5DT3A 4JL9A 4TRLA 4C57A 3TUDA 4BKJA 1RDQE 2ITTA 5IMEA 3ZO1A 1PXNA 5CEIA 1FBNA 5HE0A 2QR8A 2XK8A 4L67A 3P86A 2XH5A 3Q5ZA 2XIRA 3HUCA 2XJ0A 3EQRA 3P0MA 4X3FB 5CSHA 4IHPA 3HZTA 4FTRA 5M08A 3ORMA 3BZ3A 1H1RA 3ZZEA 4CRLA 4AQCA 4TTHB 3Q32A 2W9ZB 1KV2A 3ET7A 4DF3A 5AP4A 3D94A 3IPHA 4GKIA 4DFXE 4TNBA 5DG5A 2WQBA 3NNUA 4Y72A 3R7YA 3U6JA 3BBWA 4QQCA 2A27A 3O17A 2QG7A 4O7VA 1DI8A 4FKRA 4DH1A 4ZJVA 3F5PA 4RJ8A 3R8UA 2O5KA 3NCGA 5KMLA 3BI6A 3BPRA 3G5DA 2IVSA 3VVHA 4FGRA 4O22A 1H28A 3GU8A 3QZHA 4RSSA 1J1CA 2XM9A 4IACA 4Q9ZA 4ANSA 3QWKA 5HORA 4EJ7A 3W2OA 4LOOA 2YDIA 3UOHA 2W0JA 1Z9XA 2WIHA 4DH8A 1Q62A 3VQHA 4RWKA 2JIUA 5CLPA 3TXOA 4QNYA 3BV3A 3F5GA 3F5UA 4JIAA 5AP7A 4WNOA 1BUHA 2RF9A 2UV2A 3TN8A 4O7NA 4O27B 2C3KA 3UIMA 3R63A 4FSRA 4ZMEA 2Z60A 2J50A 3HRBA 3SV0A 4LYNA 2GMXA 2QI8A 5T6KA 2VV9A 3AXWA 5KBQA 1O6YA 1TKIA 2GS6A 5LMAA 2CGUA 5ACBC 4B8MA 4R7HA 3GNIB 4GVJA 4I5PA 3MDYA 4FSUA 4MAOA 4EH2A 4HPUE 5EKNA 4FV0A 3A62A 3NYXA 5AV0A 2R0IA 3NDMA 3SW4A 4F0IA 5CU2A 3GXLA 3NLBA 3KMUA 1Q8WA 3HVCA 4DG0E 2QO2A 4FIHA 4F9YA 1OIRA 1P4OA 1NW1A 3LCTA 4Y95A 5B0XA 4CZUA 5IMXA 3QD0A 2GNHA 5D12A 3BE9A 1APME 1UWHA 2WQNA 4UMQA 2JD5A 1YWVA 4GEOA 4QQ5A 3V01A 2HELA 4EK4A 3NUSA 1JWHA 4IB1A 3VUGA 4DEBA 1YXVA 3PE2A 3LOKA 5JN2A 5J1WA 4FOBA 2PE1A 4IM0A 2F57A 3UZPA 2QOLA 5K4JA 3G9LX 2OW3A 3NAXA 4YP8A 2R3MA 2W5HA 4MNFA 4QP3A 4R3CA 4ERKA 2CN8A 4PF4A 2OFUA 2RKUA 3PYYA 2W1HA 1H07A 4FTIA 4ALVA 3PIYA 4MXXA 2WTJA 2PSQA 3PXZA 4C2WA 4QMVA 3A7FA 2EXMA 4HYIA 3BQCA 3CJFA 3VBVA 3KXZA 4U0IA 2UW8A 4M67A 4CZTA 2ETKA 4IJPA 4FV5A 4UMTA 4FV7A 5IA4A 4IX4A 3TJDA 2P33A 3KULB 3MB6A 3OT3A 4ACHA 3CKXA 3LFAA 5HBHA 3F3TA 3C13A 4I0TA 5FEDA 1OKWA 4UMRA 2C5NA 2QKRA 4ZSJA 2IW8A 3V5QA 4BDHA 5IH5A 3ORZA 4CGAA 4DFNA 4FKJA 3F3WA 3FQSA 2PZ5A 3PXFA 1WBSA 4FV8A 1H0WA 5FTOA 4NM3A 4D1SA 3E63A 1R78A 4KSQA 4MH7A 2Y6OA 5A4CA 5JEBA 4AT4A 4R1VA 5DE2A 5LOHA 1LPUA 2V5QA 4P5QA 2C3JA 3WILA 4R5YA 5E8SA 4ZJIA 5AR4A 3DK3A 3I60A 1PYXA 3D4QA 4HCUA 5BYZA 1H1PA 3LIJA 4ALUA 4AOTA 4MBIA 4QTBA 3EFLA 2XCHA 2Y0AA 4YR8A 1U46A 2O63A 1JSTA 3ZLXA 4N70A 4BY9E 4G34A 4L7FA 2YCRA 1IAHA 4A4XA 4WA9A 4QMXA 4NFNA 4V0GB 2UZWE 3FJQE 2O8YA 2VTJA 1G8AA 4X2KA 3GOPA 4KRCA 1ZZ2A 3R8MA 4E20A 3AC3A 2JDRA 3FZPA 2Y6MA 3QGWA 2EXCX 2CGVA 3DKGA 5M4CA 4EBVA 4YGAA 5G6VA 3BIZA 3C9WA 3SX9A 4FF8A 4D4VA 5I9ZA 4XLVA 4RJ4A 2KTYA 2NP8A 3A61A 4FEWA 3EMGA 4O84A 4FTAA 5DR2A 4LRMA 1PMEA 5HG8A 3B8QA 4E3CA 1Y57A 5BPYA 4ZZMA 1OM1A 3E93A 5BUJA 3TKIA 3M1SA 3A8WA 4D9UA 1SVGA 4JQEA 4PUZA 4AGDA 3EKKA 3ODYX 4XRJA 5FGKA 5IA1A 1XWSA 3JYAA 1XH5A 3A2CA 5HD4A 5M4UA 4ZMFA 3LE6A 2JC6A 1H24A 3HV7A 4YZNA 3I6UA 2PVNA 4XG9A 4DGLC 3LJ1A 4ERWA 5JK3A 1UU8A 3OROA 4LOQA 3MESA 2E2BA 2GCDA 4YLKA 4EK3A 4GIHA 1H27A 5CXHA 3NW5A 3BYSA 4K9YA 2Y4IC 1PKGA 4L9IA 2CPKE 2JDTA 2CSNA 3NUYA 4ASEA 5BVWA 5LVMA 1J91A 3UO5A 1M2QA 2XUUA 4C0TA 4F1TA 4FYNA 3RHKA 2GTMA 3Q52A 4O91A 3V5JA 5I9VA 4GK3A 2FSLX 4IANA 4NJ3A 4O0WA 3QX2A 2OI4X 4C4JA 2GHMA 4FKOA 2G2IA 4D1ZA 2OXYA 3UBDA 5FLFA 1STCE 2GFCA 2PTKA 4RIXB 4L3PA 4JQ8A 4E73A 4DINA 3CTJA 3C4EA 4CKJA 3QQLA 3NEWA 4QMPA 1H1WA 3UPZA 4G3EA 2X0GA 2YDKA 1GZ8A 4TY1A 1Y8GA 4DFUA 3RMFA 4FTOA 2V7AA 5A6NA 5ANDA 2PZPA 2YEXA 3UMWA 4CYJA 1XBBA 5CVHA 2Q0NA 2QOKA 1G5SA 1WVXA 3EQHA 4I94A 3GC7A 4CG8A 2WMRA 4PDOA 1HOWA 4XBRA 1Q99A 5JFSA 3Q9YA 2XBAA 3AMAA 4LQMA 3LVPA 3H3CA 4BN1A 4RWJA 3KXMA 4F0GA 3G2FA 4YJVA 3FBVA 5EDQA 3QYZA 4O38A 1REKA 3W2CA 4OTQA 4BCNA 2XYUA 4PPBA 4O0TA 1E9HA 5D10A 5ETFA 3I79A 2PMLX 1L8TA 2J0MB 2QOHA 3F3ZA 4C4FA 3TACA 3KA0A 3MB7A 2X8IA 2FYSA 3ZFYA 1CSNA 1Q41A 2X7FA 3WOWA 3JY0A 4EH7A 4FSNA 2C5VA 2GPHA 1YXXA 4KA3A 3SDJA 1IAJA 3GC0A 3ZFXA 5C26A 3H9RA 3E64A 4QMMA 5AV3A 5LMBA 4OBQA 2JBPA 3HGKA 5TR6A 5K5XA 3CXWA 3A99A 5I3OA 3R8ZA 1Q8TA 3O8PA 4YTHA 3MSSA 1U5RA 5CYIA 1H1SA 4A9UA 4AXAA 1MRYA 4M68A 2V62A 4FKPA 4E1ZA 2FH9A 1WBWA 1RW8A 1YHWA 3LM0A 3UIBA 3UNJA 5DWRA 4CXAA 4L46A 3D9VA 4L45A 3GCVA 3O71A 2VO3A 2YM5A 2X7OA 4FSMA 3KMMA 1JSVA 4LMUA 2J5FA 4C36A 5IZFA 1AD5A 2WMSA 4AW1A 3UC3A 2CKEA 1M52A 4EOMA 3FLZA 5HCXA 4RX7A 3PVWA 4LGHA 2RFEA 3AD6A 3HKOA 5EK7A 3W32A 4EHGA 2ZMCA 1Z5MA 4YUQA 4CFXA 4HYHA 5CAUA 3IG7A 3RP9A 1YI4A 2OXXA 4KKEA 5AAFA 5HTCA 3FAAA 4KIKA 4M69A 3RM7A 1Q61A 4QYGA 2XVDA 3FI8A 3TM0A 3NSZA 4D5KA 2E9VA 2EXEA 2C6IA 2HCKA 4BCPA 1Q97A 2WU6A 1SNXA 3C0IA 4BCJA 3GQLA 4U9AA 3FI2A 4DN5A 1OL6A 5IEVA 4TWPA 4FL3A 2YDJA 2J0LA 3FV8A 4JXFA 3EQCA 4LMNA 3F82A 3ORNA 5J9LA 3VS6A 5EQEA 3QL8A 4I0SA 3VS1A 4MXOA 3V8WA 2G15A 3EKNA 3OT8A 5KKRB 2OJIA 3DKFA 2HYYA 2I6LA 4NUSA 4PWNA 5J8IA 5J9YA 3QTQA 4FTNA 3D2IA 4DYMA 1XH8A 3MVHA 2XEZA 2YCQA 4NU1A 4EQCA 5CANA 1ZYLA 2G9XA 5EI6A 3TJCA 5DMZA 5HU3A 5HX8A 2JDVA 3FMKA 2A1AB 2ZM4A 3QHRA 3DT1A 3GU4A 2J7TA 4BDBA 3F66A 4E6DA 1WBNA 5TO8A 4F7NA 3Q6WA 3VBYA 3O8UA 3ROCA 3NUUA 4FBXA 4HOKA 3B2WA 5FBOA 4NM7A 3MH2A 2RIOA 1H4LA 3A7GA 4U3ZA 1ERKA 3L8PA 3OD6X 4NT4A 4RIWB 5A54A 5LXMA 4YHJA 3S0OA 1K9AA 3MPTA 2PVFA 2HZNA 3CTHA 3FC2A 4I21A 2FSTX 4G17A 2UZTA 3TG1A 3S4QA 4ZY5A 4V01A 2B4SB 3AC5A 1ZARA 1OL7A 3O7LD 4B99A 3E62A 4XEYA 3GUBA 4C4HA 2VD5A 4PDYA 5ANIA 2OF4A 1UNGA 4K0YA 4AZWA 4KSPA 4J8MA 4RMZA 5ANEA 4AT5A 3R04A 1HCLA 1V0BA 4FT7A 4UV0A 4DEIA 4EZ7A 5C1QB 3NVMB 3WF8A 4KABA 2PUPA 4JG6A 3ZLSA 4KS7A 4X7QA 4S30A 2IWIA 2W1IA 3VUKA 2OU7A 4YLLA 3EJ1A 3MJ1A 4QYEA 3KF4A 2VTRA 3FPMA 3MVMA 4ZSEA 3EN4A 4GJ2A 5HNGA 5CQUA 2QONA 2ETMA 3SC1A 2BVAA 2OZAB 4I4FA 4NW6A 5B2LA 4BR3A 4A7CA 4ALWA 3F9NA 1WVWA 5FD2A 2YN8A 2QC6A 5HEZA 3DJ7A 3KRLA 4ZLZA 5LQFA 5BVKA 2BFXA 1Y91A 4ZTRA 3G51A 3KK9A 5F9EA 3ZM9A 4YSJA 2WXVA 5FWKK 1IEPA 2XIKA 2QHMA 3FKNA 5AP6A 4MNEA 4BFMA 4CZYB 3OVVA 2YISA 1VEBA 2PE0A 3CY3A 3MVLA 5GIOE 3DB6A 4F0FA 5ANGA 3S00A 1I44A 3M11A 3RGFA 2PULA 3ZDUA 5J1VA 2WMVA 5JSMA 5M4IA 5HIDA 5LVPA 2E9UA 2R4BA 4YO4A 2BDWA 2W99B 2WMUA 4MK0A 4APCA 3FZ1A 3KK8A 1JSUA 3R1SA 3RPSA 1FQ1B 3AD5A 4TT7A 2BMCA 3AC2A 4FSTA 3IO7A 3V3VA 1JOWB 2H96A 3BLQA 1FOTA 3PPKA 1OMWA 4BC6A 4D5HA 1YKRA 3DQWA 3VF8A 3VC4A 4FV6A 5D9HA 3VW8A 5CF8A 3D5UA 3GCPA 2JFLA 3QQFA 4GT5A 4YC8A 1MUOA 3QCSA 2BROA 5G1XA 5JH6A 2R3QA 2RG6A 2OJ9A 4L3JA 3R9HA 3UG2A 4UALA 1KE7A 1ZOEA 4NCTA 5EH0A 4M66A 2PHKA 4XH6A 2CCHA 4DEAA 3KY2A 4OBOA 4NSTA 3IW7A 3THBA
chains in the Genus database with same CATH superfamily
3DKOA 3VRYA 1V0PA 3CIKA 3PZEA 1XHAA 2UZBA 4BZDA 4OTIA 5DVRA 3ZTXA 3PDTA 4DAWA 2JKOA 3HMPA 4NKAA 4YC6A 4KKGA 4KUJA 3BV2A 3QZGA 2XP2A 4ASZA 4FIJA 4QP7A 3PLSA 1PMUA 3GU7A 4OTDA 4PNIA 4BF2A 4F63A 3C0HA 3G90X 4MQ1A 4ZTHA 4XV2A 5M09A 2VAGA 1Y6AA 3CE3A 3SXSA 1IASA 2O2UA 5AUTA 5CAQA 4EC8A 4AN2A 5HIEA 5FDPA 2B0QA 2GU8A 4HYSA 3QC9A 3MJ2A 4XCUA 5JQ8A 1W98A 2B9FA 3Q6UA 2PMNX 5E9EA 1B6CB 1JVPP 3SHEA 3PSDA 5A4LA 4B6LA 4UMUA 5J7HA 4I6LA 1I09A 1KOBA 2WTIA 5CVFA 2HXLA 4AA5A 3E7OA 2AC3A 2E9OA 3NGAA 3D7TB 4FKGA 4AOJA 4C02A 4BCOA 3LFEA 3LZBA 4W4YA 5IDPA 4XLIA 3OUNB 2R5TA 4XBUA 4HYUA 1M17A 2BZHB 4J99A 4BDIA 3VW6A 3QQGA 4FZDB 4BCMA 4QEBA 3HA8A 4AE6A 3FMHA 3BEAA 3ORTA 4FV3A 5FP6A 3S3IA 3W16A 5DN3A 3QHWA 4QMSA 4TN6A 4U6RA 3CPBA 4P2KA 5AV2A 4BKYA 3QQHA 1YWNA 5IA5A 4C58A 5GZ9A 4QMTA 5J7BA 4TWOA 4RVLA 4XG8A 2HXQA 3QGYA 2FA2A 5EM7A 4UMPA 2BKKA 3PA4A 4JG7A 3V5TA 4QP2A 1XR1A 3W8QA 3VBWA 3FKOA 5D41A 4IVCA 3SRVB 4BYIA 2JIVA 4JAJA 5KMJA 5FDXA 3BU6A 2C6KA 5L2QA 3QXOA 1XQZA 3ROYA 3FMMA 3QRJA 2IN6A 2X4ZA 1OKVA 2C3IB 3FUPA 4K2RA 4WHZA 3L9PA 5AMNA 3R9OA 4AE9A 4AWIA 1W2FA 4IZAA 3UOKA 3COIA 4HGEA 5BVNA 5I5ZA 2XYNA 4Y83A 5KNJA 3LQ8A 2WTKC 4CCUA 4KAOA 4U79A 1P5EA 4JAIA 3IDCA 4NTSA 5HTBA 2UW6A 2VTIA 4WT6A 3OCTA 4X21A 1UKIA 1CKJA 4YJUA 3VUIA 4BCIA 5GJDA 4WRSA 5LVNA 4ITIA 1J3HA 3PY3A 4OTPA 3ZBFA 3VRZA 1Y8YA 2I1MA 3GCSA 4AA0A 5CSPA 1VLRA 2WO6A 5H9BA 4APPA 5HLNA 4FIGA 5LMKA 4AX8A 3EQIA 2WTKB 2Y9QA 3MY1A 3RK7A 4XV9A 4QD6A 4NFMA 3G9NA 2CCIA 4GCJA 5D7AA 5C03A 3EYGA 4GRBA 5DRBA 5JRSA 3OUKA 1XH6A 4K1BA 5CNOA 4A9RA 3HDMA 4JDJA 4P90A 4MBJA 2OF2A 5H8EA 3SXRA 3QLFA 1H1QA 4XG4A 3I6WA 4U81A 5A4EA 2R3JA 4WOVA 4X6RA 5KBRA 3QF9A 2QR7A 3MFSA 4Q5EA 2C6EA 5AIRA 3PJ3A 5AUZA 4KNBA 4RIOA 5M06A 4FEVA 3OOMA 1JAMA 2WD1A 3Q2MA 4RVKA 1PW2A 1LP4A 3CR0A 5AAGA 4FTJA 3LCKA 5CSVA 3B8RA 5L6WL 2PE2A 3VUDA 3G15A 4R7BA 4U3YA 3P7BA 4C38A 4RWLA 2HW7A 4RQKA 4ID7A 4AOIA 4QP6A 5CF4A 3TDVA 2FGIA 1YQJA 2IO6A 2HK5A 3IQ7A 3O23A 4I22A 4D2VA 2PY3A 3KQ7A 3ZC5A 3LJ0A 2W1DA 3CGOA 3R28A 5DFPA 2XM8A 4FSWA 4MTAA 4DGOA 3W0SA 3C5IA 3ORLA 4O0UA 4LL5A 3UDTA 1W2CA 4DEGA 4MWHA 4DDIA 3I0QA 4USFA 4OTFA 4KIPA 5CT0A 4HCTA 4HNFA 4O7TA 1XH9A 3ENMA 3D5VA 4LUDA 3FLWA 2YZAA 3QUEA 4RIYA 2IEWA 4BJJB 4UZDA 2XRUA 3QQJA 4Y46A 4DTBA 2V22A 4CVAA 2B7AA 3TUCA 1M7NA 5EW8A 5HHWA 3GEQA 5DT0A 3NFGB 1R3CA 3KRRA 3PE1A 2JGZA 4FRFA 4X2JA 5K3YA 3PRIA 4WO5A 5FXSA 4F6UA 3O50A 3TEIA 4C33A 4C34A 3BU3A 3CBLA 4BDGA 4K11A 2B1PA 4XX9A 2VWBA 5LARA 3UDZA 2O64A 2XK3A 3L9NA 3BKBA 4M0ZA 5L2SA 5EHOA 5HD7A 3Q4TA 5IF1A 3R22A 3ZXZA 4DFYA 3ZRMA 4QMLA 4JBQA 4L3LA 4GMYA 2J6MA 5CU4A 5DPVA 3ZO4A 3ZSIA 3Q60A 3AKJA 1R39A 1UKHA 1QPDA 4FL2A 4GYGA 3BLAA 4RQVA 5BVFA 3C7QA 3G6GA 5M55A 3T3UA 4DFBA 3R1YA 4FKQA 4DT8A 3UODA 2G1TA 1WVYA 4AT3A 3DK7A 3G33A 5LCKA 4FTUA 3DV3A 3NIEA 3QZIA 4N57A 4O7YA 5HI2A 5HE1A 4H39A 4I1ZA 3OWLA 3O2MA 4FV9A 4XV1A 4UWCA 3DFCB 2BPMA 5IQHA 5FM2A 4FKUA 4O4FA 4F64A 2WTCA 5HESA 4LM5A 4FG8A 3ODZX 4XYFA 4W8DA 5FXQA 4I4EA 4BI1A 3QRUA 5HVYA 5H2UA 3A7JA 1O6LA 2C1BA 4LV5A 2HY81 2W4KA 5C8MA 3ZO3A 2ITWA 5DBXA 1EH4A 1U5QA 2FSMX 4KIQA 3Q9ZA 4OT5A 4EH5A 2R3KA 5L8LA 3VWAA 4C7TA 2H6DA 3PWDA 3VJNA 4CKRA 4RA4A 4U44A 2R3FA 4DHIB 4C8BA 2R7IA 3MV5A 5H8GA 1RE8A 4D2RA 4X3JA 4FVQA 4FT9A 3TIYA 3ACJA 4I23A 2X4FA 4IMYA 3DY7A 3VULA 2F2CB 3FZSA 2O0UA 4JX3A 4AXFA 3C51A 3C4WA 4RJ5A 4CT1A 1YOJA 5D1JA 4EK5A 1IA9A 5AUUA 4LFIA 2EB2A 2YIWA 3UVQA 5TF9A 3VAPA 4QTDA 4WNPA 5EHYA 2WEIA 4G5JA 4D2PA 5ETIA 5AAEA 3NNWA 3V5WA 3QCXA 4JBOA 4HCVA 4IWQA 3L9MA 2ZYBA 4O2ZA 3QWJA 2IW6A 4DFZE 5CEMA 3QBNA 3NCZA 4G6NA 4BRXA 3WYYA 5M57A 3HMMA 2W96B 2W5AA 2XS0A 3HP2A 3FEGA 3Q9WA 3LMIA 3R0TA 4GS6A 3F69A 3T8OA 4W4XA 3LHJA 3UE4A 2C5YA 2I0YA 2UW7A 5KMMA 5L6OA 4AGCA 1PMNA 1H0VA 3IGGA 2R0UA 3OEZA 3HRCA 5AR2A 1ZYSA 2R64A 3R9DA 2VGOA 2VTSA 3BYOA 3AKLA 3ATTA 2UZDA 3U4WA 2BFYA 3FYKX 1ZOGA 5F94A 3BX5A 3CKWA 4D4YA 1SVHA 4AW2A 2BZIB 3NW7A 4CV8A 4D28A 2B9HA 3IDBA 5GINE 4GVAA 3UDSA 2GHLA 3EQFA 4BTMA 3H9FA 3DQXA 3I0OA 3TNWA 4CNHA 3OXIA 4AW0A 4QP9A 3BGPA 2UZLA 3ITZA 4JJRA 4BTJA 3HL7A 3BWFA 4FT5A 4EOSA 4MEDA 3MA3A 4BCGA 1ZRZA 4UEUA 4EQUA 5CU0A 2YCSA 4U41A 1E1VA 4DLIA 1JBPE 5M53A 2B54A 3Q4CA 3R6XA 2XIXA 3IGOA 2NO3A 3KXXA 3NW6A 4BZOA 4J53A 3HAVA 5IQEA 5GZ8A 3IW6A 3CLYA 3ZEPA 3QTRA 1ZMUA 3LCSA 3DBEA 3KL8A 3EZRA 4IX6A 4UY9A 2DS1A 1CM8A 4C3PA 1S9IA 3ML1A 2OKRA 4J98A 2QOQA 4CMUA 4F6SA 2E9PA 2WAJA 2X6EA 3EIDA 2YJRA 1URWA 1L3RE 4RX5A 2Z8CA 1U54B 3DTWA 1J1BA 4ZY6A 5ICPA 5KX8A 1ZYJA 2UZOA 4I20A 4WSQA 3UIUA 4FICA 4GIIA 4RVTA 3M42A 3OCBA 4JX7A 3ZHPC 3RPRA 2VTOA 2RFSA 5ANOA 3E3PA 3A7HA 4TWNA 5E1EA 4PL3A 4X6QC 2ITPA 4BCFA 4D58A 4D1XA 4AF3A 3ENHA 5KCVA 2ERZE 3RNIA 4YTIA 4GFGA 3UO6A 2RSVA 3E5AA 3DXQA 1W84A 3H30A 3FL5A 3W0MA 1M14A 3DBCA 4RFMA 5HNBA 3TNPC 2J0JA 4FKIA 3QU0A 4JDHA 4FNZA 5AX9A 4BBFA 5C4LA 4R8QA 3KGAA 2BR1A 4X2GA 5CAVA 5C9CA 3WF9A 2IZSA 5EM8A 5HCZA 3UZTA 3ZLYA 3U6IA 4FKSA 4MF1A 1PXMA 2XEYA 3CEKA 3A4PA 4FV1A 3ULIA 3QTXA 2R7BA 4DA5A 2VX0A 4LV8A 3TKUA 3LPBA 1ZZLA 3PJCA 4WD5A 4XG2A 4WKQA 3E3BX 4FZFB 5E8XA 4IAYA 4NK9A 5AR7A 4FI1A 3OG7A 2FUMA 2QOFA 4QMWA 4M8TA 2B53A 3QKLA 2W1ZA 2OIQA 2YITA 4QOXA 4C4GA 1OIYA 4A9TA 2XAMA 5GNKA 5EKOA 4O1PA 5AP3A 3P5JC 4YZ9A 2YABA 4WRGA 3COMA 2C30A 2X6DA 3CP9A 1DM2A 1QCFA 1T46A 2HAKA 4K18A 3R7IA 2GTNA 4CT2A 3PFQA 2YAAA 4UXQA 4WNKA 4H1JA 3D5WA 3VONA 4QQTA 3W1FA 1UU3A 2Y4IB 2GHGA 4L43A 1F5QA 4PP7A 3ZCLA 5IKWA 3COHA 4YC3A 1PXKA 3VJOA 5CSWA 4BDFA 1TZDA 2OJFE 3R2YA 3MW1A 1F0QA 4MVFA 1GZNA 5EYCA 4E6AA 3TUBA 1Q3DA 4BDJA 3MY5A 3FXXA 2VU3A 2X8EA 5L2TA 1P14A 3ALOA 5H8BA 5IH4A 2OJJA 5M44A 2XKCA 1PYEA 5E90A 4RWIA 3DDQA 5HGIA 4FNXA 4HJOA 4NM0A 2ONLA 4UYNA 4DGGA 1PJKA 4ONAA 3CGFA 3LCOA 4G9RA 2HY0A 2W1FA 2QKWB 3HRFA 3WE4A 1MRUA 3E8CA 3OCSA 4IAZA 4RJ7A 3FC1X 3NRMA 5DNRA 2CNVA 5AM7A 3KU2A 4FE2A 3PVBA 3ORKA 3PG1A 4L42A 4V04A 2AUHA 2DYLA 2WQMA 3JVRA 3R21A 2P2HA 2ZM1A 4G2FA 2WEVA 4GYIA 3HDNA 2OICA 3BGZA 1K2PA 1JKLA 4ZS0A 3DJ5A 1ST4A 3LW0A 3N9XA 4FIFA 1WBVA 4YBKA 5AUWA 3NNVA 4RJ6A 3TI1A 3R1QA 2BRMA 3AT4A 3R1NA 4P5ZA 4DCEA 4EH6A 1KV1A 5L8KA 2GSFA 3CQEA 4OW8A 2PK9A 5CI7A 4QP8A 4BWKA 3LFQA 1G3NA 4DLJA 3BHUA 5JGBA 5E1SA 4CFUA 1J7UA 3UG1A 3DFAA 3UYTA 4E5AX 5M56A 3F2RA 5KUPA 3PSCA 4DG3E 2HOGA 4BL1A 3FXZA 1U4DA 2UZVA 4J96A 4F70A 3EQPA 3VO3A 5LWNA 1J7LA 3QTSA 4E4MA 2PMOX 3N51A 3NYNA 5BVOA 2NNWB 2WB8A 3WZUA 2I7QA 3ZXTA 3TIZA 4E4XA 4EK8A 3HMNA 2ZV8A 5DA3A 2ONLC 4C37A 3Q3BA 3R73A 4FG7A 2YIQA 2OZOA 2XNPA 4YNOA 3BELA 4EKLA 5BVEA 2C0IA 4O0SA 4ZIMA 4B7TA 4CRSA 1JQHA 2OGVA 4UN0C 3DPKA 1OECA 2ZB1A 3W10A 3LXPA 4AGWA 4BCHA 2QCSA 4AZVA 4BGQA 5BMSA 1ND4A 2X0OA 3DOGA 1FVVA 2GS2A 3SAYA 3N4VA 3DDPA 2JLDA 1FVRA 4FTTA 5DHJA 4I93A 4ZY4A 3AMBA 3MS9A 3HV5A 4F4PA 5CTPA 1TVOA 4JS8A 1GAGA 2W4JA 4WNMA 4LV7A 2JKKA 4FT0A 4CQGA 1R0EA 3ZMMA 1OL1A 1VR2A 4QP4A 4S2ZA 5JKGA 3GQIA 3OHTA 1OIQA 2RL5A 4FX3A 4PRJA 3V6SA 4ASXA 1Q5KA 3UP2A 4NM5A 1V1KA 4TYIA 3QC4A 5F20A 3TKHA 2Z7LA 3OY3A 1URCA 2R3IA 4IB3A 1ZMWA 4M12A 4Y5QA 5LVOA 3ID6C 3D14A 4EWHA 3F5XA 3DU8A 2A19B 3DS6A 5CX9A 4FTLA 3IW5A 2YACA 5HVKA 4PQNA 4CCBA 1JLUE 2R3LA 4FC0A 5HX6A 1YW2A 3MPMA 3WYXA 3CQWA 3W2QA 4MCVA 5EQPA 3HMOA 3PWYA 4IM2A 3JR1A 2F7XE 5AUVA 3LFCA 4V05A 4I6FA 2VTMA 3BYVA 3P7CA 4EH4A 3PPJA 3EN7A 4ZTQA 4EK6A 4YU2A 2ZVAA 5BVDA 4D55A 2ZJWA 2ESMA 4EC9A 5CZIA 2IZRA 2WTDA 4I6HA 2CJMA 2ITZA 3LM5A 3KXNA 3DZQA 1Q4LA 5EHLA 4QMQA 3FQEA 4L68A 3UNZA 3TZ9A 3LXKA 2XKDA 2W1CA 3BBTB 3DK6A 4G3FA 5B2KA 5AR8A 2ZV7A 2IVUA 4XOZA 3I5ZA 4AN3A 2OLCA 1MRVA 3WARA 4O7ZA 4AFEA 2BRNA 5TOZA 2C68A 3QRIA 5LVLA 3IOPA 3O7LB 3OFMA 2H34A 2X7GA 2FSOX 2OH4A 2QG5A 4USDA 2CLXA 4KIKB 2DUVA 4M69B 2ITNA 4BVUA 3BLHA 2DQ7X 2UW0A 2XK6A 3LQ5A 3HX4A 4PDPA 3QUPA 4PTGA 4ANBA 4XNEA 4ZJJA 4QRCA 3ZRLA 5J95A 2ERKA 4O7RA 4FUXA 5F1ZA 4ITJA 3FY2A 4H58A 5AWMA 3PY1A 4B8LA 5EM5A 3VS3A 3PUFC 1KWPA 3C4CA 1CKIA 3Q9XA 2R3PA 3SW7A 3HNGA 3RAHA 1OITA 4GUBA 3WZDA 2CKQA 4FTKA 3TV7A 2PVYA 3EQGA 1R0PA 3OMVA 3I4BA 4NWMA 4ZOGA 2B52A 4IFCA 3OTUA 3DLSA 3KCFA 4NZWB 4ITHA 4B0GA 4E6CA 4EZ5A 4IZYA 3QUDA 2PVHA 4FK6A 3O51A 4S34A 5LWMA 1SMHA 2YWVA 2A0CX 4IWDA 3IK3A 4M15A 4PMSA 4RJ3A 1WCCA 3DAJA 1FINA 5FUTA 4X2FA 2W1GA 4DBXA 3W2RA 2PVRA 4BKZA 3W0NA 3FI4A 4TNDA 5DR9A 3WZEA 1B39A 3K54A 5AX3A 4CD0A 4FTCA 2HWOA 4CG9A 4IX3A 1AGWA 4FSZA 3VHKA 2BRHA 4AG8A 1OGUA 1ZXEA 3AT2A 1FGIA 3AC1A 3ZUVA 4CFMA 4YHTA 4CTCA 4BCQA 3JS2A 3OWKA 1AQ1A 4FG9A 4IDVA 3SXFA 3DA6A 3G0EA 3H10A 1YDSE 3WI6A 4NJDA 2BTRA 5I9YA 2WKMA 5F95A 4CLIA 1BL7A 2BCJA 2VTLA 3DNEA 3MH1A 5A14A 3TZ7A 2CGXA 3HECA 1XMLA 2PVJA 4EHZA 4O7WA 4CKIA 4Z7GA 2X2MA 4CLJA 4I6BA 1PXIA 3O96A 3PUPA 3PA3A 5CENA 5KE0A 3SKCA 1B38A 3TNIA 4BZNA 4ACGA 3HUBA 3NX8A 3RM6A 4DH3A 1G8SA 5I4NA 5HG7A 4D9TA 1OL5A 4GH2A 5FP5A 4C4IA 4IAFA 3UIXA 2GQSA 4PPAA 1PKDA 4ANQA 2HZ4A 3OOGA 1LUFA 3GT8A 5EOBA 4BTFA 4EH9A 2ITYA 5BUEA 5IDNA 2JKQA 5IQCA 2UZNA 5EOLA 1XBAA 3ALNA 3D2KA 4GFMA 4U8ZA 5AUYA 2RG5A 4GFOA 3NR9A 2FVDA 3HV3A 4F99A 4EWQA 5IA0A 4XG6A 1GOLA 5CAPA 4W4VA 2CMWA 3F88A 1IR3A 4BTKA 4YZBA 4BBMA 4L53A 5HO8A 2B9IA 4P4CA 2W7XA 1PRYA 4WG4A 5KMOA 2ZM3A 1DI9A 4GV1A 3DTCA 3QQUA 4RFZA 4O0XA 5K0KA 3V5PA 1NVRA 3PA5A 4ZLYA 5IU2A 2Q83A 4Y73A 4BIDA 4EKKA 3D0EA 1GIJA 2A4LA 4BDAA 2IW9A 5JGDA 3QA8A 4D0XA 1Q8UA 3SRVA 3TNHA 4RX8A 3ZH8A 3C4ZA 4IWPA 4IDTA 4EOLA 3ZSGA 4BCKA 1YDRE 3KVXA 1FMKA 3OW3A 5E91A 3EN6A 4EONA 1VYWA 4JRVA 3OXTA 2C6DA 4O96A 5I0BA 3JVSA 3QX4A 4YTCA 5IEXA 2EWAA 2YCFA 4TL0A 3TDWA 3F7ZA 4LOPA 2VWZA 3MVJA 1OBGA 1SM2A 4FGBA 3HA6A 4D2WA 3EB0A 4NCTC 1XBCA 2X39A 3DNDA 4GK4A 3QQKA 5IQGA 1PXJA 1ZYDA 4KD1A 2ZDUA 4TW9A 4MD9E 3ERKA 1SNUA 4F6WA 1OL2A 3E88A 2IG7A 5CAOA 2J4ZA 1W0XC 2VWYA 5IUIA 5BNJA 2ITVA 4D4RA 3MI9A 3PRFA 5CT7A 1Q3WA 5J5TA 4XUFA 3W0OA 1UU9A 2ZMDA 1VJYA 2OG8A 2XBJA 3FMLA 4RC4A 4ANLA 3M2WA 4BHNA 4O0VA 4XS2A 4J7BA 3BYUA 3F61A 4TPTA 4USEA 3ZEWA 3H9OA 3OCGA 3REPA 1YHSA 2WQOA 4KRDA 4O0RA 3SD0A 2ZDTA 3A60A 3KVWA 4FZ6A 4KBKA 3GBZA 3UDBA 2LGCA 3UMXA 2ZV2A 5E7RA 5ETCA 3RZFA 4HGTA 3C5UA 1YHVA 4DBNA 3LAUA 3NMUF 5JFXA 4ZS4A 3R9RA 4MXZA 3K5VA 3OY1A 5TT7A 4BIBA 4YJNA 2J0IA 4ZZNA 4QMOA 2YIXA 4AW5A 2DWBA 2YLFA 3QA0A 2X2KA 2QVSE 5HE2A 5KZ0A 3UGCA 4DEDA 4EOKA 4LI5A 3ZFMA 2YAKA 4QNAA 4PY1A 5HTIA 3NUNA 2NPQA 3AC8A 4UWBA 3HV6A 3TWJA 4A4LA 4PPCA 3DAEA 1CMKE 3FMNA 3MWUA 3P4KA 1NT2A 4NH1A 3HP5A 4A06A 5DI1A 5BYYA 4O81A 1OI9A 3W2SA 4JBPA 2IPXA 3ACKA 2V7OA 4N6YA 1E1XA 3CD3A 3LLTA 4L52A 1A48A 1OPLA 5GIPE 4N0SA 2VX3A 2YM6A 2BRGA 4K6ZA 5C01A 5TKDA 4ZAUA 3BU5A 1A06A 5IUGA 4IAIA 3AQVA 4WUAA 3LFNA 3LFFA 2J9MA 4BJJA 4ANOA 3UO4A 1H26A 2WOTA 2BRBA 2X9EA 4QPAA 3VF9A 4OTRA 2J51A 1TQMA 2IZUA 4EOIA 2R3GA 5LJJA 2HW6A 4RA5A 4AZTA 4FK3A 4IAAA 2X1NA 4AN9A 3D7ZA 3TZ8A 5IPJA 1NY3A 4O1OA 4QT1A 1CTPE 3AT3A 3K5UA 4B4LA 3GCQA 3C0GA 1VYZA 2B9JA 2UW4A 4O21A 4CFFA 3GVUA 3HYHA 2PU8A 3D83A 4ZXTA 1OUKA 3BHHA 3QCYA 3MA6A 3RTPA 3FXWA 3NNXA 3EL7A 4QDVA 2R3RA 5HBJA 4QMNA 3E7VA 1XH4A 2C6TA 2PZRA 3RPOA 2F4JA 3C4XA 3R7UA 4QMYA 4F78A 5A6OA 3ZSHA 4UZHA 3W0PA 4FZAB 3W8LA 4X3FA 3D5XA 4YURA 5BQ0A 5LMKC 2C6MA 4PTCA 3E8EA 4X0MA 3R01A 3AOXA 2VWUA 3Q96A 3TNQB 2BDFA 1OGYA 4AFJA 3RWPA 3PTGA 1PY5A 3I5NA 5EYKA 4CFVA 3FMEA 4R1YA 3U87A 4MYGA 1M2RA 3PSBA 2QU5A 3ZZWA 2KULA 4I92A 4EQMA 5E4HA 4Y5HA 2JKMA 3L8SA 5KZIA 2GDOA 4K8AA 2VTHA 4EEVA 4QTAA 4JVGA 1GNGA 3ZRKA 4K77A 5D7VA 4F7LA 2CNQA 4EHEA 1M2PA 1OIUA 4TYHB 5IISA 3F2AA 4YJTA 3NUXA 2OWBA 2OFVA 3RCJA 5EW9A 5L2IA 3KB7A 1BMKA 1RJBA 4GU9A 2ITQA 4IZ5A 3R2BA 3G6HA 1Y6BA 2P0CA 1WFCA 3PPZA 3QKKA 3KXGA 4YPSA 3ZONA 4G6LA 5BUIA 5BYLA 4RZWA 3ZDIA 3TTJA 3LXLA 4D0WA 2VO6A 3OEFX 4MF0A 4YJRA 2QLQA 3SGCA 4ZSLA 1YDTE 4HZRA 4M0YA 5KHXA 3QXPA 4X3FC 4OTWA 3SLSA 4F7JA 4QPSA 3FY0A 4KS8A 4UX9A 2CGWA 5CS6A 2YM7A 3MBLA 5AADA 2BZKB 4MX9A 4OAUC 1W8CA 2C3LA 2PVMA 3RPYA 4FVRA 4IADA 4CMOA 2EUFB 2VWWA 1ZAOA 2UW9A 2WPAA 4Q2AA 3RVGA 3EH9A 4EYMA 2GNJA 3ORIA 5EI2A 4MHAA 4FSQA 3ULZA 1NVSA 4YBJA 1GY3A 4G6OA 3OW4A 4ZTLA 3V04A 3UZRA 5AR5A 4I5HA 3UVPA 3FZRA 4O4CA 1JPAA 4XV3A 4FOCA 4RIYB 3RZBA 3EL8A 4E5BA 3VBQA 1WAKA 2W1EA 4O83A 1ZWSA 4ACDA 4DGMA 3ELJA 4UXLA 3AGMA 5M4FA 4WIHA 2ZAZA 2C6LA 3GP0A 5I9XA 4LL0A 2Z02A 3VHEA 3CS9A 4YJQA 3UNKA 1SZMA 2X81A 3IECA 4S32A 4DTKA 3CC6A 5FTQA 4BI2A 5AFVA 4IE9A 2BDJA 2G2FA 4JDKA 4NIFB 4L01A 3NPCA 3OS3A 4FYOA 5IQFA 2V0DA 2G01A 4XG3A 3QLGA 3KEXA 4LGDA 3W0RA 3FL4A 5HBEA 2WMWA 4NL0A 3GFWA 4AZFA 3KULA 5HU9A 5L3AA 1Q24A 1P2AA 3FLNC 3VS5A 3DAKA 3HMIA 1WBTA 4FVPA 4EYJA 3SVVA 2XKEA 3RPVA 2YM8A 4JOAA 4U7ZA 5CEKA 3EN5A 4A9SA 5AUXA 4GKHA 1XH7A 5CNNA 3Q4ZA 3MTFA 3VS7A 4AACA 4WUNA 1IRKA 1Q8ZA 2VRXA 2I0HA 1LEZA 2YM3A 3PVGA 3RWQA 5FG8A 4Z3VA 4GG5A 1OZ1A 3PY0A 3ZC6A 2CKOA 1U54A 4JNWA 2I0EA 4OLIA 3U9CA 2VWVA 4O7LA 2HENA 4IVAA 2P55A 1PF8A 3LCDA 3S1HA 3U4UA 3CSVA 4IIRA 4ZK5A 1WMKA 1KE8A 3IONA 3VQUA 1UNLA 3FLQA 2E9NA 1JKSA 3O0GA 4MQ2A 3A8XA 2QO7A 3BHVA 2XIZA 4EORA 3DZOA 2WIPA 2OIDA 4V0GA 3GC8A 3MFTA 4JI9A 3PZHA 5E8ZA 3QRKA 3TV6A 3VBXA 5AA9A 4QMZA 5J5SA 4PV0A 1WZYA 2ACXA 4S31A 2C69A 3W18A 4QDEA 1ATPE 2ITOA 3ZUTA 5CEOA 3TYKA 2WMQA 4YNEA 4HVSA 5JFWA 5JZNA 5GHVA 4BBEA 5IEYA 5HG5A 2PUIA 1XKKA 3PJ2A 4NTTA 4F9WA 1GZKA 5BMMA 4XMOA 1H25A 3L1SA 5I9UA 2Y4PA 4MXCA 4PDSA 3VUTA 3P79A 4EUUA 2OSCA 4OR5A 1YOLA 2IVVA 4BDKA 4CQEA 2A98A 3UP7A 4MWIA 4EUTA 4W9XA 2HIWA 5CZHA 2YJSA 3KCKA 1NXKA 4PL5A 4BGHA 3BHYA 2UUEA 1BKXA 3K3JA 3NYVA 1FVTA 3EOCA 4NW5A 2R3HA 5DH3A 4JRNA 4II5A 5HE3A 4QPMA 2JIIA 3QALE 4YZDA 3GU6A 2V55A 5AP5A 4E7WA 4U45A 4F9CA 3RBWA 2XB7A 3LJ2A 3P08A 4FR4A 5E8WA 4XG7A 1SYKA 3AC4A 5DR6A 4Y85A 2WU7A 4FTMA 2OIBA 3SOCA 1W7HA 3JPVA 2ZOQA 4Z55A 5I9WA 4DHJA 4GW8A 3KKVA 2SRCA 4BDEA 4FNWA 3RAWA 4AU8A 2RFDA 4RIXA 4CEGA 4U97A 4H05A 2WTWA 2WQEA 4KINA 4O2PA 2BUJA 3KN5A 2ZFYA 5A4TA 4DEEA 1F3MC 3CY2A 4FTQA 4O4DA 5BV3A 3R7EA 3LQ3A 3R71A