2A19B

Pkr kinase domain- eif2alpha- amp-pnp complex.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
273
structure length
263
Chain Sequence
AHTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLINRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein synthesis/transferase
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 82
structure length 263
sequence length 273
chains with identical sequence C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2a19B02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2a19B01
4I24A 4EK3A 4E4XA 4FTKA 2R4BA 4A7CA 4LL0A 4ZY6A 4XG9A 1ZYSA 5IUGA 2X9FA 4OTRA 5ITAA 4UBAA 4K2RA 4I41A 3P23A 4UMTA 4ZZOA 4WNOA 4G3CA 3U9NA 2GNLA 4L3LA 4GH2A 1CMKE 3BGPA 1Y57A 2RGPA 3NX8A 3A7IA 2XS0A 3PWYA 4IIRA 1KE7A 3UP2A 3L1SA 2QOOA 5CT7A 5EI6A 5EHOA 4X21A 4C33A 4R78A 5HTIA 2ZMDA 4O84A 3NNXA 2RFSA 4JR7A 5IISA 5GJDA 1FGIA 5BUEA 3KXGA 2ITYA 3FY2A 4NZWB 1PXNA 3RAHA 4IVCA 2BKZA 4KABA 4M67A 2EB2A 4I6HA 4A07A 2RFEA 4LMNA 4FV7A 1SYKA 3SHEA 3VHEA 4BY9E 1M2QA 4YNEA 4CRSA 2PE2A 3HRBA 2OLCA 2X8DA 4BDDA 4R77A 1NXKA 3CQWA 5AR7A 5HNGA 5CEPA 3QFVA 5L2SA 5KMIA 2XVDA 2XNEA 3CS9A 2XA4A 4BCOA 3UNKA 3NDMA 3R28A 4IMYA 4LGDA 4BDGA 4KSPA 3F2RA 2PZPA 3LVPA 3Q32A 5CI6A 5B0XA 2CLQA 5CF5A 3IW4A 3S2PA 4C7TA 3GOPA 3VRYA 1ND4A 4UV0A 1OZ1A 5JK3A 4ZSJA 5KO1A 3F3ZA 5T3QA 4KD1A 5AP0A 5TF9A 2PPQA 4XV2A 4F0GA 4LV5A 4GG7A 5KE0A 4AE6A 1YWVA 1OIUA 4ITJA 3KMMA 3EZRA 2BFXA 4FZ7A 5D9HA 1KE9A 3ZFXA 2FA2A 5D1JA 4AFJA 3QL8A 4NM0A 4MKCA 4AP7A 5BX0A 4D0XA 3DJ7A 5M08A 3FBVA 2YDKA 3QZFA 4QMPA 4ASEA 3LXLA 4ZMFA 3UG1A 4FR4A 1H25A 2J4ZA 2NPQA 3NUUA 3KK8A 4GG5A 1OUKA 4TTHB 5FM2A 3RWPA 4IH8A 3TL8A 4AZTA 4EQUA 3EN7A 3GBZA 2QU5A 5CF8A 3QQHA 1GIJA 1WBTA 3MH0A 3OF0A 4GVAA 4EKLA 5I3OA 5CS6A 3NNVA 2G9XA 2P2IA 4C36A 4AE9A 1TKIA 3RGFA 1ZY4A 3H30A 4S30A 4RJ3A 4KIPA 4TYHB 2XKFA 4FF8A 3WZDA 4DFZE 4KB8A 1WAKA 3ZHPC 3C51A 4D1ZA 2LGCA 4FA2A 3IW6A 4FKQA 4DEDA 5IH4A 4C02A 3WARA 4W9WA 3TZ7A 2YCFA 2WD1A 4J8MA 1VJYA 4CKRA 5JEBA 3LFFA 2VTIA 2HZNA 3GNIB 1PMUA 3HDMA 3KFAA 3MVJA 3OXTA 4PTEA 3QTSA 5M07A 1H01A 1MQ4A 3DJ6A 3UQGA 5I9YA 3TTJA 4Y95A 3SG9A 2JKOA 4E1ZA 1UU7A 3EH9A 2P4IA 1WMKA 4IC7A 5DT3A 3S00A 2VTTA 2JD5A 2WXVA 4IAKA 5IPJA 2B52A 3LMIA 3R0TA 3ZO1A 4FV0A 4F0FA 4CCBA 2IZRA 5DNRA 4HJOA 3P7BA 4LUEA 5CT0A 1M2RA 3R73A 2YZLA 3VS0A 2G01A 3OUNB 4X3FB 2A1AB 3BRBA 2FSTX 3DTCA 4IBMA 4BIBA 5IA2A 4FSUA 2P55A 2ITNA 1YW2A 3O51A 3U87A 3D5WA 4UZDA 4KBAA 5DE2A 4ZJJA 2XM8A 1O6LA 2G15A 4E4LA 4DCAA 1Y91A 2GS7A 3EQHA 5DT0A 2JAVA 3D83A 3QRKA 1OPJA 3UOKA 4BGGA 5DBXA 2UVXA 3KXXA 3PJ3A 1OM1A 4IFCA 4QPMA 5ETIA 3FLQA 3GC9A 5AX3A 5J8IA 5LMAA 4ZY5A 3MFSA 5EH0A 2Z7SA 4JIAA 4P5ZA 3B8QA 2I0YA 5AUZA 3Q6WA 4CG9A 2CN8A 3DOGA 4QTAA 2XK8A 4BI0A 5FTGA 4HCVA 1Q61A 4A06A 4O0RA 2WFYA 1H1SA 4FVPA 5IQAA 2BZIB 3RAKA 4WKQA 4TZRA 3QWKA 4F65A 3C9WA 5TKDA 4IFGA 4JL9A 4U43A 4BCGA 5CU4A 2XCHA 3PXQA 4C2VA 1FINA 3PXZA 5E8UA 2JDTA 2JKQA 2GNGA 3R83A 4C59A 3JVSA 4QOXA 2WMXA 4HOKA 5FD2A 2W7XA 3NAXA 2W4JA 3Q2JA 2UW7A 4MYGA 1OMWA 2GSFA 2RG5A 4FV8A 4RX9A 3RMFA 3LCDA 4HNFA 2BUJA 4Y83A 4EHGA 4PX6A 3F6XA 4OTIA 4RRVA 4EH6A 5KZIA 4ASDA 4BDKA 4IVDA 1NVRA 3DV3A 4BKYA 5C8KA 4U40A 4E5WA 2QKWB 2VZ6A 2P3GX 1Q3DA 4IJPA 1OPKA 4XV1A 4D1SA 3FKNA 5HBJA 4RIOA 1OB3A 1SMHA 4TWCA 5DN3A 3SDJA 4JAIA 2UW8A 2J50A 4FI1A 4FYOA 3QTIA 1YXXA 2V5QA 3AC5A 3PG1A 4FVQA 4QQCA 4YC6A 5HKMA 3UBDA 3R04A 3UYTA 3ZS5A 4I6BA 5E92A 1PY5A 4HYIA 2DWBA 3EL8A 3LFSA 3ZSHA 3SVVA 4D5HA 2C6LA 3IONA 4GEOA 4DBNA 3LM5A 5FG8A 4IDTA 3FWQA 3W8LA 2GNHA 1OKWA 3LCSA 2W1IA 3PSDA 3FXZA 5LOHA 1B6CB 3HMOA 5JMSA 4ZLYA 2C0OA 1E9HA 5CSPA 2XEYA 4RLLA 3A8WA 4EH4A 4NM7A 3F3VA 2GTMA 2DYLA 3DBEA 3UIMA 5HOAA 3UIXA 1XBAA 1IAHA 2CKQA 4YJPA 3OTVA 3FSKA 3R8VA 5TOZA 2Q0BA 3IQ7A 3NNUA 3PLSA 4D1XA 3Q60A 4NK9A 4K11A 5LVNA 3K5VA 5JFWA 4XBUA 3L8SA 3KA0A 4NT4A 1UV5A 3U6JA 2DS1A 2YM7A 3DY7A 1U5QA 4DFYA 4UMRA 3C4EA 3JUHA 2QC6A 4W4YA 3KCKA 4YUQA 3ZSGA 4I21A 2R3JA 5IEYA 3PXRA 4RC2A 4JXFA 4CTBA 5G1XA 2C5OA 4QMYA 4F9WA 2B9JA 4NUSA 3SXRA 2A4LA 3Q9WA 4YU2A 1YI4A 4WSQA 5J9ZA 3GENA 3HL7A 1A06A 5EYKA 4BTFA 4FNYA 3TI1A 1WVXA 5IMXA 3G51A 4FSRA 2G2HA 2WTKB 3ODYX 3CKWA 1ZYCA 4HYSA 4MH7A 3R9DA 4ANQA 4EC8A 2F9GA 4XEYA 2F49A 5KCVA 3U51A 4AU8A 2JIIA 5AUYA 5E7RA 3SOCA 3DLZA 1XH5A 3L9LA 2XMYA 1O9UA 3HAVA 3PRIA 2DQ7X 2EB3A 4YBJA 3QRIA 4TYIA 3UOJA 3OWPA 3D7ZA 4I20A 4FTLA 4JQ8A 5E4HA 5CX9A 2W1HA 4GV1A 3ZO4A 2W9ZB 3MW1A 3MFRA 2BHHA 3WI6A 4DEGA 4NSTA 1H1QA 4ANSA 3H3CA 3NLBA 3Q04A 3PZEA 1FGKA 3BYSA 3DT1A 2I0HA 3AD6A 3OOMA 2BKKA 3P86A 3ZRLA 5AR5A 3P7CA 5IQHA 5LVOA 1Y8GA 2BZJA 5HGIA 4G31A 4AA0A 3G9NA 4DN5A 3BZ3A 2UVZA 4GFOA 4IDVA 4MBJA 4JI9A 3NYVA 2ZYBA 4BCPA 5E91A 5DMZA 5LWMA 3N9XA 2XP2A 1YWNA 3NW5A 5HG9A 4ITIA 3PPJA 5FBNC 3RNYA 2X7GA 4PMMA 3WF9A 4MD9E 4QO9A 5I5ZA 2PHKA 4IM2A 4XG8A 2QR8A 4NW6A 3FHIA 1XJDA 3ENHA 4C34A 4KBCA 2ETRA 4FSYA 3C13A 4UMQA 4TRLA 1YXVA 4RT7A 3SW7A 4ZK5A 5CAUA 3OEFX 3EN5A 4PDOA 3BX5A 3KMWA 3KXNA 3K3JA 1KOAA 1Q99A 2IVVA 4YLLA 5TR6A 4IZ7A 3UG2A 4LRJA 2XZSA 5AUWA 2R64A 1QPEA 4HZSA 5AJQA 4GU6A 3BGQA 1U54A 2ETMA 1ZOEA 5L6WL 3JXWA 4RIYA 4BIDA 3FMNA 3ET7A 4U0IA 4FEWA 2WEVA 2VWWA 4L52A 2W17A 3V01A 5J5TA 3UDBA 5EW3A 4C37A 1IRKA 5FUTA 4IWQA 3LPBA 4TWNA 5CF4A 1R39A 5EOLA 3PTGA 4L00A 4OLIA 4GK4A 4CFVA 5K5XA 4G17A 2WMUA 2X7FA 4PRJA 2PL0A 5B7VA 3NEWA 1WBVA 3PA4A 3VUHA 1VZOA 4PTCA 2W1GA 2I0VA 2QODA 4OBPA 4QTDA 3PA5A 3R1SA 4FKPA 3ZFYA 3KKVA 1V0BA 5EM8A 4UWBA 2YCQA 3MJ2A 4ID7A 4JX7A 3GGFA 2OK1A 3VIDA 2J90A 2YA9A 3ORXA 3D2KA 3PP0A 2OFUA 5CWZA 2X9EA 3ZXTA 4O38A 1WVWA 4DEIA 2UW6A 4DGOA 5HNIX 1WCCA 3MGYA 2CJMA 4U3YA 4EZ7A 4DC2A 4EK6A 4JAJA 3FYKX 3QTWA 4HZRA 2Y6OA 5CNOA 5AR3A 2WU6A 3VO3A 4M3QA 3RAIA 3DGKA 5E8SA 4FTAA 3KRXA 2C3LA 4JR3A 1Q5KA 4CYIA 4YHJA 3BV3A 3FZOA 1WVYA 1U4DA 4IX4A 4QP2A 1PXKA 1S9IA 3CPBA 2HIWA 2PMNX 3R8ZA 5AV2A 2ITQA 4FG7A 2WKMA 4RIXB 3FZ1A 3LJ1A 4G3DA 3ZZWA 4CTCA 1H1WA 2ITVA 1CTPE 3G2FA 1DI8A 2ZJWA 3TV6A 3OBGA 2JGZA 1F5QA 3S1HA 4RC4A 3UO5A 4EH8A 5IMEA 4DFXE 3ZONA 3TUBA 4Y5QA 4FSMA 3EKKA 2GNIA 5CQUA 2OI4X 1VYZA 5D10A 4MNFA 5ACBC 2FO0A 4DFLA 5C26A 4RX7A 4Y8DA 1KV2A 3AC2A 3O23A 5AAGA 2CNQA 4D9TA 3F61A 1BYGA 3R1QA 1OKVA 2VTHA 3NYXA 4FTQA 4AZWA 4PMPA 2C30A 4YJUA 3VF8A 3DK3A 3KRLA 1M17A 3P78A 3SC1A 4X3JA 4QMWA 3BLRA 4BI1A 1M14A 1K9AA 2WTWA 2GPHA 4YJSA 2GMXA 3CGOA 3HMNA 4D4YA 5EYMA 3DKGA 4BIEA 4EEVA 2C5NA 3T9IA 3C4CA 5M4FA 2J6MA 4XV9A 4R7IA 2OW3A 4WG5A 1H0VA 5AV1A 4MXXA 1ZOGA 4FODA 4QMZA 4BCMA 4Q5EA 4IZ5A 5CU2A 3ATTA 5AFVA 3MY1A 3HMIA 2YAKA 2AC3A 4U97A 2QG7A 3NUAA 4FEXA 3R9NA 5CU0A 2ITUA 5GJFA 3VUTA 1PRYA 3QKLA 4H58A 2W5AA 2I7QA 2X6EA 4F7JA 4HVGA 4I22A 4HYUA 3W10A 4YZBA 4U81A 5LCKA 2YAAA 4CD0A 3E62A 1LEZA 4NYEA 1BUHA 5ANDA 3DU8A 3NUPA 4HPUE 3LZBA 5IQFA 1Q8YA 4K33A 5FEEA 4OBQA 2WIHA 2WMTA 1GZNA 3OS3A 4YLJA 2GFSA 2WPAA 3QHRA 1L8TA 5IG1A 3FPMA 5M44A 2PVKA 4IADA 4G3FA 4JBQA 5KZ0A 3FLWA 4X3FA 4ZXTA 4ZTSA 4CNHA 5KMOA 1OBGA 4DGGA 4RVKA 3EOCA 3IGGA 1TVOA 1YRPA 3DBFA 4XRLA 3D4QA 3R7UA 4DT8A 4LL5A 3VJNA 2O3PA 2X1NA 3ZOSA 4GK2A 3O96A 3IG7A 4QD6A 3QU0A 4RJ7A 4I0SA 3QC9A 4YGAA 5D7AA 5FTQA 2NRYA 3KEXA 2JDSA 5BMSA 5I9XA 4KS8A 3IW8A 4HNIA 3I6WA 4IAZA 2R3PA 4GYIA 5AR4A 4NIFB 3WF6A 1PXLA 4NU1A 4EHVA 5TT7A 4YTIA 2VNYA 4BN1A 3CD3A 3GI3A 2QR7A 4Z7GA 3HNGA 4ZSLA 3PE2A 5CZHA 3BEGA 2YLFA 5C8MA 5FGKA 5BVWA 3ACJA 1Q8WA 3V3VA 1T45A 4F0IA 1MUOA 4E5AX 1AQ1A 4FKWA 5AA9A 5CQWA 3QD2B 4RBLA 5DRBA 2PULA 4RJ8A 1YQJA 4M15A 3IW7A 4QP4A 4DG2E 3A4PA 5AM6A 3O8UA 2HWPA 1Z5MA 3RM6A 4F6UA 3M11A 3QZGA 4PL5A 4O7NA 3NS9A 5KBRA 4CQEA 3PJ2A 5IEVA 4MF1A 2UZLA 3ORKA 3MDYA 4ZOGA 2V7AA 3WF5A 2C1BA 2WIPA 5AM7A 4AACA 4M69A 3GU4A 4QYGA 3HLLA 4AZFA 3BYMA 5DVRA 4MXYA 4QMSA 4IANA 2V22A 2RG6A 1F0QA 2IW9A 3CQUA 5F20A 1FVTA 4FT5A 3OFMA 3U4UA 4JNWA 3FHRA 4YNOA 2ERKA 2PE0A 5EI8A 2HK5A 3BE2A 3SQQA 3MIYA 5BMMA 4KIOA 5A3XA 5HX6A 1YI3A 2VTOA 4OTPA 4U41A 4WG4A 5AP7A 3ZC6A 3HP5A 3Q9ZA 4H3BA 4M68A 3OY1A 3L9PA 4P5QA 4OAUC 2PU8A 2ZM3A 2FYSA 4XHKB 4QYEA 4G9CA 2CPKE 2R0UA 4MD7E 2FH9A 3HX4A 4XP0A 5HU3A 4FSZA 2VWZA 3PYYA 5AP5A 5HO7A 5HVYA 4CV9A 5AR8A 5HESA 5CI7A 5A6NA 4C58A 2CN5A 3WYYA 4C62A 5FEQA 4QQ5A 3SA0A 2J0LA 3HUBA 3E5AA 2HCKA 4KIKA 4LUDA 4MXOA 4UXQA 5IQDA 1Y8YA 1H26A 2CLXA 2PUIA 1W98A 1J1BA 2UVYA 3NUNA 4CMUA 3QX2A 4QNYA 3ROYA 4FV5A 2XYUA 4JBPA 2C1AA 5EYDA 4HVDA 3SKCA 4ACHA 2W1EA 4G3GA 1H24A 4LFIA 1L3RE 4RSSA 4EH2A 3G6HA 5DHJA 1DAWA 3FZRA 2CMWA 4PTGA 3LMHA 4L46A 3NW7A 4F9YA 4O0SA 3VJOA 3UO6A 3BQRA 2JFMA 1XBBA 3KN5A 4FIHA 3TDVA 1I44A 2QOCA 4DF3A 5CTPA 3NIEA 2REIA 1SVGA 3PJ8A 3VRZA 4I94A 3BBTB 3LCOA 3D5VA 3MBLA 5IKWA 3RTPA 1QPDA 3A7JA 4FL1A 1JOWB 5FQDC 4ZSEA 3BHHA 3NW6A 3S4QA 5M53A 4F64A 1HOWA 2I0EA 2ZB0A 3OCTA 2KULA 3DNEA 2WEIA 2G1TA 3GCUA 4KRCA 4B8MA 5HD7A 1GY3A 5HIEA 2WOUA 3DAEA 4FKGA 3C0GA 2GDOA 2PVMA 3DDQA 2XIXA 1YDSE 1ERKA 2YEXA 3C4ZA 2ZDTA 5FRIA 4D2TA 5CEIA 3FLZA 3R2BA 5AEPA 2VTJA 3DFCB 1BKXA 4FEQA 4FK6A 3KRJA 4IX3A 4YZMA 3UJGA 4A9UA 4IAYA 3KGAA 3UPZA 1YXTA 2W9FB 3PVBA 3HDNA 4FIEA 2H6DA 4FT3A 1TQIA 2WGJA 2ZAZA 5CY3A 1H1PA 4FICA 3V5JA 3KF7A 3A2CA 3FLNC 4ZTQA 4DLJA 5J79A 4ZTLA 2FUMA 3RPVA 4DG0E 4PQNA 2R3GA 4BYIA 1JKKA 4E4NA 3PVWA 2QKRA 3PZHA 3BHUA 3SG8A 1V0PA 5KMLA 3E64A 3A8XA 2XNBA 3COKA 4IM3A 3BGZA 4IHPA 2C0IA 1XH8A 3M2WA 5GNKA 4ZIMA 3RP9A 3L8VA 3SRVB 4DFNA 2VWYA 4Y72A 3RALA 5ETCA 4I1ZA 3K54A 4JG7A 3BHVA 4GCJA 3F9NA 1FMOE 4X2JA 4GW8A 3ALNA 4IQ6A 4AOTA 4BWXA 4YPSA 5M4CA 2VWXA 4L53A 2QO2A 3R00A 5J7HA 4O2ZA 3F82A 3QTQA 4PP9A 3MPMA 3O7LB 3TEIA 4EI4A 5IQCA 4O7LA 4D28A 4LRKA 4ANOA 4Y5HA 1Q62A 1UU8A 3HP2A 2CSNA 3C7QA 2H8HA 3OMVA 3QA8A 3V04A 4BGQA 1P4OA 5B2MA 5CF6A 4EJNA 4B8LA 3MPAA 4AGDA 4RLKA 4W4XA 1R0EA 1YOLA 1A48A 1J91A 4ONAA 4QP8A 3PIZA 2JKMA 3GQLA 4L01A 4FKOA 3OEZA 4HGSA 3MFUA 3K5UA 5C03A 1M52A 1XO2B 3NIZA 4KSQA 5CVHA 4DGMA 3GT8A 4KAOA 3V5WA 4DBXA 3UVQA 3VF9A 3NWWA 3N4TA 4I5CA 3IOPA 5AP3A 5C8NA 1LP4A 4F4PA 3IS5A 2W1ZA 3MIAA 4JQEA 4NJ3A 4B9DA 2OXXA 3KQ7A 1H1RA 4H36A 1BL6A 2VUWA 3FI4A 4CFUA 5IA1A 2YCSA 4A9RA 4FKTA 2F7EE 3CY3A 2CNVA 3ZM9A 4JVGA 4ERWA 3R7VA 3FV8A 3A7GA 1JAMA 3BHYA 5KKRC 5C1QB 2C6IA 2UZDA 3BLHA 4BCHA 3FSFA 3E93A 4PNKA 4MNEB 2RKUA 1H28A 1ZZ2A 3F5XA 1S9JA 4LOQA 5M4IA 4FKIA 4IAIA 3ZUTA 2BCJA 4ALVA 1IASA 4L3PA 3RINA 5G6VA 2B9HA 2PZ5A 5HIDA 4JBVA 4U3ZA 1ZRZA 4DITA 5DR6A 3V8WA 3BKBA 2YJRA 4YMJA 5JFXA 3Q4ZA 2GNJA 2YIRA 2ITWA 4RWIA 2VO6A 3ORZA 1O6KA 4OT5A 4QMMA 3PIXA 4AT4A 2I40A 4C4JA 3GB2A 3KVWA 2PVYA 3DTWA 5CU3A 3TKHA 4XBRA 3UVRA 5CEOA 2WOTA 3FXWA 2BFYA 1KSWA 3CTJA 3QX4A 2V62A 4I6QA 4OTWA 4BWPA 4PPCA 5J9YA 1WBSA 2UZTA 4AN2A 1R78A 4EK5A 5JGDA 3BCEA 2CKPA 4O7VA 1LUFA 2ZV9A 3PPKA 1KWPA 1G3NA 3Q4UA 4LOOA 3UGCA 3FMLA 3FMDA 3IGOA 4FUXA 4KS7A 3F7WA 2OU7A 4WNPA 4FTNA 3VS3A 3EB0A 3ZXZA 3AG9A 2CDZA 3DNDA 4L67A 3F5PA 4AFEA 4EOMA 3QQJA 1TQMA 4MK0A 3W8QA 3FKOA 3ZFMA 5A4EA 4PF4A 4WA9A 4NL0A 5D11A 2HXLA 2XKEA 5F94A 3OT8A 4MXZA 3VWAA 3VQUA 4AGCA 5K9IA 2PUNA 4FNZA 4F1OA 2E9VA 4CKJA 3BYUA 3W2QA 4LGGA 5E8XA 5GJGA 3CP9A 1ZAOA 3GCQA 4FIIA 4A9YA 5F1ZA 3QC4A 4KKEA 3VUKA 2R3FA 5CVGA 5J1VA 4MAOA 3GC8A 4RC3A 4ZLZA 5AWMA 2C69A 5JFSA 4G3EA 3D2IA 5CU6A 5ANIA 3TCPA 3EYHA 4IZAA 4FKSA 4QRCA 5DOSA 4IVAA 1OVEA 4R5SA 3HRCA 2OKRA 4WHZA 4RPVA 2J0IA 3MA3A 3AD5A 5C27A 5HZNA 3Q52A 3QTUA 4YZDA 4N70A 5EDRA 3UC3A 4G16A 3VS6A 4D9UA 3BBWA 4O7TA 1CKPA 1OL6A 2C5XA 3TV4A 5JGAA 5LWNA 4AGWA 2NRUA 4R1VA 5JQ8A 2O64A 3R63A 4FC0A 4JQ7A 1AGWA 4XX9A 4YJNA 4TY1A 5EHYA 5HO8A 2IVUA 2J7TA 3D5UA 3A61A 1HCLA 4AS0A 3V6SA 5EYCA 3QTXA 4EBWA 5BYYA 4EZ5A 3TZ9A 5IEXA 3I60A 5HNBA 4QMXA 2UV2A 4W4WA 5KBQA 3QKMA 4JDKA 4O81A 1CDKA 2C4GA 1ZYDA 4NIFA 4TPTA 4K0YA 3THBA 4MTAA 5L2WA 3WYXA 4KUJA 4GJ3A 5ANEA 2V7OA 2BAJA 4II5A 3DKCA 3E87A 4AW1A 3R21A 4FBXA 5EKOA 3BE9A 2R5TA 2WAJA 4JDJA 4OR5A 4DEAA 2BTSA 4BF2A 2QOHA 4OTGA 4JS8A 5CEKA 1CM8A 3HZTA 2W1FA 2PVFA 3ZYAA 1H07A 4AZEA 3POZA 3RPOA 3UTOA 4K18A 3ZO3A 4JX3A 4F9AA 2BROA 2W05A 4E20A 2E2BA 4ZJIA 4XCUA 4YO4A 2UZOA 1ZZLA 3KXZA 1MQBA 4IE9A 3F69A 5ICPA 2HZ4A 3FE3A 1PXIA 4ITHA 4RIWB 3OTUA 4ZTRA 3GEQA 3LFCA 3R7GA 1NY3A 2JLDA 3BYOA 4TW9A 5IUIA 3EQCA 2HENA 3MTFA 4TYGA 4EL9A 3RPRA 3DQWA 4JRNA 4UYNA 3W1FA 2O5KA 3TNQB 3K3IA 3B2WA 4EUTA 1P4FA 2Z60A 2YM3A 4M0YA 3R7IA 3F5GA 3TKUA 1FBNA 1UWHA 3NCZA 4CFXA 4ZZNA 3GP0A 3ENMA 3MVLA 3QQFA 3IECA 1XQZA 4O0WA 4WNMA 2R3HA 4NKAA 5B2KA 3TKIA 4BBMA 5CAVA 4R3PA 4GIIA 3PY1A 5HCXA 2KTYA 3FMKA 4NH1A 4O1OA 2OH0E 5EG3A 5E90A 2C5YA 3PVGA 4UX9A 4WO5A 3PY3A 3UODA 5LXMA 1APME 2P33A 3QUDA 3HKOA 3MV5A 1XKKA 3HV7A 3NVMB 3UOHA 1WZYA 2JAMA 2VV9A 1YXUA 3AOXA 5FM3A 4HGLA 4C8BA 5I9ZA 1ZY5A 3FYJX 2W96B 2J51A 4G6OA 3VUDA 4U5JA 4O0YA 1NVSA 3RPSA 2FSOX 4G5PA 3TNWA 5A46A 4UY9A 3O71A 4BTJA 4NFMA 4IJ9A 1JKLA 3AMAA 2G2IA 3FAAA 4ZS0A 5M57A 3PIYA 4G2FA 4Y85A 2BRBA 3VW8A 2YWPA 2IVTA 5DH3A 4S34A 4AN3A 2ERZE 4IW0A 1XH7A 2Q0NA 2BIKB 4IX6A 5DYJA 4CMTA 5HHWA 1JVPP 2RFNA 1JLUE 3NCGA 1UKIA 2GNFA 2HOGA 2OZAB 3LM0A 1K2PA 4LGHA 2BDFA 4RFYA 4M7IA 3RJCA 4RX5A 2PSQA 2IJMA 4C2WA 3MI9A 1XHAA 4OUCA 5HBHA 4I93A 4QQJA 2VNWA 2ZV8A 2VGOA 4DH3A 3PXKA 5LMBA 1GAGA 4AQCA 3HEGA 4GT4A 4FV2A 4KRDA 4M84A 3C5IA 3SAYA 3Q6UA 4J99A 2XYNA 3JVRA 4G9RA 3RPYA 3U6IA 4XV3A 1H27A 5J95A 4XG2A 1Y6BA 3MH1A 3BQCA 3QCSA 2GQGA 5E8TA 4C61A 2Z7RA 3FLYA 3QGWA 4FV6A 5E8ZA 3PDTA 2C6EA 2QI8A 4O27B 3W55A 2O2UA 3ZRMA 4YZ9A 4E26A 4K1BA 2ESMA 4RVTA 1MP8A 1OIYA 3R01A 4DTAA 4XG7A 4DFUA 3D7TB 3GC7A 4C4IA 4MHAA 4ZY4A 1ZXEA 3R1NA 3IKAA 2C6DA 2GQSA 2PZYA 4A9SA 1RDQE 1XBCA 2R3LA 2E9PA 4RMZA 4BB4A 3FC1X 4AW0A 4J95A 5T68A 4K8AA 2VTAA 1QPCA 4FV1A 2BRMA 1FPUA 4IB3A 2JIVA 4E8AA 3VUGA 5LVLA 1XH9A 2YCRA 3F2AA 5KHWA 4G34A 4MCVA 4F9CA 1UNGA 4ALUA 1Z57A 3A7FA 5CAQA 4I6FA 5D7VA 4IEBA 3I81A 1YXSA 3Q96A 5AMNA 5JRSA 4D4SA 5E8YA 4CFMA 3G90X 3LXKA 3TUCA 1PXJA 4J1RA 3SRVA 5HCZA 3G6GA 5AIRA 4USDA 3FKLA 3TV7A 3CCNA 5IZFA 2PY3A 2J0KA 3V5TA 3TM0A 3P08A 2J9MA 3C0HA 4HYHA 4LI5A 4AGUA 4MXAA 4NWMA 3E3BX 5CEQA 4GL9A 4IWDA 4UB7A 4YTHA 4BDBA 4QTEA 2BDWA 4WG3A 3ZZEA 3R8MA 2J0JA 2BDJA 3EQBA 3PP1A 5HO6A 3GU8A 3OVVA 1SVEA 2XRWA 4J53A 1UNHA 4ASZA 3MTLA 2YDIA 4X2FA 1W7HA 4I5MA 1W83A 2XJ2A 2NP8A 4NCTA 3RZBA 4DEHA 5KMKA 1YHWA 3RCDA 4CFNA 3ZSIA 4EHZA 4W8DA 4PWNA 4CMOA 3E8EA 4BTMA 2X4FA 4FVRA 3NRMA 4OTHA 3EZVA 1FQ1B 3CPCA 3GQIA 4FKJA 3RNIA 3TG1A 1PJKA 5CNNA 3OCGA 2JEDA 4GK3A 3Q4CA 5E1SA 2Y4IC 1M7NA 3CKXA 5CSWA 2PZIA 3TNPC 3DBDA 5HLWA 4U45A 2VRXA 3ZM4A 2WQBA 4JG6A 4RVLA 5JH6A 3KF4A 5HE0A 3SGCA 3O7LD 2WTJA 5F95A 5TE0A 3EFWA 4F1TA 4QTCA 2W1DA 4O0UA 3RCJA 4BDIA 4EOKA 3FZPA 3MVMA 4O6EA 3LFEA 4AZSA 5HLPA 3WBLA 2VTMA 4MF0A 1LPUA 1Q41A 2YIYA 4ANNA 3T3VA 3DZOA 4DGNA 2PE1A 3CBLA 1J7LA 4GYGA 2E9UA 3C0IA 5GINE 3QLGA 4QPAA 4AT5A 3BELA 4X3FC 4XLIA 3PVUA 4D58A 2XRUA 5EDQA 4YTCA 2OFVA 3SV0A 3NPCA 3Q4TA 4E6QA 3AXWA 4FL3A 2XNGA 3HV5A 5BVEA 1PHKA 3EYGA 1W0XC 2OSCA 3I5ZA 3M1SA 3DZQA 3KXHA 5EK7A 2OXYA 3UOLA 5L8LA 4O7ZA 5EM7A 3W16A 4HCTA 1WBOA 4FG8A 4QP1A 3BIZA 1RE8A 4AOJA 2EXMA 5J87A 4ENXA 5L3AA 3FY0A 3CTHA 3D5XA 1YHSA 3K2LA 3L9MA 3MB6A 4EYJA 5HG7A 4NTSA 3NMUF 2VO0A 3MY5A 3BI6A 2GHMA 4RA5A 4RJ5A 2HAKA 5FDXA 3CIKA 3LMGA 4TYHA 5C9CA 4DHFA 3IW5A 4GMYA 4MXCA 4I0RA 3WE4A 5M06A 2X0GA 3DAJA 1XH6A 3ZUUA 3I0QA 2OF2A 4IB1A 4FGBA 1GOLA 4EOOA 2XBAA 3OXIA 2JFLA 5L8JA 5FP5A 3VS4A 4PL4A 2UZUE 4QP6A 5AV4A 4I4EA 5M4UA 3NVKI 5HU9A 2C3IB 1YHVA 2F57A 3T9TA 2WMVA 4FKVA 2VO3A 1A9UA 1QMZA 4XP3A 2YISA 4ACGA 1Q24A 4ZTMA 4R1YA 4R3CA 2IZTA 3E92A 3COHA 1FMKA 2UW4A 4IAFA 1JSTA 2Y9QA 3TN8A 3U8WA 2W5HA 2XF0A 3FI3A 3OWKA 5EQYA 5FWKK 4GU9A 2RL5A 4DH5A 3VHKA 3NNWA 4BDCA 4H3QA 3IO7A 4UXLA 5EOBA 3UNJA 4ASXA 4EKKA 4J52A 4FE2A 4RX8A 3EL7A 3L9NA 4Z16A 4XOYA 4ANBA 2J5EA 1W82A 2XIZA 3FMJA 3UPXA 4PV0A 2O65A 2G2FA 5FXQA 4XJ0A 4BFMA 1E1XA 4HGEA 2XCKA 5HE2A 1J3HA 2A19B 3EQIA 1DM2A 5A4LA 4L7SA 2GTNA 4M0ZA 5ETFA 2YIXA 2YACA 4RWKA 3ITZA 5J9LA 5IDPA 3ULIA 5BVFA 3N4VA 4BRXA 3I7CA 4DG3E 2X8IA 2XK4A 5GZAA 3HA6A 5CLPA 3G5DA 4LG4A 1OKYA 5CSHA 4FEUA 3LXNA 4FTIA 3DS6A 4LYNA 4RVMA 5CAOA 5HG8A 2YZAA 1VYWA 3NSZA 3H0ZA 4P2KA 2OJFE 2R3RA 4O0XA 2C3KA 5BVOA 2CCHA 4J98A 1OI9A 3REPA 2QQ7A 3M42A 1G5SA 3ID6C 4O83A 1PKDA 2VU3A 2JBOA 4ZP5A 3HYHA 3PY0A 4LRMA 2UZNA 1CSNA 2QHMA 5HE3A 4P7EA 2QO9A 4IWOA 4YC3A 3D94A 2W99B 2OJIA 3GC0A 3L8XA 5ANGA 3LJ2A 4IAAA 3TTIA 2IWIA 1OL7A 4IZYA 5H8BA 3SX9A 3OC1A 3EIDA 3WIGA 4F09A 5IQIA 1UA2A 3WOWA 2YM8A 2ZV2A 4DTKA 5HORA 2CGWA 1YVJA 3AD4A 3DPKA 3QRTA 4YHFA 4UALA 5AP1A 4NM5A 5BVNA 3RK7A 2WTKC 3LCKA 2OZOA 3CTQA 4KINA 2XK3A 4D5KA 5HLNA 5JQ5A 3KREA 2PVJA 4CKIA 4B7TA 4WNKA 2IW6A 2IO6A 3L8PA 3LAUA 5I4NA 4RA4A 3TNHA 3MN3A 2UZBA 4MX9A 2CGVA 3PG3A 3VS5A 5BNJA 3MS9A 2XH5A 2XIKA 3B2TA 2XK7A 4FX3A 4RIWA 4L7FA 5D12A 4TYEA 1G8SA 1DI9A 2NO3A 4Q9ZA 3R7OA 2R3MA 4K6ZA 3KN6A 2I1MA 3LFAA 5HIBA 2AUHA 3R8UA 3R9OA 4BI2A 4O7YA 5IQEA 2R3OA 3CC6A 2R3KA 1JPAA 2EUFB 5CALA 2WO6A 3A99A 3O2MA 4WRGA 1CKJA 1LR4A 2QLUA 3ZEWA 3PRFA 3RVGA 4LM5A 2HXQA 5C4LA 4U7ZA 1QL6A 4V0GB 3DK6A 5ANKA 4E4MA 3UZTA 4CG8A 4DT9A 3WZUA 4DEEA 2QOQA 3QALE 3WZKA 3QZHA 4PUZA 5HVKA 5DIAA 4YP8A 4CVAA 3V5PA 3EQPA 3VQHA 3ZH8A 4NFNA 5AR2A 4UZHA 5C4KA 3ODZX 5BUJA 2QOFA 4RGJA 3FDNA 5JKGA 2QOBA 2F7ZE 1Q97A 3W2CA 2IW8A 4YC8A 5LARA 1K3AA 1GZOA 4FZDB 4FK3A 4KKGA 2JDRA 5E9EA 4G5JA 4KA3A 4C0TA 4CFFA 3KK9A 2O8YA 5HEZA 4MQ1A 4EWQA 3BU5A 1Q8TA 5HBEA 2BAQA 3LE6A 4PPBA 3PSBA 4XYFA 5GHVA 3S3IA 2YN8A 2UW9A 5IA5A 4AZVA 3W2OA 1IA9A 3JYAA 5FP6A 4ZEGA 5B2LA 2P2HA 3R2YA 5FXSA 4X2NA 2WU7A 4ACDA 1JSVA 2XKCA 3OCSA 2A27A 5EDPA 2R7IA 3OG7A 1VR2A 3HMPA 4XOZA 2WTDA 4PNIA 3ZLWA 2YABA 4FTOA 1UVRA 4FT9A 3MH2A 4FT7A 5AAFA 2VTPA 2GU8A 2Z8CA 3HV3A 4D55A 3FEGA 2EU9A 3PE1A 2XNNA 4YBKA 3BHTA 5D41A 4GJ2A 3VW6A 4ALWA 4LQMA 1BLXA 3VS2A 4HVHA 3EMGA 2V55A 4FKUA 3ORPA 3ZBFA 4YTFA 4XRJA 4EK8A 2BILB 2BIYA 5CENA 1VEBA 4FV9A 3EWHA 4QYFA 5BYZA 4PDYA 2VTNA 4BBFA 4D2WA 4YURA 3DA6A 3LIJA 4HCUA 3UE4A 3LOKA 5K5NA 3F5UA 2QOIA 2VTLA 2E9OA 2B53A 2VTQA 3EHAA 2R7BA 2OG8A 3TJDA 4AXAA 3PJCA 4ZLOA 2OICA 2BMCA 4YSJA 1OKZA 2WNTA 3UMXA 2VWUA 2C47A 2HY0A 2PVRA 3QUPA 3NGAA 4CSVA 4Q9SA 4QPSA 4EOSA 2UW0A 3I0OA 4G6LA 4J97A 1OECA 1Q8UA 4RZVA 5K3YA 2W1CA 5E8WA 4FSQA 4QMVA 4FZAB 3R7YA 5LMKA 3FJQE 4CCUA 2J0MB 3FLSA 1MRVA 3GVUA 4GKIA 5AP2A 4U6RA 3H10A 3MB7A 3EQFA 2ZB1A 5DEYA 4TNBA 4YO6A 3BWJA 3GOKA 3CJGA 2XIYA 4E73A 2YWVA 5H8EA 4FZFB 2HYYA 3OW4A 5CXHA 3POOA 5HTCA 3HA8A 4C4FA 5BVDA 1UNLA 4M14A 4DA5A 5I9WA 4MWIA 4RIYB 4NJDA 5L2IA 4F7LA 5IUHA 4FSTA 2CKOA 3P5KA 4Z7HA 3LFNA 2QLQA 4UMUA 2WQEA 2JDOA 3C4FA 3CR0A 3SXFA 5IA0A 3OWLA 2WMAA 2PMLX 4H3PA 3OXZA 4KNBA 4X2KA 4DFBA 2JITA 4MBIA 3RBWA 1RW8A 1R3CA 3EN9A 5BYLA 3UIBA 3VAPA 3RZFA 3QCXA 2CGXA 4OTFA 3CSVA 3GUBA 5A54A 3B8RA 3MWUA 4IWPA 3UQCA 2A0CX 3VS7A 2QD9A 5BUIA 4PPAA 3VS1A 1BI7A 5CAPA 4W8EA 4K9YA 3F3TA 4KKHA 2IPXA 4OTDA 4V05A 3A7HA 4GFMA 4W4VA 2C68A 2BRHA 3ZBXA 1IR3A 1YDRE 3ACKA 3TIYA 4EZ3A 1H4LA 4MVFA 1YI6A 3QTRA 1STCE 3H0YA 2C0TA 3ORIA 5K0KA 4HVSA 5LJJA 2Z2WA 5DT4A 1YDTE 2XIRA 3KY2A 2RFDA 5CYIA 3UMWA 1JWHA 3ANQA 2VN9A 3LFQA 4G6NA 2C3JA 4O0VA 2WTCA 3UVPA 2VAGA 5ETAA 4FTTA 4J8NA 4E6DA 4RIXA 1OL5A 4I4FA 4APPA 3I7BA 5DRDA 3UP7A 2HZ0A 3HRFA 3VBTA 4N57A 2X81A 2XJ1A 3AC8A 3TT0A 3DKFA 3KULB 3MJ1A 2VTRA 5DLSA 4ZS4A 1H00A 2AYPA 2QOLA 3O8PA 3PWDA 4O86A 3OW3A 3DFAA 5EQPA 1JSUA 2GS2A 4X6QC 3LLTA 3WILA 4F9BA 3GU7A 3MESA 3MPTA 2XK6A 3OOGA 4ACCA 4O6LA 3FMEA 3QXOA 5DFPA 5JN2A 3UNZA 5L4QA 4L6QA 4S2ZA 2C6MA 2XUUA 4X2GA 5EM6A 2B54A 3RHXA 2GHLA 2B7AA 3UIUA 2IG7A 3LW0A 3F3WA 1GZ8A 3E7VA 3EQDA 5DR2A 3V5QA 4ZMEA 2H9VA 2Y0AA 5EKNA 4L43A 3QXPA 3O8TA 3QRJA 4U9AA 3QD4A 3FXXA 5A6OA 5FTOA 2WELA 4K77A 5IF1A 4BDJA 2RSVA 3QUEA 5KHXA 4J7BA 5A4CA 3EKNA 3T3UA 3QHWA 1J7IA 4F63A 4RJ6A 2JKKA 2YITA 3G33A 2IVSA 2VO7A 4PP7A 3R02A 4P90A 1UU3A 4D2RA 3C5UA 1KE6A 3FL5A 5JT2A 2RIOA 5HCYA 2HZIA 3ROCA 3ZLSA 3LXPA 3GU5A 4NM3A 1REKA 1TQPA 4QNAA 4UYAA 5TO8A 5HI2A 4C57A 2FB8A 5AAEA 2R3NA 1PF8A 4XG6A 1YKRA 2XKDA 3R7EA 4TXCA 4BWKA 4E3CA 5HTBA 3UQFA 5ANOA 2WTIA 3AC3A 3C50A 1NA7A 3JY0A 4G1WA 2W06A 2Y4IB 3RAWA 4RQKA 3VBVA 3QYWA 4L45A 2CKEA 4FT0A 4FUYA 4AX8A 4PY1A 4FG9A 4GSBA 4ZSGA 3BU3A 3HUCA 3I79A 1UKHA 3H9RA 2XB7A 3ALOA 4I92A 3LKMA 2UZEA 3RHKA 4YJOA 2UZWE 3V5LA 2X6DA 4LMUA 4BCQA 1O6YA 5IA4A 4RZWA 4CZUA 5FDPA 3SOAA 4I5PA 5JFVA 4R8QA 5I9VA 1WFCA 5L8KA 3DAKA 4O2PA 3W18A 1V1KA 4QMQA 4CT2A 5FXRA 3JR1A 2H34A 3EQGA 4L42A 3TDWA 5FLFA 4ZTHA 4RG0A 3W32A 5DPVA 2ZM1A 4B4LA 4ARKA 4DINA 3GU6A 3DKOA 2B4SB 2R3IA 4TYJA 3KRWA 4D2SA 5EQEA 4DTBA 3NYOA 3Q9YA 3QTZA 2PYWA 3BWFA 1OL2A 3A62A 2DUVA 3EN4A 4YJVA 1URCA 3O0GA 1W8CA 2ZV7A 4X0MA 1SNXA 3II5A 3RKBA 2UW3A 4Y46A 2GQRA 1ZWSA 5AV0A 1PW2A 2BRNA 3QQGA 3FPQA 3BU6A 4E6AA 3KRRA 4WSYA 4GVJA 4CYJA 3LLAA 3FC2A 4BHZA 4BC6A 1PXMA 4EQMA 2YM4A 2VWVA 4FGRA 1KE8A 1PYXA 3A4OX 2QVSE 3ORLA 4I3ZA 4QP7A 4DH1A 4WBOA 3GCSA 3Q53A 5DEWA 4YJQA 5KMMA 2X2KA 3GFEA 4ANMA 3QYZA 1NVQA 2WMSA 4XP2A 3QA0A 4M97A 3U4WA 4EUUA 3P1AA 3F88A 2VX0A 3PPZA 4UEUA 5DI1A 4EORA 4RQVA 4XUFA 3ULZA 2CGUA 3G15A 1BL7A 3OZ6A 3QD0A 5DG5A 2HY81 2XK9A 3JS2A 5CZIA 4YSMA 3LQ3A 3VVHA 1ZYJA 4L68A 4AW2A 4YJRA 4AA4A 2UUEA 3R9HA 1PYEA 4PDPA 4AF3A 4EH9A 3FL4A 4EOPA 4HVIA 3FQSA 4I5HA 5A4QA 1NT2A 3NAYA 3P9JA 4LOPA 3ZDIA 4BCJA 2PVNA 5I0BA 4NKSA 2EXEA 3DLSA 4BYJA 2BHEA 4M69B 4WBBB 3RWQA 4FIFA 4BR3A 1IEPA 3E88A 2ITPA 4FIJA 4ZTNA 1GZKA 3G9LX 4ZAUA 2B0QA 4ORKA 5CSXA 4JBOA 1B39A 5AIKA 2FSMX 3IK3A 3DBCA 4M8TA 2R2PA 4RFMA 3U6HA 2QO7A 5L6OA 5E8VA 3AMYA 4EOIA 2YIWA 4CV8A 4U79A 3WF8A 1ZLTA 3OY3A 2OH4A 3N51A 4FTCA 4H1JA 3VNTA 2BTRA 2F2UA 1J7UA 1CKIA 1XR1A 3KL8A 4ZJVA 4MWHA 3E8DA 4RJ4A 3W2RA 3IDBA 4OBOA 5HG5A 3ZLXA 1DS5A 2OJJA 2QNJA 3GFWA 4V0GA 5AUVA 3TZ8A 4HW7A 3HVCA 5J7BA 4YJTA 4XMOA 1G8AA 3QGYA 1T46A 3QLFA 4FTRA 3QBNA 4GT5A 5H3QA 4EWHA 1YWRA 5IH5A 3LJ0A 2EVAA 2HELA 4HGTA 1OL1A 4KIKB 3OCBA 4PDSA 1QCFA 2WMBA 3UYSA 4BKJA 4FZ6A 2OF4A 5J5SA 2YIQA 1H8FA 5CEMA 1Z9XA 5IU2A 4TKSA 4B0GA 2VGPA 3PUPA 5CANA 2OIQA 5KUPA 3E8CA 3HGKA 2PUUA 1ZMVA 1RJBA 1SVHA 2OJ9A 4JDIA 4EHEA 5JRQA 2BR1A 4C4EA 2WTVA 4CLIA 4U42A 1KE5A 3W2PA 4TL0A 3P4KA 4NCTC 2X39A 4EQCA 1PMVA 4GKHA 5JZNA 3UZRA 5F9EA 3W33A 5KX8A 3HAMA 1I09A 3OP5A 2XNMA 2PWLA 4FNWA 3DJ5A 4GRBA 4FL2A 4Y73A 2AC5A 3ERKA 3MY0A 1UU9A 2WQNA 4FKLA 4AW5A 4BL1A 2PK9A 2XJ0A 3O17A 2BZHB 2BAKA 4R7HA 4IB0A 5J1WA 3COIA 3NUSA 4ERKA 1KOBA 2YLEA 3GCVA 4BCKA 3VC4A 2I6LA 5C01A 2BALA 4O7RA 4OGRA 1E1VA 1OITA 4Q5HA 4BDHA 1JQHA 3RM7A 3TNIA 4YLKA 5AADA 1FVVA 3VBQA 2BPMA 2WQOA 3WF7A 3WIKA 3SD0A 3VBYA 1P14A 1UWJA 2C6TA 3FQHA 3UO4A 1YOJA 2B1PA 4BGHA 3Q5IA 2ITXA 4UWCA 3NUYA 5CXZA 3ZC5A 2ZM4A 4FTUA 4O82A 4IACA 4XS2A 3U55A 5ANJA 2HW6A 4EOJA 4C4HA 5EW9A 4B99A 4W9XA 2O0UA 4NW5A 4RFZA 2SRCA 2YERA 1PKGA 3BPRA 2FSLX 4DE4A 4O21A 2QOKA 2OBJA 4C35A 3FI8A 3SLSA 3OT3A 3QQUA 3MSSA 3UZPA 3MFTA 1GIIA 3AT3A 2WMRA 3DXPA 4O1PA 4GUEA 4FEVA 5M56A 4PL3A 3PXFA 3F2NA 2IZSA 3QD3A 1SZMA 1M7QA 5HICA 3P79A 2CNUA 4S32A 5BPYA 3ZUVA 5IDNA 1DAYA 4IVBA 4AOIA 3EFJA 5AA8A 3CGFA 2XBJA 4S31A 4CRLA 5HX8A 2E9NA 2F7XE 2VTSA 4OW8A 3TUDA 4AN9A 3BLQA 1U46A 4TWPA 4N0SA 4X7QA 5EFQA 2OIBA 4C3PA 3QCQA 4JDHA 3TJCA 5JSMA 2GS6A 2C6OA 1Q3WA 1P2AA 2W5BA 4NEUA 4QMTA 2ITOA 4FTJA 3CEKA 4EONA 2PMOX 4BTKA 2BVAA 2VX3A 4C4GA 4Z3VA 4FIGA 3CE3A 4EOQA 3ZO2A 4EH7A 2V0DA 4EK4A 1BMKA 3AGMA 4APCA 2EWAA 3BEAA 2IN6A 2ZOQA 4KBKA 4QMLA 4MQ2A 4DEBA 4E7WA 2W4KA 4MNEA 1WBNA 3PLAE 3R1YA 4AAAA 5GZ8A 3Q3BA 3MA6A 4U80A 4UMPA 4U8ZA 1OIQA 4L44A 2PVHA 3AT4A 4FOBA 3H9FA 2GCDA 1REJA 4QTBA 4E93A 4XG3A 3OROA 4MD8E 3TZMA 3S0OA 2X7OA 5A14A 3KVXA 5I9UA 4WRSA 3BV2A 3DB8A 4TNDA 4F6SA 4ENYA 2XNOA 3KULA 4LV8A 5I3RA 4FYNA 1U5RA 4O0TA 3ZMMA 4DCEA 2YDJA 3CQEA 5AUXA 4F7SA 2QCSA 5AUUA 1JBPE 3ATSA 4P4CA 2ZVAA 3EFKA 4BZNA 5K0XA 2X4ZA 1F3MC 2YM6A 3AC4A 4KIQA 4BDAA 3F7ZA 5CVFA 4WUAA 3TXOA 2CCIA 2ZMCA 2A2AA 3FI2A 3IPHA 3LQ8A 4JJRA 4L9IA 3RI1A 1PMNA 4YHTA 3ZU7A 1IA8A 3MYGA 4CZYB 4N6ZA 4JRVA 2ETKA 4F70A 3E7OA 4O7WA 4BHNA 5T6KA 4O96A 1IG1A 3E8NA 4JIKA 4JLCA 3FMMA 2PVLA 1Q4LA 4DH8A 3DXNA 2HW7A 3PSCA 3TIZA 3GXLA 4OAVB 3ORTA 2B9IA 2J5FA 4R7BA 4GUBA 1LEWA 3AT2A 4IB5A 3DDPA 3ELJA 4JG8A 5LCJA 2Z7LA 3QQLA 5E1EA 4DGLC 1X8BA 1OBDA 4BCIA 5KKRB 5EI2A 5DA3A 3E63A 4MEDA 3CXWA 4WOVA 1FVRA 4OT6A 5H8GA 4F08A 3P7AA 2YM5A 4D4RA 1AD5A 4E5BA 2OWBA 5L2TA 3DBQA 3DCVA 3QF9A 3NR9A 5L6PA 2XM9A 2JIUA 1W84A 1YOMA 5LVPA 2C6KA 2GFCA 4EJ7A 4V01A 4ZSAA 3S95A 3H9OA 3EJ1A 3ZTXA 2EXCX 4FV3A 3I4BA 5LVMA 5BVKA 3Q9XA 2W0JA 2X8EA 2PUPA 5H2UA 2B9FA 2QHNA 3V8SA 4BBEA 2IZUA 4ACMA 4FV4A 4F1MA 1FOTA 1ZMWA 5EHLA 4A4XA 4ANLA 2WMQA 1ZARA 1GJOA 2Y7JA 4GT3A 4DH7A 4CGAA 4RWJA 4BCFA 3H4JA 2ONLC 1URWA 5F4NA 4CXAA 3ZRKA 2F4JA 2VWBA 3OUKA 3ZLYA 4A4LA 4BZOA 4IXPA 3F66A 4XNEA 1U59A 4AT3A 3LFBA 4H05A 2WQMA 1OPLA 3U54A 3OBJA 3ZCLA 2RF9A 1XH4A 3R6XA 4YR8A 3KMUA 4S33A 1BI8A 5IQBA 5KNJA 1OUYA 4UWYA 5IA3A 4OTQA 3FZTA 1RQQA 2YJSA 3CJFA 5JGBA 4C3RA 2VWIA 3MVHA 1NW1A 5AP6A 2Y4PA 2W4OA 2X2MA 3PA3A 4XH6A 3TACA 4QQTA 4PMSA 1KUTA 1ZOHA 2R9SA 3R71A 1PXOA 4YZNA 4YPDA 3FZSA 2XNPA 3ORNA 2ITTA 4I0TA 5GIOE 1MRUA 4O7SA 1JKSA 5K4JA 4FOCA 4R3RA 4GFGA 5CSVA 3FMHA 1XWSA 3DQXA 1P5EA 1PMEA 3VBWA 3IOKA 2UW5A 3R22A 3KU2A 2H96A 3HMMA 2FGIA 4GIHA 5JZJA 3QZIA 1EH4A 2OGVA 2WB8A 2WHBA 4B6LA 4IC8A 3DB6A 4A4OA 3A60A 5LQFA 5M09A 3AQVA 5EW8A 4D2PA 1ZMUA 3G0EA 1OGUA 4L8MA 4AWIA 2OXDA 3EQRA 3R30A 3DXQA 3MH3A 2ACXA 3C1XA 1R0PA 4QMOA 5HE1A 3DK7A 4J71A 3RK5A 4Q2AA 4D4VA 4JT3A 5EM5A 2JBPA 1WBWA 3FQEA 2NNWB 3D15A 4CLJA 4IX5A 1OIRA 3AGLA 4N6YA 1JKTA 2LAVA 4CZTA 4MBLA 3KC3A 4BDFA 4E6CA 4BVUA 4GS6A 3WZEA 4J96A 4CEGA 2CHLA 4QMUA 4QP3A 5DGZA 4AUAA 2ONLA 2R3QA 4CFWA 5BQ0A 3R8LA 4BCNA 4Z55A 4U44A 3RK9A 2VD5A 4AG8A 5LMKC 2X2LA 2JC6A 2PMIA 3I5NA 4N4SA 2R0IA 3R8PA 3VN9A 4EH5A 3R9RA 4H39A 1KV1A 5KMNA 3SW4A 3D0EA 4O91A 1R1WA 3KB7A 2YFXA 1IAJA 1SNUA 2FVDA 2XEZA 4WUNA 4EYMA 1MRYA 3AC1A 5GZ9A 4EH3A 2PTKA 3JY9A 1QPJA 4QP9A 2OIDA 4ZZMA 3PXYA 5AP4A 5AV3A 3CD8A 1GIHA 4CT1A 4C3FA 2ZDUA 4F99A 5IQGA 3LCTA 3NYNA 3V6RA 3GCPA 5FBOA 5HVJA 3ZDUA 2OO8X 1M2PA 4I23A 1GNGA 2JDVA 4M13A 4YZCA 5M55A 3ETAA 4FSNA 3NZ0A 2WMWA 2Y8OA 4FSWA 4X6RA 4QYHA 3OWJA 1H08A 3O50A 2O63A 2OZAA 3VUIA 3P0MA 5A9UA 1ATPE 1PXPA 4TN6A 3QWJA 4QMNA 4DAWA 2J2IB 3HV6A 2P0CA 3EFLA 3NUXA 3ZEPA 4F7NA 3VUMA 3HECA 3CY2A 4R5YA 1Y6AA 3COMA 3ORMA 1WBPA 1B38A 3HV4A 2GHGA 3PFQA 3UC4A 3VBXA 3WZJA 2QG5A 4QT1A 1ZYLA 4DYMA 5HD4A 3I6UA 4BKZA 5HQ0A 5M51A 2Q83A 3F3UA 4L3JA 3LFDA 3SXSA 4F6WA 5DWRA 2WZJA 5L2QA 4XG4A 5A4TA 3G0FA 3C4WA 4D0WA 3QKKA 4M66A 4FMQA 3U9CA 3OD6X 4QYYA 2F2CB 4FKRA 4AA5A 4CQGA 2QONA 4USFA 5K4IA 5CASA 3D9VA 2BZKB 5DR9A 3QCYA 4BICA 1BX6A 3Q2MA 4EBVA 2BRGA 3N4UA 4O22A 2PZRA 4D2VA 3E3PA 3LQ5A 3VULA 4BZDA 2YHVA 4EOLA 5GIPE 3QQKA 4DLIA 3D7TA 1Q8ZA 2OJGA 4HPTE 1HCKA 3LHJA 3PJ1A 2HWOA 4V04A 3TWJA 4XLVA 3QAME 3D14A 2C5VA 4RWLA 3V8TA 2UZVA 3V51A 4FNXA 3ANRA 4TT7A 3C4XA 3JPVA 3Q5ZA 5AUTA 2Z02A 3OHTA 3BYVA 3FUPA 3AMBA 2VX1A 4R6VA 4NTTA 4WD5A 4FTMA 2QURA 3WE8A 2Z7QA 4H1MA 5ACKA 4A9TA 2QU6A 2Y6MA 3IDCA 3CLYA 4EC9A 4IM0A 1SM2A 5AX9A 1U54B 1H0WA 4KWPA 4C38A 5H9BA 4M12A 4UN0C 1JNKA 2ITZA 3KCFA 5IH6A 3W2SA 3I1AA 4TWOA 4WT6A 4Z9LA 4JOAA 1J1CA 3KXMA 3EN6A 2B55A 3IDPA 5FEDA 3QRUA 4BDEA 3T8OA 1V0OA 4USEA 5KMJA 4PMTA 4WIHA
chains in the Genus database with same CATH superfamily
4I24A 4EK3A 4E4XA 4FTKA 2R4BA 4A7CA 4LL0A 4ZY6A 4XG9A 1ZYSA 5IUGA 2X9FA 4OTRA 5ITAA 4UBAA 1TZDA 4K2RA 4I41A 3P23A 4UMTA 4ZZOA 4WNOA 4G3CA 3U9NA 2GNLA 4L3LA 4GH2A 1CMKE 3BGPA 1Y57A 2RGPA 3NX8A 3A7IA 2XS0A 3PWYA 4IIRA 1KE7A 3UP2A 3L1SA 2QOOA 5CT7A 4DHIB 5EI6A 5EHOA 4X21A 4C33A 4R78A 5HTIA 2ZMDA 4O84A 3NNXA 2RFSA 4JR7A 5IISA 5GJDA 1FGIA 5BUEA 3KXGA 2ITYA 3FY2A 4NZWB 1PXNA 3RAHA 4IVCA 2BKZA 4KABA 4M67A 2EB2A 4I6HA 4A07A 2RFEA 4LMNA 4FV7A 1SYKA 3SHEA 3VHEA 4BY9E 1M2QA 4YNEA 4CRSA 2PE2A 3HRBA 2OLCA 2X8DA 4BDDA 4R77A 1NXKA 3CQWA 5AR7A 5HNGA 5CEPA 3QFVA 5L2SA 5KMIA 2XVDA 2XNEA 3CS9A 2XA4A 3W0RA 4BCOA 3UNKA 3NDMA 3R28A 4IMYA 4LGDA 4BDGA 4KSPA 3F2RA 2PZPA 3LVPA 3Q32A 5CI6A 5B0XA 2CLQA 5CF5A 3IW4A 3S2PA 4C7TA 3GOPA 3VRYA 1ND4A 4UV0A 1OZ1A 5JK3A 4ZSJA 5KO1A 3F3ZA 5T3QA 4KD1A 5AP0A 5TF9A 2PPQA 4XV2A 4F0GA 4LV5A 4GG7A 5KE0A 4AE6A 1YWVA 1OIUA 4ITJA 3KMMA 3EZRA 2BFXA 4FZ7A 5D9HA 1KE9A 3ZFXA 2FA2A 5D1JA 4AFJA 3QL8A 4NM0A 4MKCA 4AP7A 5BX0A 4D0XA 3DJ7A 5M08A 3FBVA 2YDKA 3QZFA 4QMPA 4ASEA 3LXLA 4ZMFA 3UG1A 4FR4A 1H25A 2J4ZA 2NPQA 3NUUA 3KK8A 4GG5A 1OUKA 4TTHB 5FM2A 3RWPA 4IH8A 3TL8A 4AZTA 4EQUA 3EN7A 3GBZA 2QU5A 5CF8A 3QQHA 1GIJA 1WBTA 3MH0A 3OF0A 4GVAA 4EKLA 5I3OA 5CS6A 3NNVA 2G9XA 2P2IA 4C36A 4AE9A 1TKIA 3RGFA 1ZY4A 3H30A 4S30A 4RJ3A 4KIPA 4TYHB 2XKFA 4FF8A 3WZDA 4DFZE 4KB8A 1WAKA 3ZHPC 3C51A 4D1ZA 2LGCA 4FA2A 3IW6A 4FKQA 4DEDA 5IH4A 1G8JA 4C02A 3WARA 4W9WA 3TZ7A 2YCFA 2WD1A 4J8MA 1VJYA 4CKRA 5JEBA 3LFFA 2VTIA 2HZNA 3GNIB 1PMUA 3HDMA 3KFAA 3MVJA 3OXTA 4PTEA 3QTSA 5M07A 1H01A 1MQ4A 3DJ6A 3UQGA 5I9YA 3TTJA 4Y95A 3SG9A 2JKOA 4E1ZA 1UU7A 3EH9A 2P4IA 1WMKA 4IC7A 5DT3A 3S00A 3W0PA 2VTTA 2JD5A 2WXVA 4IAKA 5IPJA 2B52A 3LMIA 3R0TA 3ZO1A 4FV0A 4F0FA 4CCBA 2IZRA 5DNRA 4HJOA 3P7BA 4LUEA 5CT0A 1M2RA 3R73A 2YZLA 3VS0A 2G01A 3OUNB 4X3FB 2A1AB 3BRBA 2FSTX 3DTCA 4IBMA 4BIBA 5IA2A 4FSUA 2P55A 2ITNA 1YW2A 3O51A 3U87A 3D5WA 4UZDA 4KBAA 5DE2A 4ZJJA 2XM8A 1O6LA 2G15A 4E4LA 4DCAA 1Y91A 2GS7A 3EQHA 5DT0A 2JAVA 3D83A 3QRKA 1OPJA 3UOKA 4BGGA 4DHJA 5DBXA 2UVXA 3KXXA 3PJ3A 1OM1A 4IFCA 4QPMA 5ETIA 3FLQA 3GC9A 5AX3A 5J8IA 5LMAA 4ZY5A 3MFSA 5EH0A 2Z7SA 4JIAA 4P5ZA 3B8QA 2I0YA 5AUZA 3Q6WA 4CG9A 2CN8A 3DOGA 4QTAA 2XK8A 4BI0A 5FTGA 4HCVA 1Q61A 4A06A 4O0RA 2WFYA 1H1SA 4FVPA 5IQAA 2BZIB 3RAKA 4WKQA 4TZRA 3QWKA 4F65A 3C9WA 5TKDA 4IFGA 4JL9A 4U43A 4BCGA 5BV3A 5CU4A 2XCHA 3PXQA 4C2VA 1FINA 3PXZA 5E8UA 2JDTA 2JKQA 2GNGA 3R83A 4C59A 3JVSA 4QOXA 2WMXA 4HOKA 5FD2A 2W7XA 3NAXA 2W4JA 3Q2JA 2UW7A 4MYGA 1OMWA 2GSFA 2RG5A 4FV8A 4RX9A 3RMFA 3LCDA 4HNFA 2BUJA 4Y83A 4EHGA 4PX6A 3F6XA 4OTIA 4RRVA 4EH6A 5KZIA 4ASDA 4BDKA 4IVDA 1NVRA 3DV3A 4BKYA 5C8KA 4U40A 4E5WA 2QKWB 2VZ6A 2P3GX 1Q3DA 4IJPA 1OPKA 4XV1A 4D1SA 3FKNA 5HBJA 4RIOA 1OB3A 1SMHA 4TWCA 5DN3A 3SDJA 4JAIA 2UW8A 2J50A 4FI1A 4FYOA 3QTIA 1YXXA 2V5QA 3AC5A 3PG1A 4FVQA 4QQCA 4YC6A 5HKMA 3UBDA 3R04A 3UYTA 3ZS5A 4I6BA 5E92A 1PY5A 4HYIA 2DWBA 3EL8A 3LFSA 3ZSHA 3SVVA 4D5HA 2C6LA 3IONA 4GEOA 4DBNA 3LM5A 5FG8A 4IDTA 3FWQA 3W8LA 2GNHA 1OKWA 3LCSA 2W1IA 3PSDA 3FXZA 5LOHA 1B6CB 3HMOA 5JMSA 4ZLYA 2C0OA 1E9HA 5CSPA 2XEYA 4RLLA 3A8WA 4EH4A 4NM7A 3F3VA 2GTMA 2DYLA 2X0OA 3DBEA 5HOAA 3UIMA 1XBAA 3UIXA 1IAHA 4YJPA 3OTVA 3FSKA 3R8VA 5TOZA 2Q0BA 3IQ7A 3NNUA 3PLSA 4D1XA 3Q60A 4NK9A 4K11A 5LVNA 3K5VA 5JFWA 4XBUA 3L8SA 3KA0A 4NT4A 1UV5A 3U6JA 2DS1A 2YM7A 3DY7A 1U5QA 4DFYA 4UMRA 3C4EA 3JUHA 2QC6A 4W4YA 3KCKA 4YUQA 3ZSGA 4I21A 2R3JA 5IEYA 3PXRA 4RC2A 4JXFA 4CTBA 5G1XA 2C5OA 4QMYA 4F9WA 2B9JA 4NUSA 3SXRA 2A4LA 3Q9WA 4YU2A 1YI4A 4WSQA 5J9ZA 3GENA 3HL7A 1A06A 5EYKA 4BTFA 4FNYA 3TI1A 1WVXA 5IMXA 3G51A 4FSRA 2G2HA 2WTKB 3ODYX 3CKWA 1ZYCA 4HYSA 4MH7A 3R9DA 4ANQA 4EC8A 2F9GA 4XEYA 2F49A 5KCVA 3U51A 3P5JC 4AU8A 2JIIA 5AUYA 5E7RA 3SOCA 3DLZA 1XH5A 3L9LA 2XMYA 1O9UA 3HAVA 3PRIA 2DQ7X 2EB3A 4YBJA 3QRIA 4TYIA 3UOJA 3OWPA 3D7ZA 4I20A 4FTLA 4JQ8A 5E4HA 5CX9A 2W1HA 4GV1A 3ZO4A 2W9ZB 3MW1A 3MFRA 2BHHA 3WI6A 4DEGA 4NSTA 1H1QA 4ANSA 3H3CA 3NLBA 3Q04A 3PZEA 1FGKA 3BYSA 3DT1A 2I0HA 3AD6A 3OOMA 2BKKA 3P86A 3ZRLA 5AR5A 3P7CA 5IQHA 5LVOA 1Y8GA 2BZJA 5HGIA 4G31A 4AA0A 3G9NA 4DN5A 3BZ3A 2UVZA 4GFOA 4IDVA 4MBJA 4JI9A 3NYVA 2ZYBA 4BCPA 5E91A 5DMZA 5LWMA 3N9XA 2XP2A 1YWNA 3NW5A 5HG9A 4ITIA 3PPJA 5FBNC 3RNYA 2X7GA 4PMMA 3WF9A 4MD9E 4QO9A 5I5ZA 2PHKA 4IM2A 4XG8A 2QR8A 4NW6A 3FHIA 1XJDA 3ENHA 4C34A 3TMOA 4KBCA 2ETRA 4FSYA 3C13A 4UMQA 4TRLA 1YXVA 4RT7A 3SW7A 4ZK5A 5CAUA 3OEFX 3EN5A 4PDOA 3BX5A 3KMWA 3KXNA 3K3JA 1KOAA 1Q99A 2IVVA 4YLLA 5TR6A 4IZ7A 3UG2A 4LRJA 2XZSA 5AUWA 2R64A 1QPEA 4HZSA 5AJQA 4GU6A 3BGQA 1U54A 2ETMA 1ZOEA 5L6WL 3JXWA 4RIYA 4BIDA 3FMNA 3ET7A 4U0IA 4FEWA 2WEVA 2VWWA 4L52A 2W17A 3V01A 5J5TA 3UDBA 5EW3A 4C37A 1IRKA 5FUTA 4IWQA 3LPBA 4TWNA 5CF4A 1R39A 5EOLA 3PTGA 4L00A 4OLIA 4GK4A 4CFVA 5K5XA 4G17A 2WMUA 2X7FA 4PRJA 2PL0A 5B7VA 3NEWA 1WBVA 3PA4A 3VUHA 1VZOA 4PTCA 2W1GA 2I0VA 2QODA 4OBPA 4QTDA 3PA5A 3R1SA 4FKPA 3ZFYA 3KKVA 1V0BA 5EM8A 4UWBA 2YCQA 3MJ2A 4ID7A 4JX7A 3GGFA 2OK1A 3VIDA 4DDIA 2J90A 2YA9A 3ORXA 3D2KA 3PP0A 2OFUA 5CWZA 2X9EA 3ZXTA 4O38A 1WVWA 4DEIA 2UW6A 4DGOA 5HNIX 1WCCA 3MGYA 2CJMA 4U3YA 4EZ7A 4DC2A 4EK6A 4JAJA 3FYKX 3QTWA 4HZRA 2Y6OA 5CNOA 5AR3A 2WU6A 3AKLA 3VO3A 4M3QA 3RAIA 3DGKA 5E8SA 4FTAA 3KRXA 2C3LA 4JR3A 1Q5KA 4CYIA 4YHJA 3BV3A 3FZOA 1WVYA 1U4DA 4IX4A 4QP2A 1PXKA 1S9IA 3CPBA 2HIWA 2PMNX 3R8ZA 5AV2A 2ITQA 4FG7A 2WKMA 4RIXB 3FZ1A 3LJ1A 4G3DA 3ZZWA 4CTCA 1H1WA 2ITVA 1CTPE 3G2FA 1DI8A 2ZJWA 3TV6A 3OBGA 2JGZA 1F5QA 3S1HA 4RC4A 3UO5A 4EH8A 5IMEA 4DFXE 3ZONA 3TUBA 4Y5QA 4FSMA 3EKKA 2GNIA 5CQUA 2OI4X 1VYZA 5D10A 4MNFA 5ACBC 2FO0A 4DFLA 5C26A 4RX7A 4Y8DA 1KV2A 3AC2A 3O23A 5AAGA 2CNQA 4D9TA 3F61A 1BYGA 3R1QA 1OKVA 2VTHA 3NYXA 4FTQA 4AZWA 4PMPA 2C30A 4YJUA 3VF8A 3DK3A 3KRLA 1M17A 3P78A 3SC1A 4X3JA 4QMWA 3BLRA 4BI1A 1M14A 1K9AA 2WTWA 2GPHA 4YJSA 2GMXA 3CGOA 3HMNA 4D4YA 5EYMA 3DKGA 4BIEA 4EEVA 2C5NA 3T9IA 3C4CA 5M4FA 2J6MA 4XV9A 4R7IA 2OW3A 4WG5A 1H0VA 5AV1A 4MXXA 1ZOGA 4FODA 4QMZA 4BCMA 4Q5EA 4IZ5A 5CU2A 3ATTA 5AFVA 3MY1A 3HMIA 2YAKA 2AC3A 4U97A 2QG7A 3NUAA 4FEXA 4FJVA 3R9NA 5CU0A 2ITUA 5GJFA 3VUTA 1PRYA 3QKLA 4H58A 2W5AA 2I7QA 2X6EA 4F7JA 4HVGA 4I22A 4HYUA 3W10A 4YZBA 4U81A 5LCKA 2YAAA 4CD0A 3E62A 1LEZA 4NYEA 4BJJB 1BUHA 5ANDA 3DU8A 3NUPA 4HPUE 3LZBA 5IQFA 1Q8YA 4K33A 5FEEA 4OBQA 2WIHA 2WMTA 1GZNA 3OS3A 4YLJA 2GFSA 2WPAA 3QHRA 1L8TA 5IG1A 3FPMA 5M44A 2PVKA 4IADA 4G3FA 4JBQA 5KZ0A 3FLWA 4X3FA 4ZXTA 4ZTSA 4CNHA 5KMOA 1OBGA 4DGGA 4RVKA 3EOCA 3IGGA 1TVOA 1YRPA 3DBFA 4XRLA 3D4QA 3R7UA 4DT8A 4LL5A 3VJNA 2O3PA 2X1NA 3ZOSA 4GK2A 3W0SA 3O96A 3IG7A 4QD6A 3QU0A 4RJ7A 4I0SA 3QC9A 4YGAA 5D7AA 5FTQA 2NRYA 3KEXA 2JDSA 5BMSA 5I9XA 4KS8A 3IW8A 4HNIA 3I6WA 4IAZA 2R3PA 4GYIA 5AR4A 4NIFB 3WF6A 1PXLA 4NU1A 4EHVA 5TT7A 4YTIA 2VNYA 4BN1A 3CD3A 3GI3A 2QR7A 4Z7GA 3HNGA 4ZSLA 3PE2A 5CZHA 3BEGA 2YLFA 5C8MA 2X0QA 5FGKA 3ACJA 1Q8WA 5BVWA 1T45A 3V3VA 4F0IA 1MUOA 4E5AX 1AQ1A 4FKWA 5AA9A 5CQWA 3QD2B 4RBLA 5DRBA 2PULA 4RJ8A 1YQJA 4M15A 3IW7A 4QP4A 4DG2E 3A4PA 5AM6A 3O8UA 2HWPA 1Z5MA 3RM6A 4F6UA 3M11A 3QZGA 4PL5A 4O7NA 3NS9A 5KBRA 4CQEA 3PJ2A 5IEVA 4MF1A 2UZLA 3ORKA 3MDYA 4ZOGA 2V7AA 3WF5A 2C1BA 2WIPA 5AM7A 4AACA 4M69A 3GU4A 4QYGA 3HLLA 4AZFA 3BYMA 5DVRA 4MXYA 4QMSA 4IANA 2V22A 2RG6A 1F0QA 2IW9A 3CQUA 5F20A 1FVTA 4FT5A 3OFMA 3U4UA 4JNWA 3FHRA 4YNOA 2ERKA 2PE0A 5EI8A 2HK5A 3BE2A 3SQQA 3MIYA 5BMMA 4KIOA 5A3XA 5HX6A 1YI3A 2VTOA 4OTPA 4U41A 4WG4A 5AP7A 3ZC6A 3HP5A 3Q9ZA 4H3BA 4M68A 3OY1A 3L9PA 4P5QA 4OAUC 2PU8A 2ZM3A 2FYSA 4XHKB 4QYEA 4G9CA 2CPKE 2R0UA 4MD7E 2FH9A 3HX4A 4XP0A 5HU3A 4FSZA 2VWZA 3PYYA 5AP5A 5HO7A 5HVYA 4CV9A 5AR8A 5HESA 5CI7A 5A6NA 4C58A 2CN5A 3WYYA 4C62A 5FEQA 4QQ5A 3SA0A 2J0LA 3HUBA 3E5AA 2HCKA 4KIKA 4LUDA 4MXOA 4UXQA 5IQDA 1Y8YA 1H26A 2CLXA 2PUIA 1W98A 4O4BB 1J1BA 2UVYA 3NUNA 4CMUA 3QX2A 4QNYA 3ROYA 4FV5A 2XYUA 4JBPA 2C1AA 5EYDA 4HVDA 3SKCA 4ACHA 2W1EA 4G3GA 4AXEA 1H24A 4LFIA 1L3RE 4RSSA 4EH2A 3G6HA 5DHJA 1DAWA 3FZRA 2CMWA 4PTGA 2AEGA 3LMHA 4L46A 3NW7A 4F9YA 4O0SA 3VJOA 3UO6A 3BQRA 2JFMA 1XBBA 3KN5A 4FIHA 3TDVA 1I44A 1ST4A 2QOCA 4DF3A 5CTPA 3NIEA 2REIA 1SVGA 3PJ8A 3VRZA 4I94A 3BBTB 3LCOA 3D5VA 3MBLA 5IKWA 3RTPA 1QPDA 3A7JA 4FL1A 1JOWB 5FQDC 4ZSEA 3BHHA 3NW6A 3S4QA 5M53A 4F64A 1HOWA 2I0EA 2ZB0A 3OCTA 2KULA 2X0PA 2WEIA 2G1TA 3DNEA 3GCUA 4KRCA 4B8MA 5HD7A 1GY3A 5HIEA 2WOUA 3DAEA 4FKGA 3C0GA 2GDOA 2PVMA 3DDQA 2XIXA 1YDSE 1ERKA 2YEXA 3C4ZA 2ZDTA 5FRIA 4D2TA 5CEIA 3FLZA 3R2BA 5AEPA 2VTJA 3DFCB 1BKXA 4FEQA 4FK6A 3KRJA 4IX3A 4YZMA 3UJGA 4A9UA 4IAYA 3KGAA 3UPZA 1YXTA 2W9FB 3PVBA 3HDNA 4FIEA 2H6DA 4FT3A 1TQIA 2WGJA 2ZAZA 5CY3A 1H1PA 4FICA 3V5JA 3KF7A 3A2CA 3FLNC 4ZTQA 4DLJA 5J79A 4ZTLA 2FUMA 3RPVA 4DG0E 4PQNA 2R3GA 4BYIA 1JKKA 4E4NA 3PVWA 2QKRA 3PZHA 3BHUA 3SG8A 1V0PA 5KMLA 3E64A 3A8XA 2XNBA 3COKA 4IM3A 3BGZA 4IHPA 2C0IA 1XH8A 3M2WA 5GNKA 4ZIMA 3RP9A 3L8VA 3SRVB 4DFNA 2VWYA 4Y72A 3RALA 5ETCA 4I1ZA 3K54A 4JG7A 3BHVA 4GCJA 3F9NA 1FMOE 4X2JA 4GW8A 3ALNA 4IQ6A 4AOTA 4BWXA 4YPSA 5M4CA 2VWXA 3VONA 4L53A 2QO2A 3R00A 5J7HA 4O2ZA 3F82A 3QTQA 4PP9A 3MPMA 3O7LB 3TEIA 4EI4A 5IQCA 4O7LA 4D28A 4LRKA 4ANOA 3AKJA 4Y5HA 1Q62A 1UU8A 3HP2A 2ZFYA 2CSNA 3C7QA 2H8HA 3OMVA 3QA8A 3V04A 4BGQA 1P4OA 5B2MA 5CF6A 4EJNA 4B8LA 3MPAA 4AGDA 4RLKA 4W4XA 1R0EA 1YOLA 1A48A 1J91A 4ONAA 4QP8A 3PIZA 2JKMA 3GQLA 4L01A 4FKOA 3OEZA 4HGSA 3MFUA 3K5UA 5C03A 1M52A 1XO2B 3NIZA 4KSQA 5CVHA 4DGMA 3GT8A 4KAOA 3V5WA 4DBXA 3UVQA 3VF9A 3NWWA 3N4TA 4I5CA 3IOPA 5AP3A 5C8NA 1LP4A 4F4PA 3IS5A 2W1ZA 3MIAA 4JQEA 4NJ3A 4B9DA 2OXXA 3KQ7A 1H1RA 4H36A 1BL6A 2VUWA 3FI4A 4CFUA 5IA1A 2YCSA 4A9RA 4FKTA 2F7EE 3CY3A 2CNVA 3ZM9A 4JVGA 4ERWA 3R7VA 3FV8A 3A7GA 1JAMA 3BHYA 5KKRC 5C1QB 2C6IA 2UZDA 3BLHA 4BCHA 3FSFA 3E93A 4PNKA 4MNEB 2RKUA 1H28A 1ZZ2A 3F5XA 3O5AA 1S9JA 4LOQA 5M4IA 4FKIA 4IAIA 3ZUTA 2BCJA 4ALVA 1IASA 4L3PA 3RINA 5G6VA 2B9HA 2PZ5A 5HIDA 4JBVA 4U3ZA 1ZRZA 4DITA 5DR6A 3V8WA 3BKBA 2YJRA 4YMJA 5JFXA 3Q4ZA 2GNJA 2YIRA 2ITWA 4RWIA 2VO6A 3ORZA 1O6KA 4OT5A 4QMMA 3PIXA 4AT4A 2I40A 4C4JA 3GB2A 3KVWA 2PVYA 3DTWA 5CU3A 3TKHA 4XBRA 3UVRA 5CEOA 2WOTA 3FXWA 2BFYA 1KSWA 3CTJA 3QX4A 2IF8A 2V62A 4I6QA 4OTWA 4BWPA 4PPCA 5J9YA 1WBSA 2UZTA 4AN2A 1R78A 4EK5A 5JGDA 3BCEA 2CKPA 4O7VA 1LUFA 2ZV9A 3PPKA 1KWPA 1G3NA 3Q4UA 4LOOA 2CKQA 3UGCA 3FMLA 3FMDA 3IGOA 4FUXA 4KS7A 3F7WA 2OU7A 4WNPA 4FTNA 3VS3A 3EB0A 3ZXZA 1OGYA 3AG9A 2CDZA 3DNDA 4L67A 3F5PA 4AFEA 4EOMA 3QQJA 1TQMA 4MK0A 3W8QA 3FKOA 3ZFMA 5A4EA 4PF4A 4WA9A 4NL0A 5D11A 2HXLA 2XKEA 5F94A 3OT8A 4MXZA 3VWAA 3VQUA 4AGCA 5K9IA 2PUNA 4FNZA 4F1OA 2E9VA 4CKJA 3BYUA 3W2QA 4LGGA 5E8XA 5GJGA 3CP9A 1ZAOA 3GCQA 4FIIA 4A9YA 5F1ZA 3QC4A 4KKEA 3VUKA 2R3FA 5CVGA 5J1VA 4MAOA 3GC8A 4RC3A 4ZLZA 5AWMA 2C69A 5JFSA 4G3EA 3D2IA 5CU6A 5ANIA 3TCPA 1VLRA 3ML1A 3EYHA 4IZAA 4FKSA 4QRCA 5DOSA 4IVAA 1OVEA 4R5SA 3HRCA 2OKRA 4WHZA 4RPVA 2J0IA 3MA3A 3AD5A 5C27A 5HZNA 3Q52A 3QTUA 4YZDA 4N70A 5EDRA 3UC3A 4G16A 3VS6A 4D9UA 3BBWA 1XMLA 4O7TA 1CKPA 1OL6A 2C5XA 3TV4A 5JGAA 5LWNA 4AGWA 2NRUA 4R1VA 5JQ8A 2O64A 3R63A 4FC0A 4JQ7A 1AGWA 4XX9A 4YJNA 4TY1A 5EHYA 5HO8A 2IVUA 2J7TA 3D5UA 3A61A 4FRFA 1HCLA 4AS0A 3V6SA 5EYCA 3QTXA 4EBWA 5BYYA 4EZ5A 3TZ9A 3UDZA 5IEXA 3I60A 5HNBA 4QMXA 2UV2A 4W4WA 5KBQA 3QKMA 4JDKA 4O4CA 4O81A 1CDKA 2C4GA 1ZYDA 4NIFA 4TPTA 4K0YA 3THBA 4DDGA 4MTAA 5L2WA 3WYXA 4KUJA 4GJ3A 5ANEA 2V7OA 2BAJA 4II5A 3DKCA 3E87A 4AW1A 3R21A 4FBXA 5EKOA 3BE9A 2R5TA 2WAJA 4JDJA 4OR5A 4DEAA 2BTSA 4BF2A 2QOHA 4OTGA 4JS8A 5CEKA 1CM8A 3HZTA 2W1FA 4JMQA 2PVFA 3ZYAA 1H07A 4AZEA 3POZA 3BLAA 3RPOA 3UTOA 4K18A 3ZO3A 4JX3A 4F9AA 2BROA 2W05A 4E20A 2E2BA 4ZJIA 4XCUA 4YO4A 2UZOA 1ZZLA 3KXZA 1MQBA 4IE9A 3F69A 5ICPA 2HZ4A 3FE3A 1PXIA 4ITHA 4RIWB 3OTUA 4ZTRA 3GEQA 3LFCA 3R7GA 1NY3A 2JLDA 3BYOA 4TW9A 5IUIA 3EQCA 2HENA 3MTFA 4TYGA 4EL9A 3RPRA 3DQWA 4JRNA 4UYNA 3W1FA 2O5KA 3TNQB 3K3IA 3B2WA 4EUTA 1P4FA 2Z60A 2YM3A 4M0YA 3R7IA 3F5GA 3TKUA 1FBNA 1UWHA 3NCZA 4CFXA 4ZZNA 3GP0A 3ENMA 3MVLA 3QQFA 3IECA 1XQZA 4O0WA 4WNMA 2R3HA 4NKAA 5B2KA 3TKIA 4BBMA 5CAVA 4R3PA 4GIIA 3PY1A 5HCXA 2KTYA 3FMKA 4NH1A 4O1OA 2OH0E 5EG3A 5E90A 2C5YA 3PVGA 4O4EA 4UX9A 4WO5A 3PY3A 3UODA 5LXMA 1APME 2P33A 3QUDA 3HKOA 3MV5A 1XKKA 3HV7A 3NVMB 3UOHA 1WZYA 2JAMA 2VV9A 1YXUA 3AOXA 5FM3A 4HGLA 4C8BA 5I9ZA 1ZY5A 3FYJX 2W96B 2J51A 4G6OA 3VUDA 4U5JA 4O0YA 1NVSA 3RPSA 2FSOX 4G5PA 3TNWA 5A46A 4UY9A 3O71A 4BTJA 4NFMA 4IJ9A 1JKLA 3AMAA 2G2IA 3FAAA 4ZS0A 5M57A 3PIYA 4G2FA 4Y85A 2BRBA 3VW8A 2YWPA 2IVTA 5DH3A 4S34A 4AN3A 2ERZE 4IW0A 1XH7A 2Q0NA 2BIKB 4IX6A 5DYJA 4CMTA 5HHWA 1JVPP 2RFNA 1JLUE 3NCGA 1UKIA 1W2DA 2GNFA 2HOGA 2OZAB 3LM0A 1K2PA 4LGHA 2BDFA 4RFYA 4M7IA 3RJCA 4RX5A 2PSQA 2IJMA 4C2WA 3MI9A 1XHAA 4OUCA 5HBHA 4I93A 4QQJA 2VNWA 2ZV8A 2VGOA 4DH3A 3PXKA 5LMBA 1GAGA 4AQCA 3HEGA 4GT4A 4FV2A 4KRDA 4M84A 3C5IA 3SAYA 3Q6UA 4J99A 2XYNA 3JVRA 4G9RA 3RPYA 3U6IA 4XV3A 1H27A 5J95A 4XG2A 1Y6BA 3MH1A 3BQCA 3QCSA 2GQGA 5E8TA 4C61A 2Z7RA 3FLYA 3QGWA 4FV6A 5E8ZA 3PDTA 2C6EA 2QI8A 4O27B 3W55A 2O2UA 3ZRMA 4YZ9A 4E26A 4K1BA 2ESMA 4RVTA 1MP8A 1OIYA 3R01A 4DTAA 4XG7A 4DFUA 3D7TB 3GC7A 4C4IA 4MHAA 4ZY4A 1ZXEA 3R1NA 3IKAA 2C6DA 2GQSA 2PZYA 4A9SA 1RDQE 1XBCA 2R3LA 2E9PA 4RMZA 4BB4A 3FC1X 4AW0A 4J95A 5T68A 4K8AA 2VTAA 1QPCA 4FV1A 2BRMA 1FPUA 4IB3A 2JIVA 4E8AA 3VUGA 5LVLA 1XH9A 2YCRA 3F2AA 5KHWA 4G34A 4MCVA 4F9CA 1UNGA 4ALUA 1Z57A 3A7FA 5CAQA 4I6FA 5D7VA 4IEBA 3I81A 1YXSA 3Q96A 5AMNA 5JRSA 4D4SA 5E8YA 4CFMA 3G90X 3LXKA 3TUCA 1PXJA 4J1RA 3SRVA 5HCZA 3G6GA 5AIRA 4USDA 3FKLA 3TV7A 3CCNA 5IZFA 2PY3A 2J0KA 3V5TA 3TM0A 3P08A 2J9MA 3C0HA 4HYHA 4LI5A 4AGUA 4MXAA 4NWMA 3E3BX 5CEQA 4GL9A 4IWDA 4UB7A 4YTHA 4BDBA 4QTEA 2BDWA 4WG3A 3ZZEA 3R8MA 2J0JA 2BDJA 3EQBA 3PP1A 5HO6A 3GU8A 3OVVA 1SVEA 2XRWA 4J53A 1UNHA 4ASZA 3MTLA 2YDIA 4X2FA 1W7HA 4I5MA 1W83A