2A19B

Pkr kinase domain- eif2alpha- amp-pnp complex.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
273
structure length
263
Chain Sequence
AHTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLINRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Higher-Order Substrate Recognition of eIF2alpha by the RNA-Dependent Protein Kinase PKR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein synthesis/transferase
molecule keywords Eukaryotic translation initiation factor 2 alpha subunit
total genus 82
structure length 263
sequence length 273
chains with identical sequence C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2a19B02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2a19B01
3KK9A 4S33A 2R3IA 2IW9A 2RFSA 1PW2A 4EOSA 2NP8A 1CKPA 4MBJA 5BX0A 3QAME 4YC6A 2BUJA 4YO4A 3GQIA 4H3QA 3PP0A 1V0PA 3ZYAA 3DS6A 4AN9A 2C3IB 3FKNA 2I40A 3R9RA 4ZZOA 3E87A 3VBXA 4FVPA 3C9WA 3POZA 5KMLA 5HQ0A 3F7WA 3WIGA 5AADA 4U80A 2GS6A 4MNEA 4HNFA 2C3JA 4GW8A 4ZP5A 4WNMA 2BILB 1QPJA 4HGLA 4RX8A 4OTPA 3HV4A 4FG9A 4D1XA 3NZ0A 4RGJA 2RF9A 3TNPC 2PWLA 4II5A 2WU7A 5HVJA 4K2RA 3FYKX 4NEUA 5CZHA 4UMTA 2CGUA 2XEYA 3BE2A 3FMMA 2PZYA 3FC2A 1P5EA 4K18A 5IH5A 5J9YA 1W8CA 5IQCA 1UWJA 4NCTC 2C5NA 5HESA 3Q3BA 3NYOA 5EHLA 2O3PA 4JJRA 4W9XA 4D1ZA 3MVMA 4ENXA 4MCVA 2W1ZA 5HG9A 5CX9A 4CQEA 3F3VA 1Q3DA 3FMNA 3MBLA 4IM0A 4UYNA 1W83A 3VS4A 3NWWA 4I24A 4IBMA 4XBRA 3V5QA 3VS6A 5KHXA 2VO7A 3RHXA 1JKKA 3PXZA 4BCNA 2X9EA 4XV2A 4EOQA 3C5IA 3P7CA 1FGKA 1IEPA 3MS9A 4MH7A 5GZ9A 4E4NA 2P2HA 2R3JA 2OG8A 4I23A 4MX9A 4QP2A 3RK5A 4A4OA 4HVDA 2GHLA 1ZYJA 4CFNA 5M09A 3A7IA 4EUTA 4RX5A 3CJFA 4XP2A 3HL7A 2QOCA 3NIEA 2QONA 3IOKA 3QQKA 3M11A 4XRJA 3N51A 2YJRA 5F9EA 5IISA 4J53A 5E8XA 5KMMA 4OTRA 4IHPA 4KD1A 2GNHA 3V6SA 2V7AA 3AQVA 2W1GA 2W9FB 1WVWA 4OTDA 4PNKA 3BWJA 5I9VA 2R9SA 3R83A 4NL0A 1OL2A 3E63A 5B2LA 4W4XA 1Q24A 3HUBA 3UOLA 2WTJA 4HYIA 4DH5A 1ZARA 2UZUE 4ZTHA 3CS9A 5L8JA 2X4FA 4APCA 2PUPA 1W0XC 4FICA 3Q6UA 5FXRA 1E1VA 2P33A 1YWNA 3LXPA 4Z9LA 4GU9A 2ETMA 4DBXA 3HP2A 4I93A 3H0ZA 2X2KA 2R3PA 2YIXA 3GGFA 1XHAA 2YIYA 3DK3A 3QD2B 4J52A 4OTQA 4ZSGA 3A4PA 1BMKA 3MGYA 4JDJA 4JX7A 3VBVA 3G6GA 5J5TA 3ZZWA 1QPEA 2QI8A 2YHVA 3R30A 4ANQA 5HVYA 4BWKA 3G90X 3NYVA 2E9PA 2WNTA 2OZOA 1OUKA 4E93A 4I1ZA 4RWJA 5L3AA 2J2IB 3ORNA 4G6NA 5FWKK 3ZLYA 3HRFA 4AF3A 1YVJA 2G1TA 3FPMA 3PG1A 4BHNA 1YRPA 1OL1A 2JDTA 3E3PA 2GFCA 5IUIA 1YI4A 3SQQA 3A7FA 3PLAE 1NA7A 5JRQA 3TWJA 5JGAA 1IAJA 2UZBA 4PP7A 1R0PA 2JAMA 4IVBA 1IG1A 5IUGA 1Y8GA 2HELA 3THBA 3ZXTA 4BFMA 3V8TA 2JIUA 3ORKA 2WTWA 4YZ9A 4EZ5A 5A4EA 1AQ1A 4U79A 4FTJA 3RAHA 3PZHA 3BHUA 3R1YA 3GCPA 3UVRA 2W7XA 3ORMA 2BRNA 1H1PA 4O7LA 5AM6A 4RZVA 3RPOA 4F63A 3GC8A 4KA3A 5AIKA 3DBCA 1A9UA 2VTOA 3ZDIA 3QWKA 1OKYA 3D2KA 4NTSA 4QT1A 4YLKA 5EG3A 5B7VA 2W1DA 2V0DA 4NTTA 3ZFXA 4YURA 3CGOA 4DGNA 3EKNA 4QOXA 1PF8A 2X0GA 5CSWA 5HBJA 4RZWA 4AN2A 4AFJA 4L6QA 1OGUA 2BZJA 3IW6A 3MFSA 5C27A 4E4LA 3DKCA 4MWIA 5CF6A 1H1SA 1OBDA 5BVFA 2YJSA 3QUEA 4CKRA 3ATSA 4D0WA 5M06A 4BCKA 2GS7A 4JRVA 3O0GA 4U43A 3RZFA 2BMCA 1OB3A 2R3KA 2YLEA 3DKFA 4CEGA 4C4FA 1UU9A 2GNJA 2JFMA 4M67A 3NYXA 1KE9A 4BYIA 2WD1A 4FV3A 4Z7GA 5L2WA 4IAAA 4G3GA 5J1WA 4S34A 2OIBA 2ERKA 3VS2A 1PXIA 3GC9A 4GIIA 1L8TA 3R28A 5ANOA 4UXLA 4E8AA 3ZRKA 4QYHA 4MHAA 5K3YA 5LMAA 3EHAA 1P2AA 5T68A 4XNEA 5ETFA 4USFA 2WKMA 5CY3A 5ANGA 4LOPA 2WFYA 2X81A 5JFVA 5CEOA 4NYEA 3FJQE 1JLUE 4RMZA 2C6EA 2AC3A 3FC1X 1XQZA 3RINA 4AGWA 2ZM4A 5KX8A 4QTBA 3RMFA 2H34A 1OL5A 5C8NA 3R2BA 1ERKA 4JIAA 3D5XA 4G2FA 4WNKA 4RC2A 4YZCA 3SXSA 4D2TA 3OG7A 4JQ8A 2R3FA 3FMLA 4FV8A 4I0TA 3FMJA 4IW0A 3NNWA 5HCXA 3VUIA 3PPZA 3QX2A 4PQNA 1QCFA 4GT5A 4RA4A 3VUKA 3HDMA 5CXHA 3UMXA 4AE9A 5AP0A 4WT6A 3S0OA 4XOZA 5HEZA 3TG1A 4CKIA 1WVXA 5JT2A 2CKQA 5D41A 4D9UA 4FSYA 2PYWA 4MWHA 1PMEA 2EVAA 1XJDA 1CMKE 3DT1A 3EQGA 4KB8A 2YM7A 3SRVB 2QR8A 3WZDA 3ZLXA 3TV7A 3U54A 2OI4X 4D2VA 3GI3A 4AG8A 4NM7A 3ORPA 2CHLA 3CPBA 1SZMA 4AGUA 1H1WA 3DNEA 2B9HA 4JI9A 3W2SA 4CD0A 2VV9A 3D7TA 3MH0A 4FZ6A 3LHJA 3I79A 2HCKA 1LEWA 3BQRA 1T45A 5ETCA 3D14A 3VBWA 1FMKA 5A4TA 4TWNA 4R7IA 2CDZA 5AP5A 2XNMA 3QQGA 4JG6A 5AUUA 4IACA 3SHEA 1PXMA 4FTOA 5ANDA 5JZNA 4O7VA 3OOMA 4D4RA 3I6UA 3PVWA 3TL8A 1M2RA 3UNZA 4IEBA 4OTWA 3DKOA 3VULA 2WEIA 4KIOA 2F7ZE 4AE6A 4Y83A 2VTNA 3TZMA 4ZTMA 5CEQA 4LOQA 3BRBA 1SM2A 4F6UA 4Y5QA 2HK5A 5ITAA 4FGBA 5AR8A 3T9IA 1UNHA 5CSHA 2PL0A 1WZYA 2PVNA 3MFUA 4OTGA 4UMRA 4MXCA 3VO3A 1YXUA 3R9HA 2JDOA 4ZLZA 3Q52A 3BLQA 1F5QA 2UW8A 3O2MA 3NS9A 4E4MA 3WF7A 4F0IA 4MXAA 4PRJA 4KKHA 3PIXA 4Y46A 3S00A 4DTAA 1U5RA 4L67A 3KF7A 3R21A 4YHFA 3ZC6A 5HNIX 4FSQA 1QMZA 3HNGA 4E6DA 4JVGA 4JBQA 4YR8A 3I81A 4G16A 4MD8E 2RFEA 4KSQA 4PL4A 4DH8A 5HOAA 4ACMA 5KMNA 4DF3A 1LR4A 2F49A 1YKRA 4I41A 3BKBA 4R8QA 3FPQA 3AMBA 5M55A 4AWIA 4U3YA 1MQ4A 3FI2A 4V0GB 2JDSA 5LMBA 1URWA 1YWRA 4ZEGA 3PJ1A 4DE4A 1APME 2OO8X 2QQ7A 3BHVA 4WA9A 1V1KA 3FL4A 4YJRA 2JITA 4HVSA 5BUEA 5TO8A 5CWZA 2B55A 2EU9A 3DXQA 1CSNA 3NUPA 3FQEA 2OJGA 4JBPA 3NDMA 5AJQA 5DG5A 3AXWA 3CY2A 3EFWA 2OSCA 4BGGA 3MFRA 4ERKA 1KV1A 1OITA 2OICA 5H8EA 2OU7A 2YCQA 3DK6A 3FSFA 3QYWA 2R7IA 5AIRA 1H24A 2ESMA 3DNDA 3FHIA 2C0IA 1Q8WA 3QZHA 5IG1A 1TQPA 2WB8A 3MH1A 4YJQA 4EK3A 2XK7A 2ZV8A 4L3JA 4GJ2A 3E8EA 3BBWA 4FTNA 4I6FA 3GU6A 4G3DA 4CFUA 3FXZA 1LPUA 4MXXA 3C4FA 3OT8A 4KBCA 3CC6A 3SXRA 1V0OA 3ZZEA 5DNRA 2CLXA 3ET7A 3LJ1A 4O0YA 3W55A 1NT2A 3LE6A 3PUPA 1JAMA 1H01A 4K11A 4GFMA 4U6RA 4PTCA 1WBTA 3ETAA 4U97A 5EYKA 4HW7A 5KHWA 2B9FA 5HG5A 2BAKA 3EB0A 4F9WA 1PXOA 5A6NA 5LCJA 5A9UA 1H00A 3K5UA 3CPCA 4MXZA 3UOJA 3NPCA 4BY9E 2VO6A 4FTUA 5HU9A 4I5HA 4E6AA 4DHFA 4PTGA 4H1JA 2X7GA 3I4BA 3QA8A 1OPLA 3RCDA 1JOWB 5A54A 3TACA 1JBPE 2C1AA 4F0FA 1UKIA 4O6EA 4BWXA 5D7AA 2VNYA 2QHNA 2YCRA 4IIRA 5IA4A 1Q62A 2JKQA 4YC3A 5M57A 4O83A 1OUYA 4YZBA 3UDBA 4BCMA 2B52A 5LCKA 2XS0A 2WQMA 1GZOA 4BI1A 3DQXA 3O8UA 5AEPA 1KE6A 4Y5HA 5IA1A 1GOLA 1ZMUA 3AC8A 3DY7A 3KFAA 3KC3A 2B53A 4UWYA 3R8MA 3HP5A 5CAOA 5K5XA 4JT3A 5CU0A 2VWVA 2FH9A 3RK7A 4WRSA 3B8RA 5A6OA 2QU5A 1NY3A 4YHJA 4NM0A 3ZSIA 2J5EA 2VU3A 3UIXA 2PUUA 4FNWA 4CRLA 2OKRA 4ANLA 4ZLOA 5CF5A 4FV0A 1J7LA 4K6ZA 4KINA 4PV0A 4FUYA 5CU3A 5FEEA 3QL8A 3CTHA 3O96A 1ZAOA 1LEZA 2WIHA 3TEIA 4AOJA 4FEXA 4UBAA 5EQPA 3TTJA 4LV8A 2QVSE 3A7GA 1JVPP 3DDPA 3PVBA 4FF8A 3FZSA 4CSVA 1PMVA 2H6DA 2YM5A 5JQ5A 1U5QA 3RWQA 4YZDA 3D9VA 1URCA 2OF4A 4GT3A 3R22A 1PMNA 2PHKA 2VWIA 4XH6A 1JSTA 2I0VA 2FGIA 4GK3A 3JY9A 3VC4A 2CKPA 4BDGA 3CBLA 5KMJA 4DFNA 2GNFA 2XUUA 5E91A 3LMGA 4EQMA 2VGOA 2B0QA 3QFVA 4GKHA 3TNQB 4FKIA 4L43A 4IC7A 2YM8A 3FKOA 3GC0A 3B2WA 4I0SA 3VF8A 3G51A 2A1AB 3IW4A 4TWOA 4O86A 1P4OA 3PJCA 2G15A 4PDOA 4DBNA 2ZMDA 4H58A 5JGBA 2OBJA 4LM5A 4BIEA 1KSWA 3BWFA 3ZONA 4DG3E 4P7EA 3FLNC 1FMOE 3TDWA 5L2QA 3F2RA 4ITJA 3U9NA 2JFLA 3E7OA 4MNFA 2ITVA 2XP2A 4CG8A 3TKIA 3TTIA 1Y57A 1GZ8A 3GOPA 4IWOA 3WF6A 3ATTA 3AGMA 2Q0BA 4M8TA 1M14A 4L3LA 3R9DA 2F9GA 4GS6A 4G5JA 5E8YA 2ZB1A 4I4FA 3BYMA 1PKDA 2UW3A 2IZUA 3ENHA 4G9RA 4LGGA 1H27A 2W0JA 3PE2A 5EI2A 3AD4A 4EHVA 4XLIA 2VRXA 3R04A 4M0ZA 1XWSA 2I1MA 3OBGA 3LJ0A 4GU6A 4M12A 4X0MA 5CYIA 5AP4A 2C3LA 2PE2A 3E92A 2WEVA 5F4NA 5BVWA 2ITXA 2V7OA 5T6KA 2FSMX 2UZWE 3R8LA 4K9YA 5CAPA 3KRLA 5AV3A 3PRIA 4AACA 1B39A 5HU3A 2IN6A 3C13A 3PXFA 5AAFA 2G9XA 3UNJA 4BDAA 1G8SA 4HOKA 3P86A 4F7LA 4FG8A 4LQMA 5KMKA 4UMUA 2WQEA 4RC4A 5EM5A 3Q5ZA 3PE1A 5CQUA 2FYSA 2C1BA 2OJIA 3KULB 4DC2A 4GYGA 5CT0A 5AR5A 3TJDA 3NNUA 1M17A 4IAYA 3CTJA 4AGDA 3OTUA 4A07A 5JFWA 4XG8A 5AA9A 2OH4A 3OCSA 4AT4A 3QF9A 2WMTA 2XCKA 4M0YA 5I3OA 3L9LA 3W2PA 1WFCA 3HRCA 3HYHA 4DFBA 4A06A 5J1VA 3WOWA 4EK5A 4J97A 4F65A 2FO0A 1ZOEA 2G2HA 3F9NA 3F66A 5TF9A 3MB7A 2VTIA 3AC5A 3RBWA 2CMWA 3IW8A 3R8VA 1RW8A 2BRBA 3LFNA 4TYIA 1ZRZA 3UOHA 3RKBA 3KXMA 5EOBA 5DT0A 3ZOSA 2RIOA 4YTFA 4X2GA 3FZRA 4HJOA 1NVRA 4GEOA 2Z7SA 3DLSA 4UN0C 5HLWA 2HAKA 2QOQA 1K2PA 5DOSA 3BHTA 5FQDC 3RVGA 4D2PA 3QUDA 5CS6A 1IRKA 5DA3A 4F0GA 4RWLA 1WCCA 4RJ8A 1J1BA 5GJDA 4BI0A 4IMYA 2X4ZA 4IZ7A 3AT3A 3FDNA 4E20A 5M44A 2XJ2A 3OW3A 3UZPA 3U8WA 3P23A 3NX8A 2VTAA 4EOLA 2PMIA 2XZSA 4RIYA 2QG7A 3HMIA 3HZTA 2OXXA 2UVYA 2PPQA 1W7HA 4ZY6A 4AZSA 3KGAA 4XOYA 4C34A 2RG6A 4FK6A 4RBLA 4FIHA 4ZAUA 3QUPA 1FVVA 4O0RA 3F2NA 3W18A 4E5BA 4BDIA 4RLLA 5JZJA 4O0WA 3TKHA 2Y6OA 3QHRA 5BVNA 4W4WA 4DG0E 3T8OA 4JQEA 4O7SA 3QKLA 4L9IA 5AR2A 3MVHA 5K5NA 2C6TA 2VTHA 3VHEA 3MVJA 3NAYA 3QD3A 5J87A 4XS2A 3TT0A 3L1SA 3L8VA 2AUHA 3RM7A 2CKEA 4FL2A 2Z8CA 3HMOA 3DZQA 3SRVA 3QTZA 4GK4A 4TZRA 5J9ZA 4ITHA 4K0YA 5DGZA 3QCXA 3W32A 4DFUA 3PTGA 2BFYA 3W2QA 2E9UA 2BAJA 2C6LA 3HRBA 4V01A 3BYSA 5AUZA 5TOZA 1K3AA 1CTPE 2JKOA 4C8BA 4UZHA 2W1CA 2O0UA 4YJOA 4ERWA 3N4TA 3NVKI 4GG5A 2BAQA 5DR2A 3RJCA 2GDOA 2PVLA 5HE3A 5CU4A 4IX5A 3PYYA 3IKAA 2XNOA 4LGHA 4WUNA 4FEQA 5IEVA 3ALNA 3CSVA 2HWOA 3UPZA 4D58A 4UEUA 2EB3A 3W8LA 4E1ZA 4E7WA 3IK3A 3FKLA 3OTVA 4ZSAA 3KULA 1Q61A 4BHZA 4JS8A 4B8MA 4O0UA 2VN9A 2XNGA 1L3RE 3OUKA 4C59A 5IMXA 2VUWA 3GU5A 5K4IA 5FXSA 3OWLA 3SW7A 5IU2A 3MJ1A 5HGIA 4BWPA 3BV2A 4IDTA 3AOXA 4UMQA 3Q96A 3KVWA 3TNWA 3F82A 2ITTA 3GP0A 3EFKA 4U42A 5FBOA 4EOJA 3KY2A 3NW7A 4F9AA 4YC8A 4TNDA 4DCAA 4IM2A 1KE5A 4ACHA 2VTLA 3QYZA 2XRWA 2QNJA 5ETAA 3V8SA 4GUBA 3TUDA 4U40A 3QQUA 4F09A 1STCE 3NYNA 4X3FB 2IW6A 5DVRA 2PU8A 5IQHA 5EKOA 4U3ZA 3CR0A 3HV6A 2BDFA 4S2ZA 3R9OA 4PL5A 1H28A 4WSYA 5DPVA 3QKMA 4FV2A 4FSNA 3MPAA 2G2IA 4CFMA 2WMSA 1UNGA 1TVOA 1YDRE 1YI3A 4L8MA 4NJDA 4QQJA 4RJ3A 5E4HA 2ITPA 4QMPA 4I94A 5KO1A 4BB4A 4D4YA 3CKXA 1OIRA 4JAJA 3MIAA 3P08A 1HCKA 2QOFA 5B2KA 4CV8A 4KKGA 4F6SA 5KCVA 1ATPE 3T9TA 3BU5A 4FZDB 5C9CA 2FSTX 2JLDA 2QODA 2YM4A 5CI7A 2UVXA 3WZUA 4YLLA 2BRGA 3LLTA 1J3HA 4M69B 4I92A 1R3CA 3PJ3A 1MRVA 3FLSA 3KVXA 5L2SA 3Q4TA 3RWPA 5HLPA 2YCFA 2YIRA 4D0XA 4O22A 3AG9A 3N4UA 3AMYA 4NIFB 4G3EA 5LWNA 1JWHA 4M66A 2HOGA 4Q9SA 4MXYA 2PUIA 5K0XA 1PYXA 4DG2E 2CJMA 2QOHA 3FUPA 2WU6A 3LAUA 4WBBB 4GYIA 5A4QA 2X9FA 3ZO3A 4AGCA 4DT9A 4ALVA 2JGZA 2ACXA 3UYSA 3H30A 4XG3A 3V3VA 5EYMA 3R0TA 3GCSA 3OS3A 4R78A 3MDYA 4AZWA 3R00A 4YSMA 3QQFA 3IDCA 1M2PA 3ID6C 3KU2A 3AC2A 4IXPA 3RZBA 1P14A 1I44A 3H9RA 3F88A 2IVUA 4WBOA 4CCUA 4EHGA 2C3KA 3MV5A 4JRNA 2WTCA 3ENMA 4ZZNA 5JFXA 5KBRA 4U81A 4NIFA 3FL5A 1ZXEA 3R7VA 5C8MA 4EYJA 1WBVA 1SVEA 3PFQA 4BCIA 4EH3A 5JSMA 3ZS5A 1IA9A 2XIKA 4PUZA 4X2KA 4QP1A 3V01A 4IE9A 4IFGA 4O1OA 4EEVA 1PY5A 3KF4A 2QOLA 3V8WA 3VRZA 2OZAB 2XBAA 2XM9A 5LMKA 1W82A 3JXWA 4LG4A 5DI1A 4ZMEA 4UY9A 4BCGA 5BVDA 3OCGA 4XV9A 1PKGA 4W4YA 4AP7A 5EFQA 4FR4A 4RX7A 2VTQA 5FM2A 3LMIA 2O64A 4QMYA 4IJ9A 3Q5IA 3KB7A 2JD5A 4QO9A 4HGEA 1LUFA 4R7HA 4TL0A 4G17A 2YAKA 2PE0A 3NUSA 2CCHA 3NRMA 4ZTNA 4FTIA 2XA4A 3QGYA 4O2ZA 4DEDA 2G01A 4EH8A 4UWBA 3FWQA 1WBOA 4I5CA 2JC6A 5AR7A 5JN2A 2YABA 4EH7A 4RVKA 3VBTA 4AA5A 3C0GA 3F5XA 4YBKA 5AMNA 5FP6A 3ZMMA 5IEYA 2WMVA 5KKRB 1BI7A 4D1SA 1WBSA 4F7JA 3PXYA 2ZV7A 2YA9A 2IZSA 3HA8A 1VZOA 4TY1A 5BMMA 4HVHA 3GU7A 3IPHA 4U41A 3OT3A 3LIJA 4D9TA 4YJVA 4MEDA 4FUXA 3ODZX 3ZH8A 4DGMA 3VQHA 1MRUA 4PPCA 5LARA 2R2PA 4ZOGA 2BKKA 2QOBA 2SRCA 2VNWA 2Y7JA 4C4EA 3R8PA 4FKWA 1OMWA 3ULZA 4HYHA 4CQGA 5HORA 2PZPA 3I0QA 5CU2A 4FNYA 2E9OA 1KE8A 4L3PA 1U4DA 3UMWA 2P2IA 3DK7A 3MPMA 1J7UA 3G9NA 1H0WA 3GFWA 3PA3A 3V5WA 1O6KA 4EH4A 3BGQA 3QCSA 4QP6A 4DLIA 4RVLA 3V04A 4FTQA 3VUTA 2QLUA 2UUEA 3FAAA 4TYGA 3RK9A 2FUMA 4Z3VA 5CSXA 3UIMA 4F9BA 4YHTA 4MD9E 4MF1A 2Y4PA 2GQSA 5I9ZA 4ZSJA 3IW5A 3QRIA 5DT3A 3MH2A 5E7RA 2W4OA 2XYNA 4LUDA 3I1AA 1PXPA 4QMQA 3IO7A 3AC1A 2X8EA 2J5FA 1EH4A 2GQGA 2V62A 2PVKA 3HAVA 1H26A 3FZOA 4JXFA 1PYEA 4MQ2A 2J90A 3LFSA 5C4LA 4AW2A 1JSUA 4WRGA 3QA0A 4I6HA 3MPTA 3KKVA 2ZDTA 5HIEA 5BYZA 3PIZA 1SNXA 3L9MA 3VUDA 2FB8A 3H9OA 3Q9ZA 2E9NA 5BUIA 4EBVA 2E9VA 3ITZA 4NSTA 3SA0A 4G6LA 2PTKA 3L8PA 4QMOA 2PK9A 2OW3A 3Q9YA 4RPVA 3MWUA 3ZXZA 2YAAA 1DAYA 3OWPA 4BRXA 5IPJA 4O7TA 2XMYA 3SX9A 2RSVA 4GIHA 1F3MC 1ZMWA 4DINA 5J5SA 4GG7A 4BCFA 3COHA 4NK9A 3E64A 2IW8A 3E5AA 3WF8A 5HVKA 2W06A 5DRBA 2J0IA 3W2RA 3LMHA 2F2CB 4LMUA 4O7NA 3QBNA 2BCJA 5JKGA 1YXTA 4A9UA 2VO3A 3WZEA 4WG5A 3U9CA 4DTKA 3OHTA 2YIQA 1UKHA 3ZO2A 1Y6BA 3I0OA 4HPUE 3VIDA 4F6WA 1OL6A 3HECA 4YP8A 1XBCA 4ZTLA 1A48A 3I7CA 4WNOA 3CE3A 4X2NA 3RCJA 3NNXA 4H36A 2REIA 4PPBA 3ANRA 4I22A 4TXCA 5FTOA 1SNUA 2Y6MA 1UNLA 2WMWA 2BPMA 2PMOX 3BBTB 3K3JA 1XO2B 3NW6A 4ASZA 4ZY4A 2R3RA 2QHMA 4GFOA 4Y8DA 2XYUA 2IVVA 2A2AA 3D15A 1YDTE 2I6LA 4FL3A 2HY81 4U8ZA 4QMVA 3DKGA 3SVVA 3LQ3A 1H1RA 1OIUA 2BZIB 3QC9A 4YJSA 3UOKA 3KXHA 2Y0AA 2EXMA 3A7JA 2OGVA 3DCVA 4FKQA 2HWPA 2NPQA 3CP9A 2WGJA 2X6EA 3QQJA 3R1QA 4GK2A 4J71A 3ZLWA 3RALA 4YJTA 5EYCA 2DQ7X 3DPKA 4WG3A 1PHKA 5JK3A 4O84A 1YHWA 2ETKA 4QYFA 1OECA 3OWKA 4IANA 4RWIA 2V22A 5D1JA 2BZKB 5GIPE 2WQOA 2XK9A 1VR2A 5IQFA 4CMUA 3COKA 3UBDA 3UIBA 3FI8A 4EQUA 3EZRA 3FHRA 2WQNA 4I6BA 4XLVA 3FI3A 4WKQA 4RJ4A 4FTRA 2ITUA 3WYXA 5EK7A 5CTPA 5BYYA 3FLWA 4LL5A 2WIPA 4B99A 2XK3A 2HZ4A 1U54B 2J51A 2BTSA 3ZM9A 4V05A 4XJ0A 1OPJA 1B6CB 3KCFA 2YLFA 3QD4A 5AUWA 3ERKA 3BCEA 4YJNA 4AW5A 5L8LA 2QO2A 4O38A 4QRCA 4C3FA 3Q32A 4EORA 4BTKA 1YXXA 2R7BA 3FMHA 4J7BA 2QURA 4NH1A 3MH3A 4O7YA 4JNWA 3W2OA 3EMGA 1OL7A 2GSFA 3PXQA 2EXEA 4R1YA 4TTHB 3E7VA 5E9EA 2YFXA 4RFMA 2CSNA 3UQCA 4GMYA 3I6WA 2PVFA 3R8UA 4M97A 4UWCA 2UZTA 3UQGA 4F4PA 1FVRA 3COIA 2VX3A 1X8BA 3OCBA 4CTCA 5KBQA 1NXKA 3IG7A 4HYSA 3FQSA 3QX4A 3ZRLA 1M52A 2ERZE 3QQHA 3VW8A 2QOIA 4CNHA 4EL9A 4EZ7A 5M4IA 2PVMA 3LXKA 4C4JA 2YN8A 5HE1A 4BYJA 5GNKA 2B9IA 2EWAA 3QTIA 4WD5A 2W1FA 3BGZA 4MAOA 5HLNA 3P4KA 3ZFYA 3EL8A 4I5PA 4DT8A 5HTBA 1YOJA 2XKFA 4RQKA 5L4QA 5GZAA 4FKRA 3EN7A 4BR3A 5TE0A 3PDTA 5M08A 4UYAA 3Q4ZA 1CDKA 4IX4A 4LI5A 4FTAA 3ORLA 4UALA 2OK1A 3A61A 4FKGA 4YNEA 5F94A 4BDBA 4D2RA 3ZU7A 1PXLA 4FKJA 1M7NA 2W1EA 1OVEA 4YU2A 4HCTA 3KXZA 3JY0A 2VWUA 3OMVA 4L53A 3T3VA 2O2UA 3DLZA 2DS1A 2XIXA 3PJ2A 3FXXA 3UO5A 2WTIA 4FSZA 4NUSA 3VHKA 3PA5A 1R78A 4NFMA 3FI4A 4OUCA 4X6QC 4KABA 4QTDA 3O8PA 3TIZA 4YTCA 5IQBA 4FSMA 4FE2A 5CVHA 4BKYA 5L6WL 4RVTA 5E92A 4JDIA 3ALOA 4FKPA 3R7GA 3TNIA 2QCSA 4QP3A 4Q5HA 3WE4A 5IQIA 3PWDA 5DBXA 4EWHA 4FNZA 4ACCA 4F7SA 3BYVA 2UW0A 3ZM4A 3OW4A 3ZCLA 4C38A 2QO7A 3MSSA 4MBLA 3VW6A 1Z57A 3UZRA 2J7TA 3DBDA 4XG4A 4C3PA 4ZMFA 4BCPA 5AR3A 4GV1A 2QKWB 4CFXA 4D28A 2C6OA 2WELA 3HMNA 1H0VA 5BYLA 4CG9A 1ZY4A 3RPVA 3WARA 3BV3A 4BVUA 2UZOA 4ANBA 5EH0A 3E93A 5CXZA 2R0UA 2BTRA 5B0XA 5TT7A 2WAJA 2WTKB 1PJKA 1Y8YA 3CXWA 1XH4A 3HUCA 4FG7A 4JX3A 1OKZA 5DR6A 5JQ8A 1WMKA 1JSVA 1H08A 4L44A 2AYPA 4RJ6A 3T3UA 1OI9A 4RFZA 3ZC5A 3O7LB 2W5HA 3FMDA 1IA8A 4EOMA 2VWZA 3R1SA 1REKA 3HVCA 3PLSA 3C5UA 4FVQA 4M14A 2WOTA 4OW8A 4ONAA 3QQLA 4RRVA 3W10A 3DJ6A 4L45A 4DA5A 3C4XA 3G6HA 5ANEA 2YIWA 3TI1A 2QO9A 4OLIA 4ASXA 2GCDA 2ITOA 3BE9A 2I7QA 3C51A 4OR5A 4XV1A 2WPAA 1ZOHA 2UZDA 2XCHA 4DEEA 2VTTA 5L2IA 4F64A 4CVAA 1U46A 4GKIA 4A9RA 2LGCA 2C0TA 3C50A 3H3CA 3R9NA 4Q5EA 4X3FA 3BYOA 4RJ5A 3UZTA 4FIIA 1ZYDA 4NZWB 3TN8A 4C02A 4IZYA 2OXDA 4NW5A 3HAMA 1M7QA 3E3BX 3WYYA 2WMRA 4IWDA 2W4JA 2IO6A 3K5VA 4FSWA 4YJUA 4BDDA 5M4FA 3EZVA 3ORZA 4P5QA 2P4IA 3MYGA 3O71A 2NO3A 4J1RA 2JKMA 4KRCA 1H25A 2ITYA 5E1EA 2F57A 5TKDA 4G34A 3CQUA 5AAGA 1XBAA 2OIQA 4BIBA 3UIUA 4FT5A 2A4LA 2P55A 5AP2A 5I3RA 3QALE 3U87A 4AUAA 1P4FA 5GINE 3FMEA 3GBZA 2JIIA 3ZDUA 3QU0A 3EN4A 3R1NA 2WTVA 3C1XA 4XG6A 4QP4A 2GNLA 4XP0A 2C5OA 2R3LA 4P4CA 5FD2A 4NJ3A 2VTMA 1ZYCA 2C30A 3DGKA 4KWPA 4L00A 3PXRA 5FXQA 3CEKA 1WBPA 4C4IA 3DBQA 4O81A 5HZNA 1KUTA 3NW5A 4QP7A 5HO7A 4FIEA 3VJOA 4D4VA 4Q2AA 4L46A 3WIKA 4EOKA 3LXLA 5DEWA 5E8TA 5EM7A 2UW7A 3EH9A 2C6MA 1HCLA 3KN6A 4H05A 5GIOE 4FSUA 4YGAA 2XK4A 3OXTA 3V6RA 5DR9A 4I6QA 4DFZE 3LFQA 1YWVA 4I0RA 4LRKA 2LAVA 4YTIA 2VX0A 3NLBA 3ZO4A 2CKOA 4C57A 5IMEA 2PZRA 2VZ6A 1PXNA 2X39A 4XUFA 5KKRC 5AAEA 3VRYA 3LM5A 5FTQA 3MY1A 2W99B 4EC9A 4MK0A 4JR3A 3JVSA 3LQ8A 3LFCA 2XBJA 3O23A 4IB1A 4XRLA 4E6QA 5IDPA 2UZEA 3ORTA 3VS5A 4BDFA 3R6XA 3B2TA 4X2JA 2VWWA 3UYTA 4TW9A 4PDYA 3RNIA 3FY0A 4BICA 5CNNA 5LQFA 3VS7A 4DTBA 5CF4A 3PXKA 3G5DA 3QTWA 4EHZA 4FOBA 4M84A 1HOWA 2YERA 5FGKA 2OJJA 3M42A 2H9VA 3WF9A 2EXCX 3Q2MA 3KMUA 4ID7A 4RA5A 3F6XA 3ULIA 4WHZA 1Q99A 1ZY5A 4ANSA 4JDHA 2JDVA 4CXAA 3VN9A 5CALA 3OCTA 4IAIA 2HXQA 4EH6A 2GTMA 4FTCA 4ORKA 3RPRA 5GZ8A 1G8AA 2PY3A 3ZHPC 3KEXA 3RPYA 4CZUA 3C4WA 4YMJA 3JR1A 4FV1A 3SOCA 2OXYA 2BALA 3H9FA 5E1SA 2VTJA 1BKXA 2RKUA 1UU7A 3PJ8A 3W16A 1G5SA 1UWHA 5CSPA 1BI8A 5C01A 4FKLA 4A9TA 1WVYA 4ITIA 3UP2A 2CGWA 4PMMA 4FVRA 2C47A 3C0HA 4C7TA 4QNAA 4O82A 5LJJA 4O27B 3KXGA 4MD7E 5H3QA 4W8EA 5IQAA 1FINA 3EQHA 4X3JA 1YXVA 5AV2A 1ZMVA 4L42A 3IOPA 4FX3A 4RIOA 2ZOQA 4F70A 5E90A 4FZ7A 4A7CA 3EYGA 5ACKA 4YLJA 3JPVA 1Z5MA 4RQVA 4EK4A 4DITA 2R0IA 2J0JA 3GB2A 2R3MA 4FV7A 4O6LA 4U0IA 2QG5A 4C0TA 4DCEA 3OVVA 1JNKA 5CEMA 3B8QA 2FA2A 4XCUA 3GEQA 4EOIA 3CQWA 3CQEA 4TT7A 2PMNX 4N6YA 4HVGA 5HCYA 3GUBA 4JIKA 5IDNA 5LOHA 1DAWA 3CCNA 3GFEA 2HY0A 3P7BA 4FZAB 4F08A 2PVRA 4H3PA 2BDJA 2ZVAA 2BIKB 1KOAA 4YPDA 4DN5A 5CAQA 3OY3A 3QTSA 5CLPA 5AP1A 4BZDA 4C62A 5BVEA 3C0IA 2BIYA 2NRYA 3AD6A 3VUHA 4JDKA 4ZTSA 1XR1A 3DBFA 2H8HA 4QP9A 4QTEA 3QLGA 5BNJA 2PZ5A 3PY1A 3EQFA 5F95A 4N57A 1SYKA 1W98A 2UW5A 4FTLA 4BKJA 3LOKA 3IW7A 4LMNA 5HI2A 4YTHA 2YZLA 5A4CA 3QCYA 3E8DA 3JVRA 4YPSA 2C5YA 1VEBA 2WTKC 3QD0A 4ZSLA 3QRUA 3NAXA 2X7OA 4E4XA 3PY0A 1OIYA 3BI6A 3F5PA 3KCKA 4JLCA 4CFWA 4EOPA 4IM3A 5CSVA 5JRSA 1SVHA 1XH9A 5IKWA 4MKCA 1TQIA 2W1HA 3W33A 3PY3A 4WIHA 3ZEPA 4FKUA 2X6DA 2PE1A 1JQHA 4BCHA 4C33A 3HMPA 2UW4A 4ALUA 4FZFB 2DWBA 3G9LX 4DFYA 1VJYA 4L52A 4LRJA 1DS5A 3LQ5A 4XV3A 3TUBA 3QHWA 4PTEA 2GNIA 4J96A 5I9WA 3R7EA 4QMLA 2X2MA 4EUUA 4OT5A 4I20A 4FKVA 4JBOA 4XG2A 4Q9ZA 3FEGA 4TYHA 2QR7A 4W4VA 2CGXA 3FLZA 3NSZA 1KE7A 4X7QA 2ITWA 3ANQA 4Y85A 3MY5A 3W2CA 3LLAA 2WXVA 2ZYBA 2WMBA 5CU6A 5F1ZA 3ACJA 1Q8UA 1AD5A 2ZMCA 4M3QA 1FQ1B 3MESA 2ZJWA 4CLIA 3FV8A 1Z9XA 5GJGA 4FT0A 1OKWA 5J9LA 3TXOA 5AUXA 3FE3A 3BYUA 4GH2A 5EI6A 2BHEA 2XIZA 3EKKA 4ARKA 3DDQA 4BGQA 3UVPA 4LRMA 2XF0A 4IVAA 3OP5A 2GHGA 3GQLA 2BFXA 2OF2A 4PDPA 3HV7A 4NCTA 3DV3A 5L6PA 5CEKA 3ZRMA 4S32A 3ZBFA 4E26A 4BZOA 4ZTQA 3K3IA 2BZHB 3SLSA 3SOAA 5IQGA 3PP1A 2VD5A 2EUFB 1FGIA 3CLYA 5G1XA 5DWRA 4O1PA 2KTYA 4R3RA 4TRLA 4FYOA 5FDPA 4CGAA 4OT6A 2GHMA 5T3QA 3BEAA 3EN6A 1GY3A 3LJ2A 4BBEA 2QU6A 4JBVA 5FUTA 3P0MA 4PX6A 1BX6A 3AC4A 1PRYA 3CD3A 1ZLTA 3DAJA 4K33A 2RGPA 4DFXE 2YCSA 5IA5A 3U4WA 1FOTA 1ZYLA 3DU8A 3AMAA 4HGTA 3LFBA 3G0EA 3IS5A 1CKJA 3QTRA 5HTIA 1SVGA 2I0EA 1OM1A 3LFAA 3PVUA 3F69A 1KWPA 1XH8A 3GCQA 3MIYA 3ODYX 4HGSA 4PMTA 5FRIA 4IB5A 4LGDA 5CVFA 5EM6A 5C03A 5BVKA 5J7HA 3R63A 3U6HA 3P1AA 3FLYA 4V04A 3REPA 1YXSA 4TN6A 4ZJJA 1E1XA 4QYGA 1UVRA 3F5UA 5A3XA 3VJNA 5C1QB 4EONA 2P3GX 4P5ZA 4MF0A 1MP8A 5D12A 2ITZA 2XKEA 3DTCA 3AGLA 4D5KA 5CAUA 4EZ3A 4KIKA 5D11A 1BLXA 4X2FA 2BVAA 3U51A 1BL6A 2J4ZA 3ZBXA 3RP9A 3F61A 3MJ2A 5C8KA 4KS7A 4F1TA 4EJ7A 4AA4A 3CIKA 2WQBA 1W84A 4CV9A 3FBVA 2ZB0A 3PVGA 3HA6A 3GCVA 5M53A 5AM7A 3A60A 3EQBA 1FPUA 1J1CA 3VBYA 1OKVA 2PUNA 3G15A 3H0YA 3P79A 4RC3A 3U6JA 4PDSA 2C0OA 3NIZA 3PSDA 4GCJA 4QMSA 4FEVA 2B9JA 2Z2WA 4O0SA 2Z7LA 2CNUA 5CF8A 5FTGA 4IFCA 3GU8A 2W9ZB 2NRUA 4PMPA 1K9AA 4RFYA 4BCJA 5HG8A 3MW1A 4DEBA 4RJ7A 3FMKA 3MA3A 3DQWA 5HX6A 5AP6A 4BDJA 1BL7A 5AWMA 2GQRA 3KRXA 4GVAA 4YBJA 4N70A 5DIAA 4ZY5A 5AV4A 5F20A 4QYYA 4AOIA 4PMSA 2XNNA 3NCZA 5EDPA 3EFJA 3EN5A 2VAGA 4YUQA 4ZS4A 4LOOA 5ICPA 3JS2A 2FSLX 4FC0A 4FV6A 5C4KA 5BUJA 3O50A 2O63A 1BUHA 4QTAA 3UGCA 3ORXA 3PA4A 4XBUA 2C6IA 4RIXA 1NW1A 5E8ZA 1GJOA 3F7ZA 3C4CA 4AOTA 5CT7A 5C26A 3V5TA 1PXJA 4RIWA 4HNIA 3NGAA 4IX3A 1R1WA 2VWXA 4DH3A 2YZAA 4HYUA 5BPYA 4USEA 3HX4A 5J95A 4QQ5A 5HO6A 4GSBA 2BKZA 4BCQA 4LFIA 5AUYA 2WMUA 4OAVB 4Y95A 4C4GA 1PMUA 4RX9A 4IZ5A 2G2FA 4IH8A 4B7TA 4TPTA 3BHYA 3R7IA 2IVTA 3BU6A 4XG7A 4F9YA 5AUTA 2J0LA 2UZNA 4U5JA 4PWNA 2I0YA 2FSOX 3NEWA 3Q04A 1Y91A 1AGWA 4IVDA 4JAIA 2CN5A 3TIYA 3UG2A 5CENA 4ZJIA 3UPXA 2QKRA 4FTKA 3UE4A 4JQ7A 2R3OA 4QTCA 3LXNA 5BVOA 4M13A 5L8KA 5AX3A 4TWCA 3WZJA 5A46A 3KREA 4P90A 2XH5A 4RIXB 4TYEA 5B2MA 3RHKA 2YEXA 4AS0A 3KXXA 2R3GA 3DXNA 4FKTA 1Q8ZA 2YDKA 5JFSA 4NM5A 2DYLA 4ZSEA 4CYJA 2PVJA 2XVDA 3SKCA 3PPKA 5CASA 4E3CA 4AT3A 4MNEB 4B8LA 1G3NA 3SGCA 4ANMA 3KRRA 5CAVA 2CGVA 4EI4A 4BDHA 2C6KA 1YDSE 2XIRA 3ZFMA 3HKOA 4DH7A 2JBOA 2GFSA 3SDJA 4EWQA 5LVLA 4CKJA 2Q83A 4O96A 3L9NA 4USDA 3I5NA 1KV2A 5AV0A 4KKEA 4DFLA 3OBJA 2RFNA 5HTCA 2J9MA 3OXIA 2W96B 5J7BA 3Q4CA 2DUVA 4ZXTA 3ZLSA 3WBLA 3QWJA 3RGFA 4QPSA 4R3CA 3OZ6A 3LCOA 3MTFA 4APPA 3SG8A 5DT4A 4MXOA 4A9SA 4O7ZA 2YWVA 2Y4IB 2YM6A 4C4HA 3QRJA 5HBEA 3WI6A 4W8DA 5JMSA 4C36A 5LWMA 2XNBA 3MY0A 5AX9A 5K0KA 3O51A 5KZIA 3VBQA 2JAVA 1YW2A 4QMUA 1YI6A 2OH0E 1XH6A 3VUMA 3Q53A 3K54A 2XJ0A 1Q8YA 3SC1A 4YZMA 3R8ZA 4BTMA 3E8CA 4KIPA 5ETIA 4PNIA 3C4ZA 2BRMA 2YDIA 4ANNA 2IZTA 2PVYA 4IWPA 4PY1A 5E8WA 5CVGA 5AFVA 3HV3A 3EOCA 4ASEA 3O8TA 5D9HA 4EK8A 5D7VA 4L01A 4BZNA 5AP3A 2WMAA 2YISA 3AD5A 3BU3A 3PWYA 4DEGA 1I09A 2F2UA 2UW6A 2WMQA 2KULA 4DGLC 4EKLA 3QKKA 4PP9A 4CZTA 5I5ZA 4J8MA 2IPXA 2OZAA 3EQDA 5DE2A 5IUHA 4BTFA 4TYJA 3FSKA 2QD9A 1JKTA 3CTQA 4E5WA 5BQ0A 5DMZA 5M4CA 1ND4A 2XNEA 3L8XA 4IZAA 1YQJA 2W1IA 4J98A 4JG8A 3VF9A 4DEHA 3IONA 4FIGA 3UTOA 4RIWB 2CNQA 2GMXA 4K8AA 2I0HA 4GVJA 3R7UA 5FEQA 3V51A 3D7TB 5I9UA 3LZBA 4O2PA 3W1FA 1IAHA 3ZO1A 4YNOA 5I9YA 3QC4A 2IG7A 5I0BA 1DM2A 2UW9A 2PMLX 3AT4A 3LVPA 3V5LA 4P2KA 4NW6A 3Q6WA 3QZIA 5EHOA 3KMWA 1CKIA 3ZUUA 3Q9XA 1GZNA 2YM3A 2J50A 4W9WA 3RAKA 3UJGA 4G3CA 1S9IA 3KK8A 3UVQA 1ZYSA 5KMIA 5EKNA 3D2IA 2W5AA 4IDVA 4O0TA 4CFVA 4D55A 3EQIA 4FL1A 3HEGA 3QCQA 3VUGA 3UNKA 4HPTE 2GNGA 1Q97A 2J0KA 2PVHA 3UO4A 3O17A 2O65A 3CJGA 3R02A 2ZM1A 3CY3A 4J99A 3JUHA 5LVPA 2C4GA 3I5ZA 4FIFA 5A14A 2UVZA 5TR6A 4GT4A 3QZGA 3DXPA 1A06A 2XEZA 2QOKA 3S95A 4AW0A 2OLCA 2XKCA 2PSQA 5E8SA 4D4SA 1YHVA 4N4SA 3RNYA 2HXLA 2F4JA 1JKLA 4B4LA 3F3ZA 3MFTA 5D10A 1Q3WA 4GRBA 2BROA 2AC5A 1BYGA 3PSCA 4FODA 3A4OX 4KBKA 3MTLA 3OEFX 3TNHA 3PPJA 2J0MB 1O6LA 5K9IA 4CTBA 2R4BA 2RFDA 3POOA 4A4XA 4E6CA 4FTTA 2JIVA 3LCSA 4WOVA 4Z16A 5M4UA 2R3HA 4G9CA 5HHWA 3GU4A 2FVDA 4EOOA 5M07A 4X6RA 4RG0A 2QOOA 2JDRA 4HCUA 2BRHA 4QMZA 4QMXA 3OROA 4EH5A 2VWYA 1XBBA 5EOLA 5CI6A 4DGOA 3G33A 3UQFA 3BIZA 2VTSA 3WE8A 2J6MA 5HCZA 2Y9QA 3KQ7A 2CCIA 1ZOGA 4PPAA 4UX9A 5DN3A 1R39A 5FM3A 2A0CX 3EWHA 3G2FA 4EJNA 3U55A 1YOMA 2B7AA 3F5GA 4AW1A 4EH9A 2V5QA 4NT4A 1LP4A 1RJBA 3IDBA 3MN3A 4PL3A 3O7LD 3LM0A 3A99A 3I7BA 4FT7A 4A9YA 1IASA 3A8XA 3H10A 4BCOA 4ZJVA 3UO6A 4FSRA 1QPCA 5LMKC 3D5UA 1J7IA 3VWAA 1R0EA 4EC8A 2XK8A 4F99A 4OTFA 4AN3A 4M7IA 4EK6A 1SMHA 1MQBA 2RL5A 1REJA 4IVCA 4F9CA 2B4SB 3QRTA 5LVMA 3TUCA 3KA0A 1CM8A 3RAWA 5FBNC 3QZFA 2HZNA 5IH4A 2OJ9A 3FZTA 1VYZA 4FT3A 5HICA 4WO5A 4MTAA 5EW3A 5HX8A 1E9HA 4U7ZA 5CANA 4I21A 4EHEA 4U9AA 2CN8A 4K1BA 4CT1A 1Y6AA 3RPSA 5M51A 3DA6A 3M2WA 4O91A 4WUAA 4Z55A 4BBMA 3LCTA 2X2LA 4FI1A 5HBHA 3HMMA 4QPMA 5L2TA 3N4VA 5DH3A 4QYEA 3I60A 4FIJA 1ZZ2A 2HW6A 3IGOA 2CPKE 3BPRA 4QQTA 4M69A 3Q4UA 5IA3A 5EQYA 1KOBA 3GENA 1Q41A 4I3ZA 4AXAA 3HGKA 3TCPA 4WNPA 5KE0A 1YOLA 1UU8A 5AV1A 1GZKA 4KNBA 3QXOA 3DJ7A 3CGFA 4NWMA 3BQCA 4Y73A 4ZIMA 4R1VA 2Z7QA 4O7WA 5CQWA 1H1QA 4TWPA 5IEXA 4PF4A 4OBPA 4YJPA 4YZNA 4FEWA 4QMWA 4KUJA 3OFMA 4JG7A 3RI1A 3QRKA 4XMOA 4XEYA 1WAKA 1MUOA 3Q9WA 3HLLA 4M68A 4O21A 4AQCA 4I4EA 1OZ1A 5FDXA 4AT5A 3EIDA 2GU8A 1DI9A 2XKDA 2O8YA 4EBWA 2XB7A 2WHBA 3AC3A 4KSPA 4BF2A 4CLJA 4CT2A 4B0GA 4HCVA 5AA8A 2GS2A 1O6YA 3LCKA 4KAOA 4DEAA 3NUAA 3D4QA 4HZRA 3KL8A 2B1PA 3R2YA 1PXKA 3FLQA 2QC6A 3SW4A 3BELA 4L68A 2GPHA 3KRWA 3FYJX 4JOAA 1T46A 5H8BA 1H07A 4M15A 4BGHA 1S9JA 4RVMA 2P0CA 3KN5A 5HIBA 1ZZLA 3L8SA 4IC8A 4FMQA 4CMTA 1GIJA 2ZAZA 3ORIA 3NNVA 1WBNA 4OTHA 3ZTXA 5J79A 5DYJA 4ZK5A 2X8DA 2HIWA 4XP3A 5ANKA 1TQMA 2X8IA 3D5VA 2ETRA 3IQ7A 3KXNA 4UZDA 3R73A 5KZ0A 4BI2A 3MA6A 2OFVA 3EYHA 3BHHA 4R5SA 4XX9A 5HKMA 4AFEA 3QTQA 5FLFA 3W8QA 4BIDA 4O7RA 3A2CA 2X7FA 4LYNA 3TV4A 4ANOA 3PG3A 3LKMA 5JH6A 2H96A 4QMTA 2JKKA 4EKKA 1GNGA 4OBOA 5K4JA 1Q8TA 3OXZA 5AP7A 4C2WA 4G5PA 3VAPA 2ONLA 3FQHA 3II5A 1M2QA 4R77A 5IZFA 3QLFA 5IF1A 2BDWA 4DYMA 2UV2A 4R7BA 2WO6A 3KMMA 3P5KA 4BDEA 4OTIA 2R3QA 4FK3A 4DEIA 3BLHA 4K77A 5H2UA 4C37A 3EL7A 1ZWSA 2XNPA 3COMA 3F3UA 3OEZA 4FV4A 5I9XA 2OWBA 4S31A 4MYGA 3M1SA 1NVQA 3LFDA 4ALWA 1FVTA 2HW7A 4GFGA 4OAUC 2X1NA 4GJ3A 4JL9A 5H9BA 1NVSA 4IJPA 2CNVA 3LFEA 5ANIA 4C61A 5JGDA 3EQCA 3PRFA 4O0XA 4FEUA 4CZYB 4Z7HA 3BX5A 2EB2A 5IH6A 4FYNA 2PULA 4TYHB 1WBWA 2NNWB 5HO8A 3OY1A 3NMUF 3WF5A 2F7EE 3A8WA 3LW0A 4NM3A 4B9DA 3PZEA 3CD8A 5M56A 3F2AA 1UU3A 3DBEA 2ZV2A 1Q4LA 2OJFE 1GAGA 3ACKA 3DB8A 4LL0A 4AZVA 3DFAA 3C4EA 2XK6A 3P78A 4R6VA 5EI8A 4ASDA 4D2WA 4F7NA 3E62A 3F3TA 5LVNA 3QTXA 1GIHA 3TZ8A 5JEBA 3AT2A 4MVFA 4NKAA 4BN1A 4HVIA 5FP5A 3QTUA 5DEYA 4IADA 3EJ1A 3TZ9A 4RSSA 5E8VA 3TDVA 3C7QA 3DFCB 3IGGA 4Y72A 3MVLA 4ACGA 4HZSA 5FEDA 4NFNA 4L7FA 1OIQA 3NUNA 3QGWA 3ELJA 3GVUA 4IAFA 3ZSGA 4AZTA 4EQCA 2PZIA 3OWJA 5L6OA 4RLKA 5HD4A 4JR7A 2HZ0A 4RIYB 2B54A 2XIYA 3A62A 5EDRA 5H8GA 5HE0A 5CEPA 4E73A 3G0FA 5AR4A 1Q5KA 3OC1A 4QP8A 3U4UA 4H39A 4U45A 3VS0A 4IQ6A 4XHKB 3UC3A 2WOUA 4DGGA 3NUYA 3ZUVA 4LUEA 5DLSA 3ROYA 4D2SA 4O0VA 3D5WA 4IB3A 3SG9A 5IQDA 5EW9A 5EW8A 4C58A 2W05A 3FXWA 3NCGA 1IR3A 3F3WA 3OUNB 5EHYA 4G6OA 3V5PA 4C3RA 3BEGA 2IWIA 2YACA 3GT8A 4FTMA 4FV5A 4N0SA 4TKSA 4WSQA 4IAZA 1UV5A 2C5VA 4FV9A 4J95A 3V5JA 4ZZMA 3D7ZA 1TKIA 3GC7A 5BMSA 3DB6A 5J8IA 4LV5A 3U6IA 3DZOA 2YWPA 5HE2A 4X3FC 5CNOA 4AU8A 1B38A 2R3NA 3NUUA 4G1WA 4MBIA 3TKUA 3KRJA 2JBPA 1H8FA 1QL6A 3RM6A 4U44A 1F0QA 5ANJA 4KS8A 3FZ1A 3EFLA 5LXMA 3OD6X 3P7AA 5ACBC 2C69A 4MQ1A 4F1MA 2F7XE 4FSTA 3RTPA 4ENYA 4FOCA 3DOGA 4YO6A 3D0EA 3IECA 3OF0A 4NU1A 4E5AX 2V55A 2VO0A 2VTPA 2A19B 5IA2A 4CCBA 3D94A 3GNIB 4H1MA 3H4JA 3GXLA 3N9XA 5HNBA 5HG7A 3EN9A 5E8UA 2VTRA 5KUPA 5I4NA 2IJMA 3A7HA 3S3IA 1QPDA 3R7YA 2ITQA 4X21A 4AAAA 4J8NA 1FBNA 1MRYA 5EQEA 3JYAA 3VQUA 3S2PA 2C68A 3E8NA 1OBGA 1O9UA 2Q0NA 3S1HA 4FBXA 5DHJA 3R01A 2R64A 4GL9A 4OBQA 5DRDA 2WMXA 2CLQA 4UV0A 4KIQA 3SD0A 4D5HA 4BL1A 2JEDA 4GUEA 3VNTA 4ZS0A 1XKKA 4ACDA 4FKOA 4IX6A 4BDKA 3VS3A 3ROCA 4C2VA 2BR1A 2YITA 1U59A 4KIKB 5AUVA 2W5BA 1RQQA 3LPBA 4AZEA 3BLRA 4OGRA 5G6VA 2ZM3A 3UG1A 1U54A 4AZFA 4UB7A 2VWBA 1XH7A 4BTJA 5KNJA 4BBFA 1J91A 4CFFA 5HD7A 2Z60A 3ZEWA 3VVHA 4DLJA 4AX8A 3BZ3A 5CEIA 3TJCA 3UP7A 3HV5A 1VYWA 2RG5A 4QMNA 2OIDA 4H3BA 5DFPA 4EYMA 3P9JA 3GCUA 4QD6A 4CRSA 2E2BA 4CYIA 5HIDA 2ITNA 3TM0A 2C6DA 3K2LA 4FNXA 3GOKA 4IWQA 3D83A 4BC6A 5LVOA 2HZIA 5EYDA 3WZKA 2Y8OA 2WZJA 3MB6A 4A4LA 5HNGA 3Q60A 2W4KA 2GTNA 3PSBA 4QMMA 4WG4A 2C5XA 3DAKA 4N6ZA 5CZIA 4QPAA 2A27A 3EQPA 4XYFA 3DTWA 1JPAA 4BKZA 3S4QA 1JKSA 3UODA 3VS1A 3BGPA 2W17A 2BHHA 4FT9A 2Z7RA 4RWKA 4UMPA 3DJ5A 3SV0A 4IAKA 2Y4IC 4G3FA 3PIYA 4ZLYA 4KBAA 4L7SA 4QNYA 3SAYA 3RAIA 5GJFA 3FZPA 5EDQA 3LFFA 2XRUA 3ZUTA 4B6LA 4DAWA 4FGRA 1V0BA 3LCDA 4EH2A 2UZLA 3CKWA 2HENA 3R7OA 4C35A 3NR9A 4S30A 4FKSA 4CMOA 2QLQA 5IA0A 1XH5A 5GHVA 2WTDA 3TV6A 4R3PA 3R71A 5EM8A 4BDCA 2O5KA 2OFUA 2YDJA 3E88A 4YSJA 4I5MA 4XG9A 4UXQA 2ZV9A 2ZDUA 3HDNA 4V0GA 4NKSA 3EQRA 2R5TA 3MI9A 4TNBA 3Q2JA 2XJ1A 3UC4A 3OOGA 5IQEA 4DH1A 5KMOA 5A4LA 3L9PA 4F1OA 4FA2A 1RE8A 2ONLC 2VGPA 2IVSA 4G31A 2UZVA 1GIIA 3IDPA 3WILA 1UA2A 4QQCA 1YHSA 2HYYA 3NVMB 1DI8A 4RT7A 3FY2A 3TZ7A 1OPKA 4AA0A 2IZRA 2Z02A 2XM8A 3NUXA 4ZTRA 5FG8A 1RDQE 4R5YA 3QXPA 3SXFA 3DAEA 1H4LA 3ZSHA 2VX1A 4KRDA 4IB0A
chains in the Genus database with same CATH superfamily
3KK9A 4S33A 2R3IA 2IW9A 2RFSA 1PW2A 4EOSA 2NP8A 1CKPA 4MBJA 5BX0A 3QAME 4YC6A 2BUJA 4YO4A 3GQIA 4H3QA 3PP0A 1V0PA 3ZYAA 3DS6A 4AN9A 2C3IB 3FKNA 2I40A 3R9RA 4ZZOA 3E87A 3VBXA 4FVPA 3C9WA 3POZA 5KMLA 5HQ0A 3F7WA 3WIGA 5AADA 4U80A 2GS6A 4MNEA 4HNFA 2C3JA 4GW8A 4ZP5A 4WNMA 2BILB 1QPJA 4HGLA 4RX8A 4OTPA 3HV4A 4FG9A 4D1XA 3NZ0A 4RGJA 2RF9A 3TNPC 2PWLA 4II5A 2WU7A 5HVJA 4K2RA 3FYKX 4NEUA 5CZHA 4UMTA 2CGUA 2XEYA 3BE2A 3FMMA 2PZYA 3FC2A 1P5EA 4K18A 5IH5A 5J9YA 1W8CA 5IQCA 1UWJA 4NCTC 2C5NA 5HESA 3Q3BA 3NYOA 5EHLA 2O3PA 4JJRA 4W9XA 4D1ZA 3MVMA 4ENXA 4MCVA 2W1ZA 5HG9A 5CX9A 4CQEA 3F3VA 1Q3DA 3FMNA 3MBLA 4IM0A 4UYNA 1W83A 3VS4A 3NWWA 4I24A 4IBMA 4XBRA 3V5QA 3VS6A 5KHXA 2VO7A 3RHXA 1JKKA 3PXZA 4BCNA 2X9EA 4XV2A 4EOQA 3C5IA 3P7CA 1FGKA 1IEPA 3MS9A 4MH7A 5GZ9A 4E4NA 2P2HA 2R3JA 2OG8A 4I23A 4MX9A 4QP2A 3RK5A 4A4OA 4HVDA 2GHLA 1ZYJA 4CFNA 5M09A 3A7IA 4EUTA 4RX5A 3CJFA 4XP2A 3HL7A 2QOCA 3NIEA 2QONA 3IOKA 3QQKA 3M11A 4XRJA 3N51A 2YJRA 5F9EA 5IISA 4J53A 5E8XA 5KMMA 4OTRA 4IHPA 4KD1A 2GNHA 3V6SA 2V7AA 3AQVA 2W1GA 2W9FB 1WVWA 4OTDA 4PNKA 3BWJA 5I9VA 4AXEA 2R9SA 3R83A 4NL0A 1OL2A 3E63A 5B2LA 4W4XA 1Q24A 3HUBA 3UOLA 2WTJA 4HYIA 4DH5A 1ZARA 2UZUE 4ZTHA 3CS9A 5L8JA 2X4FA 4APCA 2PUPA 1W0XC 4FICA 3Q6UA 5FXRA 1E1VA 2P33A 1YWNA 3LXPA 4Z9LA 4GU9A 2ETMA 4DBXA 3HP2A 4I93A 3H0ZA 2X2KA 2R3PA 2YIXA 3GGFA 1XHAA 2YIYA 3DK3A 3QD2B 4J52A 4OTQA 4ZSGA 3A4PA 1BMKA 3MGYA 4JDJA 4JX7A 3VBVA 3G6GA 3W0OA 5J5TA 4O4DA 3ZZWA 1QPEA 2QI8A 2YHVA 3R30A 4ANQA 5HVYA 4BWKA 3G90X 3NYVA 2E9PA 2WNTA 2OZOA 1OUKA 4E93A 4I1ZA 4RWJA 5L3AA 2J2IB 3ORNA 4G6NA 5FWKK 3ZLYA 3HRFA 4AF3A 1YVJA 2G1TA 3FPMA 3PG1A 4BHNA 1YRPA 1OL1A 2JDTA 3E3PA 2GFCA 5IUIA 1YI4A 3SQQA 3A7FA 3PLAE 1NA7A 5JRQA 3TWJA 5JGAA 1IAJA 2UZBA 4PP7A 1R0PA 2JAMA 4IVBA 1IG1A 5IUGA 1Y8GA 2HELA 3THBA 3ZXTA 4BFMA 3V8TA 2JIUA 3ORKA 2WTWA 4YZ9A 4EZ5A 5A4EA 1AQ1A 4U79A 4FTJA 3RAHA 3PZHA 3BHUA 3R1YA 3GCPA 3UVRA 2W7XA 3ORMA 2BRNA 1H1PA 4O7LA 5AM6A 4RZVA 3RPOA 4F63A 3GC8A 4KA3A 5AIKA 3DBCA 1A9UA 2VTOA 3ZDIA 3QWKA 1OKYA 3D2KA 4NTSA 4QT1A 4YLKA 5EG3A 5B7VA 2W1DA 2V0DA 4NTTA 3ZFXA 4YURA 3CGOA 4DGNA 3EKNA 4QOXA 1PF8A 2X0GA 5CSWA 5HBJA 4RZWA 4AN2A 4AFJA 4L6QA 1OGUA 2BZJA 3IW6A 3MFSA 5C27A 4E4LA 3DKCA 4MWIA 5CF6A 1H1SA 1OBDA 5BVFA 2YJSA 3QUEA 4CKRA 3ATSA 4D0WA 5M06A 4BCKA 2GS7A 4JRVA 3O0GA 4U43A 3RZFA 2BMCA 1OB3A 2R3KA 2YLEA 3DKFA 4CEGA 4C4FA 1UU9A 2GNJA 2JFMA 4M67A 3NYXA 1KE9A 4BYIA 2WD1A 4FV3A 4Z7GA 5L2WA 4IAAA 4G3GA 5J1WA 4S34A 2OIBA 2ERKA 3VS2A 1PXIA 3GC9A 4GIIA 1L8TA 1TZDA 3R28A 5ANOA 4UXLA 4E8AA 3ZRKA 4QYHA 4MHAA 5K3YA 5LMAA 3EHAA 1P2AA 5T68A 4XNEA 5ETFA 4USFA 2WKMA 5CY3A 5ANGA 4LOPA 2WFYA 2X81A 5JFVA 5CEOA 4NYEA 3FJQE 1JLUE 4RMZA 2C6EA 2AC3A 3FC1X 1XQZA 3RINA 4AGWA 2ZM4A 5KX8A 4QTBA 3RMFA 2H34A 1OL5A 5C8NA 3R2BA 1ERKA 4JIAA 3D5XA 4G2FA 4WNKA 4RC2A 4YZCA 3SXSA 4D2TA 3OG7A 4JQ8A 2R3FA 3FMLA 4FV8A 4I0TA 3FMJA 4IW0A 3NNWA 5HCXA 3VUIA 3PPZA 3QX2A 4PQNA 2X0OA 1QCFA 4GT5A 4RA4A 3VUKA 3HDMA 5CXHA 3UMXA 4AE9A 5AP0A 4WT6A 3S0OA 4XOZA 5HEZA 3TG1A 4CKIA 1WVXA 5JT2A 2CKQA 5D41A 4D9UA 4FSYA 2PYWA 4MWHA 1PMEA 2EVAA 1XJDA 1CMKE 3DT1A 3EQGA 4KB8A 2YM7A 3SRVB 2QR8A 3WZDA 3ZLXA 3TV7A 3U54A 2OI4X 4D2VA 3GI3A 4AG8A 4NM7A 3ORPA 2CHLA 3CPBA 1SZMA 4AGUA 1H1WA 3DNEA 2B9HA 4JI9A 3W2SA 4CD0A 2VV9A 3D7TA 3MH0A 4FZ6A 3LHJA 3I79A 2HCKA 1LEWA 3BQRA 1T45A 5ETCA 3D14A 3VBWA 1FMKA 5A4TA 4TWNA 4R7IA 2CDZA 5AP5A 2XNMA 3QQGA 4JG6A 5AUUA 4IACA 3SHEA 1PXMA 4FTOA 5ANDA 5JZNA 4O7VA 3OOMA 4D4RA 3I6UA 3PVWA 3TL8A 1M2RA 3UNZA 4IEBA 4OTWA 3DKOA 3VULA 2WEIA 4KIOA 2F7ZE 4AE6A 4Y83A 2VTNA 3TZMA 4ZTMA 5CEQA 4LOQA 3BRBA 1SM2A 4F6UA 4Y5QA 2HK5A 5ITAA 4FGBA 5AR8A 3T9IA 1UNHA 5CSHA 1W2FA 2PL0A 4QDEA 1WZYA 2PVNA 3MFUA 4OTGA 4UMRA 4MXCA 3VO3A 1YXUA 3R9HA 2JDOA 4ZLZA 3Q52A 3BLQA 1F5QA 2UW8A 3O2MA 3NS9A 4E4MA 3WF7A 4F0IA 4MXAA 4PRJA 4KKHA 3PIXA 4Y46A 3S00A 4DTAA 1U5RA 4L67A 3KF7A 3R21A 4YHFA 3ZC6A 5HNIX 4FSQA 1QMZA 3HNGA 4E6DA 4JVGA 4JBQA 4YR8A 3I81A 4G16A 4MD8E 2RFEA 4KSQA 4PL4A 4DH8A 5HOAA 4ACMA 5KMNA 4DF3A 1LR4A 2F49A 1YKRA 4I41A 3BKBA 4R8QA 3FPQA 3AMBA 5M55A 4AWIA 4U3YA 1MQ4A 3FI2A 4V0GB 2JDSA 5LMBA 1URWA 1YWRA 4ZEGA 3PJ1A 4DE4A 1APME 2OO8X 2QQ7A 3BHVA 4WA9A 1V1KA 3FL4A 4YJRA 2JITA 4HVSA 5BUEA 5TO8A 5CWZA 2B55A 2EU9A 3DXQA 1CSNA 3NUPA 3FQEA 2OJGA 4JBPA 3NDMA 5AJQA 5DG5A 3AXWA 3CY2A 3EFWA 2OSCA 4BGGA 3MFRA 4ERKA 1KV1A 1OITA 2OICA 5H8EA 2OU7A 2YCQA 3DK6A 3FSFA 3QYWA 2R7IA 5AIRA 1H24A 2ESMA 3DNDA 3FHIA 2C0IA 1Q8WA 3QZHA 5IG1A 1TQPA 2WB8A 3MH1A 4YJQA 4EK3A 2XK7A 2ZV8A 4L3JA 4GJ2A 3E8EA 3BBWA 4FTNA 4I6FA 3GU6A 4G3DA 4CFUA 3FXZA 1LPUA 4MXXA 3C4FA 3OT8A 4KBCA 3CC6A 3SXRA 1V0OA 3ZZEA 5DNRA 2CLXA 3ET7A 3LJ1A 4O0YA 3W55A 1NT2A 3LE6A 3PUPA 1JAMA 1H01A 4K11A 4GFMA 4U6RA 4PTCA 1WBTA 3ETAA 4U97A 5EYKA 4HW7A 5KHWA 2B9FA 4O4BB 5HG5A 2BAKA 3EB0A 4F9WA 1PXOA 5A6NA 5LCJA 5A9UA 1H00A 3K5UA 3CPCA 4MXZA 3UOJA 3NPCA 4BY9E 2VO6A 4FTUA 5HU9A 4I5HA 4E6AA 4DHFA 4PTGA 4H1JA 2X7GA 3I4BA 3QA8A 1OPLA 3RCDA 1JOWB 5A54A 3TACA 1JBPE 2C1AA 4F0FA 1UKIA 4O6EA 4BWXA 5D7AA 2VNYA 2QHNA 2YCRA 4IIRA 5IA4A 1Q62A 2JKQA 4YC3A 5M57A 4O83A 1OUYA 4YZBA 3UDBA 4BCMA 2B52A 5LCKA 2XS0A 2WQMA 1GZOA 4BI1A 3DQXA 3O8UA 5AEPA 1KE6A 4Y5HA 5IA1A 1GOLA 1ZMUA 3AC8A 3DY7A 3KFAA 3KC3A 2B53A 4UWYA 3R8MA 3HP5A 5CAOA 5K5XA 4JT3A 5CU0A 2VWVA 2FH9A 3RK7A 4WRSA 3B8RA 5A6OA 2QU5A 1NY3A 4YHJA 4NM0A 3ZSIA 2J5EA 2VU3A 3UIXA 2PUUA 4FNWA 4CRLA 2OKRA 4ANLA 4ZLOA 5CF5A 4FV0A 1J7LA 4K6ZA 4KINA 4PV0A 4FUYA 5CU3A 5FEEA 3QL8A 3CTHA 3O96A 1ZAOA 1LEZA 2WIHA 3TEIA 4AOJA 4FEXA 4UBAA 5EQPA 3TTJA 4LV8A 2QVSE 3A7GA 1JVPP 3DDPA 3PVBA 4FF8A 3FZSA 4CSVA 1PMVA 2H6DA 2YM5A 5JQ5A 1U5QA 3RWQA 4YZDA 3D9VA 1URCA 2OF4A 4GT3A 2ZFYA 3R22A 1PMNA 2PHKA 2VWIA 4XH6A 1JSTA 2I0VA 2FGIA 4GK3A 3JY9A 3VC4A 2CKPA 4BDGA 3CBLA 5KMJA 4DFNA 2GNFA 2XUUA 5E91A 3LMGA 4EQMA 2VGOA 2B0QA 3QFVA 4GKHA 3TNQB 4FKIA 4L43A 4IC7A 2YM8A 3FKOA 3GC0A 3B2WA 4I0SA 3VF8A 3G51A 2A1AB 3IW4A 4TWOA 4O86A 1P4OA 3PJCA 2G15A 4PDOA 4DBNA 2ZMDA 4H58A 5JGBA 2OBJA 4LM5A 4BIEA 1KSWA 3BWFA 3ZONA 4DG3E 4P7EA 3FLNC 1FMOE 3TDWA 5L2QA 3F2RA 4ITJA 3U9NA 2JFLA 3E7OA 4MNFA 2ITVA 2XP2A 4CG8A 3TKIA 3TTIA 1Y57A 1GZ8A 3GOPA 4IWOA 3WF6A 3ATTA 3AGMA 4DDGA 2Q0BA 4M8TA 1M14A 4L3LA 3R9DA 4LDTA 2F9GA 4GS6A 4G5JA 5E8YA 2ZB1A 4I4FA 3BYMA 1PKDA 2UW3A 2IZUA 3ENHA 4G9RA 4LGGA 1H27A 2W0JA 3PE2A 5EI2A 3AD4A 4EHVA 4XLIA 2VRXA 3R04A 4M0ZA 1XWSA 2I1MA 3OBGA 3LJ0A 4GU6A 4M12A 4X0MA 5CYIA 5AP4A 2C3LA 2PE2A 3E92A 2WEVA 5F4NA 5BVWA 2ITXA 2V7OA 5T6KA 2FSMX 2UZWE 3R8LA 4K9YA 5CAPA 4AXDA 3KRLA 5AV3A 3PRIA 4AACA 1B39A 5HU3A 2IN6A 3C13A 3PXFA 5AAFA 5BV3A 2G9XA 3UNJA 4BDAA 1G8SA 4HOKA 3P86A 4F7LA 4FG8A 4LQMA 5KMKA 4UMUA 2WQEA 4RC4A 5EM5A 3Q5ZA 3PE1A 5CQUA 2FYSA 2C1BA 2OJIA 3KULB 4DC2A 4GYGA 5CT0A 5AR5A 3TJDA 3NNUA 1M17A 4IAYA 3CTJA 4AGDA 3OTUA 4A07A 5JFWA 4XG8A 5AA9A 2OH4A 3OCSA 4AT4A 3QF9A 2WMTA 2XCKA 4M0YA 5I3OA 3L9LA 3W2PA 1WFCA 3HRCA 3HYHA 4DFBA 4A06A 5J1VA 3WOWA 4EK5A 4J97A 4F65A 2FO0A 1ZOEA 2G2HA 3F9NA 3F66A 5TF9A 3MB7A 2VTIA 3AC5A 3RBWA 2CMWA 3IW8A 3R8VA 1RW8A 2BRBA 3LFNA 4TYIA 1ZRZA 3UOHA 3RKBA 3KXMA 5EOBA 5DT0A 3ZOSA 2RIOA 4YTFA 4X2GA 3FZRA 4HJOA 1NVRA 4GEOA 2Z7SA 3DLSA 4UN0C 5HLWA 3W0RA 2X0QA 2HAKA 2QOQA 1K2PA 5DOSA 3BHTA 5FQDC 3RVGA 4D2PA 3QUDA 5CS6A 1IRKA 5DA3A 4F0GA 4RWLA 1WCCA 4RJ8A 1J1BA 5GJDA 4BI0A 4AQKA 4IMYA 2X4ZA 4IZ7A 3AT3A 3FDNA 4E20A 5M44A 2XJ2A 3OW3A 1G8KA 3UZPA 3U8WA 3P23A 3NX8A 2VTAA 4EOLA 2PMIA 2XZSA 4RIYA 2QG7A 3HMIA 3HZTA 2OXXA 2UVYA 2PPQA 1W7HA 4ZY6A 4AZSA 3KGAA 4XOYA 4C34A 2RG6A 4FK6A 4RBLA 4FIHA 4ZAUA 3QUPA 1FVVA 4O0RA 3F2NA 3W18A 4E5BA 4BDIA 4RLLA 5JZJA 4O0WA 3TKHA 2Y6OA 3QHRA 5BVNA 4W4WA 4DG0E 3T8OA 4JQEA 4O7SA 3QKLA 4L9IA 5AR2A 3MVHA 5K5NA 2C6TA 2VTHA 3VHEA 3MVJA 3NAYA 3QD3A 5J87A 4XS2A 3TT0A 3L1SA 3L8VA 2AUHA 3RM7A 2CKEA 4FL2A 2Z8CA 3HMOA 3DZQA 3SRVA 3QTZA 4GK4A 4TZRA 5J9ZA 4ITHA 4K0YA 5DGZA 3QCXA 3W32A 4DFUA 3PTGA 2BFYA 3W2QA 2E9UA 2BAJA 2C6LA 3HRBA 4V01A 3BYSA 5AUZA 5TOZA 1K3AA 1CTPE 2JKOA 4C8BA 4UZHA 2W1CA 2O0UA 4YJOA 4ERWA 3N4TA 3NVKI 4GG5A 2BAQA 5DR2A 3RJCA 2GDOA 2PVLA 5HE3A 5CU4A 4IX5A 3PYYA 3UDZA 3IKAA 2XNOA 4LGHA 4WUNA 4FEQA 5IEVA 3ALNA 3CSVA 2HWOA 3UPZA 4D58A 4UEUA 2EB3A 3W8LA 4E1ZA 4E7WA 3IK3A 3FKLA 3OTVA 4ZSAA 3KULA 1Q61A 4BHZA 4JS8A 4B8MA 4O0UA 2VN9A 2XNGA 1L3RE 3OUKA 4C59A 5IMXA 2VUWA 3GU5A 5K4IA 5FXSA 3OWLA 3SW7A 5IU2A 3MJ1A 5HGIA 4BWPA 3BV2A 4IDTA 3AOXA 4UMQA 3Q96A 3KVWA 3TNWA 3F82A 2AEGA 2ITTA 3GP0A 3EFKA 4U42A 5FBOA 4EOJA 3KY2A 3NW7A 4F9AA 4YC8A 4TNDA 4DCAA 4IM2A 1KE5A 4ACHA 2VTLA 3QYZA 2XRWA 2QNJA 5ETAA 3V8SA 4GUBA 3TUDA 4U40A 3QQUA 4F09A 1STCE 2XAMA 3NYNA 4X3FB 2IW6A 5DVRA 2PU8A 5IQHA 5EKOA 4U3ZA 3CR0A 3HV6A 2BDFA 4S2ZA 3R9OA 4PL5A 1H28A 4WSYA 5DPVA 3QKMA 4FV2A 4FSNA 3MPAA 2G2IA 4CFMA 2WMSA 1UNGA 1TVOA 1YDRE 1YI3A 4L8MA 4NJDA 4QQJA 4RJ3A 5E4HA 2ITPA 4QMPA 4I94A 5KO1A 4BB4A 1G8JA 4D4YA 3CKXA 1OIRA 4JAJA 3MIAA 3P08A 1HCKA 2QOFA 5B2KA 4CV8A 4KKGA 4F6SA 5KCVA 1ATPE 3T9TA 3BU5A 4FZDB 5C9CA 2FSTX 2JLDA 2QODA 2YM4A 5CI7A 2UVXA 3WZUA 4BJJB 4YLLA 2BRGA 3LLTA 1J3HA 4M69B 4I92A 1R3CA 3PJ3A 1MRVA 3FLSA 3KVXA 5L2SA 3Q4TA 3RWPA 3BL7A 5HLPA 2YCFA 2YIRA 4D0XA 4O22A 3AG9A 3N4UA 3AMYA 4NIFB 4G3EA 5LWNA 1JWHA 4M66A 2HOGA 4Q9SA 4MXYA 2PUIA 5K0XA 1PYXA 4DG2E 2CJMA 2QOHA 3FUPA 2WU6A 3LAUA 4WBBB 4GYIA 5A4QA 1XMLA 2X9FA 3ZO3A 4AGCA 4DT9A 4ALVA 2JGZA 2ACXA 3UYSA 3H30A 4XG3A 3V3VA 1TFFA 5EYMA 3R0TA 3GCSA 3OS3A 4R78A 3MDYA 4AZWA 3R00A 4YSMA 3QQFA 3IDCA 1M2PA 3ID6C 3KU2A 3AC2A 4IXPA 3RZBA 4DHIB 1P14A 1I44A 3H9RA 3F88A 2IVUA 4WBOA 4CCUA 4EHGA 2C3KA 3MV5A 4JRNA 2WTCA 3ENMA 4ZZNA 5JFXA 5KBRA 4U81A 4NIFA 3FL5A 1ZXEA 3R7VA 5C8MA 4EYJA 1WBVA 1SVEA 3PFQA 4BCIA 4EH3A 5JSMA 3ZS5A 1IA9A 2XIKA 4PUZA 4X2KA 4QP1A 3V01A 4IE9A 4IFGA 4O1OA 4EEVA 1PY5A 3KF4A 2QOLA 3V8WA 3VRZA 2OZAB 2XBAA 2XM9A 5LMKA 1W82A 3JXWA 4LG4A 5DI1A 4ZMEA 4UY9A 4BCGA 5BVDA 3OCGA 4XV9A 1PKGA 4W4YA 4AP7A 5EFQA 4FR4A 4RX7A 2VTQA 5FM2A 3LMIA 2O64A 4QMYA 4IJ9A 3Q5IA 3KB7A 2JD5A 4QO9A 4HGEA 1LUFA 4R7HA 4TL0A 4G17A 2YAKA 2PE0A 3NUSA 2CCHA 3NRMA 4ZTNA 4FTIA 2XA4A 3QGYA 4O2ZA 4DEDA 2G01A 4EH8A 4UWBA 3FWQA 1WBOA 4I5CA 2JC6A 5AR7A 5JN2A 2YABA 4EH7A 4RVKA 3VBTA 4AA5A 3C0GA 3F5XA 4YBKA 5AMNA 5FP6A 3ZMMA 5IEYA 2WMVA 5KKRB 1BI7A 4D1SA 1WBSA 4F7JA 3PXYA 2ZV7A 2XARA 2YA9A 2IZSA 3HA8A 1VZOA 4TY1A 5BMMA 4HVHA 3NFGB 3GU7A 3IPHA 4U41A 3OT3A 3LIJA 4D9TA 4YJVA 4MEDA 4FUXA 3ODZX 3ZH8A 4DGMA 3VQHA 1MRUA 4PPCA 5LARA 2R2PA 4FRFA 4ZOGA 2BKKA 2QOBA 2SRCA 2VNWA 2Y7JA 4C4EA 3R8PA 4FKWA 1OMWA 3ULZA 4HYHA 4CQGA 5HORA 2PZPA 3I0QA 5CU2A 4FNYA 2E9OA 1KE8A 4L3PA 1U4DA 3UMWA 2P2IA 3DK7A 3MPMA 1J7UA 3G9NA 1H0WA 3GFWA 3PA3A 3V5WA 3NFFB 1O6KA 4EH4A 3BGQA 3QCSA 4QP6A 4DLIA 4RVLA 3V04A 4FTQA 3VUTA 2QLUA 2UUEA 3FAAA 4TYGA 3RK9A 2FUMA 4Z3VA 5CSXA 3UIMA 4F9BA 4YHTA 3UDTA 4MD9E 4MF1A 2Y4PA 2GQSA 5I9ZA 4ZSJA 3IW5A 3QRIA 5DT3A 3MH2A 5E7RA 2W4OA 2XYNA 4LUDA 3I1AA 1PXPA 4QMQA 3IO7A 3AC1A 2X8EA 2J5FA 1EH4A 2GQGA 2V62A 2PVKA 3HAVA 1H26A 3FZOA 4JXFA 1PYEA 4MQ2A 2J90A 3LFSA 5C4LA 4AW2A 1JSUA 4WRGA 3QA0A 4I6HA 3MPTA 3KKVA 2ZDTA 5HIEA 5BYZA 3PIZA 1SNXA 3L9MA 3VUDA 2FB8A 3H9OA 3Q9ZA 2E9NA 5BUIA 4EBVA 2E9VA 3ITZA 4NSTA 3SA0A 4G6LA 2IF8A 2PTKA 3L8PA 4QMOA 2PK9A 2OW3A 3Q9YA 4RPVA 3MWUA 3ZXZA 2YAAA 1DAYA 3OWPA 4BRXA 5IPJA 4O7TA 2XMYA 3SX9A 2RSVA 4GIHA 1F3MC 1ZMWA 4DINA 5J5SA 4GG7A 4BCFA 3COHA 4NK9A 3E64A 2IW8A 3E5AA 3WF8A 5HVKA 2W06A 5DRBA 2J0IA 3W2RA 3LMHA 2F2CB 4LMUA 4O7NA 3QBNA 2BCJA 5JKGA 1YXTA 4A9UA 2VO3A 3WZEA 4WG5A 3U9CA 4DTKA 3OHTA 2YIQA 1UKHA 3ZO2A 1Y6BA 3I0OA 4HPUE 3VIDA 4F6WA 1OL6A 3HECA 4YP8A 4DDIA 1XBCA 4ZTLA 1A48A 3I7CA 4WNOA 3CE3A 4X2NA 3RCJA 3NNXA 2CNVA 4H36A 2REIA 4PPBA 3ANRA 4I22A 4TXCA 5FTOA 1SNUA 2Y6MA 1UNLA 2WMWA 2BPMA 2PMOX 3BBTB 3K3JA 1XO2B 3NW6A 4ASZA 4ZY4A 2R3RA 2QHMA 4GFOA 4Y8DA 2XYUA 2IVVA 2A2AA 3D15A 1YDTE 2I6LA 4FL3A 2HY81 4U8ZA 3KIOC 4QMVA 3DKGA 3SVVA 3LQ3A 1H1RA 1OIUA 2BZIB 3QC9A 4YJSA 3UOKA 3KXHA 2Y0AA 2EXMA 3A7JA 2OGVA 3DCVA 4FKQA 2HWPA 2NPQA 3CP9A 2WGJA 2X6EA 3QQJA 3R1QA 4GK2A 4J71A 3ZLWA 3RALA 4YJTA 5EYCA 2DQ7X 3DPKA 4WG3A 1PHKA 5JK3A 4O84A 1YHWA 2ETKA 4QYFA 1OECA 3OWKA 4IANA 4RWIA 2V22A 5D1JA 2BZKB 5GIPE 2WQOA 2XK9A 1VR2A 5IQFA 4CMUA 3COKA 3UBDA 3UIBA 3FI8A 4EQUA 3EZRA 3FHRA 2WQNA 4I6BA 4XLVA 3FI3A 4WKQA 4RJ4A 4FTRA 2ITUA 3WYXA 5EK7A 5CTPA 5BYYA 3FLWA 4LL5A 2WIPA 4B99A 2XK3A 2HZ4A 1U54B 2J51A 2BTSA 3ZM9A 4V05A 4XJ0A 1OPJA 1B6CB 3KCFA 2YLFA 3QD4A 5AUWA 3ERKA 3BCEA 4QEBA 4YJNA 4AW5A 5L8LA 2QO2A 4O38A 4QRCA 4C3FA 1OGYA 3Q32A 4EORA 4BTKA 1YXXA 2R7BA 3FMHA 4J7BA 2QURA 4NH1A 3MH3A 2A98A 4O7YA 4JNWA 3W2OA 3EMGA 1OL7A 2GSFA 3PXQA 2EXEA 4R1YA 4TTHB 3E7VA 5E9EA 3AKLA 2YFXA 4RFMA 2CSNA 3UQCA 4GMYA 3I6WA 2PVFA 3R8UA 4M97A 4UWCA 2UZTA 3UQGA 4F4PA 1FVRA 3COIA 2VX3A 1X8BA 3OCBA 4CTCA 5KBQA 1NXKA 3IG7A 4HYSA 3FQSA 3QX4A 3ZRLA 1M52A 2ERZE 3QQHA 3VW8A 2QOIA 4CNHA 4EL9A 4EZ7A 5M4IA 2PVMA 3LXKA 4C4JA 2YN8A 5HE1A 4BYJA 5GNKA 2B9IA 2EWAA 3QTIA 4WD5A 2W1FA 3BGZA 4MAOA 5HLNA 3P4KA 3ZFYA 3EL8A 4I5PA 4DT8A 5HTBA 1YOJA 2XKFA 4RQKA 5L4QA 5GZAA 4FKRA 3EN7A 4BR3A 5TE0A 3PDTA 5M08A 4UYAA 3Q4ZA 1CDKA 4IX4A 4LI5A 4FTAA 4JMQA 3ORLA 4UALA 2OK1A 3A61A 4FKGA 4YNEA 5F94A 4BDBA 4D2RA 3ZU7A 1PXLA 4FKJA 1M7NA 2W1EA 1OVEA 4YU2A 4HCTA 3KXZA 3JY0A 2VWUA 3OMVA 4L53A 3T3VA 2O2UA 3DLZA 2DS1A 2XIXA 3PJ2A 3FXXA 3UO5A 2WTIA 4FSZA 4NUSA 3VHKA 3PA5A 1R78A 4NFMA 3FI4A 4OUCA 4X6QC 4KABA 4QTDA 3O8PA 3TIZA 4YTCA 5IQBA 4FSMA 4FE2A 5CVHA 4BKYA 5L6WL 4RVTA 5E92A 4JDIA 3ALOA 4FKPA 3R7GA 3TNIA 4BJJA 2QCSA 4QP3A 4Q5HA 3WE4A 5IQIA 3PWDA 5DBXA 4EWHA 4FNZA 4ACCA 4F7SA 4LV7A 3BYVA 2UW0A 3ZM4A 3OW4A 3ZCLA 4C38A 2QO7A 3MSSA 4MBLA 3VW6A 3UDSA 1Z57A 3UZRA 2J7TA 3DBDA 4XG4A 4C3PA 4ZMFA 4BCPA 5AR3A 4GV1A 2QKWB 4CFXA 4O4EA 2C6OA 4D28A 2WELA 3HMNA 1H0VA