5F20A

Structure of tyk2 with inhibitor 4: 3-azanyl-5-(2-methylphenyl)-7-(1-methylpyrazol-3-yl)-1~{h}-pyrazolo[4,3-c]pyridin-4-one
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
289
structure length
274
Chain Sequence
DPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKGWKQEIDILRTLYHEHIIKYKGCCEDSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHSQHYIHRNLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGQGQMTVLRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Non-receptor tyrosine-protein kinase TYK2
publication title Structure-Based Design and Synthesis of 3-Amino-1,5-dihydro-4H-pyrazolopyridin-4-one Derivatives as Tyrosine Kinase 2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 274
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5f20A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5f20A01
4QP4A 5AADA 4OTHA 4BZOA 4MNEA 3KA0A 5TO8A 4QNAA 4GUEA 4FSMA 4NU1A 4YNEA 4XJ0A 5FLFA 4XG7A 3ZSGA 3MVLA 3A7HA 3RPVA 5CSPA 3NAXA 4O21A 3UIXA 1H27A 3HDMA 4YO6A 1U54A 4GCJA 3VBYA 4ANBA 4O0UA 2GNLA 2PVJA 3BE9A 4RZWA 2CSNA 3Q2MA 4QMQA 4MQ2A 4CFVA 1WBPA 4L7FA 2XK7A 1MRUA 3MPAA 4B4LA 1K3AA 3OD6X 3I1AA 3QRIA 3LFAA 4FSYA 3BKBA 4YBJA 3RAHA 4DGMA 4BDKA 3WARA 5JQ5A 5L2WA 1UA2A 4ZS0A 4PMSA 3G5DA 4IJ9A 4OT5A 4BI1A 3FWQA 2OJGA 2J9MA 4DG0E 4YO4A 3LCDA 3DQXA 4H1MA 2CGXA 2UZNA 1UWHA 3TTJA 4CV8A 2WMWA 5LVPA 4L6QA 4XG8A 5CF4A 3WILA 2R3QA 2CN5A 3ODYX 3OOMA 1OL7A 5CSWA 2X1NA 3R8UA 2ERZE 1WBVA 1FOTA 4LRMA 2RSVA 3KRXA 3BE2A 3R1NA 2ZB1A 3CBLA 3PG1A 2KTYA 1U5RA 3BYSA 4GVJA 3GC8A 2QOQA 3AC2A 2WEIA 4C62A 5A4QA 4XH6A 4A06A 4C33A 1B6CB 3FXWA 3O0GA 4U3ZA 2I40A 4L00A 4RLKA 3DBEA 2A27A 3QTUA 4BI0A 1H0VA 2EXMA 2HY81 3L8PA 1BI7A 3FKNA 2O3PA 4ALUA 2VD5A 4IMYA 3KRWA 4RC2A 4H3BA 4ZP5A 3QZGA 3COIA 5CEOA 4GKIA 3LLTA 4HZRA 3U54A 1YI3A 2XEZA 3UNJA 3HYHA 4EOSA 3SW4A 4Q5EA 2AUHA 2ITWA 2YM8A 2JBPA 5TOZA 4QYHA 2HY0A 2OWBA 2YIWA 2G2HA 3RJCA 4ASXA 4I6FA 5IUGA 2R64A 4HVDA 2VWBA 3PVUA 3RAWA 5KMLA 4HGSA 2DWBA 4JDIA 3HAMA 4GJ2A 4IH8A 3RI1A 4EQMA 3ZC5A 4C3RA 3C5IA 3HP2A 3EQRA 4FUXA 3FC2A 4DEBA 4X2NA 4O0VA 2H9VA 5C01A 3DFAA 3ZO2A 1Y6AA 1A9UA 1JVPP 4IB0A 5HG8A 5TKDA 4MX9A 2YAKA 3ZO1A 4X3FB 5HTBA 2PVMA 4YLJA 3CQUA 3WBLA 3PE1A 4BZNA 1Q5KA 2H96A 1Q8TA 2XVDA 2VO0A 4QTDA 4EOOA 3KXGA 4EOPA 4CMUA 4FKRA 3PSBA 3IW8A 3MJ2A 3DXPA 4R7HA 4LYNA 5IUIA 3HDNA 4G1WA 4KS7A 4C4HA 4OTPA 1A06A 4JR3A 4O6EA 3F7ZA 4TYHB 4APCA 4EH2A 2BFXA 4ENXA 5CALA 5KMJA 4Y73A 4JDHA 4F6UA 4QTEA 2VNYA 2BR1A 3Q60A 1GZNA 4DBNA 3FMHA 3PP0A 2DS1A 3JYAA 4EWQA 4Z7GA 3P23A 2BZJA 5IF1A 3G6HA 3ZHPC 4J1RA 2C30A 3PLAE 1Z9XA 4ZTQA 4ZY5A 3A7FA 3HMMA 5BVNA 3LAUA 3LFNA 1M52A 3LFFA 2UZDA 3AD5A 4GT5A 4NJDA 3OXZA 4HCTA 3PG3A 2F2UA 3A8XA 4RIXA 4G6OA 3VS2A 3UVRA 4RC4A 5HBHA 5JKGA 4PTCA 1OVEA 5CF8A 4FYOA 3CY3A 4YJPA 2JC6A 5K9IA 1J91A 2Y4PA 4O83A 2C6KA 4QPSA 3UIMA 2C6IA 2XIZA 4W4VA 4HYHA 5CF6A 3WZUA 2CGUA 5AV2A 3ZYAA 4JR7A 4UMQA 2YDKA 3PJCA 2XYNA 3H30A 5CEIA 2AYPA 4LRKA 4EHVA 2J51A 2G15A 5A6OA 3BZ3A 1PMVA 5M4IA 2Z7LA 2VRXA 1JPAA 4BBFA 4I6HA 3D2KA 3VRZA 2PZIA 4FKLA 3RAKA 2QKRA 4JXFA 3NYOA 5HD7A 3REPA 2Y6MA 4DFYA 5G1XA 4ACGA 2YHVA 3RALA 4CYJA 4FTJA 2W4KA 2ZVAA 3UPZA 2V62A 2C6DA 3U8WA 5C1QB 3BX5A 5IZFA 4O7SA 1I44A 3EKNA 3OC1A 3Q04A 1OUYA 2EU9A 3SXSA 1STCE 1PMNA 3ZRMA 4BIBA 4MXCA 3RPYA 5FP5A 2W9FB 2GNHA 5E7RA 3E88A 1OKZA 4EHEA 4CFXA 4UV0A 4M3QA 1JAMA 2BAJA 4BCGA 4EOLA 3C0IA 1ZZ2A 2EVAA 3DKOA 1XH6A 4FV1A 4QP1A 4WUAA 1Q97A 4TRLA 2Y0AA 2OIBA 1UWJA 4XLVA 4MXOA 2IZUA 4MXYA 4BYJA 2WMAA 4FKTA 4C2WA 3V8SA 3ZSIA 4AXAA 5DHJA 3BU6A 4BHNA 4CTBA 3G9LX 4R1YA 5AV1A 5EHLA 3OEFX 3Q52A 3NRMA 1OECA 3DKGA 2XNOA 2YLFA 3A7IA 4W4XA 2OXXA 3M2WA 5IMXA 4U0IA 5LCJA 5IA5A 1YXUA 2C68A 5BVEA 4AUAA 1YOLA 4FTLA 4A9SA 3CPCA 4AT5A 5EOBA 2ZDTA 2ZM4A 3NIEA 2J0IA 4IB1A 1WVXA 5HHWA 3WI6A 3R71A 3B2WA 4XG2A 4F0GA 4ZLZA 2BIYA 2HOGA 2ZB0A 2OGVA 1M2QA 1XHAA 5JFVA 3D2IA 1OIUA 2R2PA 4M13A 4GYIA 2PYWA 2BPMA 3Q4TA 4FKGA 4MD9E 4QO9A 5IEVA 4PY1A 4H39A 5DFPA 3TZ9A 4PPAA 5BVDA 4O1PA 5DWRA 2I0YA 4P5ZA 2HENA 5JN2A 3Q32A 2UW6A 3RHKA 2JKMA 1XH9A 4Z7HA 2OBJA 4G2FA 2XNNA 5JH6A 3VUHA 3MIAA 4CV9A 2O2UA 1OL1A 4KB8A 3HX4A 2FSTX 4WG3A 1ZOHA 4WSQA 3EZRA 4D1ZA 4DG2E 4FTIA 2Z7RA 2XMYA 1NVSA 4I4EA 4K11A 4R77A 1GY3A 3F3TA 4BTJA 3W2QA 4JIKA 3PJ3A 4UY9A 5HU3A 5L2TA 2VWUA 3MY0A 3DS6A 4D2WA 5JZJA 3QFVA 4CQGA 4D1SA 4G31A 4IC8A 4CKJA 4QQCA 1WBSA 3QCQA 3PXRA 4GKHA 4I20A 2ZAZA 3P7AA 5HICA 5HE1A 2CDZA 2P55A 3EKKA 4OTWA 3R2YA 4RVLA 5HO6A 4OAVB 4GFGA 3COKA 2VTJA 4EHGA 5J7HA 5CI7A 3EYHA 3PY0A 3W33A 3EN5A 3BV3A 5EYCA 4NFMA 4O84A 2CHLA 1OIYA 5GZ9A 1ZRZA 1Y91A 4JX3A 2RIOA 3EN7A 2FVDA 2UW4A 2JKKA 2P2HA 3DB8A 3OW4A 5AR2A 2RL5A 4FEVA 1H01A 4JX7A 5AX3A 5I4NA 1XH4A 3TZ8A 3QTWA 4NTSA 4UMTA 5DH3A 5CVFA 3BRBA 4FTTA 3K3IA 2C3IB 4PWNA 4MNEB 3HMPA 2VU3A 3FZTA 3WZEA 3AD6A 5ACBC 2OZAA 3I5NA 2XRUA 2RFDA 4APPA 2VTQA 2WO6A 5DR2A 1UU9A 4AZVA 2YIYA 1URCA 4TWCA 4QRCA 5HG5A 2UZWE 2ACXA 1TKIA 3HA8A 3ALNA 3QTSA 5H8EA 3Q53A 3R7EA 4MH7A 2OH0E 1H1RA 4ERWA 5BVKA 4MAOA 2W1DA 5H8BA 5AAFA 5K5NA 5L2SA 1YI6A 3CQWA 3FMLA 4D0XA 1R78A 1ZWSA 3FLNC 1YXXA 4O7YA 3BELA 4DF3A 4EORA 5EQEA 3FMJA 3L8XA 5EYMA 5HO7A 5EI8A 4A7CA 4AF3A 3E7VA 2GU8A 4V0GA 4XG6A 2EUFB 4NH1A 4PX6A 4YJTA 4CKIA 2YWVA 4DEIA 4PMPA 4Z3VA 3VUGA 2IVVA 3ZUVA 4F1OA 1ZMVA 3BLQA 4TYJA 2G01A 2IZTA 4RX9A 4E3CA 5IG1A 1JOWB 1V0OA 3DTWA 1YWVA 2NP8A 3Q6UA 4NK9A 2W7XA 3SLSA 4E4LA 4YU2A 5AUVA 1R39A 2CGVA 4RJ7A 3DDPA 3PIXA 3P5KA 3RNYA 5HNBA 3TEIA 4GW8A 4S33A 4UYAA 3KVXA 2HW6A 3R8LA 5KCVA 1WVWA 2OH4A 3EL7A 3R7IA 2VAGA 4U9AA 2PE2A 3UNZA 4AFEA 5BYZA 3OOGA 2C5XA 3ORNA 1R0PA 4C35A 1DM2A 4G6LA 5E8SA 3MI9A 3MIYA 2VX0A 1Q3DA 4C3FA 3UYTA 2W1CA 3W32A 4OBQA 2BRMA 3ZZEA 3Q4ZA 4GMYA 1ZARA 3VO3A 3DTCA 4L9IA 4X2KA 2C69A 5A4EA 3VS0A 4DEAA 3RZBA 3G15A 3LLAA 3KXNA 1YDTE 2ITXA 3FSKA 2PVKA 3MPTA 4J7BA 1Q3WA 1Z57A 3OXIA 2VZ6A 2WU6A 3RCDA 1H1PA 5ANJA 3BPRA 3ZEWA 3WOWA 4JBQA 4DAWA 4DYMA 2UZUE 2XCHA 4FGBA 3BYVA 3EQPA 4RFYA 5EI6A 4YC3A 3GENA 2ZJWA 2BILB 2ONLC 2CKQA 3ZU7A 3T3VA 3L1SA 3RZFA 4K6ZA 1WAKA 3E93A 2R7IA 2GQRA 5L4QA 3BU5A 5H9BA 4FIHA 3V5WA 2WTJA 2DQ7X 3ZOSA 3OVVA 2XBAA 2YJRA 5CU0A 3Q6WA 3O2MA 3W1FA 1W84A 5EDRA 4FICA 3UOKA 2QG5A 5ANOA 1XWSA 3MBLA 4BDBA 5I3OA 3GFEA 3VAPA 3JPVA 3TJCA 4ENYA 2OKRA 4TWNA 3WE4A 4E6CA 2R3NA 3DLSA 4U80A 3U87A 4D2SA 4O7ZA 2CN8A 2XJ1A 3KMUA 1Q99A 4KBKA 3TNWA 2VTNA 3HZTA 3VS4A 5DMZA 4JVGA 4FKQA 3UYSA 5J9ZA 3MH1A 2XZSA 3V5TA 2C1BA 4K0YA 2PSQA 3R7OA 4C0TA 2VNWA 4PDSA 2VX3A 4AN2A 4MHAA 4AG8A 4BDEA 4H3QA 4EQUA 3EN4A 3AT4A 3EQCA 4QMYA 3VHKA 3UG1A 3TDVA 4KIKB 3LIJA 5A46A 2YN8A 3L8SA 4I0RA 4YJSA 1JSUA 5I5ZA 2NNWB 3UQFA 1GNGA 3QZHA 5B2MA 3I4BA 5C8MA 2F57A 2ZYBA 5KMOA 3HV3A 1WBTA 1KE5A 4WNKA 3VN9A 3ZRLA 5JGDA 5AP1A 5KMMA 4RWIA 5KBRA 2J90A 3NSZA 4J98A 3MY5A 3HRCA 4XUFA 1XBCA 1QPCA 1MQBA 4F6SA 3C4XA 5GNKA 3FQHA 4UZHA 4JLCA 4A9UA 1ERKA 4BCMA 3EQBA 5J7BA 4FR4A 2BROA 4G3DA 3V8WA 3IG7A 4B99A 4OTGA 4QMZA 4OGRA 2QU5A 1PYXA 4FKIA 1Q8YA 4LG4A 4U43A 4AZWA 1OB3A 4MWHA 4CYIA 3SVVA 4UYNA 4RWLA 4ORKA 3LFSA 5HVYA 4PDYA 2E9PA 4EOMA 3OT8A 4M66A 3A62A 5HZNA 5AR3A 2WQEA 5LXMA 4M67A 4D4YA 3ZUUA 3LQ3A 4JBVA 2WQMA 3DOGA 3CLYA 4RQKA 4R7BA 4O7LA 3QALE 3KKVA 2H8HA 2YFXA 3CGFA 4ITHA 3NLBA 4H36A 3CD3A 1CDKA 3B8RA 2XIXA 5BX0A 3MW1A 3ZLWA 5HG9A 2B9FA 4QMVA 2XK3A 1PJKA 3VHEA 3KXZA 3NW7A 4ITJA 5HGIA 2Q0BA 3FI4A 3DKFA 2F49A 4QTCA 1T45A 3SRVB 5I9WA 2JBOA 4ALWA 2PUUA 4DE4A 3QWJA 3R8ZA 3F9NA 1J1CA 4E4NA 4NKAA 1PMEA 2XYUA 4L68A 3KULB 2NRUA 4FT7A 4FG8A 2WHBA 3MB6A 1Q24A 2BTRA 2X4ZA 1M7QA 2YAAA 4FI1A 4MXAA 4NW5A 1FVVA 4FL3A 5F95A 4A9YA 5HX6A 4H05A 4FKUA 4HVHA 3VVHA 2WTWA 1XBAA 4J71A 1UKIA 3A4OX 4TNDA 1M7NA 2XK6A 5HQ0A 3DBDA 3JY9A 3U9CA 2CLQA 4BGHA 5GJDA 4RIOA 3D94A 4C4GA 4M14A 3UO6A 4HOKA 4DGLC 2XIYA 3BWFA 4AS0A 4F7NA 2BDJA 1YXTA 3NYNA 1RQQA 3QX4A 3F3ZA 2I6LA 2VN9A 2ZV7A 5KMKA 5HG7A 5HVKA 1DI9A 4BCKA 5KO1A 2QO9A 4RIYB 5FBNC 4P90A 3OCBA 3N9XA 2PVYA 2OFVA 4WG5A 3V8TA 4FIJA 3MFTA 5IA2A 4JBPA 5KKRB 4QYGA 4EONA 5BUJA 4O2PA 4RRVA 4HPTE 1B39A 3AMYA 4BCPA 4M0YA 4FZAB 1L3RE 3G0EA 3EYGA 2NO3A 3PXFA 2Y9QA 3ZXTA 3DAEA 4IVBA 5CZHA 2IW9A 3C4CA 2WQBA 2YCFA 3P1AA 3PVBA 4CXAA 4NL0A 2W99B 3F5XA 3U55A 2UZLA 2OO8X 2OF2A 4I21A 4EBVA 2XS0A 4YHJA 3FLWA 2UV2A 3P9JA 5CSHA 4YTHA 1AD5A 4QMSA 3CKXA 1ZOEA 3DJ7A 4JL9A 4LMNA 4O38A 5M55A 3UC4A 3VS7A 3QGYA 5FTGA 3DK7A 4BWXA 3U9NA 3F5UA 4Q5HA 2BALA 2E9VA 3KREA 4DGGA 3GGFA 2J0KA 4WKQA 5J5TA 3JR1A 4DT9A 4GFMA 1OBDA 3FLSA 5HE0A 5E1EA 4YP8A 2PVHA 5H3QA 2GNFA 2J4ZA 2UZEA 3UTOA 4EKKA 1YW2A 3WZJA 4WNMA 3P7BA 4N6YA 3QAME 4XV2A 4BWPA 4PTEA 2PVLA 3LMIA 3S2PA 4JNWA 4NIFB 3OWLA 3R02A 5AIRA 1ZOGA 2ERKA 3AMBA 3M11A 3UVPA 3KRLA 4KBCA 1RDQE 3FMKA 3QZFA 4FK6A 3ROYA 3ZCLA 3KF4A 2CPKE 1PXJA 2UW0A 3EMGA 3KQ7A 5D11A 4FEWA 4U79A 3CJGA 2OZAB 3HMNA 5A4LA 3NNXA 5HIDA 3DCVA 3GC0A 3HKOA 1IEPA 3AOXA 3DPKA 4JAJA 3K2LA 4USEA 4S2ZA 1A48A 3RVGA 4AA0A 3S4QA 5EHOA 3BLRA 4YMJA 2WOTA 3LXNA 5DT4A 3ZM4A 5M06A 5EM7A 2JITA 3MTLA 5C8NA 4MWIA 4BCJA 5FDPA 2E2BA 1APME 2HAKA 3ORMA 5ITAA 3PTGA 5DRBA 2B55A 4Y5HA 4LV5A 5FM3A 5HOAA 2PVFA 3FPQA 2ITVA 4F7SA 5M57A 4O2ZA 4UXLA 4XRJA 5L2QA 4RA5A 3R28A 4D28A 4MF1A 3O7LD 4E20A 5IQCA 4D9UA 2XP2A 3PZEA 4YLLA 1CM8A 3V3VA 2YDIA 3UC3A 4DFZE 3BCEA 3PVGA 2C3KA 1ZXEA 3LJ2A 2XM8A 4C3PA 3HUBA 2HYYA 4IAZA 4O0XA 4RA4A 5CAOA 1H07A 3OS3A 2GHGA 4C4FA 2UW5A 3PZHA 1MUOA 3NUYA 3LZBA 4FVQA 4FE2A 2X7FA 2W5BA 5AR5A 1JKSA 2C47A 5AM6A 3EOCA 3CY2A 5AX9A 4CFMA 4IAKA 1PW2A 5GZAA 2CNQA 2W05A 3ZTXA 3GOPA 3QA8A 4WRGA 5E91A 4BCQA 1HOWA 4XCUA 2PZ5A 2XIKA 3G90X 5AAGA 1PY5A 3DXNA 2CNVA 4PNKA 2R0UA 4HGEA 5ETAA 3S0OA 3NW5A 1IA9A 5CF5A 4LMUA 4BFMA 2VWYA 2ONLA 3GQLA 2WTKC 3QD3A 2B4SB 4Y5QA 5HIBA 2WNTA 4L7SA 3QQUA 4UALA 3CJFA 3NZ0A 5J79A 3R0TA 4IZYA 3C4ZA 2IG7A 1M17A 3G51A 4QP2A 4CTCA 4XRLA 3ZLYA 4I22A 4DCEA 4ZOGA 3VUIA 3GU5A 1QPEA 3NUSA 4CSVA 4GIIA 5KBQA 4L8MA 3TJDA 2I0EA 4Y72A 3T9TA 1P2AA 3NVMB 5HD4A 3ERKA 4MYGA 3MB7A 4ZLOA 2VTTA 5KE0A 4DH7A 2VO6A 4IX5A 2XNPA 5F20A 4C34A 4DEHA 5I9ZA 4L67A 1ND4A 4BICA 3UO5A 2Z60A 2JDOA 3NNVA 2X81A 1QPJA 4FODA 1RE8A 4IDVA 3IK3A 4IIRA 3UPXA 3LCSA 4RX5A 3IW6A 3KXHA 3VS5A 3KVWA 2VTIA 3COMA 3IGOA 4DFNA 5JGBA 5J1WA 4XMOA 5I9YA 3CIKA 3LHJA 2YITA 3ELJA 4C38A 5JQ8A 4MEDA 4AP7A 1FBNA 3F3WA 4OW8A 4O0TA 1H1QA 2V7OA 5FEDA 5KUPA 3E5AA 4H58A 3U6IA 4X7QA 4LGHA 2LGCA 2VGPA 1H1SA 4TN6A 5CT0A 4BCFA 1MRVA 4EZ3A 4QP8A 5E9EA 3ITZA 4QPAA 3WZDA 2YZAA 3IS5A 4E6AA 4LGGA 1H8FA 2HELA 4IADA 3TM0A 4BDJA 2HZ0A 1VYWA 3EB0A 3QL8A 4YBKA 5AWMA 4PL3A 1UU8A 5AFVA 1OGUA 2VTLA 4RVTA 3VF8A 2BRBA 5A54A 4FOBA 3VBXA 5L8KA 1YKRA 3DZOA 5CEKA 5KZ0A 1UNHA 3R01A 3GFWA 3UZRA 3VUTA 5TT7A 5EQPA 4DEDA 3QYZA 4FTKA 4GH2A 4FEQA 3KMWA 3Q9ZA 4GVAA 3FI8A 4YJVA 5IQAA 4RLLA 3ZONA 4M15A 3FMDA 4CZTA 3II5A 5C03A 4O96A 4FV8A 3QYWA 4FX3A 3EN6A 4CZUA 3V6RA 1Q8WA 2WTIA 3DDQA 1LPUA 5EW8A 4ZLYA 5D7AA 5DEWA 1CKIA 4XP2A 3UOHA 2AC3A 1ZYJA 1UNLA 3ORZA 3D83A 5BUEA 2HZIA 3MVJA 4LV8A 4AGDA 4DT8A 2AC5A 4BL1A 4WBBB 2YZLA 4DH8A 4DA5A 4HCVA 1JQHA 2XK9A 4WHZA 3VNTA 2XJ2A 2PE1A 4OT6A 4L44A 5AUTA 4KINA 4OTRA 1QMZA 4E4MA 2QHNA 4X6RA 4PDPA 5IA0A 1IRKA 3Q5ZA 4YJUA 4GRBA 2WFYA 2X39A 3FZOA 2CKOA 3PUPA 4KWPA 3WF6A 5BVOA 3AC1A 3OWPA 3UMXA 4I41A 3E64A 4O7VA 4V01A 3I6UA 3SGCA 3H0ZA 3ORXA 4BIEA 3CGOA 5JGAA 2QO7A 4U3YA 2ITOA 3O96A 3NVKI 3E92A 3U6JA 3OG7A 1MP8A 2YABA 4O7NA 5L6OA 5L8JA 2BRHA 3SDJA 3V04A 1MQ4A 2YIXA 4YC6A 3S95A 1BLXA 4DTBA 5KNJA 1YQJA 4FT5A 5M44A 2C4GA 3VF9A 2VTHA 3QTRA 2A4LA 2XIRA 2QOHA 3LXKA 2R3PA 3C4WA 2QLQA 4KBAA 4EKLA 3F82A 2W1FA 2OG8A 3KCKA 5FTOA 5DE2A 3ATSA 4XP0A 4IJPA 4OTIA 1AQ1A 3HL7A 3D9VA 4OUCA 2Y4IC 4ANNA 1WMKA 3RINA 1KUTA 4UMRA 3IKAA 5IQEA 2R3JA 4NYEA 4USDA 3CS9A 1CMKE 4FOCA 2FSMX 1Q61A 4M69A 3U4WA 4TYEA 3R9OA 2PULA 3SG9A 2WMXA 3IONA 3OCTA 2CGWA 4EI4A 4XP3A 3HA6A 1YHWA 2G2IA 2ZDUA 2EB3A 4K77A 5AP6A 5EKNA 4G34A 1KWPA 4ZJJA 2BZIB 4YZNA 3HECA 4MCVA 5HTIA 1ZY4A 2ITNA 2Z02A 3DJ6A 3D7TB 4K33A 4N4SA 3NYXA 2X9FA 4BDIA 4I92A 3IO7A 4RG0A 3E8DA 5JMSA 1ZYDA 3Q4UA 4A07A 4PV0A 3R30A 5AUZA 3D5XA 2JIVA 4XX9A 2V0DA 3QHRA 4HYSA 2GDOA 4BGQA 3DQWA 1ZYSA 3R7GA 2OFUA 4QMUA 3OFMA 3FI2A 2YM6A 4ASDA 5EW3A 2VO7A 4NKSA 2G1TA 3NIZA 2XNGA 2XKEA 3CQEA 2GTMA 3QCYA 2J0JA 5FD2A 4DITA 4FKPA 3MA6A 1IAHA 3CSVA 1DAYA 4GFOA 3EWHA 4TYGA 4WNOA 4EZ7A 4D58A 5M51A 4IQ6A 2P4IA 3TV7A 4L3LA 1JSTA 4EJNA 5EK7A 2XF0A 2QKWB 3P0MA 4CFNA 3L9NA 2C5OA 4M97A 3DZQA 2PTKA 1SMHA 3G33A 1YOJA 1VJYA 3PA3A 4MQ1A 1FGKA 2OJFE 2WMSA 4FMQA 5ETCA 2R3GA 4XG4A 3BI6A 2XJ0A 1PXKA 1U46A 3TV4A 2QCSA 3ULZA 3I81A 5I9VA 3ZLSA 3D14A 3A60A 4C57A 3C13A 4YJNA 5JFWA 1SYKA 5DRDA 2PMLX 1Q62A 1W98A 3QKKA 4I5CA 4NWMA 2RFNA 5LCKA 3RPSA 4C8BA 4RIWA 4CCBA 3ZLXA 4YLKA 5EOLA 1PKGA 5L8LA 2OIDA 3FBVA 3PY3A 5DA3A 4FG7A 3RNIA 3NGAA 1PXMA 4XLIA 4D1XA 5J9LA 2BZKB 4U41A 5JRSA 2CJMA 3LQ8A 3R73A 3JS2A 4CNHA 4LUDA 4J8NA 4F0FA 4E5WA 4AOTA 3TNPC 5ANGA 5DEYA 3R7UA 1ZMUA 2YIQA 4FSNA 4ZTLA 4O7WA 4JBOA 4F08A 2XH5A 4KIOA 5AJQA 3FJQE 5E1SA 4ZJVA 4NJ3A 3VBWA 4ZTRA 4ZTHA 4DTAA 3HV5A 4UXQA 4JG7A 4C2VA 1OKYA 4ZMFA 3VS6A 4YC8A 2I7QA 5AAEA 3GI3A 2UUEA 3QQHA 3L8VA 3OY1A 4V04A 4BGGA 5L6PA 3NCGA 4NM3A 2PVRA 4FIIA 5B0XA 3UOJA 3KMMA 4O22A 4L52A 2E9NA 3G9NA 4R3RA 3LCOA 4QMOA 5CY3A 4JIAA 3HV4A 4A9RA 2B0QA 1NVRA 4FTNA 4PMTA 4ALVA 1UU7A 1GIHA 2F7XE 4CLIA 3FYJX 1G5SA 3HV6A 4PPBA 4TY1A 3SXFA 3UDBA 2JIIA 4ARKA 3PWYA 3LXPA 4JG8A 1SM2A 5K5XA 4ZY6A 3TNHA 2Q0NA 5CVHA 3V5QA 3CKWA 4RQVA 3RWQA 5CEPA 3NWWA 3E8CA 2G9XA 1P14A 3BLHA 5HE2A 4BWKA 4NT4A 4AGWA 4IZ5A 1WVYA 4Y95A 5KMIA 3VRYA 4FV2A 3E7OA 3DY7A 3DLZA 3POOA 3DFCB 3Q4CA 3QD2B 4MBIA 4ITIA 4O0WA 2BFYA 3LCTA 2JGZA 4H3PA 3R8PA 2OXYA 4EOIA 2PE0A 3QQKA 2C0TA 3ET7A 1OIQA 3UNKA 4IAIA 3K54A 4IDTA 1U54B 4S32A 3MS9A 4YJRA 5HVJA 2CLXA 3O8UA 5FM2A 2BIKB 4FIEA 4XOYA 4YGAA 3W2SA 2WMBA 4FTRA 3QRUA 3H4JA 4GT4A 2YIRA 4G3EA 4E7WA 2J7TA 4TZRA 4DH1A 2F7EE 2R9SA 4FZ6A 3DJ5A 5EFQA 5T68A 4AN9A 4TPTA 1XBBA 2PU8A 4O7RA 1SVEA 3O8TA 1FMOE 3O71A 5B2KA 4ASEA 5HORA 5LJJA 2R4BA 4IWPA 1XR1A 2PMNX 2PPQA 5C4LA 5E8TA 2IJMA 1WBOA 4YZDA 3R04A 3LFQA 2OJJA 2C5NA 3ZFXA 4I93A 3QCXA 4IXPA 3KXXA 3QUEA 4KABA 1Q8ZA 2O8YA 2YM5A 3KB7A 5DN3A 4ZSJA 5CEQA 3OBGA 4ZMEA 2XM9A 2ZV9A 1OKVA 3F88A 3GXLA 3R9DA 4CD0A 3RK7A 2VTPA 2WMTA 4Y83A 3D4QA 3FE3A 3DBFA 3I6WA 1IG1A 3QA0A 4IM2A 4YSMA 3R7VA 4BDDA 2OSCA 4CFUA 2VTRA 4EYMA 1CTPE 4EC9A 3KCFA 5JFXA 1H25A 5IH4A 2JFLA 5J5SA 3BYMA 2UVZA 3E63A 3QTIA 3Q2JA 3O50A 4DEGA 1BI8A 3PY1A 4R6VA 1JKLA 3DBCA 2XKCA 3FHIA 3T8OA 4FV3A 1M2PA 5TR6A 2IW8A 3CXWA 4ZTMA 2YEXA 1XJDA 3MPMA 4YPSA 4AWIA 4DH5A 2C3LA 4NEUA 2IVUA 5AV3A 1Q4LA 3LQ5A 2R3KA 3C0HA 3FZPA 4FSRA 3CC6A 4J96A 3TZ7A 4D5HA 4AW2A 5L6WL 1OUKA 5G6VA 4EL9A 4WD5A 2XBJA 3HUCA 4YUQA 4UMPA 4LOPA 1MRYA 3RM6A 3THBA 3MYGA 4RX7A 3BYUA 4LL5A 5CU6A 2WMQA 2WGJA 4EOKA 4QPMA 5ICPA 4D2TA 4FGRA 2IVSA 4PPCA 3OUKA 4IX4A 4HVSA 1XO2B 1UNGA 4YTIA 4ZY4A 1Y8GA 2F2CB 5AP2A 2GPHA 3BYOA 2O0UA 3QRJA 3QQLA 4JOAA 3MY1A 4FA2A 2FH9A 5HLNA 1GOLA 5EYDA 3SKCA 4GS6A 1NY3A 1PRYA 3OT3A 3ZMMA 4U7ZA 5A9UA 4IB3A 4FKSA 3K5UA 2A0CX 3AC4A 4QYYA 4Y8DA 3ZXZA 4WG4A 4BCNA 2BZHB 4F1TA 4ZS4A 2Y7JA 4FV0A 5D10A 1ZYLA 3LCKA 3O8PA 4BDGA 2PL0A 4DH3A 5D9HA 3KRJA 4AN3A 5ANEA 3QZIA 3ORIA 1GZOA 2NRYA 3IDPA 1IASA 2JDRA 2PWLA 5DR6A 3QHWA 4G3GA 4IVCA 3KK9A 3U51A 3LE6A 3E8NA 2PZRA 4F7JA 4IACA 3LM5A 1FVTA 4U81A 1ZAOA 2GS6A 2PHKA 5F1ZA 5T3QA 5IPJA 4J53A 4MTAA 4DLJA 5E4HA 3RK5A 3ZBXA 4ACMA 2BRGA 4ZSEA 4FV4A 3TT0A 4LFIA 2PK9A 1REJA 2JKOA 3PVWA 3TNQB 3F7WA 3VS1A 3ZC6A 5IU2A 3GCUA 2WTDA 4JRNA 2PUNA 3OCSA 4RFMA 4NM5A 2J50A 5B7VA 1KE6A 4L45A 3FL5A 4RIXB 4K18A 4D55A 4E6DA 2B52A 4L46A 3LFBA 3AC3A 4I24A 4M69B 3MESA 4FKOA 4ONAA 3DNDA 2C5YA 2J5EA 3C0GA 4JJRA 4P4CA 1XH7A 2F4JA 4DTKA 1O6YA 2OICA 4O0YA 3UZPA 1FQ1B 1KV1A 3SOCA 2O5KA 4IAFA 4ANSA 3NUPA 5I0BA 2EXEA 2GHLA 1KE8A 3TG1A 4BVUA 5JFSA 1W83A 3NAYA 3QCSA 4R5YA 2YACA 3MFRA 4BZDA 4UB7A 2BAQA 2ITYA 1JKKA 4MD8E 4F09A 2OI4X 1R3CA 4EK5A 4YHFA 2HK5A 3F2RA 4FT9A 4YTFA 3DV3A 5HCXA 1PYEA 2XB7A 4C61A 3ODZX 1Y8YA 4DFUA 5KX8A 5EHYA 3CCNA 5D1JA 4EUUA 3T9IA 4R3PA 4RGJA 3WE8A 1PHKA 4XHKB 4QP3A 4X0MA 5LVNA 1S9JA 1LR4A 3P08A 4H1JA 5M09A 5CXZA 4RSSA 3E62A 5D41A 4QYFA 4Z16A 5JT2A 3A2CA 3FXXA 3FZ1A 2VTAA 3G0FA 4FT3A 3GT8A 4LQMA 3RHXA 3W2CA 4ANOA 5AV4A 4DBXA 2B1PA 4HPUE 4IWQA 4C4EA 3B2TA 4L3JA 1H0WA 2UZTA 3IGGA 5A3XA 2V7AA 4BDAA 3SW7A 4IZ7A 3IECA 4EC8A 1DS5A 3PXQA 3P78A 1SNUA 3IW4A 2X7GA 3NEWA 4K8AA 3ID6C 2Z7QA 2W0JA 3V51A 3TACA 5FXRA 5GZ8A 5GINE 3EQHA 4U45A 2YM7A 3BQCA 4AFJA 3QQGA 1IR3A 3IQ7A 1JNKA 1TQIA 3JVRA 4G5JA 4NM7A 3LMHA 1OL6A 1JSVA 2VV9A 5DT3A 1HCLA 1KE9A 4AAAA 3C9WA 3LMGA 3WYXA 4TYHA 3DK6A 1AGWA 1H24A 2BDWA 4KAOA 1K9AA 4MVFA 3TI1A 3WZKA 2I0VA 2B9IA 1G3NA 3OEZA 4KA3A 2OIQA 4F9WA 5JRQA 3BIZA 3BV2A 4FUYA 4OR5A 1KSWA 3SX9A 4R78A 3QD4A 4YJQA 4C37A 2A19B 3LM0A 4I5MA 3POZA 3EZVA 3EFLA 4F9AA 4B6LA 2UVYA 4FT0A 4LM5A 1K2PA 3RCJA 5IA4A 1X8BA 4QP6A 1H4LA 1OKWA 2QC6A 2C6MA 2R5TA 4P2KA 2X2LA 5C26A 3UQCA 3H9FA 3IOPA 2BHEA 4D4SA 4IZAA 1RJBA 5M08A 2ITTA 3L9LA 3ZBFA 2GSFA 3GEQA 3QBNA 5T6KA 2R7BA 2DYLA 4AZTA 1O6KA 3FMMA 4FZDB 4U8ZA 2WTKB 2ZMDA 4FSTA 2VTSA 5M07A 4E1ZA 3U6HA 4JRVA 3OUNB 4UWCA 4ZK5A 2WXVA 1YDRE 3MWUA 4IVAA 2GNIA 5K0KA 2JEDA 5DPVA 2W9ZB 2QOIA 2UZBA 4X2JA 3BGZA 3LOKA 1W7HA 3R8MA 1J7UA 4QD6A 1P4OA 3EQDA 3BU3A 1PXLA 2ITPA 3BEAA 1I09A 2F7ZE 2BHHA 4CVAA 3KEXA 3FYKX 4JS8A 4O0RA 5IISA 4TXCA 4HYUA 4ANQA 4I5HA 5B2LA 3FUPA 4ZSGA 4QYEA 3NUUA 4U40A 1PXPA 3P7CA 4CG8A 5IQBA 1OI9A 5F4NA 3PFQA 3Q96A 5LVOA 5BYYA 2QOFA 1YDSE 1Z5MA 2JKQA 2J0MB 3LPBA 2YWPA 4XV1A 4XYFA 2VWXA 4TTHB 3R83A 1BL6A 2W4JA 4RX8A 1PXNA 4ZTSA 2WMVA 2CCHA 2R0IA 3NYVA 5TF9A 4CLJA 4DG3E 4E93A 4S31A 3QRTA 3UJGA 3VIDA 2BDFA 5DR9A 2G2FA 2J0LA 3MN3A 4GK3A 4TWOA 1SZMA 1GZKA 4IBMA 5FXQA 4FC0A 1YXSA 3GOKA 4HGLA 4U5JA 5EQYA 4V0GB 3M42A 4CFWA 4G3FA 4CRSA 3NX8A 3F2AA 1FINA 3VW6A 4EJ7A 2X8DA 4CT1A 4LUEA 5E8ZA 4KIPA 2GHMA 5BMMA 5IQFA 3C5UA 3GCVA 4FNYA 5CU2A 2X8IA 3F3UA 4II5A 3FI3A 3QGWA 3V6SA 2RKUA 3RKBA 3AXWA 4YHTA 4F70A 4PL4A 3FLQA 5AM7A 1BKXA 4RMZA 2Q83A 3R00A 3LXLA 3HEGA 2A1AB 3DAKA 3ZFMA 2B53A 3MFUA 3QLFA 4M12A 5CVGA 2QLUA 3FXZA 4W8DA 4AE9A 3TKUA 3HAVA 3LJ1A 4PL5A 2IW6A 4ZIMA 3AMAA 4QNYA 3GCPA 4RT7A 5IA1A 3KFAA 3LJ0A 1PF8A 3RBWA 3O7LB 4RPVA 1XH5A 3QD0A 3M1SA 5EI2A 5KZIA 3WIGA 5IQHA 3NR9A 2E9OA 4CKRA 1J3HA 5DIAA 3GBZA 2QD9A 4TWPA 4AA5A 5A6NA 1ZMWA 2HWOA 5HBEA 5IKWA 3H10A 3OY3A 4B8LA 2QO2A 3ETAA 3BWJA 3IW5A 1PKDA 3ANQA 5GHVA 1WZYA 1LUFA 2W1IA 4BCIA 3MV5A 3MJ1A 4W4YA 3OBJA 5A4CA 5DVRA 3I60A 3KL8A 5EM8A 2FSLX 2X6EA 5AR8A 4RJ6A 4CMTA 1NW1A 2XNEA 3GB2A 4WOVA 4LGDA 4XG3A 5IMEA 5CAVA 3W8LA 2J5FA 1GAGA 2BKKA 3UOLA 2UW8A 1NXKA 3AGLA 1OIRA 1KE7A 4BYIA 5K4JA 3R7YA 3S00A 1QCFA 4FVPA 2FA2A 5BPYA 3TKHA 1G8AA 4O6LA 4J99A 3HGKA 3KC3A 3PJ1A 4U6RA 3O23A 4I94A 3CEKA 4FSUA 4UWBA 2GS2A 5HLWA 4ASZA 3KF7A 5CSXA 3D15A 4A9TA 4HW7A 3WIKA 5IA3A 3E3PA 4IEBA 2HW7A 4ZTNA 2GCDA 4GK4A 5BQ0A 2XEYA 4QTBA 5IUHA 2Y4IB 3PYYA 5HKMA 4EZ5A 4QMLA 4O0SA 3UGCA 3VJNA 4ZZNA 4G9RA 2YISA 4K2RA 4G9CA 2FSOX 1ZY5A 1BYGA 2IN6A 4UEUA 4ACHA 3DB6A 4ZAUA 5HO8A 4RWJA 5I9XA 2QHMA 4IE9A 2C6EA 3KGAA 2FB8A 4YPDA 5BVWA 3UP2A 5EW9A 4AZEA 4QMNA 1PMUA 3F61A 3GU7A 3OWJA 4PP7A 5CZIA 4XV9A 4IWDA 4E5BA 4O86A 4D0WA 3BHTA 3FAAA 5D12A 3TWJA 3V5PA 4FSQA 3NS9A 4USFA 3NPCA 5LWNA 3MA3A 2ETMA 3SD0A 1UVRA 3TKIA 2VUWA 4JQEA 2R3IA 4HNIA 3EFJA 4ACDA 3OTUA 4O81A 2WIHA 1V0PA 2W5AA 3ENHA 3L9MA 5DYJA 1OZ1A 4N6ZA 4FBXA 5LMKA 5FG8A 3DA6A 2IWIA 3F2NA 4XBUA 3IDCA 4LOOA 3W8QA 4EK4A 1Q41A 1OITA 2YLEA 3FZRA 4Z9LA 3D5VA 4G5PA 4J95A 4BCOA 2VTMA 3A8WA 4E73A 3AT2A 2VWVA 4A4XA 2ETKA 2F9GA 3FV8A 4LI5A 5IH5A 2Z8CA 2ZV8A 3UBDA 4M0ZA 4F6WA 1OL2A 3RAIA 2EB2A 3TV6A 2P33A 3A7GA 2WOUA 3PPKA 4YTCA 3H0YA 3N4TA 4TNBA 3WF5A 2C3JA 3U4UA 1M2RA 3EQIA 3QKLA 2ITQA 4PQNA 4W8EA 4BBEA 2Y6OA 4FK3A 5BMSA 4YZBA 5EYKA 4CFFA 3EL8A 1JWHA 4R1VA 3COHA 4CEGA 4OTDA 4OBPA 2JAVA 5AA8A 3R1YA 4I0TA 5AEPA 3FC1X 5HLPA 4HVIA 3JVSA 4S34A 4JT3A 2O63A 2YCSA 3FMEA 3BEGA 2R3LA 3KRRA 4N57A 3C1XA 5CNNA 4EK8A 4M8TA 4D2PA 4C36A 2GNJA 2J6MA 3JY0A 4NFNA 2GMXA 3QRKA 4PTGA 1OPLA 4IM3A 4RFZA 1TQPA 5EG3A 3SHEA 3WF9A 4P7EA 2JDSA 3PRFA 4QQ5A 4V05A 2PZPA 4MBLA 4BHZA 5M4FA 5GIOE 4EH5A 1FVRA 4Q9SA 1OPJA 4HCUA 4OBOA 5LOHA 3R9NA 1U59A 1S9IA 3FKOA 5HNIX 3NNUA 5CAUA 4EH3A 2R3HA 4PRJA 4TL0A 3P86A 4FTAA 3PLSA 4X2GA 3TUCA 1O9UA 4FKJA 3AG9A 4AZFA 4GJ3A 3EQGA 5EKOA 1JKTA 4AX8A 4B7TA 2W1HA 3GU8A 3PIYA 4PNIA 1U4DA 2HWPA 3OW3A 2JD5A 3RMFA 3H9OA 4D5KA 3I7BA 4AOIA 3TUDA 4KIKA 3QF9A 4MD7E 5AIKA 2HXQA 3UE4A 5F94A 3SXRA 3PP1A 2OF4A 3G2FA 2C6OA 5LARA 5C27A 3PPZA 4QTAA 4PUZA 2H34A 3NUAA 2W4OA 3NW6A 4O1OA 2EWAA 5AMNA 2LAVA 5CXHA 4GSBA 5L3AA 3ORPA 2GFCA 4B0GA 4BBMA 5DG5A 4S30A 4CRLA 3SG8A 4EWHA 3W2OA 3RGFA 3B8QA 3GP0A 3GVUA 1PXOA 4WIHA 4B8MA 5KHWA 1F0QA 2VX1A 2OLCA 5CQWA 5FXSA 2PMIA 5GJFA 4GK2A 1OPKA 2B9JA 1XQZA 3D5UA 2VGOA 3R9HA 5IEYA 2UW7A 3RM7A 4Z55A 4E26A 3QU0A 5J87A 4NCTA 2QONA 1E1VA 4AGCA 4NUSA 4ZSAA 4KKGA 1LEWA 3QC9A 3PE2A 4K9YA 2QVSE 3V5LA 2ITUA 2ZMCA 3R63A 3ORLA 4M7IA 3UG2A 4F7LA 2YA9A 3FMNA 3CP9A 4HNFA 3CE3A 5LVMA 3W18A 2C1AA 4QMPA 4UN0C 2UZVA 2YJSA 5K3YA 4F9BA 4ZEGA 2CMWA 3R9RA 3TXOA 4FSWA 2FGIA 3MH2A 3SRVA 2UW3A 2RGPA 4FV6A 3UODA 4BTFA 5J9YA 5ETFA 4EYJA 3UIUA 4FEUA 1L8TA 2B9HA 2CKEA 5FEQA 2KULA 3OHTA 3QQFA 3ZRKA 4BTMA 4BKYA 4RJ4A 5BYLA 1SNXA 4BRXA 3KULA 3BHVA 4QP9A 5CS6A 3MGYA 4N0SA 4CQEA 4RWKA 3ZM9A 3AC5A 5E92A 4X3FC 2RF9A 3JUHA 5AUWA 1URWA 2O65A 3W10A 4CZYB 4N70A 4D4VA 3I0OA 4FIFA 4FTQA 4ERKA 4A4OA 2W06A 1H00A 4J8MA 4F99A 2FUMA 5CWZA 2A2AA 3I5ZA 2QURA 1JBPE 1YVJA 3DNEA 3MH3A 4YSJA 4EBWA 3K5VA 4Y85A 4E6QA 2WB8A 3GC7A 4AW5A 4IANA 2BRNA 4WBOA 5DBXA 3MFSA 5LWMA 1TVOA 1GJOA 4I5PA 4I6QA 4IB5A 4AACA 3TTIA 2ZV2A 5E8WA 3NDMA 3N4VA 4RIYA 1J1BA 5AP3A 5FRIA 5D7VA 2EXCX 5DOSA 2IPXA 4IAAA 5HI2A 4A4LA 4KIQA 4GEOA 4QMTA 5AP5A 1YOMA 4BB4A 2UZOA 4U44A 3OTVA 4FNWA 4QP7A 4Q2AA 3CPBA 3W2PA 3R1SA 4BKZA 4FV5A 4DINA 3EFWA 4PP9A 4KUJA 1YRPA 2Z2WA 3F69A 2QI8A 5J8IA 4DEEA 2OZOA 4EH7A 5CLPA 2BKZA 4KRCA 4E5AX 1IA8A 1Y57A 2WELA 5CT7A 5IDPA 5C8KA 2X2MA 3BGPA 1ZZLA 2WD1A 4G17A 1H1WA 4FL1A 3E87A 4GL9A 3QXOA 5HTCA 2PMOX 3D7ZA 4KRDA 2Z7SA 3LFEA 4BI2A 5HE3A 5CSVA 4EK6A 3PJ2A 3ACJA 2C0IA 2JDTA 2QOKA 4HYIA 1GIIA 1KV2A 1Q8UA 2IZSA 4GT3A 1FGIA 3RWPA 2V5QA 4IC7A 3VBVA 4LL0A 4XS2A 3VS3A 5K4IA 1SVGA 1DI8A 2E9UA 1TQMA 4CMOA 2VWWA 4EH9A 2IZRA 4EH8A 2WIPA 4FYNA 4E4XA 1B38A 1PXIA 1LEZA 1G8SA 4UZDA 1WBWA 3E8EA 3SAYA 4JQ7A 4R3CA 4NIFA 4WSYA 4F0IA 3MVMA 4M68A 5IQIA 2Y8OA 4GUBA 3FHRA 5ANKA 3PA5A 5H8GA 4DFLA 1ATPE 2JIUA 3HNGA 3ATTA 2YM3A 4DCAA 2CNUA 2QU6A 4RVKA 3ULIA 5H2UA 2WU7A 5KHXA 3RK9A 2GQSA 4WA9A 3PA4A 4NM0A 5AP0A 4DGNA 3RP9A 3GU4A 1U5QA 2V22A 2PVNA 1R1WA 3CTJA 3F6XA 4O91A 3QTXA 5LMAA 3R8VA 3VW8A 4CT2A 2HCKA 5FUTA 3PSCA 4AQCA 3R1QA 3OWKA 2JAMA 4OLIA 5CX9A 2GQGA 3BBWA 2P3GX 3K3JA 4B9DA 3S1HA 3C4EA 5CI6A 3ZEPA 3SC1A 1W0XC 4FTOA 1KOAA 4EK3A 1NA7A 3BQRA 4L42A 1YI4A 1BX6A 3VC4A 3TNIA 3F5PA 4ANLA 2W96B 3QXPA 5CAQA 4GIHA 4I4FA 1F5QA 5CU3A 4GG5A 2X0GA 2XNMA 4U97A 3MH0A 4YR8A 2PUIA 2GFSA 3SOAA 2BAKA 4FTCA 4IX6A 1W82A 4ZXTA 3ZSHA 4E8AA 2QOCA 1OM1A 3S3IA 5L2IA 4AOJA 5M4UA 3R21A 4QQJA 2H6DA 3TL8A 3LKMA 4GU6A 2WQNA 3HVCA 4IAYA 5HESA 2OU7A 2WZJA 3LW0A 4KKEA 3I0QA 3ALOA 5FBOA 1UKHA 4WO5A 4XBRA 3BGQA 4I3ZA 3ZZWA 1QL6A 3G6GA 5GIPE 4IX3A 5AP4A 2XKDA 3BBTB 5FWKK 4F64A 1J7LA 4IW0A 2UW9A 5J95A 4D2RA 4HGTA 5JK3A 4BDCA 3A7JA 5CYIA 2V55A 4GYGA 4AT4A 5CASA 4L53A 4BF2A 2UVXA 1H08A 3EH9A 3LVPA 2W17A 1M14A 3NUXA 2HIWA 4FNZA 5AUXA 3TN8A 3EN9A 3VBTA 5HIEA 4CGAA 1YHVA 3AT3A 4HVGA 2WTVA 2RFSA 5GJGA 2FYSA 5JEBA 3ROCA 4ZSLA 4WNPA 3T3UA 1GZ8A 4FNXA 3O17A 2OK1A 4IVDA 5EH0A 3W55A 4KSPA 2XK8A 5E8UA 5ETIA 1JLUE 1XH8A 4L01A 3A4PA 2CCIA 4AZSA 4DLIA 2PZYA 4G6NA 3IPHA 4KD1A 4QMMA 2BCJA 4RJ5A 3VUMA 5JSMA 3FEGA 5C4KA 1Y6BA 2OJ9A 2XRWA 2QQ7A 3LFDA 4ID7A 2VWIA 3HV7A 3NCZA 4P5QA 4RJ8A 4RZVA 5E8YA 3Q9XA 3EIDA 1FMKA 3ORKA 4ZJIA 5M53A 3DK3A 3QUDA 2NPQA 4HJOA 4YZMA 3PSDA 4RVMA 5CAPA 4IHPA 4BN1A 4BTKA 5A4TA 4ZZMA 4OTQA 4C58A 1LP4A 1V0BA 4F9YA 3IW7A 3SA0A 4JDKA 2VTOA 3NMUF 4JAIA 2X2KA 4DGOA 5EM6A 5JZNA 4UWYA 4EQCA 3HLLA 4CG9A 3OZ6A 4I1ZA 4WRSA 5ANIA 3EFKA 3OXTA 4TW9A 2X7OA 5E8XA 5HX8A 1WCCA 2R3MA 3KN6A 3Q9YA 2VO3A 2XKFA 3ORTA 1EH4A 4J52A 4RJ3A 2XNBA 4BIDA 3SV0A 3QQJA 2P0CA 3RPRA 3TZMA 5HCYA 1GIJA 2GTNA 2W1ZA 1YWRA 3DAJA 3SQQA 3OCGA 3O51A 2YDJA 5BNJA 3H9RA 3FSFA 3FLZA 3ACKA 1REKA 4PMMA 4W9XA 4FG9A 4PF4A 4QT1A 3TDWA 1HCKA 2X9EA 3FY2A 5TE0A 3FKLA 4AW1A 5LMKC 3CD8A 4MNFA 5E8VA 4FSZA 3FLYA 4EH4A 4U42A 4IFGA 2X4FA 4X6QC 4OAUC 4D9TA 3VBQA 2WEVA 4X3JA 5LVLA 2J2IB 3DU8A 4Q9ZA 4XNEA 4FEXA 5EDPA 5ACKA 5BVFA 1WFCA 2WTCA 2W5HA 4GV1A 4KSQA 3BHYA 4GG7A 2QOLA 4L3PA 3WF7A 3GNIB 5HU9A 4NTTA 3MDYA 5AR7A 2IO6A 3ANRA 2CKPA 5AP7A 1VR2A 1V1KA 2GNGA 4AGUA 5IQGA 4I0SA 3BHUA 1QPDA 2QNJA 3N51A 1OL5A 2HZNA 4JI9A 3TIZA 3KXMA 5I9UA 3VJOA 3CTHA 2XCKA 2ESMA 3R6XA 4PDOA 2OXDA 3VWAA 3IOKA 4ZZOA 5DNRA 4BDHA 4C7TA 5K0XA 1E9HA 1YXVA 3F3VA 1CSNA 4X3FA 2IVTA 3GC9A 3QKMA 4DFBA 4BCHA 3FPMA 2QODA 3DKCA 5DT0A 4MXXA 3I7CA 4RIWB 3P4KA 1J7IA 4C4JA 2RFEA 4FZFB 5ANDA 3CTQA 4C4IA 2I0HA 1BL7A 4DHFA 4EOQA 4UBAA 2I1MA 3Q9WA 5DGZA 3HP5A 4D4RA 4AT3A 4QQTA 4BC6A 3Q5IA 5F9EA 3HRBA 4O82A 4OTFA 4K1BA 4X21A 5DLSA 4C59A 2C6LA 5FEEA 2DUVA 4QMXA 3TIYA 4KNBA 1UU3A 3C51A 3ENMA 3AQVA 1BUHA 3ZDUA 4WT6A 4QMWA 4YJOA 5BUIA 5C9CA 4I6BA 2QR7A 4UMUA 3OMVA 2ITZA 5EM5A 3AC8A 4C02A 2YERA 5LMBA 2XK4A 3ZUTA 2WMRA 3C4FA 3UVQA 4TKSA 3QTZA 1H26A 1O6LA 1R0EA 5FTQA 4R8QA 3PRIA 1NVQA 3RTPA 4UX9A 2PY3A 3FL4A 3GU6A 3QLGA 3FQSA 4ACCA 2VWZA 3R2BA 5HNGA 1CKPA 2REIA 3UO4A 3FDNA 3NUNA 5AUYA 4F65A 1YHSA 3QTQA 3DGKA 3JXWA 5CNOA 3VUKA 5KMNA 5I3RA 2O64A 3FQEA 4W9WA 3D0EA 3D7TA 3WF8A 4BR3A 3L9PA 1T46A 4MF0A 4FVRA 2QOOA 3DT1A 3HMOA 4DC2A 1XKKA 3QX2A 2W1GA 3QWKA 5CENA 3EJ1A 4NW6A 5CANA 5M56A 3GCQA 5AA9A 2B7AA 3FZSA 4IWOA 4FTMA 5HBJA 2HZ4A 4AU8A 4IFCA 4XG9A 1P5EA 4EHZA 2WMUA 3CR0A 4LOQA 1E1XA 4MBJA 1VYZA 3KN5A 4EUTA 1P4FA 1W8CA 2XA4A 4FTUA 3ZDIA 4MK0A 1CKJA 3UZTA 3VUDA 2WKMA 2ZM3A 5IDNA 2P2IA 4CCUA 3ZH8A 1OBGA 3RPOA 1RW8A 3PXZA 3PWDA 4NCTC 5DI1A 2BVAA 4XV3A 3VQHA 4DN5A 5IEXA 5LQFA 3AD4A 3PIZA 2WPAA 3KK8A 4KS8A 5FDXA 1FPUA 2RG6A 2C0OA 3PDTA 4F4PA 3C50A 2FO0A 2YCRA 3UIBA 2X8EA 3ZS5A 3IDBA 3P79A 2WQOA 3I79A 4BDFA 4HZSA 1SVHA 2C5VA 2ZM1A 3Q3BA 2ZOQA 4G16A 5CTPA 2XUUA 3BHHA 4F9CA 1ZLTA 3OP5A 1F3MC 4XEYA 3QC4A 4YZCA 4AE6A 4EEVA 2QG7A 5M4CA 4IM0A 1NT2A 5HEZA 5J1VA 1YWNA 3FY0A 3KY2A 3OF0A 4FV7A 4R7IA 3KU2A 2PUPA 3A99A 5AV0A 4W4WA 4ANMA 3OROA 4TYIA 5EDQA 4RC3A 2C6TA 2BUJA 4TT7A 5CQUA 2YCQA 3LFCA 4M84A 1DAWA 4NZWB 2W1EA 4O27B 2B54A 3C7QA 3MSSA 4FKWA 3MVHA 3UMWA 3ZFYA 3PXYA 4EH6A 3MTFA 2GS7A 2R3RA 3PJ8A 3GCSA 4YURA 3EQFA 2OW3A 4L43A 4F1MA 3HMIA 4BY9E 4G3CA 4BKJA 4X2FA 4FL2A 2JFMA 1VZOA 4D2VA 4Y46A 1WBNA 3H3CA 3TCPA 3HRFA 2R3OA 3VQUA 2WAJA 3F66A 4XOZA 5A14A 1IAJA 3ZO3A 3TUBA 4F63A 4LRJA 5E90A 2SRCA 3EHAA 4QOXA 3UQGA 4JDJA 2OJIA 5CU4A 2HXLA 3W2RA 5AUUA 3GQIA 3F5GA 5AR4A 4O7TA 4I23A 1VEBA 3ZO4A 3QUPA 4AA4A 3W16A 5KKRC 1ZYCA 4JQ8A 2BMCA 4FV9A 4WUNA 4EOJA 2JLDA 4J97A 5IQDA 1OMWA 3V5JA 4AW0A 3N4UA 3DXQA 4NSTA 4RBLA 4FIGA 4KKHA 4GU9A 3GUBA 1BMKA 3V01A 5CEMA 5FGKA 3WYYA 2RG5A 4FKVA 1KOBA 3D5WA 3R22A 5HCZA 2BTSA 3PPJA 3NNWA 4JG6A 4YNOA 3A61A 3E3BX 2R3FA 3DBQA 4MKCA 3UP7A 2JDVA 4DFXE 3AGMA 2QOBA 4FZ7A 2YM4A 4R5SA 5IH6A 5FP6A 1H28A 2ETRA 4MXZA 3VULA 1UV5A 4FF8A 4YZ9A 3PXKA 2X6DA 2QR8A 5FQDC
chains in the Genus database with same CATH superfamily
4QP4A 5AADA 4OTHA 4BZOA 3TYKA 4MNEA 3KA0A 5TO8A 4QNAA 4GUEA 4FSMA 4NU1A 4YNEA 4XJ0A 5FLFA 4XG7A 3ZSGA 3MVLA 3A7HA 3RPVA 5CSPA 3NAXA 4O21A 3UIXA 1H27A 3HDMA 4YO6A 1U54A 4GCJA 3VBYA 4ANBA 4O0UA 2GNLA 2PVJA 3BE9A 4RZWA 2CSNA 3Q2MA 4QMQA 4MQ2A 4CFVA 1WBPA 4L7FA 2XK7A 1MRUA 3MPAA 4B4LA 1K3AA 3OD6X 3I1AA 3QRIA 3LFAA 4FSYA 3BKBA 4YBJA 3RAHA 4DGMA 4BDKA 3WARA 5JQ5A 5L2WA 1UA2A 4ZS0A 4PMSA 3G5DA 4IJ9A 4OT5A 4BI1A 3FWQA 2OJGA 2J9MA 4DG0E 4YO4A 3LCDA 3DQXA 4H1MA 2CGXA 2UZNA 1UWHA 3TTJA 4CV8A 2WMWA 5LVPA 4L6QA 4XG8A 5CF4A 3WILA 2R3QA 2CN5A 3ODYX 3OOMA 1OL7A 5CSWA 2X1NA 3R8UA 2ERZE 1WBVA 1FOTA 4LRMA 2RSVA 3KRXA 3BE2A 3R1NA 2ZB1A 3CBLA 3PG1A 2KTYA 1U5RA 3BYSA 4GVJA 3GC8A 2QOQA 3AC2A 2WEIA 4C62A 5A4QA 4XH6A 4A06A 4C33A 1B6CB 3FXWA 3O0GA 4U3ZA 2I40A 4L00A 4RLKA 3DBEA 2A27A 3QTUA 4BI0A 1H0VA 2EXMA 2HY81 3L8PA 1BI7A 3FKNA 2O3PA 4ALUA 2VD5A 4IMYA 3KRWA 4RC2A 4H3BA 4ZP5A 3QZGA 3COIA 5CEOA 4GKIA 3LLTA 4HZRA 3U54A 1YI3A 2XEZA 3UNJA 3HYHA 4EOSA 3SW4A 4Q5EA 2AUHA 2ITWA 2YM8A 2JBPA 5TOZA 4QYHA 2HY0A 2OWBA 2YIWA 2G2HA 3RJCA 4ASXA 4I6FA 5IUGA 2R64A 2X0QA 2VWBA 4HVDA 3PVUA 3RAWA 5KMLA 4HGSA 2DWBA 4JDIA 3HAMA 4GJ2A 4IH8A 3RI1A 4EQMA 3ZC5A 4C3RA 3C5IA 3HP2A 3EQRA 4FUXA 3FC2A 4DEBA 4X2NA 4O0VA 2H9VA 5C01A 3DFAA 3ZO2A 1Y6AA 1A9UA 1JVPP 4IB0A 5HG8A 5TKDA 4MX9A 2YAKA 3ZO1A 4X3FB 5HTBA 2PVMA 4YLJA 3CQUA 3WBLA 3PE1A 4BZNA 1Q5KA 2H96A 1Q8TA 2XAOA 2XVDA 2VO0A 4QTDA 4EOOA 3KXGA 4EOPA 4CMUA 4FKRA 3PSBA 2XALA 3IW8A 3MJ2A 3DXPA 2IF8A 4LYNA 4R7HA 5IUIA 3HDNA 4G1WA 4KS7A 4C4HA 4OTPA 1A06A 4JR3A 4O6EA 3F7ZA 4TYHB 4APCA 4EH2A 2BFXA 4ENXA 5CALA 5KMJA 4Y73A 4JDHA 4F6UA 3VONA 4QTEA 2VNYA 2BR1A 3Q60A 1GZNA 4DBNA 3FMHA 3PP0A 2DS1A 3JYAA 4EWQA 4Z7GA 3P23A 2BZJA 5IF1A 3G6HA 3ZHPC 4J1RA 2C30A 3PLAE 1Z9XA 4ZTQA 4ZY5A 3A7FA 3HMMA 5BVNA 3LAUA 3LFNA 1M52A 3LFFA 2UZDA 3AD5A 4GT5A 4NJDA 3OXZA 4HCTA 3PG3A 2F2UA 3A8XA 4RIXA 4G6OA 3VS2A 3UVRA 4RC4A 5HBHA 5JKGA 4PTCA 1OVEA 5CF8A 4FYOA 3CY3A 4YJPA 2JC6A 5K9IA 1J91A 2Y4PA 4O83A 2C6KA 4QPSA 3UIMA 2C6IA 2XIZA 4W4VA 4HYHA 5CF6A 3WZUA 2CGUA 5AV2A 3ZYAA 4JR7A 4UMQA 2YDKA 3PJCA 4BJJA 2XYNA 3H30A 5CEIA 2AYPA 4LRKA 4EHVA 4MUQA 2J51A 2G15A 5A6OA 3BZ3A 1PMVA 5M4IA 2Z7LA 2VRXA 1JPAA 4BBFA 4I6HA 3D2KA 3VRZA 2PZIA 4FKLA 3RAKA 2QKRA 4JXFA 3NYOA 5HD7A 3REPA 2Y6MA 4DFYA 5G1XA 4ACGA 2YHVA 3RALA 4CYJA 4FTJA 2W4KA 2ZVAA 3UPZA 2V62A 2C6DA 3U8WA 5C1QB 3BX5A 5IZFA 4O7SA 1I44A 3EKNA 3OC1A 3Q04A 1OUYA 2EU9A 3SXSA 1STCE 1PMNA 3ZRMA 4BIBA 4MXCA 3RPYA 5FP5A 2W9FB 2GNHA 5E7RA 3E88A 1OKZA 4EHEA 4CFXA 4UV0A 4M3QA 1JAMA 2BAJA 4BCGA 4EOLA 3C0IA 1ZZ2A 2EVAA 3DKOA 1XH6A 4FV1A 4QP1A 4WUAA 1Q97A 4TRLA 2Y0AA 2OIBA 1UWJA 4XLVA 4MXOA 2IZUA 4MXYA 4BYJA 2WMAA 4FKTA 4C2WA 3V8SA 3ZSIA 4AXAA 5DHJA 3BU6A 4BHNA 4CTBA 3G9LX 4R1YA 5AV1A 5EHLA 3OEFX 3Q52A 3NRMA 1OECA 3DKGA 2XNOA 3W0PA 2YLFA 3A7IA 4W4XA 2OXXA 3M2WA 5IMXA 4U0IA 5LCJA 5IA5A 1YXUA 2C68A 5BVEA 4AUAA 1YOLA 4FTLA 4A9SA 3CPCA 4AT5A 5EOBA 2ZDTA 2ZM4A 3NIEA 2J0IA 4IB1A 1WVXA 5HHWA 3WI6A 3R71A 3B2WA 4XG2A 4F0GA 4ZLZA 2BIYA 2HOGA 2ZB0A 2OGVA 1M2QA 1XHAA 5JFVA 3D2IA 1OIUA 2R2PA 4M13A 4GYIA 2PYWA 2BPMA 3Q4TA 4FKGA 4MD9E 4QO9A 5IEVA 4PY1A 4H39A 5DFPA 3TZ9A 4PPAA 5BVDA 4O1PA 5DWRA 2I0YA 4P5ZA 2HENA 5JN2A 3Q32A 2UW6A 3RHKA 2JKMA 1XH9A 4Z7HA 2OBJA 4G2FA 2XNNA 5JH6A 3VUHA 3MIAA 4CV9A 2O2UA 1OL1A 4KB8A 3HX4A 2FSTX 4WG3A 1ZOHA 4WSQA 3EZRA 4D1ZA 4DG2E 4FTIA 2Z7RA 2XMYA 1NVSA 4I4EA 4K11A 4R77A 4AXDA 1GY3A 2X0OA 3F3TA 4BTJA 3W2QA 4AQKA 4JIKA 3PJ3A 4UY9A 5HU3A 5L2TA 2VWUA 3MY0A 3DS6A 4D2WA 5JZJA 3QFVA 4CQGA 4D1SA 4G31A 4IC8A 4CKJA 4QQCA 1WBSA 3QCQA 3PXRA 4GKHA 4I20A 2ZAZA 3P7AA 5HICA 5HE1A 2CDZA 2P55A 3EKKA 4OTWA 3R2YA 4RVLA 5HO6A 4OAVB 4GFGA 3COKA 2VTJA 4EHGA 5J7HA 5CI7A 3EYHA 4DDIA 3PY0A 3W33A 3EN5A 3BV3A 5EYCA 4NFMA 4O84A 2CHLA 1OIYA 5GZ9A 1ZRZA 1Y91A 4JX3A 2RIOA 3EN7A 2FVDA 2UW4A 2JKKA 2P2HA 3DB8A 3OW4A 5AR2A 2RL5A 4FEVA 1H01A 4JX7A 5AX3A 5I4NA 1XH4A 3TZ8A 3QTWA 4NTSA 4UMTA 5DH3A 5CVFA 3BRBA 4FTTA 3K3IA 2C3IB 4PWNA 4MNEB 3HMPA 2VU3A 3FZTA 3WZEA 3AD6A 5ACBC 2OZAA 3I5NA 2XRUA 3W0MA 2RFDA 4APPA 2VTQA 2WO6A 5DR2A 1UU9A 4AZVA 2YIYA 1URCA 4TWCA 4QRCA 5HG5A 2UZWE 2ACXA 1TKIA 3HA8A 3ALNA 3QTSA 5H8EA 3Q53A 3R7EA 4MH7A 2OH0E 1H1RA 4ERWA 5BVKA 4MAOA 2W1DA 5H8BA 5AAFA 5K5NA 5L2SA 1YI6A 3CQWA 3FMLA 4D0XA 1R78A 1ZWSA 3FLNC 1YXXA 4O7YA 3BELA 4DF3A 4EORA 5EQEA 3FMJA 3L8XA 5EYMA 5HO7A 5EI8A 4A7CA 4AF3A 3E7VA 2GU8A 4V0GA 4XG6A 2EUFB 4NH1A 4PX6A 4YJTA 4CKIA 2YWVA 4DEIA 4PMPA 4Z3VA 3VUGA 2IVVA 3ZUVA 4F1OA 1ZMVA 3BLQA 4TYJA 2G01A 2IZTA 4RX9A 4E3CA 5IG1A 4QEBA 1JOWB 1V0OA 3DTWA 1YWVA 2NP8A 3Q6UA 4NK9A 2W7XA 3SLSA 4E4LA 4YU2A 5AUVA 1R39A 2CGVA 4RJ7A 3DDPA 3PIXA 3P5KA 3RNYA 5HNBA 3TEIA 4GW8A 4S33A 4UYAA 3KVXA 2HW6A 3R8LA 5KCVA 1WVWA 2OH4A 3EL7A 3R7IA 2VAGA 4U9AA 2PE2A 3UNZA 4AFEA 5BYZA 3OOGA 2C5XA 3ORNA 1R0PA 4C35A 1DM2A 4G6LA 5E8SA 3MI9A 3MIYA 2VX0A 1Q3DA 4C3FA 3UYTA 2W1CA 3W32A 4OBQA 2BRMA 2XAMA 3ZZEA 3Q4ZA 4GMYA 1ZARA 4DHZA 3VO3A 3DTCA 4L9IA 4X2KA 2C69A 5A4EA 3VS0A 4DEAA 3RZBA 3G15A 3LLAA 3KXNA 1YDTE 2ITXA 3FSKA 2PVKA 3MPTA 4J7BA 1Q3WA 1Z57A 3OXIA 2VZ6A 2WU6A 3RCDA 1H1PA 5ANJA 3BPRA 3ZEWA 3WOWA 4JBQA 4DAWA 4DYMA 2UZUE 2XCHA 4FGBA 3BYVA 3EQPA 4RFYA 5EI6A 4YC3A 3GENA 2ZJWA 2BILB 2ONLC 2CKQA 3ZU7A 3T3VA 3L1SA 3UDZA 3RZFA 4K6ZA 1WAKA 3E93A 2R7IA 2GQRA 5L4QA 3BU5A 5H9BA 4FIHA 3V5WA 2WTJA 2DQ7X 3ZOSA 3OVVA 2XBAA 2YJRA 4AAYA 5CU0A 3Q6WA 3O2MA 3W1FA 1W84A 5EDRA 4FICA 3UOKA 2QG5A 5ANOA 1XWSA 3MBLA 4BDBA 5I3OA 3GFEA 3VAPA 3JPVA 3TJCA 4ENYA 2OKRA 4TWNA 3WE4A 4E6CA 2R3NA 3DLSA 4U80A 3U87A 4D2SA 4O7ZA 2CN8A 2XJ1A 3KMUA 1Q99A 4KBKA 3TNWA 2VTNA 3HZTA 3VS4A 5DMZA 4JVGA 4FKQA 3UYSA 5J9ZA 3MH1A 2XZSA 3V5TA 2C1BA 4K0YA 2PSQA 3R7OA 4C0TA 2VNWA 4PDSA 2VX3A 4AN2A 4MHAA 4AG8A 4BDEA 4H3QA 4EQUA 3EN4A 3AT4A 3EQCA 4QMYA 3VHKA 3UG1A 3TDVA 4KIKB 3LIJA 5A46A 2YN8A 3L8SA 4I0RA 4YJSA 1JSUA 5I5ZA 2NNWB 3UQFA 1GNGA 3QZHA 5B2MA 3I4BA 5C8MA 2F57A 2ZYBA 5KMOA 3HV3A 1WBTA 1KE5A 4WNKA 3VN9A 3ZRLA 5JGDA 5AP1A 5KMMA 4RWIA 5KBRA 2J90A 3NSZA 4J98A 3MY5A 3HRCA 4XUFA 1XBCA 4DDGA 1QPCA 1MQBA 4F6SA 3C4XA 5GNKA 3FQHA 4UZHA 4JLCA 4A9UA 1ERKA 4BCMA 3EQBA 5J7BA 4FR4A 2BROA 4G3DA 3V8WA 3IG7A 4B99A 4OTGA 4QMZA 4OGRA 2QU5A 1PYXA 4FKIA 1Q8YA 4LG4A 4U43A 4AZWA 1OB3A 4MWHA 4CYIA 3SVVA 4UYNA 4RWLA 4ORKA 3LFSA 5HVYA 4PDYA 2E9PA 4EOMA 3OT8A 4M66A 3A62A 5HZNA 5AR3A 2WQEA 5LXMA 4M67A 4D4YA 3ZUUA 3LQ3A 4JBVA 2WQMA 3DOGA 3CLYA 4RQKA 4R7BA 4O7LA 3QALE 3KKVA 2H8HA 2YFXA 3CGFA 4ITHA 3NLBA 4H36A 3CD3A 1W2CA 1CDKA 3B8RA 2XIXA 5BX0A 3MW1A 3ZLWA 5HG9A 2B9FA 4QMVA 2XK3A 1PJKA 3VHEA 3KXZA 3NW7A 4ITJA 5HGIA 2Q0BA 3FI4A 3DKFA 2F49A 4QTCA 1T45A 3SRVB 5I9WA 2JBOA 4ALWA 2PUUA 4DE4A 3QWJA 3R8ZA 3F9NA 1J1CA 4E4NA 4NKAA 1PMEA 2XYUA 4L68A 3KULB 2NRUA 4FT7A 4FG8A 2WHBA 3MB6A 1Q24A 2BTRA 2X4ZA 1M7QA 2YAAA 4FI1A 4MXAA 4NW5A 1FVVA 4FL3A 5F95A 4A9YA 5HX6A 4H05A 5BV3A 4FKUA 4HVHA 3VVHA 2WTWA 1XBAA 4J71A 1UKIA 3A4OX 4TNDA 1M7NA 2XK6A 5HQ0A 3DBDA 3JY9A 3U9CA 2CLQA 4BGHA 5GJDA 4RIOA 3D94A 4C4GA 4M14A 3UO6A 4HOKA 4DGLC 3KIOC 2XIYA 3BWFA 4AS0A 4F7NA 2BDJA 1YXTA 3NYNA 1RQQA 3QX4A 3F3ZA 2I6LA 2VN9A 2ZV7A 5KMKA 5HG7A 5HVKA 1DI9A 4BCKA 5KO1A 2QO9A 4RIYB 5FBNC 4P90A 3OCBA 3N9XA 2PVYA 2OFVA 4WG5A 3V8TA 4FIJA 3MFTA 5IA2A 4JBPA 5KKRB 4QYGA 4EONA 5BUJA 4O2PA 4RRVA 4HPTE 1B39A 3AMYA 4BCPA 4M0YA 4FZAB 1L3RE 3G0EA 3EYGA 2NO3A 3PXFA 2Y9QA 3ZXTA 3DAEA 4IVBA 5CZHA 2IW9A 3C4CA 2WQBA 2YCFA 3P1AA 3PVBA 4CXAA 4NL0A 2W99B 3F5XA 3U55A 2UZLA 2OO8X 2OF2A 4I21A 4EBVA 2XS0A 4YHJA 3FLWA 2UV2A 3P9JA 5CSHA 4YTHA 1AD5A 4QMSA 3CKXA 1ZOEA 3DJ7A 4JL9A 4LMNA 4O38A 5M55A 3UC4A 3VS7A 3QGYA 5FTGA 3DK7A 4BWXA 3U9NA 3F5UA 4Q5HA 2BALA 2E9VA 3KREA 4DGGA 3GGFA 2J0KA 4WKQA 5J5TA 3JR1A 4DT9A 4GFMA 1OBDA 3FLSA 5HE0A 5E1EA 4YP8A 2PVHA 5H3QA 2GNFA 2J4ZA 2UZEA 3UTOA 4EKKA 3AKKA 1YW2A 3WZJA 4WNMA 3P7BA 4N6YA 3QAME 4XV2A 4BWPA 4PTEA 2PVLA 3LMIA 3S2PA 4JNWA 4NIFB 3OWLA 3R02A 5AIRA 1ZOGA 2ERKA 2ZFYA 3AMBA 3M11A 3UVPA 3KRLA 4KBCA 1RDQE 3FMKA 3QZFA 4FK6A 3ROYA 3ZCLA 3KF4A 2CPKE 1PXJA 2UW0A 3EMGA 3KQ7A 5D11A 4FEWA 4U79A 3CJGA 2OZAB 3HMNA 4O4EA 3NNXA 5HIDA 5A4LA 3DCVA 3GC0A 3HKOA 1IEPA 3AOXA 3DPKA 4JAJA 3K2LA 4USEA 4S2ZA 1A48A 3RVGA 4AA0A 3S4QA 5EHOA 3BLRA 4YMJA 2WOTA 3LXNA 5DT4A 3ZM4A 5M06A 5EM7A 2JITA 3MTLA 5C8NA 4MWIA 4BCJA 5FDPA 2E2BA 1APME 2HAKA 3ORMA 5ITAA 3PTGA 5DRBA 2B55A 4Y5HA 4LV5A 5FM3A 5HOAA 2PVFA 3FPQA 2ITVA 4F7SA 5M57A 1XMLA 4JMQA 4O2ZA 4UXLA 4XRJA 5L2QA 4RA5A 3R28A 4D28A 4MF1A 3O7LD 4E20A 5IQCA 4D9UA 2XP2A 3PZEA 4YLLA 4F78A 1CM8A 3V3VA 2YDIA 3UC3A 4DFZE 3BCEA 3PVGA 2C3KA 1ZXEA 3LJ2A 2XM8A 4C3PA 3HUBA 2HYYA 4IAZA 4O0XA 4RA4A 5CAOA 1H07A 3OS3A 2GHGA 4C4FA 2UW5A 3PZHA 1MUOA 3NUYA 3LZBA 4FVQA 4FE2A 2X7FA 2W5BA 5AR5A 1JKSA 2C47A 5AM6A 4AXCA 3EOCA 3CY2A 5AX9A 4CFMA 4IAKA 1PW2A 5GZAA 2CNQA 2W05A 3ZTXA 3GOPA 3QA8A 4WRGA 5E91A 4BCQA 1HOWA 4XCUA 2PZ5A 2XIKA 3G90X 5AAGA 1PY5A 3DXNA 2CNVA 4PNKA 2R0UA 4HGEA 5ETAA 3S0OA 3NW5A 1IA9A 5CF5A 4LMUA 4BFMA 2VWYA 2ONLA 3GQLA 2WTKC 3QD3A 2B4SB 4Y5QA 5HIBA 2WNTA 4L7SA 3QQUA 4UALA 3CJFA 3NZ0A 5J79A 3R0TA 4IZYA 3C4ZA 2IG7A 1M17A 3G51A 4QP2A 4CTCA 4XRLA 3ZLYA 4I22A 4DCEA 4ZOGA 3VUIA 3GU5A 1QPEA 3NUSA 4CSVA 4GIIA 5KBQA 4L8MA 3TJDA 2I0EA 4Y72A 3T9TA 1P2AA 3NFFB 3NVMB 5HD4A 3ERKA 4MYGA 3MB7A 4ZLOA 2VTTA 5KE0A 4DH7A 2VO6A 4IX5A 2XNPA 5F20A 4C34A 4DEHA 5I9ZA 4L67A 1ND4A 4BICA 3UO5A 2Z60A 2JDOA 3NNVA 2X81A 1QPJA 4FODA 1RE8A 4IDVA 3IK3A 4IIRA 3UPXA 3LCSA 4RX5A 3IW6A 3KXHA 3VS5A 3KVWA 2VTIA 3COMA 3IGOA 4DFNA 5JGBA 5J1WA 2XANA 4XMOA 5I9YA 3CIKA 3LHJA 2YITA 3ELJA 4C38A 5JQ8A 4MEDA 4AP7A 1FBNA 3F3WA 4OW8A 4O0TA 1H1QA 2V7OA 5FEDA 5KUPA 3E5AA 4H58A 3U6IA 4X7QA 4LGHA 2LGCA 2VGPA 1H1SA 4TN6A 5CT0A 4BCFA 1MRVA 4EZ3A 4QP8A 5E9EA 3ITZA 4QPAA 3WZDA 2YZAA 3IS5A 4E6AA 4LGGA 1H8FA 2HELA 4IADA 3TM0A 4BDJA 2HZ0A 1VYWA 3EB0A 3QL8A 4YBKA 5AWMA 4PL3A 1UU8A 5AFVA 1OGUA 2VTLA 4RVTA 3VF8A 2BRBA 5A54A 4FOBA 3VBXA 5L8KA 1YKRA 3DZOA 5CEKA 5KZ0A 1UNHA 3R01A 3GFWA 3UZRA 3VUTA 5TT7A 5EQPA 4DEDA 3QYZA 4FTKA 4GH2A 4FEQA 3KMWA 3Q9ZA 4GVAA 3FI8A 4YJVA 5IQAA 4RLLA 3ZONA 4M15A 3FMDA 4CZTA 3II5A 5C03A 4O96A 4FV8A 3QYWA 4FX3A 3EN6A 4CZUA 3V6RA 1Q8WA 2WTIA 3DDQA 1LPUA 5EW8A 4ZLYA 5D7AA 5DEWA 1CKIA 4XP2A 3UOHA 2AC3A 1ZYJA 1UNLA 3ORZA 3D83A 5BUEA 2HZIA 3MVJA 4LV8A 4AGDA 4DT8A 2AC5A 4BL1A 4WBBB 2YZLA 4DH8A 4DA5A 4HCVA 1JQHA 2XK9A 4WHZA 3VNTA 2XJ2A 2PE1A 4OT6A 4L44A 5AUTA 1W2FA 4KINA 4OTRA 1QMZA 4E4MA 2QHNA 4X6RA 4PDPA 5IA0A 1IRKA 3Q5ZA 4YJUA 4GRBA 2WFYA 2X39A 3FZOA 2CKOA 3PUPA 4KWPA 3WF6A 5BVOA 3AC1A 3OWPA 3UMXA 4I41A 3E64A 4O7VA 4V01A 3I6UA 3SGCA 3H0ZA 3ORXA 4BIEA 3CGOA 3W0SA 5JGAA 2QO7A 4U3YA 2ITOA 3O96A 3NVKI 3E92A 3U6JA 3OG7A 1MP8A 2IEWA 2YABA 5L6OA 5L8JA 2BRHA 3SDJA 3V04A 4O7NA 1MQ4A 2YIXA 4YC6A 3S95A 1BLXA 4DTBA 5KNJA 1YQJA 4FT5A 5M44A 2C4GA 3VF9A 2VTHA 3QTRA 2A4LA 2XIRA 2QOHA 3LXKA 2R3PA 3C4WA 2QLQA 4KBAA 4EKLA 3F82A 2W1FA 2OG8A 3KCKA 5FTOA 5DE2A 3ATSA 4XP0A 4IJPA 4OTIA 1AQ1A 3HL7A 3D9VA 4OUCA 2Y4IC 4ANNA 1WMKA 3RINA 1KUTA 4UMRA 3IKAA 5IQEA 2R3JA 4NYEA 4USDA 3CS9A 1CMKE 4FOCA 2FSMX 1Q61A 4M69A 3U4WA 4TYEA 3R9OA 2PULA 3SG9A 2WMXA 3IONA 3OCTA 2CGWA 4EI4A 4XP3A 3HA6A 1YHWA 2G2IA 2ZDUA 2EB3A 4K77A 5AP6A 5EKNA 4G34A 1KWPA 4ZJJA 2BZIB 4YZNA 3HECA 4MCVA 5HTIA 1ZY4A 2ITNA 2Z02A 3DJ6A 3D7TB 4K33A 4N4SA 3NYXA 3W0OA 2X9FA 4BDIA 4I92A 3IO7A 4RG0A 3E8DA 5JMSA 1ZYDA 3Q4UA 4A07A 4PV0A 3R30A 5AUZA 3D5XA 2JIVA 4XX9A 2V0DA 3QHRA 4HYSA 2GDOA 4BGQA 3DQWA 1ZYSA 3R7GA 2OFUA 4QMUA 3OFMA 3FI2A 2YM6A 4ASDA 5EW3A 2VO7A 4NKSA 2G1TA 3NIZA 2XNGA 2XKEA 3CQEA 2GTMA 3QCYA 2J0JA 5FD2A 4DITA 4FKPA 3MA6A 1IAHA 3CSVA 1DAYA 4GFOA 3EWHA 4TYGA 4WNOA 4EZ7A 4D58A 5M51A 4IQ6A 2P4IA 2XARA 3TV7A 4L3LA 1JSTA 4EJNA 5EK7A 2XF0A 2QKWB 3P0MA 4CFNA 3L9NA 2C5OA 4M97A 3DZQA 2PTKA 1SMHA 3G33A 1YOJA 1VJYA 3PA3A 4MQ1A 1FGKA 2OJFE 2WMSA 4FMQA 5ETCA 2R3GA 4XG4A 3BI6A 2XJ0A 1PXKA 1U46A 3TV4A 2QCSA 3ULZA 3I81A 5I9VA 3ZLSA 3D14A 3A60A 4C57A 3C13A 4YJNA 5JFWA 1SYKA 5DRDA 2PMLX 1Q62A 1W98A 3QKKA 4I5CA 4NWMA 2RFNA 5LCKA 3RPSA 4C8BA 4RIWA 4CCBA 3ZLXA 4YLKA 5EOLA 1PKGA 5L8LA 2OIDA 3FBVA 3PY3A 5DA3A 4FG7A 3RNIA 3NGAA 1PXMA 4XLIA 4D1XA 5J9LA 2BZKB 4U41A 5JRSA 2CJMA 3LQ8A 3R73A 3JS2A 4CNHA 4LUDA 4J8NA 4F0FA 4E5WA 4AOTA 3TNPC 5ANGA 5DEYA 3R7UA 1ZMUA 2YIQA 4FSNA 4ZTLA 4O7WA 4JBOA 4F08A 2XH5A 4KIOA 5AJQA 3FJQE 5E1SA 4ZJVA 4NJ3A 3VBWA 4ZTRA 4ZTHA 4DTAA 3HV5A 4UXQA 4JG7A 4C2VA 1OKYA 4ZMFA 3VS6A 4YC8A 2I7QA 5AAEA 3GI3A 2UUEA 3QQHA 3L8VA 3OY1A 4V04A 4BGGA 5L6PA 3NCGA 4NM3A 2PVRA 4FIIA 5B0XA 3UOJA 3KMMA 4O22A 4L52A 2E9NA 3G9NA 4R3RA 3LCOA 4QMOA 5CY3A 4JIAA 3HV4A 4A9RA 2B0QA 1NVRA 4FTNA 4PMTA 4ALVA 1UU7A 1GIHA 2F7XE 4CLIA 3FYJX 1G5SA 3HV6A 4PPBA 4TY1A 3SXFA 3UDBA 2JIIA 4ARKA 3PWYA 4AXEA 3LXPA 4JG8A 1SM2A 5K5XA 4ZY6A 3TNHA 2Q0NA 5CVHA 3V5QA 3CKWA 4RQVA 3RWQA 5CEPA 3NWWA 3E8CA 2G9XA 1P14A 3BLHA 5HE2A 4BWKA 4NT4A 4AGWA 4IZ5A 1WVYA 4Y95A 5KMIA 3VRYA 4FV2A 3E7OA 3DY7A 3DLZA 3POOA 3DFCB 3Q4CA 3QD2B 4MBIA 4ITIA 4O0WA 2BFYA 3LCTA 2JGZA 4H3PA 3R8PA 3P5JC 2OXYA 4EOIA 2PE0A 3QQKA 2C0TA 3ET7A 1OIQA 3UNKA 4IAIA 3K54A 4IDTA 1U54B 4S32A 3MS9A 4YJRA 5HVJA 2CLXA 3O8UA 5FM2A 2BIKB 4FIEA 4XOYA 4YGAA 3W2SA 2WMBA 4FTRA 3QRUA 3H4JA 4GT4A 2YIRA 4G3EA 4E7WA 1ST4A 2J7TA 4TZRA 4DH1A 2F7EE 2R9SA 4FZ6A 3DJ5A 5EFQA 5T68A 4AN9A 4TPTA 1XBBA 2PU8A 4O7RA 1SVEA 3O8TA 1FMOE 3O71A 5B2KA 4ASEA 5HORA 5LJJA 2R4BA 4IWPA 1XR1A 1TFFA 2PMNX 2PPQA 5C4LA 5E8TA 3W0QA 2IJMA 1WBOA 4YZDA 3R04A 3LFQA 2OJJA 2C5NA 3ZFXA 3BL9A 4I93A 3QCXA 4IXPA 3KXXA 3QUEA 4KABA 1Q8ZA 2O8YA 2YM5A 3KB7A 5DN3A 4ZSJA 5CEQA 3OBGA 4ZMEA 2XM9A 2ZV9A 1OKVA 3F88A 3GXLA 3R9DA 4CD0A 3RK7A 2VTPA 2WMTA 4Y83A 3D4QA 3FE3A 3DBFA 3I6WA 1IG1A 3QA0A 4IM2A 4YSMA 3R7VA 4BDDA 2OSCA 4CFUA 2VTRA 4EYMA 1CTPE 4EC9A 3KCFA 5JFXA 1H25A 5IH4A 2JFLA 5J5SA 3BYMA 2UVZA 3E63A 3QTIA 3Q2JA 3O50A 4DEGA 1BI8A 3PY1A 4R6VA 1JKLA 3DBCA 2XKCA 3FHIA