5F20A

Structure of tyk2 with inhibitor 4: 3-azanyl-5-(2-methylphenyl)-7-(1-methylpyrazol-3-yl)-1~{h}-pyrazolo[4,3-c]pyridin-4-one
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
289
structure length
274
Chain Sequence
b'DPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKGWKQEIDILRTLYHEHIIKYKGCCEDSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHSQHYIHRNLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGQGQMTVLRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-receptor tyrosine-protein kinase TYK2
publication title Structure-Based Design and Synthesis of 3-Amino-1,5-dihydro-4H-pyrazolopyridin-4-one Derivatives as Tyrosine Kinase 2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 274
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5f20A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5f20A01
5AM7A 3TV6A 3IDBA 4ZSGA 3SG9A 3NNUA 3O7LD 1PXNA 4HPUE 5HO6A 3I81A 2PVYA 2PVNA 4G9RA 5HVYA 5JGDA 1H24A 3KVXA 3L9LA 4FV4A 5KMMA 3F61A 2A0CX 1ZYJA 4FG7A 3A60A 3BYSA 2OXDA 3HEGA 3F88A 3P08A 4BKYA 3C13A 4WKQA 3Q96A 4EH4A 1K9AA 2HY0A 3AC5A 3LFSA 4ZP5A 3PY3A 4RJ6A 1Y6BA 4GK3A 4AA5A 5KO1A 3MTFA 4IE9A 4WNOA 4FICA 4TNDA 3NW7A 3MB7A 2WAJA 4NW6A 3SLSA 4QQJA 4EQUA 5AUUA 3C4FA 4NTSA 2VX3A 3V3VA 3LQ3A 1H27A 3KCKA 3ZU7A 2XNNA 3CTQA 3SD0A 4FIJA 4V01A 2AYPA 1M7QA 5C8MA 4OGRA 3RK9A 4C57A 5IG1A 4F6UA 4LOOA 3U9NA 4AZSA 5IQBA 1PYEA 4RVTA 3EQRA 5HKMA 3GENA 4R6VA 2XK7A 3I7CA 2J9MA 1BI7A 2WMQA 2WMXA 4QYEA 3V5PA 3LFCA 2YN8A 3PE2A 4TRLA 3OUNB 4GT4A 1H25A 3FL4A 4GIHA 3SXFA 5BVFA 2ITOA 2IO6A 3FI2A 4Y8DA 4K0YA 3VRYA 2B9JA 4LYNA 4PTEA 3ENHA 2QOOA 3R0TA 4DE4A 4JR3A 4BDBA 3QU0A 4GRBA 4MXXA 2G1TA 3KRJA 5A4TA 1UU9A 3ZOSA 4BIEA 4I4FA 5LOHA 1BLXA 4JAJA 3HRFA 3TNHA 3IONA 5C1QB 5KMNA 3UIBA 3MA6A 1TKIA 4KSQA 4P5QA 4EOKA 3R8UA 4F1TA 2YZAA 2NP8A 1YQJA 2JDSA 3DY7A 3EFWA 3F3TA 2XS0A 3BBTB 5HESA 3BGZA 3NSZA 2VTRA 3ORXA 4QYHA 4X3JA 5HGIA 5L2IA 2QHNA 4OR5A 4KAOA 2C5NA 2YM6A 3PSBA 5E8ZA 5FQDC 2HWPA 5EI6A 3VUDA 4UZHA 3Q3BA 4CFVA 1ZYSA 1V1KA 4FI1A 5C4LA 2FYSA 4OW8A 4S31A 3BLQA 5DR2A 3ZC5A 1YI6A 2PVFA 3N9XA 2FO0A 2PZIA 3P79A 4J8MA 4TYGA 4A4XA 2G2HA 2JAVA 3ZLYA 3GT8A 4JI9A 1DI9A 2XP2A 3DGKA 3HUBA 4FK3A 4BWPA 3VW6A 2WO6A 1H1SA 4F1MA 2WQMA 4DH3A 3RINA 5L2QA 1H1RA 4AFJA 4BCIA 2HY81 3R8LA 3NR9A 5M4UA 4DEIA 2HWOA 1Q62A 2BVAA 3ZO3A 3CCNA 4HVDA 2OXXA 3OY3A 2JIUA 2OBJA 4YJSA 2EB2A 5IQCA 5CALA 5L4QA 2EVAA 3TNQB 3LMIA 5M4FA 3PXYA 3ZXTA 4YPDA 5CEMA 4RLKA 2Y4IC 2J90A 3PPJA 2O3PA 4UYNA 4S30A 2VRXA 4PY1A 1YOMA 2GTMA 3EQGA 2OJFE 4CFFA 4R1YA 4QMNA 4AGWA 4ONAA 5E8SA 2OO8X 2ESMA 3OWKA 5AR4A 3W2SA 2CGUA 3VBVA 1DAYA 1XH9A 3E3PA 4WT6A 4IAFA 3AMYA 5DWRA 2J50A 4CCUA 4YPSA 3L9MA 2J0IA 1YWNA 4G3DA 5KUPA 3E64A 4CZTA 5DBXA 3ORNA 3PYYA 2DWBA 4GCJA 2WMVA 1KV1A 4QMUA 2W1IA 4BHNA 4QMYA 3ORKA 4H3BA 1YDRE 4ERKA 2CMWA 2ZM1A 4GUBA 4YZ9A 1Z9XA 3R1YA 3RKBA 4JIAA 4ZJJA 2R3MA 5CYIA 4M69A 4CG8A 2XNBA 5DT0A 5HTBA 2CKOA 1GIJA 5AV1A 3PWYA 5E91A 4U3ZA 2EXEA 4XG9A 1F5QA 5HTIA 3W16A 3FJQE 2VTJA 2C47A 4O2PA 4XOZA 5D10A 1AD5A 3Q9XA 4J99A 2ITWA 1WBPA 1QPCA 3RWPA 3UDBA 3Q4ZA 3UVPA 4GKIA 2W5BA 1KE8A 3I6WA 4FZFB 5M51A 4QMMA 4HNFA 4LQMA 4RVKA 2GMXA 3R71A 5IKWA 2H6DA 2XIYA 4FTLA 3FMEA 1H1QA 3HMPA 2Z7LA 5TKDA 4MCVA 2P2IA 5DIAA 1YHVA 2J0KA 3ZDIA 4O7ZA 3OMVA 4JG6A 3SXRA 2IZUA 4L46A 3BU3A 4JG8A 3RAIA 5AAFA 4IVDA 1NVSA 3CKXA 5CNOA 1WBNA 3MY5A 4J95A 1OMWA 4EC8A 1V0PA 1J3HA 2HZ0A 3VUTA 3PDTA 2WTCA 3UE4A 4L8MA 2Y6MA 4L6QA 3Q53A 2OW3A 2ZM4A 4WBOA 4C37A 5C8NA 1OL7A 3JPVA 1GIIA 3Q6UA 2V55A 3AOXA 2QD9A 3H10A 3KF7A 3ZRLA 2XUUA 3LAUA 2OZAA 5HIEA 3VUHA 4FEUA 3DLZA 4GS6A 5HO7A 5L8LA 3KFAA 4P90A 3ZSIA 4FL3A 5CU4A 2DS1A 2H96A 1PW2A 4GU9A 3VJOA 3U8WA 5M44A 1OPJA 4FUXA 3QALE 5C8KA 3TUDA 4WSQA 4O7LA 3QQUA 5G6VA 3FDNA 4Y95A 2ZB0A 3VF8A 3FI8A 4BDDA 2GU8A 3EKKA 1UU3A 5AUYA 4G3GA 2EXMA 3E8NA 3NUUA 3CEKA 3UNZA 3ZUVA 3IGOA 5HICA 3V5QA 1F3MC 1WFCA 3L8VA 3ORLA 4FKIA 5ANGA 3HV5A 3NDMA 4FKJA 4GFGA 3TZMA 2W4KA 4FKSA 4AW1A 4C3FA 3Q52A 2YM4A 4HYSA 3U6JA 4ZY6A 3DB6A 4C0TA 4HVSA 3V8WA 5HHWA 4NW5A 3FE3A 4E4XA 4TYJA 2QOBA 3ATTA 3FY0A 4D9TA 2QLUA 2YEXA 3EQBA 3Q04A 3TNWA 3W8QA 4EOMA 4JQEA 1ZAOA 5BUEA 5AWMA 3DLSA 4D5HA 4IX5A 3SXSA 2W5HA 1M52A 4U45A 5BYLA 1ZMUA 2WMSA 1JSVA 1GIHA 3LW0A 3A7GA 1U54A 3A7IA 1T45A 4OT6A 5EHLA 4BDFA 4Y83A 1H26A 3DAJA 4NM7A 2C3LA 2Z7RA 4F09A 3UZRA 2BRMA 3FC2A 4K8AA 3E5AA 4EUUA 1XBCA 2QU6A 1IA9A 2REIA 2WMUA 2YJRA 4YBJA 4CFXA 3G15A 4DT8A 3GP0A 3Q4UA 4F65A 2V7AA 3RAWA 3GXLA 3DK6A 4QP3A 3TV7A 4CYIA 3AC1A 4NM0A 3PVGA 3TZ7A 3OFMA 2XJ1A 1ZZLA 2OK1A 3EKNA 5JRSA 3QUPA 5JQ8A 2QKRA 4P2KA 4JVGA 3NNWA 3BHVA 5FM2A 5HCYA 1HCLA 1WMKA 4YJOA 5DVRA 4AA0A 4O83A 3ORPA 3RK5A 4YO4A 4TT7A 4AOTA 3R7GA 3KRRA 2CNUA 3P78A 4E6AA 1YOLA 3FMDA 3QZIA 3Q9WA 5HG5A 2H9VA 5B2KA 5I9UA 4AOIA 4ANLA 4IAYA 3DAEA 4A4LA 2Y4PA 3BX5A 5BVOA 4UX9A 5CWZA 2NPQA 3H9OA 5CAPA 1ZLTA 3M42A 3TDWA 4L52A 4LM5A 3VS0A 2WMTA 4IDTA 4PMTA 4EK6A 5C4KA 3QLFA 3DU8A 3QC4A 4APCA 4O27B 5AX9A 1U5RA 2C0TA 3RM6A 1WBOA 1XH5A 2R3PA 3VAPA 4C58A 3TJCA 3VBWA 4EH2A 4EZ7A 2QO7A 4IC8A 2CDZA 3I6UA 1WCCA 3VIDA 1G8SA 4QNYA 4PDOA 4EORA 2YCFA 4E5AX 2XIKA 4UWBA 4FKUA 5M53A 3G0EA 2OICA 4RX9A 2BHEA 4PL5A 4IM2A 2J0JA 2YM8A 1HCKA 5I0BA 4E20A 3P4KA 4FNZA 3F7WA 2QNJA 4KKGA 4FMQA 1YDTE 4Q5EA 3C0IA 1PXMA 4C2VA 4G1WA 3BLHA 4DG3E 3CJFA 3D7ZA 2YFXA 4D1SA 3PFQA 2QR7A 4LL5A 1JSTA 4UMPA 4LMNA 5JFVA 1Q8ZA 4D2PA 3QTZA 4RRVA 5FEEA 4ZTMA 4D55A 2UZUE 4W8EA 3I79A 2VGOA 2PSQA 5ANIA 4BCJA 4YLKA 4NYEA 3ZRKA 3OW4A 4I5CA 4IIRA 2VTAA 5LXMA 3U55A 2VV9A 4FTIA 4E4NA 4H1JA 4DFUA 4QO9A 3QKKA 4DN5A 2YACA 4O6LA 4F99A 3QF9A 2ZVAA 1PMUA 4BDJA 3ZUUA 3EN6A 3EL8A 1DS5A 4ZMEA 2EWAA 4WUNA 3KU2A 3D2IA 3VO3A 2F7ZE 4BCKA 3O50A 3NUAA 2WNTA 3EYGA 4DEBA 2ZJWA 2ITYA 3BLRA 3OBJA 3PSCA 4IQ6A 3D7TB 2V22A 2WFYA 4NKAA 2W1ZA 5DMZA 3HV7A 5IMXA 4YC3A 3ZSHA 1Q24A 2CKEA 1H4LA 3SRVB 4XMOA 3R7EA 2YISA 5HBHA 2CN5A 2WGJA 4ENXA 4ZY5A 4Y5QA 2DYLA 3KRXA 1M2PA 2BIYA 4IB0A 1URWA 3QTQA 4MNEB 4IHPA 4PDYA 4QQ5A 3TTIA 2VWVA 4IW0A 1Q5KA 2WTJA 3O51A 2JIVA 4I92A 2IW6A 5M55A 3V5TA 2RFSA 5I5ZA 2P33A 3ZM9A 3JS2A 4LGHA 1YI4A 1BI8A 3GC7A 3ZCLA 3PJCA 4BL1A 4O7TA 4P7EA 4UMQA 3ZMMA 3L9NA 4FEWA 1OKYA 4QMPA 5CSVA 3C5UA 5FTQA 2Q0NA 4HYHA 5AMNA 4TYEA 1DI8A 1W7HA 3ERKA 3A99A 2R64A 3MH1A 1KE7A 3R30A 3GU6A 4FV2A 4TYHA 5IA3A 3CY2A 3EWHA 3MN3A 4ACGA 5J5SA 2YWPA 3LFFA 3LJ2A 5E8XA 4RGJA 2OJGA 1KE6A 4U40A 4ZK5A 3R01A 3RK7A 2PUPA 4FTNA 4YP8A 5AIRA 5KKRC 3AC3A 4K9YA 3UYTA 4BZNA 1SZMA 4N70A 4HGLA 2QLQA 2IJMA 2JDTA 3VN9A 4KKEA 3IK3A 4C4GA 1Q8UA 5ANEA 1BKXA 5IQDA 4OTPA 1YI3A 4FTUA 5LMAA 5JSMA 3PIZA 3RMFA 4UALA 5H9BA 5J95A 4JX7A 2WOTA 1OGUA 4GVAA 5EK7A 3MTLA 4W4VA 3QBNA 3KULB 2IN6A 1I09A 4IFGA 3LM0A 4EQMA 5IA0A 3RI1A 3OCSA 1GZ8A 4MXAA 2F7XE 1Q97A 4FKVA 4DFLA 2W05A 2UZNA 5A54A 5LVNA 4AF3A 1Z5MA 4JNWA 3AXWA 2IW9A 4E73A 2QO9A 2J0LA 2XNPA 4AE6A 3DQWA 1QCFA 2QOIA 4RWKA 5CF5A 2W1EA 4AW0A 4CRSA 1OITA 3BZ3A 2ETRA 2GSFA 4NEUA 2X39A 4ZJVA 3RAHA 4R5SA 4AG8A 1OL5A 2C5XA 1Q8WA 2I6LA 2BCJA 3JY9A 4UXQA 3DJ7A 4YURA 4MTAA 4BI0A 4JT3A 3ZYAA 3FI4A 5HCZA 4C61A 2OLCA 5E8WA 2X2LA 1XO2B 2JC6A 4RT7A 3WF7A 4CMUA 1JKTA 4FV1A 4I6BA 2B53A 4YJUA 3UODA 3CKWA 3ZEWA 2PY3A 2WB8A 3LQ5A 3FWQA 5JGAA 4XG8A 1P5EA 1U46A 3FLWA 4CMOA 5FP5A 5FBNC 4ANQA 3HMMA 4D9UA 3AT2A 4E1ZA 3IW7A 3UTOA 3ZFMA 4EI4A 3NYNA 4ACDA 5J87A 3CSVA 2AUHA 4L42A 4A7CA 1NXKA 2ACXA 4W4XA 4EEVA 5J1WA 4ERWA 1K3AA 3ZM4A 1KSWA 3LJ0A 3OHTA 4QYFA 1VJYA 4FTQA 3RALA 4YTFA 4G6LA 2ETKA 3QFVA 2X8DA 4MEDA 3HV6A 3JUHA 2QURA 3BE9A 4ZXTA 3SQQA 2WQOA 5KMJA 1M14A 5I9VA 4ASZA 2HZIA 3TKIA 4EH9A 2NRYA 3QA0A 3R7YA 5IEXA 4LL0A 4FOBA 4NIFB 4RX8A 4ZIMA 4KA3A 4DG2E 5HD4A 5E1EA 5HE0A 2C30A 2H8HA 4M68A 1YHSA 3QRUA 4BCGA 4ITIA 4RFZA 3FZRA 4QP2A 3VC4A 3HAVA 3TM0A 2UZOA 4W9WA 4FSTA 1H1PA 4U9AA 2F7EE 3JVRA 4OTHA 1ZWSA 4LGDA 1P2AA 1UNLA 4IJ9A 4FSYA 3GOPA 3QUDA 4GYIA 3DS6A 3NYXA 2C5VA 4LUEA 4MD9E 4ZAUA 2CCIA 2XB7A 4L43A 4TWNA 5DRDA 4O7NA 4J71A 2ZOQA 4YC6A 3OC1A 4PPBA 3ZC6A 4AUAA 4IMYA 3U4UA 5AP5A 2VO3A 3S3IA 3FLSA 1OKWA 3DTCA 3EN9A 1PXPA 2Z8CA 5CX9A 4DTAA 3LCTA 1WVXA 3LFDA 5ETFA 3IECA 5IQGA 2A1AB 3NEWA 4O0RA 2VTHA 4UYAA 2B1PA 3WE4A 3V6SA 2WPAA 1MRUA 3DQXA 4QT1A 3R8PA 4OBPA 1W83A 1XKKA 3QKMA 1H28A 5IEYA 4IX3A 3R22A 4MVFA 5TOZA 5JGBA 4Y73A 3WZJA 4DEAA 1A48A 4XV1A 4RIXA 2YDKA 2GFSA 3V5JA 4HCVA 4O0SA 5KE0A 4WG3A 4C4EA 4D0WA 5CZIA 1PMNA 5FXRA 2UZLA 5TO8A 4BI2A 2QVSE 3FMLA 4F70A 3G5DA 4CNHA 4FYOA 3LXNA 3HAMA 1B6CB 4KD1A 4N6YA 4NJDA 4OBQA 2OFVA 4FSWA 5CU6A 3VWAA 4BFMA 5CSPA 5IDPA 3E3BX 3IW4A 5AP3A 3ZBFA 3TN8A 4R3PA 3W32A 4K2RA 4JL9A 3IQ7A 1ZZ2A 3T3VA 4IAKA 3NMUF 5DA3A 3E93A 3SC1A 5CNNA 2GNIA 4NFNA 5HEZA 4F9AA 4CT2A 1WZYA 5IA5A 4IADA 3PA4A 5TE0A 3UVRA 3D0EA 2HZ4A 4BYJA 2JBPA 4RIWB 4NCTA 4DA5A 4CV9A 2WELA 1XBBA 4A4OA 1H0WA 3FMMA 2BAKA 3QTIA 4O22A 4BI1A 2BIKB 3DNDA 4XJ0A 4RZWA 3LLTA 3KL8A 3OROA 4XG7A 3UOKA 3RCDA 2C0IA 5HD7A 3HDNA 3THBA 2HELA 2B54A 2DUVA 3EH9A 3O96A 3F5XA 3NW6A 4OTRA 4YBKA 5F4NA 4ZZMA 3R1NA 3K5VA 5A6NA 4JDHA 3UOLA 4KINA 3F3VA 4RJ4A 4X7QA 5DE2A 5AUXA 5IH4A 3ZSGA 3EQHA 5C26A 1NVQA 3FXWA 4NCTC 3F66A 4RVLA 3PG3A 4XLIA 4CKRA 5IU2A 4PQNA 3OT3A 1Y6AA 2BAQA 1G3NA 3WYYA 5GINE 3FQHA 3QLGA 1BX6A 4KS7A 3RPRA 2R4BA 2ZDUA 3MYGA 3L9PA 4YZNA 2C3KA 3FLQA 3WBLA 4DBNA 5KMLA 3DK7A 5ACKA 5FXQA 4ZZNA 5J9LA 4MAOA 5CQUA 5M08A 3LFNA 4YR8A 3DJ5A 4FR4A 4L01A 4TKSA 4BBMA 4Q5HA 4C4FA 3GCUA 5HX8A 3PVUA 4AX8A 2CLQA 3DZOA 3D5WA 5FDXA 3CTHA 4YZCA 3LHJA 4KIKB 4QQTA 3S1HA 2GHMA 4IACA 4EH3A 3ORTA 2QO2A 1FINA 3ORMA 5H2UA 5H3QA 4KSPA 4PPCA 5LVMA 3SVVA 4U41A 2I7QA 4AT5A 3ZZEA 3HKOA 4Q9SA 5BX0A 4DGOA 3UZPA 2YM7A 4O84A 4O0YA 4O7RA 3POZA 4D1XA 1QMZA 4RQVA 2PE0A 4FV6A 5DFPA 3H3CA 2UW6A 2RFDA 2XCKA 3WOWA 4CLIA 2GNGA 4G3FA 2XCHA 2CN8A 3H9FA 1Q61A 3PUPA 1LP4A 4Z3VA 1QPDA 4FV8A 2RFNA 3AC2A 3PPZA 3UVQA 4EK4A 3CTJA 5J5TA 4MKCA 5JT2A 4O82A 3EN4A 3D94A 2GQGA 4MXYA 3W18A 5HU3A 2UZWE 4U79A 3LCSA 4AN3A 2B55A 4R5YA 4XV9A 4ACCA 3ULIA 4UWCA 4EWQA 5BYYA 5HNBA 4DCEA 2X6EA 3KXNA 4O7SA 4DEDA 4BY9E 3D5XA 3PXZA 2R3NA 3C50A 1JKLA 4IAAA 3ENMA 2I1MA 2OGVA 3MFSA 4YTCA 4EOJA 2HZNA 3NX8A 1UNHA 5FUTA 3MJ1A 4FF8A 1XWSA 5CLPA 2QQ7A 4BIDA 3TZ8A 4ENYA 3KXMA 5GJDA 3VUIA 2C1BA 4YSMA 4DLIA 4QMXA 1CMKE 3KCFA 2CGXA 4DGNA 2VTPA 5BVWA 3QC9A 3VRZA 4M14A 3CY3A 3DB8A 1FGIA 4G31A 2YJSA 2Z2WA 2H34A 3DCVA 2VO6A 3DBFA 3EFKA 5FRIA 3WZDA 3ODZX 4CSVA 4M67A 3SG8A 5D11A 1OIRA 4I0RA 2UW5A 4XG2A 5AR5A 3F2RA 2UW0A 1XHAA 5IMEA 3IOPA 4FV5A 2GNFA 3UO5A 3HA6A 4PUZA 2Q83A 3D5VA 2HOGA 3Q60A 5CAQA 4YUQA 2JLDA 2JBOA 2R3FA 2UVZA 5ANKA 4F7SA 3BEGA 2P2HA 1PF8A 3T8OA 3PJ3A 3ZO1A 4RMZA 3V04A 5GZAA 3VS3A 5M06A 3KK8A 2R3LA 4X2JA 5BVEA 1IEPA 2G2FA 3LJ1A 1OL1A 1WBWA 2PVMA 3C4ZA 3HLLA 2UW8A 2WKMA 4ZLYA 4D2WA 2QOQA 1AGWA 2F2CB 3QZGA 5KNJA 3PZEA 3GU7A 4L7SA 3O23A 4DFNA 3CGOA 4O38A 3WF6A 4E93A 1I44A 3GC8A 2WMBA 3OP5A 3POOA 3H0ZA 4FIIA 4QTDA 4E4LA 3F6XA 2ZV2A 2BAJA 3DT1A 5HE3A 4CEGA 1XH6A 4ZEGA 2YCRA 4AZVA 5KHXA 2FH9A 4KNBA 4FSQA 4DGMA 4M0YA 1Q8YA 3C7QA 5L6OA 4GMYA 3U9CA 5LWMA 3W2PA 1LR4A 2WOUA 3BYVA 4QTBA 4U5JA 3ANRA 5IQHA 4FBXA 2B52A 2ITPA 4MXCA 3LFEA 3LFAA 4BDEA 4EQCA 4J97A 2VD5A 1Y57A 3IDCA 4QP6A 2Y6OA 2Z7SA 1Y8GA 4RFMA 2BKKA 2ETMA 1O6LA 3VUKA 4AZWA 4KS8A 4EYJA 4GV1A 3E8DA 5GIPE 3MH3A 3QYZA 1ZYLA 3OOMA 4IB5A 3D83A 3MVJA 2F2UA 1OIUA 4FKLA 3CQUA 2IPXA 3QRJA 3CPBA 2X2KA 3MBLA 2X4FA 3NNXA 4EOSA 4WNPA 3RGFA 1H8FA 3QRTA 5E7RA 4AZTA 5L8JA 3ZLXA 4X2NA 5EDRA 4LV8A 3R7UA 4M69B 3U6HA 3QQLA 4KKHA 4M0ZA 4TWOA 2HXQA 4A06A 3EYHA 1JVPP 3EFJA 4IZ7A 3TV4A 1JNKA 3E7VA 4RC2A 1B39A 2XKEA 4JRNA 4RWLA 4XHKB 4L00A 2X8IA 3MVMA 4IVCA 3B8RA 4BDKA 2VO0A 4X6QC 3SW7A 4CFNA 3AD5A 4ASDA 3FZSA 4FKWA 1NA7A 2CGVA 4IDVA 4C4HA 1KV2A 4DGLC 3QRIA 4IVAA 3C4CA 4M97A 2IG7A 1SVHA 3BPRA 1ZMWA 4IZYA 2SRCA 3ET7A 3FZPA 3IW8A 5BPYA 2PVKA 2VNYA 5CF8A 4EL9A 2VWUA 4EK3A 5IEVA 3IS5A 5AP0A 3RTPA 2W9ZB 4OLIA 5TR6A 3RNIA 2HENA 4BTKA 2J6MA 4GIIA 4BC6A 2I0VA 4IAIA 1V0BA 4R3CA 4RZVA 4IB3A 3UNKA 4F6SA 3TIYA 3WILA 4AACA 4BHZA 4C36A 3U54A 4O6EA 1KOBA 5DH3A 3COMA 4HGEA 3NUSA 2R3HA 3CE3A 4X2GA 5IA1A 4F6WA 2PVHA 3DPKA 5E8TA 1OBDA 3L8PA 4KABA 1OKZA 4B8LA 3BHYA 4EBWA 4EHZA 4I1ZA 5HORA 1JPAA 4IEBA 4AZEA 4TL0A 2PUNA 3OCTA 2X81A 3SX9A 3MFUA 3I5NA 3CGFA 1W82A 2V7OA 3DDQA 4R3RA 2GTNA 1ZYCA 3RHXA 3PSDA 3BHTA 3R8ZA 3NYVA 4DITA 2PVJA 4QP4A 4RFYA 4AP7A 2V0DA 2UZTA 2RFEA 4QMVA 3G0FA 5CVFA 3RPYA 4KRDA 3WIGA 3NLBA 3DBDA 4X3FA 4DEHA 5AP7A 5IA2A 3FBVA 4RSSA 3K2LA 5JEBA 3GOKA 2FA2A 3MGYA 5CY3A 5DRBA 4U81A 4QMOA 5EM7A 4C4IA 5KMKA 3R8VA 1ZXEA 3ZONA 1Q3DA 5D12A 5HTCA 3WZUA 2PZRA 3GCPA 3ELJA 2XKDA 4HCUA 4W9XA 2BRHA 2GS7A 1ZOHA 4CZUA 4KIPA 4ANNA 3QD4A 5BMSA 2JDRA 3ACJA 3QGYA 4HVIA 3G2FA 3OT8A 3TCPA 1NY3A 3PJ1A 4FSRA 2R3RA 4X3FC 2XM8A 3I0OA 2Z02A 5E8YA 3NVMB 3R02A 4Y85A 5FTOA 2GS6A 2BZJA 5AR7A 3HP5A 4M8TA 4XX9A 3GQLA 4FC0A 3VBTA 3PP1A 3PRIA 5K0KA 5DYJA 1PYXA 1KE9A 3PY1A 4DFZE 4CTBA 2ITXA 3VQUA 3QTUA 4J8NA 1Z57A 3VVHA 4FTCA 1CDKA 2VWBA 4P5ZA 3FI3A 4V0GA 1E9HA 2E9OA 4FTAA 1E1VA 4AZFA 4H36A 3KY2A 2PMLX 1ZYDA 5BQ0A 1L3RE 1U59A 1OL2A 4O96A 4E5WA 4JG7A 3NUPA 3P7AA 1H00A 2CJMA 2RSVA 4LGGA 4A9SA 4C35A 5AA9A 3KQ7A 3SHEA 4MBLA 4R1VA 4U44A 1FVVA 4MF1A 5IH5A 5A4EA 4BRXA 4X2KA 3RNYA 3A4OX 1XBAA 4RG0A 5CU2A 4Q9ZA 2C4GA 3LCOA 2WHBA 4RJ3A 1P14A 4GJ3A 2XK3A 3RVGA 3AGMA 3G6HA 5ANDA 2YAAA 5IQEA 2ITZA 1SNXA 2UW9A 4H39A 3UP7A 4FSMA 3QXPA 4FKQA 4DTKA 3FMJA 4QMWA 4XRJA 5DEWA 3GCVA 3MS9A 1QPEA 3QWKA 2G2IA 1O9UA 2NO3A 2R5TA 3PXKA 2GFCA 3ZFXA 3ZUTA 3LE6A 2X9FA 4AGUA 2UW4A 4K77A 3PZHA 5DNRA 3W2RA 4QPMA 4LRMA 2W4JA 3FZ1A 3FQSA 3LXLA 4BCQA 4GFOA 1UKIA 5IUHA 1RDQE 4JJRA 4QRCA 4WOVA 3OXIA 2C6EA 2OF4A 3MJ2A 3OCGA 3A7JA 4DEEA 2OKRA 4GW8A 2QU5A 3C4WA 3DK3A 3PXRA 4F9BA 4F4PA 4BR3A 3KC3A 5AA8A 2CKPA 5LVPA 5EOBA 4NKSA 5LCKA 2FSMX 3H9RA 4QMLA 2W0JA 2XJ0A 3R2BA 4AS0A 4UMTA 3OS3A 3GC9A 3KN5A 5F95A 2CKQA 2OF2A 3D9VA 4B0GA 4FGRA 2GNHA 1K2PA 3VBYA 1CSNA 5CEQA 1XQZA 4E8AA 5T68A 3O8TA 4G34A 3F2AA 2XK9A 3A7HA 4JDKA 5GJGA 4C3RA 2OH4A 2WMRA 2VWWA 3DBQA 3QKLA 4FZAB 4QNAA 4EHEA 3FMHA 2CGWA 4G9CA 4WSYA 4RC3A 2YM5A 5AV3A 3QCYA 3Q2MA 3ZLSA 4ZSAA 2YABA 5EQEA 5G1XA 4BF2A 4AWIA 4BYIA 3LIJA 3MW1A 4XEYA 5B7VA 2WQEA 2XRUA 5M09A 5TF9A 3RP9A 3H0YA 4DGGA 3HYHA 3MPMA 5CEPA 4F0IA 5L3AA 4XP0A 2QR8A 2Y8OA 2GQSA 3SV0A 3ZEPA 4CFUA 4OTQA 4GYGA 4AOJA 5CF6A 3LKMA 2J0MB 4AW2A 2R9SA 3KN6A 2WU7A 1VR2A 1FGKA 2WTKC 4NUSA 4U7ZA 4U8ZA 5FEDA 5HO8A 4ZZOA 2X7GA 4R7BA 4CG9A 4D2VA 1OI9A 4ZS4A 4FZDB 3UIMA 3F5UA 1CKJA 2LAVA 4AA4A 5HX6A 5LJJA 5AV4A 2ZDTA 2EU9A 5HLWA 1U5QA 4TZRA 1PHKA 5HG8A 2PPQA 3TXOA 2PMOX 1H0VA 3QL8A 4M7IA 5KKRB 4I6QA 4C3PA 4CLJA 4FX3A 4FKPA 5D9HA 4L7FA 2CSNA 1J1BA 4PWNA 5BNJA 4FEXA 3R9DA 4NM3A 1JSUA 2FSTX 3CD8A 3LXKA 4JLCA 5BVNA 3NPCA 1CM8A 4FVQA 4UWYA 4EOOA 3B2WA 3EQCA 4EOPA 1PXKA 3P86A 2A2AA 2EB3A 4ANBA 3WF8A 3DXQA 1XJDA 2F9GA 3NCZA 2QOHA 3QQHA 4RJ8A 3VULA 5IQFA 2YCQA 3SRVA 3FPMA 4WA9A 5CAUA 1IAHA 4BWKA 2IVVA 3E62A 4FT0A 3O8PA 4BTJA 3Q4CA 4MD8E 4ALVA 4B6LA 3GC0A 2BHHA 3F5GA 4YTHA 1FVTA 5AEPA 4USFA 3QRKA 4B8MA 1IRKA 5FP6A 4YU2A 5KMIA 3C5IA 5FDPA 3ZO4A 4YHFA 2BDFA 4EJNA 3BELA 3QAME 1XH4A 4U43A 4DT9A 2J5EA 5KX8A 2O0UA 2I0EA 4NZWB 2WTIA 3KMWA 5AUTA 3HA8A 4CFMA 2VTSA 3OY1A 4XYFA 3RAKA 4DTBA 3MSSA 1JQHA 3GU4A 4IWPA 4R77A 4NT4A 3Q5IA 3WYXA 1OPKA 1WVWA 3BQRA 3II5A 3C4EA 5IQAA 3P0MA 2BZHB 3F2NA 5ETIA 3MH0A 1IR3A 5CAVA 2C3IB 4IX4A 1JWHA 2UZDA 3PA3A 4BN1A 3UIXA 3ZDUA 5M4CA 5DT3A 2XKCA 5LMKA 3VS6A 2W4OA 3IOKA 1TVOA 2J2IB 1Y91A 3OEFX 2E2BA 5CZHA 4EUTA 1QL6A 2RGPA 3FYKX 5J79A 3KXZA 4CQGA 5B0XA 4FKTA 2FVDA 4PMSA 2JIIA 4O21A 5CU3A 3UJGA 3R28A 3BBWA 4M13A 4RPVA 3ZRMA 4ALUA 3RWQA 3QTXA 3S2PA 3VS1A 4QMQA 4M15A 4L53A 2IW8A 4KB8A 3KULA 3FSFA 3IG7A 4HYUA 2YWVA 3AT3A 4FEVA 1M17A 4N6ZA 3SOCA 1APME 3QGWA 2XK8A 3IW5A 3QD3A 1BMKA 5CSXA 4F9YA 2P0CA 3ORIA 5A4QA 5LMKC 4O0WA 3ZXZA 5FD2A 4UMUA 4TY1A 2C69A 2BRBA 4F7JA 5AAGA 4RJ7A 3UYSA 1RE8A 2PZYA 3FV8A 5GZ9A 5JZNA 4C34A 4O0VA 4C8BA 1WBSA 1YHWA 3NW5A 3OG7A 1VYZA 3C0GA 5LCJA 1H1WA 4OTFA 1IAJA 3DFAA 2JKQA 3KKVA 4O7YA 5CSHA 3IO7A 1JKSA 1EH4A 5CS6A 5FBOA 2IZRA 2X9EA 4MYGA 5ETAA 2WMAA 3AQVA 3O71A 3PVBA 1PXOA 4DLJA 4EZ5A 4F7LA 3R1QA 2GS2A 2V62A 2PUIA 2XNEA 3WZKA 3GBZA 4L3JA 5E8UA 3UZTA 2AC5A 4C7TA 3OW3A 4DAWA 3QX4A 4JDIA 5HIDA 4QOXA 3VBQA 4WD5A 3PVWA 2JEDA 3R7OA 3CQWA 4I0TA 5HI2A 4TYIA 3OWLA 4BZDA 3ZS5A 4EKKA 4BDIA 2VTNA 3BQCA 4ZTRA 3A8WA 1AQ1A 5EYCA 4BICA 3F3UA 4F08A 3CPCA 4RIYA 3TDVA 3KGAA 3HZTA 5A4CA 5GHVA 2VTQA 3P7BA 1DAWA 1HOWA 4GFMA 4D5KA 1PXJA 3HMIA 4O81A 1UU7A 4L68A 2I40A 3FLZA 3DKFA 3O7LB 4RVMA 3HX4A 3ALOA 4MF0A 3NUNA 4P4CA 3VUMA 4FKGA 5M57A 5AV2A 2V5QA 3AT4A 5I9XA 2GNLA 4D0XA 4I94A 3BEAA 3G9LX 2WEIA 4D2SA 2HK5A 3NRMA 5IQIA 2BTSA 2OIQA 4K33A 4O1PA 2XIXA 3QZHA 4UY9A 5J7HA 3CLYA 4GEOA 2VTMA 2PMNX 1BL6A 4BIBA 5I4NA 4IXPA 3L8SA 3UMXA 4Z9LA 4PPAA 3TACA 3R9NA 2XZSA 3ZH8A 3PIXA 4FIGA 2PTKA 2HW6A 4LG4A 4GKHA 3TI1A 4AU8A 3GVUA 4C59A 2B0QA 3MH2A 3SKCA 5FTGA 4MNFA 4RA4A 2CLXA 4F1OA 3KMMA 4CZYB 3TKHA 1BYGA 5F9EA 3ALNA 3LFQA 5DHJA 4ACMA 3FC1X 5CU0A 5HE2A 4O0UA 4I6HA 3UOJA 5CXHA 4IWDA 1SM2A 5F1ZA 3SOAA 4YSJA 3N4TA 2XK4A 3DBEA 2UV2A 2UZVA 4BBFA 3GUBA 3AD6A 4FOCA 4IM0A 2CHLA 2YA9A 4M3QA 5IUIA 2UUEA 3FL5A 3IKAA 4TWPA 3VHEA 3FUPA 3QQJA 4V04A 3W55A 1FMOE 2WEVA 5I9WA 5LARA 2YZLA 2QG7A 3I0QA 2XM9A 3QCQA 4HPTE 4ASEA 1UKHA 3HRCA 4I93A 5CEOA 3E7OA 4IANA 3ROYA 4J96A 4DH5A 4UB7A 1LUFA 3T9IA 2ITQA 5CVGA 1PXLA 3P23A 3DV3A 4XG6A 3OXZA 3U87A 5D1JA 4GSBA 3PY0A 3NIZA 3QUEA 3CXWA 4RBLA 4IH8A 1Q4LA 4MD7E 5K4IA 2E9VA 3G90X 2JAMA 5IF1A 3M1SA 3OWJA 3S00A 2BFXA 4YO6A 1JKKA 3NWWA 3V5LA 1YDSE 4XBRA 2J5FA 3G51A 3MIYA 4BDCA 1PXIA 4ZLZA 4MWHA 2ZV9A 3HNGA 3F9NA 3L1SA 4BCMA 3TUCA 4HZSA 3DKOA 3R73A 2BROA 5L2WA 3EQDA 4GVJA 4C38A 2BMCA 2QHMA 4FUYA 4I4EA 1MQBA 3EFLA 4GT5A 4EH5A 4F9CA 4BTFA 4CFWA 1YVJA 3EZRA 4G6NA 4NM5A 1XH8A 5KBQA 1ZMVA 3F5PA 3MVLA 4HGTA 4YNOA 1X8BA 3PRFA 2Q0BA 4YLJA 4C4JA 1IASA 2ITVA 5JFXA 5J1VA 4PP9A 4YZMA 4AXAA 4RIOA 1J7IA 2WTVA 4NH1A 4I20A 4GG5A 5CI7A 2XK6A 5IA4A 2ITUA 3REPA 4N57A 1J1CA 4GG7A 5K5XA 4A9RA 4YJRA 5TT7A 2PVLA 3MDYA 3I7BA 5K4JA 3T3UA 4IFCA 5KMOA 4QD6A 4YC8A 4J53A 4L45A 4S34A 4DFYA 4C02A 4EOLA 1MRVA 3UQGA 2J7TA 4PMPA 4FEQA 3WARA 1YXSA 2ZYBA 3W1FA 3BWFA 4AN2A 3EOCA 2YLEA 3ZFYA 4EOIA 4FKOA 4V05A 4ZTLA 4ZJIA 3VW8A 2JDOA 4NFMA 4KIKA 4X6RA 5DLSA 3FKLA 4BWXA 2XKFA 2W1DA 3DFCB 4YMJA 4R78A 3BWJA 4QTEA 4I22A 4WG4A 5CF4A 4FL2A 5L6WL 3QTRA 3Q9YA 4JR7A 5IDNA 2CNVA 4O0TA 4PL4A 3EQPA 1OECA 3HMOA 4E3CA 1ERKA 5IISA 3TKUA 4FVPA 4J7BA 5DN3A 2PULA 1GZOA 3R8MA 4R7HA 2RL5A 4UMRA 3R21A 2RKUA 3EL7A 4EZ3A 5ANOA 2YIRA 3DBCA 2W7XA 3NAYA 2R3OA 2GDOA 2YDIA 3OUKA 2E9NA 2HXLA 3JYAA 4FE2A 2R3JA 4JXFA 3UP2A 4IX6A 4TW9A 3GCSA 3V51A 4ZLOA 2QC6A 2YAKA 1FMKA 3ACKA 4II5A 2QONA 2QG5A 4IM3A 1YXUA 4UZDA 2W9FB 3W2QA 3NVKI 4IZ5A 5HBJA 4JIKA 2XNGA 3WZEA 3HGKA 5DOSA 4EH6A 5EHYA 3U6IA 5E4HA 2ZB1A 4UEUA 1M2RA 4E5BA 2P4IA 4FG9A 4IBMA 4GJ2A 2BRGA 5L8KA 4W4YA 3UMWA 4YTIA 4EK5A 4YJTA 4USEA 4QMSA 2JGZA 4HGSA 3JXWA 4K18A 1CKIA 5L6PA 3FLNC 3V5WA 3GI3A 5FG8A 4XV2A 2XEZA 3R9OA 4U97A 3LOKA 3MI9A 3TTJA 1G8AA 2VGPA 1WBTA 2R0UA 2R2PA 1ZY5A 2GHGA 3DNEA 3TIZA 4PNIA 2VN9A 2YERA 3QD2B 4BTMA 4ANSA 3R6XA 2VAGA 4PMMA 2Y4IB 3VQHA 4FT3A 4FK6A 1NVRA 4MHAA 4DH1A 3S0OA 3R9RA 3SA0A 2VX0A 3O2MA 1SNUA 2JKOA 2R3KA 1UWJA 3VHKA 3VS4A 4EK8A 4IAZA 2X0GA 3QTSA 5JN2A 4KRCA 3W10A 1WAKA 3UC4A 4BGGA 2XRWA 5AP6A 3D4QA 5EDPA 4AGCA 4HZRA 2VTLA 1GOLA 2FUMA 2JDVA 5EYDA 2R7IA 2XVDA 2P55A 5AM6A 3CIKA 4G3CA 4X0MA 3FEGA 4QYGA 4FG8A 4LUDA 2WTWA 3E63A 2WU6A 3QCXA 4FYNA 2BPMA 2QOKA 4FODA 4DFXE 2C6LA 2WIPA 1OKVA 1JBPE 1KOAA 3BHUA 3R1SA 4RWJA 4AAAA 3FYJX 2B7AA 2I0HA 1STCE 2RG5A 3D2KA 4X21A 3RBWA 2PE1A 4I24A 3N51A 2QODA 3NCGA 4F63A 5JFSA 3FHIA 2OXYA 4Z55A 4ORKA 3PP0A 2W1HA 4TN6A 1OBGA 2XMYA 1J7LA 3ETAA 3LXPA 4WHZA 4DHFA 3WI6A 5AR3A 5C27A 2ERZE 4E6DA 3CD3A 3F69A 1NW1A 1YXXA 3TEIA 2Y9QA 1OM1A 2X2MA 2OWBA 5JFWA 3EJ1A 4KWPA 2ERKA 5E1SA 5EHOA 5GIOE 5GNKA 4ZY4A 4A9UA 5J7BA 5KBRA 2A27A 4FNWA 2OIDA 2VZ6A 5BYZA 5B2MA 3MY1A 4ITHA 3LCKA 3TG1A 3LMHA 5AUVA 3PWDA 4E6CA 4ASXA 2FB8A 1PRYA 2PE2A 1VEBA 1OB3A 4IVBA 3O17A 4E6QA 4J1RA 3CR0A 2X4ZA 3HUCA 3HV3A 3Q4TA 4I21A 4BKZA 2RIOA 4BCNA 5HOAA 1OIQA 3A7FA 2YCSA 3LFBA 2W1GA 3COKA 4QP1A 4CMTA 3MIAA 3R63A 3DDPA 5CXZA 3TNPC 3G6GA 3OVVA 4XS2A 4IB1A 1P4OA 2A4LA 3LCDA 3GU8A 3C0HA 4PL3A 2PVRA 5K9IA 4D2TA 5CT7A 4LV5A 4E7WA 2ZV8A 4DBXA 3KMUA 3PG1A 4FV9A 3F7ZA 1UV5A 2P3GX 3DAKA 3ZLWA 2YITA 4I0SA 4A9YA 4EHVA 2XIZA 2J51A 3NUYA 2ZAZA 4I5MA 4O7WA 1SYKA 4IJPA 3F3WA 3V6RA 3UC3A 1W84A 4LI5A 1WBVA 4DF3A 4EOQA 4YJNA 4XLVA 4G2FA 4ARKA 1VYWA 4JBOA 3DOGA 2OZAB 3TL8A 4J52A 5DG5A 4B9DA 5C9CA 4CD0A 1Y8YA 2W96B 5AAEA 5BUIA 4H1MA 2XH5A 5BUJA 3GEQA 4C62A 2XJ2A 5I3RA 3UQFA 4BGQA 3CS9A 2PUUA 3C51A 1FOTA 1MP8A 3FSKA 5FM3A 2IWIA 2PK9A 2E9UA 1SVEA 4BCOA 4CV8A 3A4PA 1W8CA 3OBGA 4NSTA 4OBOA 5B2LA 4Q2AA 5HQ0A 4I5HA 4MXOA 1TQIA 4QP8A 3E92A 4JBPA 3BI6A 3P9JA 4X3FB 4BDHA 2FSOX 2Z7QA 4FNYA 4XCUA 2CPKE 2VNWA 3NZ0A 3D14A 1YKRA 4EH8A 1O6YA 2B9IA 2XBAA 3R7IA 4AN9A 3ZHPC 2R3GA 1LEZA 4OTIA 1IG1A 1PMEA 4L9IA 1H08A 4XBUA 3GFEA 4FTKA 3E8EA 4U0IA 2O5KA 3KXHA 2WIHA 3N4UA 3BKBA 2NRUA 3BRBA 3PA5A 4I6FA 3UIUA 3OTVA 1V0OA 5E92A 2VWIA 4D28A 1PY5A 3BU6A 1YW2A 1UWHA 5BVDA 3NUXA 3LQ8A 3QA8A 4TTHB 2NNWB 1U4DA 3A61A 5EW3A 3KREA 2AC3A 4H3QA 4EBVA 4EYMA 4U80A 3UG1A 1U54B 4LMUA 2QI8A 4FKRA 5KZIA 1TQPA 5C03A 2RG6A 3PIYA 4CXAA 4FIFA 2KTYA 3MFRA 3JR1A 1ZRZA 4G5JA 2OJ9A 1T46A 3OXTA 3UGCA 5JZJA 1UU8A 2WZJA 3DA6A 3KK9A 4HYIA 2VO7A 4G17A 5GZ8A 4KBCA 5AFVA 3PE1A 3K3IA 4WNKA 3KF4A 4EKLA 4YGAA 1URCA 4V0GB 4Z7GA 4JAIA 3ZBXA 1KE5A 4FGBA 4UBAA 4ZSEA 4K11A 2YM3A 2BR1A 3MB6A 2HW7A 3ZO2A 5CEKA 3JVSA 5F20A 1O6KA 3H30A 4FNXA 4U42A 4PTCA 2PU8A 3GU5A 3VNTA 1RJBA 2ZMCA 2OIBA 3RPSA 4FT5A 2ZM3A 3FHRA 2W99B 3UNJA 2G15A 4JQ7A 4R8QA 3WIKA 5LQFA 4F0FA 4DCAA 2R3IA 3BYMA 3RHKA 4HVGA 2HAKA 4J98A 5A6OA 1QPJA 5K0XA 3W2CA 5IPJA 2BZKB 2UW7A 5L2SA 3ID6C 3EB0A 3OF0A 4EH7A 4F0GA 2XNOA 3TNIA 4O0XA 2W17A 4RJ5A 5EI8A 3OTUA 4ITJA 4Y5HA 5AR8A 1KUTA 4L3LA 4YJPA 3HRBA 5AR2A 5CANA 1R0PA 3E8CA 2BRNA 2J4ZA 4JBQA 1FVRA 5E90A 2VTOA 2XEYA 5A46A 5JQ5A 2C68A 2O8YA 3EZVA 4ZTHA 1REJA 4F64A 3FZOA 4PX6A 4GU6A 1M7NA 4IWOA 3FZTA 2OJJA 3P5KA 4RA5A 4EC9A 1ND4A 3FAAA 3IDPA 3PPKA 5A3XA 4AT4A 4TWCA 1MUOA 1BUHA 2VTIA 5HVJA 3O8UA 5CASA 4XRLA 4FSZA 1SMHA 2F57A 3ROCA 3QXOA 3PTGA 2OG8A 5EM5A 3LM5A 2PL0A 1PMVA 5CQWA 1R1WA 4WIHA 5I3OA 4E26A 5EQYA 3HECA 3BYUA 2OI4X 3FY2A 1OPLA 3GFWA 2UW3A 4DH7A 5A4LA 5DI1A 1A9UA 4G5PA 2Z60A 3LLAA 2O2UA 5CVHA 3IGGA 4MQ1A 5FEQA 2ITTA 2BDWA 1H07A 2WQBA 3RZBA 4CT1A 2YHVA 3BV2A 4FTMA 4FT7A 5EH0A 4I23A 4Z7HA 3COHA 4BKJA 4CVAA 5FXSA 3QX2A 4XP3A 4WO5A 2WTKB 5H8GA 5EYMA 2VU3A 4D4SA 3DZQA 4APPA 1GY3A 4YHTA 2YIXA 5CSWA 3V8SA 5CTPA 3UQCA 3ITZA 4LFIA 4PV0A 1L8TA 3ZTXA 1UVRA 5HCXA 3B2TA 3FKOA 1PKGA 1XR1A 4YJVA 1TQMA 3BIZA 3EIDA 4JBVA 1J91A 4CRLA 1ATPE 5HBEA 4XG4A 4KUJA 5A9UA 4FIHA 4QPAA 5C01A 2RF9A 5HNGA 4QTCA 3DKGA 4CCBA 4MX9A 5EG3A 2WD1A 1ZY4A 3LMGA 3PXFA 2A19B 4ZS0A 3BGPA 3R04A 2UVYA 2JFLA 4CTCA 1WVYA 4ZOGA 5HLPA 4D4VA 4E4MA 4GT3A 1M2QA 1YXTA 1GAGA 3HMNA 3OZ6A 3UPZA 2BTRA 4TPTA 2QOFA 4B7TA 3UO6A 3R7VA 4RC4A 2ZMDA 3A2CA 3CBLA 5FGKA 3RPVA 1FBNA 3DXPA 3QQGA 3W8LA 3AC4A 5CENA 1F0QA 3ZZWA 5EKOA 4AE9A 4BVUA 5CI6A 2VWZA 1JLUE 2UVXA 3KRLA 4HNIA 2GPHA 2OU7A 2WTDA 4XP2A 3JY0A 4D2RA 1H01A 2JD5A 2O64A 3K3JA 2C6IA 4FV3A 4HOKA 4UXLA 3Q5ZA 5DEYA 3B8QA 3BYOA 2Y0AA 1G5SA 3NYOA 5AP2A 1B38A 1OL6A 3TT0A 4CYJA 3EN7A 3M2WA 1FPUA 5BVKA 4AT3A 5FLFA 5AP4A 2I0YA 2W5AA 3D7TA 3D15A 2IVTA 4TYHB 3C4XA 2R3QA 1R78A 2IVSA 3AG9A 4JRVA 4M12A 4D4YA 2BZIB 4QQCA 1GZKA 5EFQA 5E8VA 3I1AA 1PJKA 5JH6A 3I4BA 3R83A 5LWNA 3RJCA 3MA3A 4FZ6A 5EQPA 4YZDA 5CT0A 5EKNA 4MNEA 4PTGA 1Q8TA 3MESA 3ANQA 3TUBA 2C5OA 2XA4A 5HG7A 2GHLA 3PLAE 3DXNA 3EQFA 3L8XA 4KIQA 4DYMA 2B9FA 2GNJA 4MBJA 3GCQA 4I41A 2G9XA 2BUJA 2PZPA 3ORZA 2CCHA 3QTWA 4AGDA 1UA2A 4BCHA 4DEGA 4DG0E 4KIOA 4FSNA 5M07A 3W33A 4MK0A 4WRSA 5KHWA 3ODYX 5DR9A 3W2OA 4AFEA 4BDGA 3CP9A 2B9HA 1CKPA 3COIA 2YLFA 3I60A 2QKWB 2W1CA 4HJOA 3DJ6A 4PDSA 2WXVA 5H8BA 5ACBC 3MPTA 3R9HA 1A06A 2W1FA 3BHHA 1IA8A 3PLSA 4FV0A 4I3ZA 2O65A 3V8TA 3RM7A 3HP2A 3I5ZA 4B4LA 4HCTA 4F7NA 5A14A 4RX7A 2OSCA 2PHKA 2IZTA 4GL9A 3S4QA 4LOPA 2EXCX 4IWQA 4USDA 2X1NA 4ZSLA 2YIQA 2JKMA 5I9ZA 2DQ7X 4PRJA 4U3YA 4FVRA 4CKJA 4BB4A 4D1ZA 3UPXA 2E9PA 2IZSA 3GQIA 1KWPA 2X7FA 3MY0A 4JDJA 3V01A 2FGIA 4RLLA 4AQCA 3QHWA 4MQ2A 4EONA 4S32A 4TNBA 3IPHA 3K54A 1GJOA 3WE8A 4U6RA 1LPUA 4DC2A 5LVOA 4GH2A 5J9YA 1UNGA 4XG3A 4NK9A 2JFMA 3FXXA 2BDJA 3G9NA 2BFYA 3PJ8A 2XNMA 3NGAA 2YIWA 4WBBB 3HVCA 1YRPA 4GUEA 2EUFB 2UZBA 4UN0C 3OWPA 4G6OA 3MV5A 5EM8A 1SVGA 3TZ9A 4O2ZA 4ZTNA 3NAXA 3P1AA 4AW5A 3BV3A 2FSLX 3MVHA 5KCVA 4ZMFA 3OCBA 5H8EA 3EQIA 4QP7A 2VUWA 3HDMA 2ZV7A 3LPBA 3DTWA 3EMGA 4DH8A 4LOQA 3KB7A 4FV7A 1YWRA 3KXGA 3QWJA 1GNGA 1XH7A 3O0GA 4D4RA 4OUCA 2X6DA 4QP9A 5ITAA 4OTGA 3FMKA 5ETCA 3OEZA 1J7UA 2QOLA 3KXXA 3ATSA 4X2FA 3FQEA 2ITNA 3TJDA 4DINA 2OJIA 3OOGA 4S2ZA 5EW9A 5DR6A 3QD0A 4ZTQA 4EWHA 5CAOA 1PKDA 4JOAA 4YJQA 4ANMA 5AP1A 4BCPA 3BU5A 3PJ2A 4BZOA 4C33A 4EHGA 3VS2A 3BE2A 2C6KA 2C3JA 3ULZA 5E9EA 5AV0A 3LVPA 3H4JA 3KRWA 4GK4A 4NL0A 3G33A 4MBIA 3VF9A 3NIEA 5IH6A 4RIYB 1P4FA 1ZOEA 1LEWA 4C2WA 3VS7A 4QPSA 5I9YA 5DGZA 3BCEA 3M11A 1FQ1B 4FTOA 4S33A 4YHJA 5ANJA 4N0SA 4WG5A 1E1XA 2OH0E 4KBKA 3GNIB 5M56A 4DFBA 4O91A 2C6MA 3R2YA 5EW8A 2HYYA 2R7BA 3Q32A 2F49A 3S95A 4MXZA 4OAUC 1R3CA 3A8XA 4GK2A 4BBEA 4FA2A 5IZFA 2QOCA 3PXQA 4D58A 3CC6A 4OTDA 2YDJA 4ZSJA 4Z16A 4F9WA 4NIFA 1JAMA 2WQNA 1W0XC 3AD4A 3MWUA 4FZ7A 4L44A 2C1AA 1MQ4A 3HL7A 2OFUA 4ALWA 3NNVA 4JX3A 1R0EA 3SW4A 4RIXB 5HLNA 4R7IA 5HU9A 3C9WA 3GGFA 4JS8A 4G16A 4OT5A 4TXCA 3WF5A 5D41A 5GJFA 4HW7A 1W98A 2VTTA 4MH7A 5L2TA 1Q3WA 3AMBA 5T3QA 4L67A 3IW6A 2O63A 1BL7A 2X8EA 3C1XA 4RWIA 3SGCA 5JKGA 2W06A 4FTTA 1OZ1A 5HG9A 3TWJA 4H58A 5BMMA 2F4JA 5LVLA 3UOHA 2ONLA 4M66A 4OTWA 1R39A 1ZOGA 5F94A 4FTJA 2UZEA 3OD6X 3QCSA 4CGAA 3QHRA 4ZTSA 4WRGA 4CKIA 4RX5A 2GQRA 4NU1A 5JMSA 4QTAA 2C6OA 1RW8A 2IVUA 4XOYA 4A07A 4K6ZA 1S9IA 4BCFA 1YOJA 3AMAA 3VUGA 3A62A 5AADA 2JITA 4RQKA 4FSUA 2HIWA 3T9TA 4YLLA 1VZOA 5EI2A 4FL1A 1YXVA 5ICPA 2XF0A 1Q99A 4YNEA 4W4WA 5AIKA 4O86A 5T6KA 3Q9ZA 3K5UA 4FT9A 5HE1A 5AX3A 2ONLC 2KULA 4W8DA 4FIEA 2XYNA 3SAYA 1MRYA 5J8IA 2PMIA 3RCJA 2Y7JA 3E87A 4IC7A 1CTPE 4ANOA 2VWYA 4O1OA 1JOWB 1REKA 4LRKA 2B4SB 5HZNA 2WMWA 5IUGA 2YIYA 2C6TA 2GCDA 2PYWA 3KVWA 4Y46A 1YWVA 3AGLA 3FKNA 3HV4A 4FTRA 4PF4A 3MFTA 2VWXA 5EOLA 5JK3A 1GZNA 3QQFA 4RIWA 3DKCA 2R0IA 4PNKA 3U51A 4NWMA 4XH6A 4UV0A 5DPVA 4LRJA 3KEXA 5EYKA 3VBXA 4XNEA 4BGHA 4N4SA 3EHAA 3QZFA 4Y72A 3GB2A 4OAVB 5CEIA 3R00A 4H05A 1S9JA 4JQ8A 5D7AA 3CQEA 3FXZA 4L3PA 4NTTA 5AJQA 5J9ZA 3NS9A 4IZAA 2HCKA 5AUZA 2XBJA 4KBAA 2LGCA 5M4IA 1OUYA 4G3EA 4B99A 2VX1A 4NJ3A 3FLYA 3VJNA 2BALA 3RPOA 1RQQA 4ACHA 2JKKA 3FPQA 4XV3A 4M84A 4WUAA 3U4WA 3KA0A 3UO4A 2X7OA 5DT4A 4XUFA 3E88A 4HVHA 5LMBA 4BDAA 4PP7A 4QMTA 2CNQA 4PDPA 4QMZA 3UBDA 4H3PA 5HVKA 4A9TA 4I5PA 4QYYA 3P7CA 1DM2A 2BKZA 2PWLA 3QQKA 3CJGA 5EDQA 5HNIX 1NT2A 5K3YA 2XYUA 1OIYA 3MPAA 3F82A 5JRQA 3D5UA 2QCSA 4MWIA 2C0OA 5HIBA 3FMNA 1ZARA 4YZBA 1OVEA 4K1BA 3UG2A 3VS5A 5K5NA 5D7VA 5EM6A 3WF9A 3F3ZA 3N4VA 4O7VA 2G01A 4WNMA 4ID7A 3RZFA 2BILB 3SDJA 5FWKK 4EJ7A 2OZOA 2C5YA 1OUKA 1Q41A 2XIRA 3BGQA 3Q2JA 3Q6WA 3EN5A 5KZ0A 2PZ5A 4CQEA 2C6DA 3QYWA 5AUWA 3LZBA 3AC8A
chains in the Genus database with same CATH superfamily
5AM7A 3TV6A 3IDBA 4ZSGA 3SG9A 3NNUA 3O7LD 1PXNA 4HPUE 5HO6A 3I81A 2PVYA 2PVNA 4DHZA 4G9RA 5HVYA 5JGDA 1H24A 3KVXA 3L9LA 4FV4A 5KMMA 3F61A 2A0CX 1ZYJA 4FG7A 3A60A 3BYSA 2OXDA 3HEGA 3F88A 3P08A 4BKYA 3C13A 4WKQA 3Q96A 4EH4A 1K9AA 2HY0A 3AC5A 3LFSA 4ZP5A 3PY3A 4RJ6A 1Y6BA 4GK3A 4AA5A 5KO1A 3MTFA 4IE9A 4WNOA 4FICA 4TNDA 3NW7A 3MB7A 2WAJA 4NW6A 3SLSA 4QQJA 4EQUA 5AUUA 3C4FA 4NTSA 2VX3A 3V3VA 3LQ3A 1H27A 3KCKA 3ZU7A 2XNNA 3CTQA 3SD0A 4FIJA 4V01A 2AYPA 1M7QA 5C8MA 4OGRA 3RK9A 4C57A 5IG1A 4F6UA 3UDSA 4LOOA 3U9NA 4AZSA 5IQBA 1PYEA 4RVTA 3EQRA 5HKMA 3GENA 4R6VA 2XK7A 3I7CA 2J9MA 1BI7A 2WMQA 2WMXA 4QYEA 3V5PA 3LFCA 2YN8A 3PE2A 4TRLA 3OUNB 4GT4A 1H25A 3FL4A 4GIHA 3SXFA 5BVFA 2ITOA 2IO6A 3FI2A 4Y8DA 4K0YA 3VRYA 2B9JA 4LYNA 4PTEA 3ENHA 2QOOA 3R0TA 4DE4A 4JR3A 4BDBA 3QU0A 4GRBA 4MXXA 2G1TA 3KRJA 5A4TA 1UU9A 3ZOSA 4BIEA 4I4FA 5LOHA 1BLXA 4JAJA 3NFFB 3HRFA 3TNHA 3IONA 5C1QB 5KMNA 3UIBA 3MA6A 1TKIA 4KSQA 4P5QA 4EOKA 3R8UA 4F1TA 2YZAA 2NP8A 1YQJA 2JDSA 3DY7A 3EFWA 3F3TA 2XS0A 3BBTB 5HESA 3BGZA 3NSZA 2VTRA 3ORXA 4QYHA 4X3JA 5HGIA 5L2IA 2QHNA 4OR5A 4KAOA 2C5NA 2YM6A 3PSBA 5E8ZA 5FQDC 2HWPA 5EI6A 3VUDA 4UZHA 3Q3BA 4CFVA 1ZYSA 1V1KA 4FI1A 5C4LA 2FYSA 4OW8A 4S31A 3BLQA 5DR2A 3ZC5A 1YI6A 2PVFA 3N9XA 2FO0A 2PZIA 3P79A 4J8MA 4TYGA 4A4XA 2G2HA 2JAVA 3ZLYA 3GT8A 4JI9A 1DI9A 2XP2A 3DGKA 3HUBA 2XAOA 4FK3A 4BWPA 3VW6A 2WO6A 1H1SA 4F1MA 2WQMA 4DH3A 3RINA 5L2QA 1H1RA 4AFJA 4BCIA 2HY81 3R8LA 3NR9A 5M4UA 4DEIA 2HWOA 1Q62A 2BVAA 3ZO3A 3CCNA 4HVDA 2OXXA 3OY3A 2JIUA 2OBJA 4YJSA 2EB2A 5IQCA 5CALA 5L4QA 2EVAA 3TNQB 3LMIA 5M4FA 3PXYA 3ZXTA 4YPDA 5CEMA 4RLKA 2Y4IC 2J90A 3PPJA 2O3PA 4UYNA 4S30A 2VRXA 4PY1A 1YOMA 2GTMA 3EQGA 2OJFE 4CFFA 4R1YA 4QMNA 4AGWA 4ONAA 5E8SA 2OO8X 2ESMA 3OWKA 5AR4A 3W2SA 2CGUA 3VBVA 1DAYA 1XH9A 3E3PA 4WT6A 4IAFA 3AMYA 5DWRA 2J50A 4CCUA 4YPSA 3L9MA 2J0IA 1YWNA 4G3DA 5KUPA 3E64A 4CZTA 5DBXA 3ORNA 3PYYA 2DWBA 4GCJA 2WMVA 1XMMA 1KV1A 4QMUA 2W1IA 4BHNA 4QMYA 3ORKA 4H3BA 1YDRE 4ERKA 2CMWA 2ZM1A 4GUBA 4YZ9A 1Z9XA 3R1YA 3RKBA 4JIAA 4ZJJA 2R3MA 5CYIA 4M69A 4CG8A 2XNBA 3W0MA 5DT0A 5HTBA 2CKOA 1GIJA 5AV1A 3PWYA 5E91A 4U3ZA 2EXEA 4XG9A 1F5QA 5HTIA 3W16A 3FJQE 2VTJA 2C47A 4O2PA 4XOZA 5D10A 1AD5A 3Q9XA 4J99A 2ITWA 1WBPA 1QPCA 3RWPA 3UDBA 3Q4ZA 3UVPA 4GKIA 2W5BA 1KE8A 3I6WA 4FZFB 5M51A 4QMMA 4HNFA 4LQMA 4RVKA 2GMXA 3R71A 5IKWA 2H6DA 2XIYA 4FTLA 3FMEA 1H1QA 3HMPA 2Z7LA 5TKDA 4MCVA 2P2IA 5DIAA 1YHVA 2J0KA 3ZDIA 4O7ZA 3OMVA 4JG6A 3SXRA 2IZUA 4L46A 3BU3A 4JG8A 3RAIA 5AAFA 4IVDA 1NVSA 3CKXA 5CNOA 1WBNA 3MY5A 4J95A 1OMWA 4EC8A 1V0PA 1J3HA 2HZ0A 3VUTA 3PDTA 2WTCA 3UE4A 4L8MA 2Y6MA 4L6QA 3Q53A 2OW3A 2ZM4A 4WBOA 4C37A 5C8NA 1OL7A 3JPVA 1GIIA 3Q6UA 2V55A 3AOXA 2QD9A 3H10A 3KF7A 3ZRLA 2XUUA 3LAUA 2OZAA 5HIEA 3VUHA 4FEUA 3DLZA 4GS6A 5HO7A 5L8LA 3KFAA 4P90A 3ZSIA 4FL3A 5CU4A 2DS1A 2H96A 1PW2A 4GU9A 3VJOA 3U8WA 5M44A 1OPJA 4FUXA 3QALE 5C8KA 3TUDA 4WSQA 4O7LA 3QQUA 5G6VA 3FDNA 4Y95A 2ZB0A 3VF8A 3FI8A 4BDDA 2GU8A 3EKKA 1UU3A 5AUYA 4G3GA 2EXMA 3E8NA 3NUUA 3CEKA 3UNZA 3ZUVA 3IGOA 5HICA 3V5QA 1F3MC 1WFCA 3L8VA 3ORLA 4FKIA 5ANGA 3HV5A 3NDMA 4FKJA 4GFGA 3TZMA 2W4KA 4FKSA 4AW1A 4C3FA 3Q52A 2YM4A 4HYSA 3U6JA 4ZY6A 3DB6A 4C0TA 4HVSA 3AKJA 3V8WA 5HHWA 4NW5A 3FE3A 4E4XA 4TYJA 2QOBA 3ATTA 3FY0A 4D9TA 2QLUA 2YEXA 3EQBA 3Q04A 3TNWA 3W8QA 4EOMA 4JQEA 1ZAOA 5BUEA 5AWMA 3DLSA 4D5HA 4IX5A 3SXSA 2W5HA 1M52A 4U45A 5BYLA 1ZMUA 2WMSA 1JSVA 1GIHA 3LW0A 3A7GA 1U54A 3A7IA 1T45A 4OT6A 5EHLA 4BDFA 4Y83A 1H26A 3DAJA 4NM7A 2C3LA 2Z7RA 4F09A 3UZRA 2BRMA 3FC2A 4K8AA 3E5AA 4EUUA 1XBCA 2QU6A 1IA9A 2REIA 2WMUA 2YJRA 4YBJA 4CFXA 3BL9A 3G15A 3GP0A 4DT8A 3Q4UA 4F65A 2V7AA 3RAWA 3GXLA 3DK6A 4QP3A 3TV7A 4CYIA 3AC1A 4NM0A 3PVGA 3TZ7A 3OFMA 2XJ1A 1ZZLA 2OK1A 3EKNA 5JRSA 2XAMA 3QUPA 5JQ8A 2QKRA 4P2KA 4JVGA 3NNWA 3BHVA 5FM2A 5HCYA 1HCLA 1WMKA 4YJOA 5DVRA 4AA0A 4O83A 3ORPA 3RK5A 4YO4A 4TT7A 4AOTA 3R7GA 3KRRA 2CNUA 3P78A 4E6AA 1YOLA 3FMDA 3QZIA 3Q9WA 5HG5A 2H9VA 5B2KA 5I9UA 4AOIA 4ANLA 4IAYA 3DAEA 4A4LA 2Y4PA 3BX5A 5BVOA 4UX9A 5CWZA 2NPQA 3H9OA 5CAPA 1ZLTA 3M42A 3TDWA 4L52A 4LM5A 3VS0A 2WMTA 4IDTA 4PMTA 4EK6A 5C4KA 3QLFA 3DU8A 3QC4A 4APCA 4O27B 5AX9A 1U5RA 2C0TA 3RM6A 1WBOA 1XH5A 2R3PA 3VAPA 4C58A 3TJCA 3VBWA 4EH2A 4EZ7A 2QO7A 4IC8A 2CDZA 3I6UA 1WCCA 3VIDA 1G8SA 4QNYA 4PDOA 4EORA 2YCFA 4E5AX 2XIKA 4UWBA 4FKUA 5M53A 3G0EA 2OICA 4RX9A 2BHEA 4PL5A 4IM2A 2J0JA 2YM8A 1HCKA 5I0BA 4E20A 3P4KA 4FNZA 3F7WA 2QNJA 4KKGA 4FMQA 1YDTE 4Q5EA 3C0IA 1PXMA 4C2VA 4G1WA 3BLHA 4DG3E 3CJFA 3D7ZA 2YFXA 4D1SA 3PFQA 2QR7A 4LL5A 1JSTA 4UMPA 4AXFA 4LMNA 5JFVA 1Q8ZA 4D2PA 3QTZA 4RRVA 5FEEA 4ZTMA 4D55A 2UZUE 4W8EA 3I79A 2VGOA 2PSQA 5ANIA 4BCJA 4YLKA 4NYEA 3ZRKA 3OW4A 4I5CA 4IIRA 2VTAA 5LXMA 3U55A 2VV9A 4FTIA 4E4NA 4H1JA 4DFUA 4QO9A 3QKKA 4DN5A 2YACA 4O6LA 4F99A 3QF9A 2ZVAA 1PMUA 4BDJA 3ZUUA 3EN6A 3EL8A 1DS5A 4ZMEA 2EWAA 4WUNA 3KU2A 3D2IA 3VO3A 2F7ZE 4BCKA 3O50A 3NUAA 2WNTA 3EYGA 4DEBA 2ZJWA 2ITYA 3BLRA 3OBJA 3PSCA 4IQ6A 3D7TB 2V22A 2WFYA 4NKAA 2W1ZA 5DMZA 3HV7A 5IMXA 4YC3A 3ZSHA 1Q24A 2CKEA 2AQXA 1H4LA 3SRVB 4XMOA 3R7EA 2YISA 5HBHA 2CN5A 2WGJA 4ENXA 4ZY5A 4Y5QA 2DYLA 3KRXA 1M2PA 2BIYA 4IB0A 1URWA 3QTQA 4MNEB 4IHPA 4PDYA 4QQ5A 3TTIA 2VWVA 4IW0A 1Q5KA 2WTJA 3O51A 2JIVA 4I92A 2IW6A 5M55A 3V5TA 2RFSA 5I5ZA 2P33A 3ZM9A 3JS2A 4LGHA 1YI4A 4QEBA 1BI8A 3GC7A 3ZCLA 3PJCA 4BL1A 4O7TA 4P7EA 4UMQA 3ZMMA 3L9NA 4FEWA 1OKYA 4QMPA 5CSVA 3C5UA 5FTQA 2Q0NA 4HYHA 5AMNA 4TYEA 1DI8A 1W7HA 3ERKA 3A99A 2R64A 3MH1A 1KE7A 3R30A 3GU6A 4FV2A 4TYHA 5IA3A 3CY2A 3EWHA 3MN3A 4ACGA 5J5SA 2YWPA 3LFFA 3LJ2A 5E8XA 4RGJA 2OJGA 1KE6A 4U40A 4ZK5A 3R01A 3RK7A 2PUPA 4FTNA 4YP8A 5AIRA 5KKRC 3AC3A 4K9YA 3UYTA 4BZNA 1SZMA 4N70A 4HGLA 2QLQA 2IJMA 2JDTA 3VN9A 4KKEA 3IK3A 4C4GA 1Q8UA 5ANEA 1BKXA 2XARA 5IQDA 4OTPA 1YI3A 4FTUA 5LMAA 5JSMA 3PIZA 3RMFA 2ZFYA 4UALA 5H9BA 5J95A 4JX7A 2WOTA 1OGUA 4GVAA 5EK7A 3MTLA 4W4VA 3QBNA 3KULB 2IN6A 1I09A 4IFGA 3LM0A 4EQMA 5IA0A 3RI1A 3OCSA 1GZ8A 4MXAA 2F7XE 1Q97A 4FKVA 4DFLA 2W05A 2UZNA 5A54A 5LVNA 4AF3A 1W2FA 1Z5MA 4JNWA 3AXWA 2IW9A 4E73A 2QO9A 2J0LA 2XNPA 4AE6A 3DQWA 1QCFA 2QOIA 4RWKA 5CF5A 2W1EA 4AW0A 4CRSA 1OITA 3BZ3A 2ETRA 2GSFA 4NEUA 2X39A 4ZJVA 3RAHA 4R5SA 4AG8A 1OL5A 2C5XA 1Q8WA 2I6LA 2BCJA 3JY9A 4UXQA 3DJ7A 4YURA 4MTAA 4BI0A 4JT3A 3ZYAA 3FI4A 5HCZA 4C61A 2OLCA 5E8WA 2X2LA 1XO2B 2JC6A 4RT7A 3WF7A 4CMUA 1JKTA 4FV1A 3P5JC 4I6BA 2B53A 3AKLA 4YJUA 3UODA 3CKWA 3ZEWA 2PY3A 2WB8A 3LQ5A 3FWQA 5JGAA 4XG8A 1P5EA 1U46A 3FLWA 4CMOA 5FP5A 5FBNC 4ANQA 3HMMA 4D9UA 3AT2A 4E1ZA 3IW7A 3UTOA 3ZFMA 4EI4A 3NYNA 4ACDA 5J87A 3CSVA 2AUHA 4L42A 4A7CA 1NXKA 2ACXA 4W4XA 4EEVA 5J1WA 3ML1A 4ERWA 1K3AA 3ZM4A 1KSWA 3LJ0A 3OHTA 4QYFA 1VJYA 4FTQA 3RALA 4YTFA 4G6LA 2ETKA 3QFVA 2X8DA 4MEDA 3HV6A 3JUHA 2QURA 3BE9A 4ZXTA 3SQQA 2WQOA 5KMJA 1M14A 5I9VA 4ASZA 3TMOA 2HZIA 3TKIA 4EH9A 2NRYA 3QA0A 3R7YA 5IEXA 4LL0A 4FOBA 4NIFB 4RX8A 4ZIMA 4KA3A 4DG2E 5HD4A 5E1EA 5HE0A 2C30A 2H8HA 4M68A 1YHSA 3QRUA 4QDVA 4BCGA 4ITIA 4RFZA 3FZRA 4QP2A 3VC4A 3HAVA 3TM0A 2UZOA 4W9WA 4FSTA 1H1PA 4U9AA 2F7EE 3JVRA 4OTHA 1ZWSA 4LGDA 1P2AA 1UNLA 4IJ9A 4FSYA 3GOPA 3QUDA 4GYIA 3DS6A 3NYXA 2C5VA 4LUEA 4MD9E 4ZAUA 2CCIA 2XB7A 4L43A 4TWNA 5DRDA 4O7NA 4J71A 2ZOQA 4YC6A 3OC1A 4PPBA 3ZC6A 4AUAA 4IMYA 3U4UA 5AP5A 2VO3A 3S3IA 3FLSA 1OKWA 3DTCA 3EN9A 1PXPA 2Z8CA 5CX9A 4DTAA 3LCTA 1WVXA 3LFDA 5ETFA 3IECA 5IQGA 4O4FA 2A1AB 3NEWA 4O0RA 2VTHA 4UYAA 2B1PA 3WE4A 3V6SA 2WPAA 1MRUA 3DQXA 4QT1A 3R8PA 4OBPA 1W83A 1XKKA 3QKMA 1H28A 5IEYA 4IX3A 3R22A 4MVFA 5TOZA 5JGBA 4Y73A 3WZJA 4DEAA 1A48A 4XV1A 4RIXA 2YDKA 2GFSA 3V5JA 4HCVA 4O0SA 5KE0A 4WG3A 4C4EA 4D0WA 5CZIA 1PMNA 5FXRA 2UZLA 5TO8A 4BI2A 2QVSE 3FMLA 4F70A 3G5DA 4CNHA 4FYOA 3LXNA 3HAMA 1B6CB 4KD1A 4N6YA 4NJDA 4OBQA 2OFVA 4FSWA 5CU6A 3VWAA 4BFMA 5CSPA 5IDPA 3E3BX 3IW4A 5AP3A 3ZBFA 3TN8A 4QDEA 4R3PA 3W32A 4K2RA 4JL9A 3IQ7A 1ZZ2A 3T3VA 4IAKA 3NMUF 5DA3A 3E93A 3SC1A 5CNNA 2GNIA 4NFNA 5HEZA 4F9AA 4CT2A 1WZYA 5IA5A 4IADA 3PA4A 5TE0A 3UVRA 3D0EA 2HZ4A 4BYJA 2JBPA 4RIWB 4NCTA 3W0OA 4DA5A 4CV9A 2WELA 1XBBA 4A4OA 1H0WA 3FMMA 2BAKA 3QTIA 4O22A 4BI1A 2BIKB 3DNDA 3UDZA 4XJ0A 4RZWA 3LLTA 3KL8A 3OROA 4XG7A 3UOKA 3RCDA 2C0IA 5HD7A 3HDNA 1OGYA 3THBA 2HELA 2B54A 2DUVA 3EH9A 3O96A 3F5XA 3NW6A 4OTRA 4YBKA 5F4NA 4ZZMA 3R1NA 3K5VA 5A6NA 4JDHA 3UOLA 4KINA 3F3VA 4RJ4A 4X7QA 5DE2A 5AUXA 5IH4A 3ZSGA 3EQHA 5C26A 1NVQA 3FXWA 4NCTC 3F66A 4RVLA 3PG3A 4XLIA 4CKRA 5IU2A 4PQNA 3OT3A 1Y6AA 2BAQA 1G3NA 3WYYA 5GINE 3FQHA 3QLGA 1BX6A 4KS7A 3RPRA 2R4BA 2ZDUA 3MYGA 3L9PA 4YZNA 2C3KA 4O4CA 3FLQA 3WBLA 4DBNA 5KMLA 3DK7A 5ACKA 5FXQA 4ZZNA 5J9LA 4MAOA 5CQUA 5M08A 3LFNA 4YR8A 3DJ5A 4FR4A 4L01A 4TKSA 4BBMA 4Q5HA 4C4FA 3GCUA 4AXDA 5HX8A 3PVUA 4AX8A 2CLQA 3DZOA 3D5WA 5FDXA 4AXEA 3CTHA 4YZCA 3LHJA 4KIKB 4QQTA 3S1HA 2GHMA 4IACA 4EH3A 3ORTA 2QO2A 1FINA 3ORMA 5H2UA 5H3QA 4KSPA 4PPCA 5LVMA 3SVVA 4U41A 2I7QA 4AT5A 3ZZEA 3HKOA 4Q9SA 5BX0A 4DGOA 3UZPA 2YM7A 4O84A 4O0YA 4O7RA 3POZA 4D1XA 1QMZA 4RQVA 2PE0A 4FV6A 5DFPA 3H3CA 2UW6A 2RFDA 2XCKA 3WOWA 4CLIA 2GNGA 4G3FA 2XCHA 2CN8A 3H9FA 1Q61A 3PUPA 1LP4A 4Z3VA 1QPDA 4FV8A 2RFNA 3AC2A 3PPZA 3UVQA 4EK4A 3CTJA 5J5TA 4MKCA 5JT2A 4O82A 3EN4A 3D94A 2GQGA 4MXYA 3W18A 5HU3A 2UZWE 4U79A 3LCSA 4AN3A 3KIOC 2B55A 4R5YA 4XV9A 4ACCA 3ULIA 4UWCA 4EWQA 5BYYA 5HNBA 4DCEA 2X6EA 3KXNA 4DHJA 4O7SA 4DEDA 4BY9E 3D5XA 3PXZA 2R3NA 3C50A 1JKLA 4IAAA 3ENMA 2I1MA 2OGVA 3MFSA 4YTCA 4EOJA 2HZNA 3NX8A 1UNHA 5FUTA 3MJ1A 4FF8A 1XWSA 5CLPA 2QQ7A 4BIDA 3TZ8A 4ENYA 3KXMA 5GJDA 3VUIA 2C1BA 4YSMA 4DLIA 4QMXA 1CMKE 3KCFA 2CGXA 4DGNA 2VTPA 5BVWA 3QC9A 3VRZA 4M14A 3CY3A 3DB8A 1FGIA 2IF8A 2YJSA 2Z2WA 2H34A 3DCVA 2VO6A 3DBFA 3EFKA 4G31A 5FRIA 3ODZX 3WZDA 4CSVA 4M67A 3SG8A 5D11A 1OIRA 4I0RA 2UW5A 4XG2A 5AR5A 3F2RA 2UW0A 1XHAA 5IMEA 3IOPA 4FV5A 2GNFA 3UO5A 3HA6A 4PUZA 2Q83A 3D5VA 2HOGA 3Q60A 5CAQA 4YUQA 2JLDA 2JBOA 2R3FA 2UVZA 5ANKA 4F7SA 3BEGA 3BLAA 2P2HA 1PF8A 3T8OA 3PJ3A 3ZO1A 4RMZA 3V04A 5GZAA 3VS3A 5M06A 3KK8A 2R3LA 4X2JA 5BVEA 1IEPA 2G2FA 3LJ1A 4FJVA 1OL1A 1WBWA 2PVMA 3C4ZA 3HLLA 2UW8A 2WKMA 4ZLYA 4D2WA 2QOQA 1AGWA 2F2CB 3QZGA 5KNJA 3PZEA 3GU7A 4L7SA 3O23A 4DFNA 3CGOA 4O38A 3WF6A 4E93A 1I44A 3GC8A 2WMBA 3OP5A 3POOA 3H0ZA 4FIIA 4QTDA 4E4LA 3F6XA 2ZV2A 2BAJA 3DT1A 5HE3A 4CEGA 1XH6A 4ZEGA 2YCRA 4AZVA 5KHXA 2FH9A 4KNBA 4FSQA 4DGMA 4M0YA 1Q8YA 3C7QA 5L6OA 4GMYA 3U9CA 5LWMA 3W2PA 1LR4A 2WOUA 3BYVA 4QTBA 4U5JA 3ANRA 5IQHA 4FBXA 2B52A 2ITPA 4MXCA 3LFEA 3LFAA 4BDEA 4EQCA 4J97A 2VD5A 1Y57A 3IDCA 4QP6A 2Y6OA 2Z7SA 1Y8GA 4RFMA 2BKKA 2ETMA 1O6LA 3VUKA 1ST4A 4AZWA 4KS8A 4EYJA 4GV1A 3E8DA 5GIPE 3MH3A 3QYZA 1ZYLA 3OOMA 4IB5A 3D83A 3MVJA 2F2UA 1OIUA 4FKLA 3CQUA 2IPXA 3QRJA 3CPBA 2X2KA 3MBLA 2X4FA 3NNXA 4EOSA 4WNPA 3RGFA 1H8FA 3QRTA 5E7RA 4AZTA 5L8JA 3ZLXA 4X2NA 5EDRA 4LV8A 3R7UA 4M69B 3U6HA 3QQLA 4KKHA 4M0ZA 4TWOA 2HXQA 4A06A 3EYHA 1JVPP 3EFJA 4IZ7A 3TV4A 1JNKA 3E7VA 4RC2A 1B39A 2XKEA 4JRNA 4RWLA 4XHKB 4L00A 2X8IA 3MVMA 4IVCA 3B8RA 4BDKA 2VO0A 4X6QC 3SW7A 4CFNA 3AD5A 4ASDA 3FZSA 4FKWA 1NA7A 2CGVA 4IDVA 4C4HA 1KV2A 4DGLC 3QRIA 4IVAA 3C4CA 4M97A 2IG7A 3UDTA 1SVHA 3BPRA 1ZMWA 4IZYA 2SRCA 3ET7A 3FZPA 3IW8A 5BPYA 2PVKA 2VNYA 5CF8A 4EL9A 1XMLA 2VWUA 4EK3A 5IEVA 3IS5A 5AP0A 3RTPA 2W9ZB 4OLIA 5TR6A 3RNIA 2HENA 4BTKA 2J6MA 4GIIA 4BC6A 2I0VA 4IAIA 1V0BA 4R3CA 4RZVA 4IB3A 3UNKA 4F6SA 3TIYA 3WILA 4AACA 4BHZA 4C36A 1W2CA 3U54A 4O6EA 1KOBA 5DH3A 3COMA 4HGEA 3NUSA 2R3HA 3CE3A 4X2GA 5IA1A 4F6WA 2PVHA 3DPKA 5E8TA 1OBDA 3L8PA 4KABA 1OKZA 4B8LA 3BHYA 4EBWA 4EHZA 4I1ZA 5HORA 1JPAA 4IEBA 4AZEA 4TL0A 2PUNA 3OCTA 2X81A 3SX9A 3PFYA 3MFUA 3I5NA 3CGFA 1W82A 2V7OA 3DDQA 4R3RA 2GTNA 1ZYCA 3RHXA 3PSDA 3BHTA 3R8ZA 3NYVA 4DITA 2PVJA 4QP4A 4RFYA 4AP7A 2V0DA 2UZTA 2RFEA 4QMVA 3G0FA 5CVFA 3RPYA 4KRDA 3WIGA 3NLBA 3DBDA 4X3FA 4DEHA 5AP7A 5IA2A 3FBVA 4RSSA 3K2LA 5JEBA 3GOKA 2FA2A 3MGYA 5CY3A 5DRBA 4U81A 4QMOA 5EM7A 4C4IA 5KMKA 3R8VA 1ZXEA 3ZONA 1Q3DA 5D12A 5HTCA 3WZUA 2PZRA 3GCPA 3ELJA 2XKDA 4HCUA 4W9XA 2BRHA 2GS7A 1ZOHA 4CZUA 4KIPA 4ANNA 3QD4A 5BMSA 2JDRA 3ACJA 3QGYA 4HVIA 3G2FA 3OT8A 3TCPA 1NY3A 3PJ1A 4FSRA 2R3RA 4X3FC 2XM8A 3I0OA 2Z02A 5E8YA 3NVMB 3R02A 4Y85A 5FTOA 2GS6A 2BZJA 5AR7A 4DDGA 3HP5A 4M8TA 4XX9A 3GQLA 4FC0A 3VBTA 3PP1A 3PRIA 5K0KA 5DYJA 1PYXA 1KE9A 3PY1A 4DFZE 4CTBA 2ITXA 3VQUA 2X0OA 3QTUA 4J8NA 1Z57A 3VVHA 4FTCA 1CDKA 2VWBA 4P5ZA 3FI3A 4V0GA 1E9HA 2E9OA 4FTAA 1E1VA 4AZFA 4H36A 3KY2A 2PMLX 1ZYDA 5BQ0A 1L3RE 1U59A 1OL2A 4O96A 4E5WA 4JG7A 3NUPA 3P7AA 1H00A 2CJMA 2RSVA 4LGGA 4A9SA 4C35A 5AA9A 3KQ7A 1G8KA 3SHEA 4MBLA 4R1VA 4U44A 1FVVA 4MF1A 5IH5A 5A4EA 4BRXA 4X2KA 3RNYA 1ST0A 3A4OX 1XBAA 4RG0A 5CU2A 1W2DA 4Q9ZA 2C4GA 3LCOA 2WHBA 4RJ3A 1P14A 4GJ3A 2XK3A 3RVGA 3AGMA 3G6HA 5ANDA 2YAAA 5IQEA 2ITZA 1SNXA 2UW9A 4H39A 3UP7A 4FSMA 3QXPA 4FKQA 4DTKA 3FMJA 4QMWA 4XRJA 5DEWA 3GCVA 3MS9A 1QPEA 3QWKA 2G2IA 1O9UA 2NO3A 2R5TA 3PXKA 2GFCA 3ZFXA 3ZUTA 3LE6A 2X9FA 4AGUA 2UW4A 4K77A 3PZHA 5DNRA 3W2RA 4QPMA 4LRMA 2W4JA 3FZ1A 3FQSA 3LXLA 4BCQA 4GFOA 1UKIA 5IUHA 1RDQE 4JJRA 4QRCA 4WOVA 3OXIA 2C6EA 2OF4A 3MJ2A 3OCGA 3A7JA 4DEEA 2OKRA 4GW8A 2QU5A 3C4WA 3DK3A 3PXRA 4F9BA 4F4PA 4BR3A 3KC3A 5AA8A 2CKPA 5LVPA 5EOBA 4NKSA 5LCKA 2FSMX 3H9RA 4QMLA 2W0JA 2XJ0A 3R2BA 4AS0A 4UMTA 3OS3A 3GC9A 3KN5A 5F95A 2CKQA 2OF2A 3D9VA 4B0GA 4FGRA 2GNHA 1K2PA 3VBYA 1CSNA 5CEQA 1XQZA 4E8AA 5T68A 5BV3A 3O8TA 4G34A 3F2AA 2XK9A 3A7HA 4JDKA 5GJGA 4C3RA 4BJJA 2OH4A 2WMRA 2VWWA 3DBQA 3QKLA 4FZAB 4QNAA 4EHEA 3FMHA 2CGWA 4G9CA 4WSYA 4RC3A 2YM5A 5AV3A 3QCYA 3Q2MA 3ZLSA 4ZSAA 2YABA 5EQEA 5G1XA 4BF2A 4AWIA 4BYIA 3LIJA 3MW1A 4XEYA 5B7VA 2WQEA 2XRUA 5M09A 5TF9A 3RP9A 3H0YA 4DGGA 3HYHA 3MPMA 5CEPA 4F0IA 5L3AA 4XP0A 2QR8A 2Y8OA 2GQSA 3SV0A 3ZEPA 4CFUA 4OTQA 4GYGA 4AOJA 5CF6A 3LKMA 2J0MB 4AW2A 2R9SA 3KN6A 2WU7A 1VR2A 1FGKA 2WTKC 4NUSA 4U7ZA 4U8ZA 5FEDA 5HO8A 4ZZOA 2X7GA 4R7BA 4CG9A 4D2VA 1OI9A 4ZS4A