4C36A

Pka-s6k1 chimera with compound 15e (cct147581) bound
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
338
structure length
335
Chain Sequence
ESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSYGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVLEYLPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
publication title The Discovery of Potent Ribosomal S6 Kinase Inhibitors by High-Throughput Screening and Structure-Guided Drug Design.
pubmed rcsb
source organism Bos taurus
total genus 105
structure length 335
sequence length 338
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c36A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c36A02
4HNFA 3R9RA 3HRCA 4I6HA 4M15A 5A4EA 2JDTA 3KY2A 4IJ9A 1V0BA 4JJRA 3QALE 3TZ7A 4I23A 4RZWA 4V0GA 4UZHA 4PDSA 3WYYA 3R7OA 2WIPA 2ZV7A 4QT1A 3IDPA 1H00A 4HGLA 1OZ1A 3M1SA 4YTCA 5IQGA 5H9BA 3VJOA 5IEXA 1WAKA 3S95A 5HGIA 4JIAA 4O7LA 4DH5A 1PXOA 2OF4A 4CGAA 4DCAA 1R78A 4E8AA 2R3HA 3KRWA 4Z16A 3Q96A 2XJ0A 1Q24A 4J98A 5F4NA 4KAOA 3U87A 2Z60A 4DN5A 4IC7A 4U45A 2C6OA 3DB6A 5CF4A 4BI1A 1MRVA 2G2HA 2XIYA 3PVUA 4NFNA 3WF8A 2PZ5A 2J0IA 1RJBA 3FHRA 3MH2A 4JBPA 3FLSA 5HBJA 2GNHA 3G9LX 2F57A 4WA9A 3CTJA 3W8LA 4N6YA 2V62A 4BDJA 4BGHA 4CV8A 4DAWA 5GZ8A 2VTSA 3ANRA 2B55A 5BUIA 3F3WA 3R0TA 4DFUA 4JDHA 2BDFA 4UWCA 3DXPA 1DS5A 1SVHA 3F66A 2R3QA 5A4LA 2C5NA 4BCGA 4FTUA 3LFEA 3FPQA 2BALA 4W4VA 3TEIA 2ZAZA 5CQWA 3BI6A 4PL3A 1HCLA 4OBPA 4WRGA 1XH5A 4PQNA 3UNZA 3EZRA 4YJTA 1MUOA 4YTFA 2HWPA 5CX9A 5DR9A 2BPMA 5EW9A 4FL3A 4ZSEA 3MFRA 4DH3A 5A54A 1TVOA 3LE6A 2YISA 3D7ZA 3OFMA 4E5AX 1U4DA 4MNFA 4Z7GA 5HQ0A 3EQFA 1S9IA 3UQGA 4ZMEA 5IA0A 1BX6A 1O6YA 1W7HA 4GG5A 2XEYA 3FC2A 5ANDA 3A7IA 3TXOA 2X9FA 3HLLA 4ZTQA 3O8TA 3R7UA 4BKYA 1PY5A 3COKA 3FKOA 3HZTA 4R1VA 3QCQA 1URWA 3CKXA 2YLFA 4G17A 1GZ8A 4AW2A 2VTJA 4CEGA 5KNJA 4LUEA 4F9WA 3GC7A 4F7NA 5EYCA 3OVVA 1PMUA 2BILB 3GU4A 4IFGA 3RAKA 3VWAA 5HX8A 4IADA 2FH9A 4AWIA 3O23A 3TACA 4KNBA 3QAME 2DS1A 5GZAA 4AOIA 4P4CA 1XQZA 4OBQA 3ZSHA 4CFXA 3UNKA 4QMPA 1APME 3DAJA 4E73A 3LJ1A 4RFYA 3A7HA 2UZDA 3PY1A 4RG0A 3FI2A 3QZHA 4KSQA 3R8LA 1OECA 4EHGA 5EHYA 2OIQA 4L42A 2QOLA 4KKGA 2ZMDA 5HIDA 1A48A 3NZ0A 4IHPA 3ORTA 5IA1A 3HAVA 3OW3A 4YC3A 1TQIA 3U6HA 4W9WA 4HVIA 5JGAA 1GAGA 3Q9WA 1H27A 2OLCA 1JQHA 4GCJA 2AC3A 2IZRA 4S32A 3CS9A 1PMVA 2QLUA 4U42A 3FEGA 2QHMA 5C8KA 4QPAA 1KWPA 2OI4X 5CSWA 5J87A 2FGIA 3ULIA 5LMKC 3HV3A 3PJ2A 2OH0E 3DBQA 5L6OA 4FOBA 5JZJA 2ZJWA 1Z5MA 2VTAA 4M68A 3D14A 2PUIA 4TWPA 4CZTA 3NS9A 2W99B 2X81A 3PVBA 5JFVA 4J96A 5EKOA 1H0WA 1Q8TA 3PXZA 1OBDA 4JX3A 3COIA 1OIYA 3UPXA 2ITXA 2W0JA 5GJGA 4QOXA 2FA2A 2O5KA 2X2LA 5DBXA 1R1WA 4F08A 3TWJA 4M14A 4BL1A 3NIEA 4ENYA 3VVHA 4Z55A 3ZLXA 3DXQA 4OT6A 4FSTA 4C4GA 5M07A 2PVNA 3NYNA 3TG1A 3BGZA 3FZPA 5K0XA 5DE2A 2QC6A 2B9FA 3D9VA 4YGAA 3ZMMA 4CFFA 4ZTLA 2UZVA 1FMOE 5EI8A 4FSWA 4O22A 3JYAA 3U6IA 4QP3A 4QMZA 2G2FA 4TNDA 3NVKI 3UO4A 2C5XA 3QYWA 4EOJA 4XG4A 2XKFA 3NIZA 4EQCA 4H05A 3D5WA 4FT9A 4AACA 5IA3A 2XIXA 5HE2A 2JFLA 4FR4A 3C4XA 1NXKA 4ZIMA 3GCQA 4FNWA 1BL7A 1Q3WA 3FZ1A 4BN1A 2VAGA 5JGBA 2UVZA 3V5LA 4QQTA 3R9NA 4TPTA 1FVTA 5ANGA 4LI5A 2EVAA 3CKWA 4AS0A 1PHKA 2R0IA 4D0XA 2OGVA 3MA6A 3NPCA 2ZV9A 3PP0A 5E1SA 2OFUA 5DOSA 3W2QA 1F3MC 4G9RA 3IONA 4RJ7A 3R9DA 4TL0A 3RPOA 5D7VA 5HD7A 5E7RA 3PY0A 2GQRA 2F49A 3BKBA 4H36A 5E8SA 3P23A 1R0EA 2E2BA 3QBNA 5B2KA 3QA0A 5E8YA 4NKSA 2W1FA 4WT6A 4ZMFA 2J0JA 5FGKA 3WF5A 4L8MA 3MBLA 4U0IA 3ZDUA 2C68A 2XUUA 3TT0A 4DINA 2JIIA 3MPTA 3D5XA 3P08A 4U97A 2XBJA 1H1WA 2PHKA 3HV4A 5E90A 2QG5A 5CT7A 3OY1A 2WEVA 3R22A 5JMSA 4UMPA 4FKVA 5BVEA 4FKWA 2YM5A 5BPYA 4D2SA 3NUNA 1YHWA 3A99A 3E88A 2GNIA 1OL7A 1XO2B 1PRYA 4W8EA 2OG8A 2B9IA 2C6MA 5DMZA 4EI4A 3B8RA 5KHWA 2ZV8A 2C5YA 3MI9A 1T45A 3DOGA 5AUXA 4CRSA 5L8KA 3A4OX 5CVHA 3L8XA 4U3ZA 1A06A 4L53A 2B4SB 3KXZA 1XH4A 2VTLA 4PTEA 2OICA 1LP4A 2E9VA 5CANA 2G15A 2WQEA 4UB7A 5AX3A 4RBLA 5HLNA 5IUHA 4WRSA 3VRYA 2YAKA 4G3GA 5DG5A 4I93A 5IG1A 3A62A 4O0SA 3G6GA 1B6CB 2FO0A 3LAUA 4YJOA 5HTIA 4JI9A 5EHOA 4BWPA 1JOWB 2HW7A 4EZ3A 4ALWA 4QTEA 5EYDA 2X4FA 3V8SA 5DN3A 3LLAA 2RF9A 2WTCA 4APCA 4E20A 4QQ5A 3T3VA 5KZ0A 4KB8A 1V0OA 1Q41A 3MB6A 4XG8A 4JQEA 4ZEGA 5KMNA 3QRIA 1WBTA 4ACHA 1REJA 1KUTA 1QPJA 4RJ6A 4X3FC 4S30A 4YTIA 4A06A 3ZLWA 4YLJA 3FMMA 4D5KA 5HVKA 1UWJA 2PUPA 4BBMA 4QMUA 4RQVA 3UVQA 2P55A 3FXWA 4FKSA 3ZU7A 2Z7RA 3OT8A 2VTMA 1ZZLA 3MW1A 5J1WA 4HPUE 2DWBA 3E63A 4XBRA 3Q52A 4QTAA 4JOAA 3SXRA 3P9JA 4O83A 5A6OA 4FNZA 5J8IA 2WMAA 4PMPA 3WARA 5DRDA 2QO2A 4FV3A 3VS3A 3OTVA 2PZYA 5EM6A 4AZFA 3EL8A 3DB8A 2C0TA 3O2MA 5BUEA 3SKCA 3WF7A 2BFXA 5EW8A 1RW8A 2HZIA 3BWFA 4LQMA 3A7JA 3SOAA 5E8ZA 3R71A 2GHMA 5DEWA 5L4QA 3R8PA 2UW9A 1ND4A 4TYHB 2VO3A 5AP2A 1HOWA 3IOPA 3UO5A 3VW8A 5L8JA 4ZLZA 4ZLYA 2OF2A 3GNIB 2C4GA 4O6LA 2WNTA 3ORMA 1CKIA 2GPHA 4AGCA 4S2ZA 5CYIA 4O7SA 3C50A 3HVCA 4G34A 2XNEA 4FV5A 3BE9A 4GW8A 4QP1A 3BRBA 4ANBA 4FNXA 5B7VA 3W8QA 3ZTXA 5LJJA 3FLWA 3E8EA 3HV6A 3ERKA 2VU3A 1V1KA 4U9AA 2B7AA 4LGDA 4X6QC 2VNWA 4PP9A 3EN5A 5HLPA 3OCGA 5EDRA 4B8LA 4USDA 3FZOA 3F5GA 1W98A 3IW6A 5EW3A 4MBIA 1YOLA 3IPHA 4CKRA 4BTFA 1YDTE 2YLEA 3LXNA 4M12A 2OJJA 2R3FA 4E5WA 2WKMA 3MFUA 2QR7A 5HORA 4EOIA 3H9FA 4XG7A 5E8VA 3GENA 3UE4A 4XOYA 5AR3A 4G6NA 5CSHA 2IVTA 4D2WA 3AT4A 3GU7A 5EH0A 4C33A 2BRGA 4RRVA 3ANQA 5AV3A 2VX1A 3UZPA 2CN8A 5IMXA 3BX5A 5L2IA 3T8OA 3OWJA 4F1MA 3H0YA 2GQSA 1UA2A 1JSTA 3QC9A 4BGQA 4CV9A 3Q5IA 4FODA 1WBVA 4P5QA 2VO0A 2X2MA 3ZS5A 3SW7A 4F70A 1WVYA 1KE6A 3A61A 3MGYA 3ZEPA 2J0KA 4E1ZA 3WILA 4RVKA 4QMVA 4NT4A 5JRQA 3W18A 4ANQA 4XG2A 4CT1A 2RFEA 1JSUA 2XH5A 3JPVA 1YKRA 5BMSA 4GUEA 3QTQA 3TUDA 5JFXA 2XCHA 3C0HA 3QL8A 4JQ7A 4RPVA 5AP3A 2JAVA 4FSUA 5BUJA 2F9GA 3IOKA 2Q0BA 3UVRA 2CNQA 4GIHA 1REKA 3B2WA 4E6CA 3MSSA 2XKDA 5C26A 4R3PA 3AMYA 5IZFA 4KIKB 4YNOA 5EQYA 1YOMA 3LCDA 3NMUF 3ZFYA 1Y6BA 2X4ZA 4YJRA 3AC4A 4EOMA 4BVUA 2AUHA 2X39A 4QMOA 3V5TA 2I7QA 1PXNA 2UV2A 3QQJA 4HGTA 1OPKA 1Y91A 2X7OA 5AAGA 1MQ4A 1QPEA 4E4MA 3I7BA 3QUDA 3UMXA 5A3XA 1IR3A 2YHVA 3SV0A 3KN6A 1GIJA 3LLTA 4TYIA 2IVVA 3F2NA 5A46A 3ETAA 2OJGA 4GK3A 4O81A 2OJFE 3OOGA 4CG8A 5BVKA 1ZRZA 4E4XA 4LRMA 3ZHPC 3TDVA 2QHNA 2WMBA 4NCTC 2IZSA 5A9UA 5FEQA 3UYSA 2O63A 4FV7A 2FYSA 5F94A 2A19B 4U3YA 5HG5A 3QGYA 2CCHA 2JEDA 4C58A 3QWJA 4U79A 4ZSAA 4I4FA 3NX8A 1VYZA 4HCUA 4II5A 4FICA 2C5OA 4XNEA 3S1HA 3RI1A 3EFWA 5IUGA 1GZNA 3DBCA 4WSQA 4O7WA 3DDPA 3KK9A 1GJOA 5IEVA 3Q3BA 3REPA 3ZC6A 1OMWA 4Q5HA 3E8CA 2YABA 3FLZA 4FZ7A 2GHLA 5EDPA 3GCSA 4LMNA 3TIZA 5DT3A 1GY3A 3F5XA 1GIHA 4AFEA 2BZJA 4FTNA 2WQOA 3F3TA 1PXLA 1WMKA 4DGOA 4I0TA 4W4YA 2Y6MA 3H9RA 2IW9A 2BHHA 3HA6A 2HYYA 4FKPA 3DK3A 1PMNA 4QMLA 2WTWA 1OKVA 4FIEA 3LMHA 5KKRB 5M4UA 2Z8CA 3HP5A 3Q2MA 1VYWA 2JKOA 1M2QA 1ZARA 3D7TB 3IW7A 4K2RA 4FGBA 3I60A 4IZAA 4U6RA 4XS2A 4EOKA 2CHLA 5DI1A 3NUXA 2W1DA 5L2QA 3F7WA 4C0TA 5J5TA 2PE0A 5B0XA 3UC3A 3UIMA 2HWOA 1BI7A 4YHTA 1H0VA 3LZBA 4LL5A 3FUPA 4O91A 2FSOX 5KX8A 3EJ1A 3DZOA 2EXEA 2I6LA 1FOTA 5LVNA 4M13A 2PVHA 5AR8A 1ATPE 3GFEA 3NNUA 4FG9A 3A4PA 4FX3A 4NIFA 3NCZA 3C9WA 4JR7A 4MNEB 4E5BA 3Q9XA 5IQFA 1PKGA 2XRWA 3R9OA 2GFCA 3ZUVA 4HNIA 4RSSA 3QQFA 4BCQA 2VWBA 4OTDA 4C34A 4CZUA 2JITA 2CJMA 3TI1A 3ZO3A 3MFTA 1PKDA 3U6JA 4CMOA 5FBOA 3FE3A 1XBAA 5IQIA 5H2UA 4J8NA 4F4PA 4FKJA 4WOVA 5BVWA 3KCFA 2W1ZA 2W5HA 4GVAA 3KGAA 3E64A 5CEIA 4IVDA 1YXTA 3R9HA 2QOQA 3DCVA 3MVHA 4BCMA 3E7VA 3R8ZA 4BKJA 5A14A 1XBBA 3FMKA 3AXWA 4XP3A 2CKQA 2BTSA 1ZOEA 3RNIA 1NY3A 2W4OA 2XBAA 3LCOA 5FTQA 4RMZA 5J7HA 2R3PA 2YACA 5IKWA 2FUMA 4F0IA 5M4IA 1H1PA 4XLIA 4H39A 2J5FA 4CG9A 5AR4A 4XP0A 2CGWA 3TNQB 4B99A 4RX8A 4APPA 1OBGA 2HY81 3JUHA 2ITVA 3LKMA 5A4QA 3DNDA 3IECA 4O96A 4YO4A 3QF9A 4FSNA 3V5WA 5CAVA 2CCIA 5EM8A 3TIYA 4LRKA 1R39A 3AC2A 3MV5A 4XV1A 5HIBA 4FEUA 4LGGA 4FI1A 4A4LA 4ITJA 3RCJA 3RK7A 1UVRA 2WMUA 3OP5A 4FSMA 3RHXA 4EJNA 2OW3A 2KTYA 3JS2A 3IGGA 2Y4IC 5AV0A 1I09A 4YJSA 5CASA 4L68A 1ZY5A 5EI2A 3BHYA 2OO8X 2V55A 1AD5A 4FKQA 4YBKA 4YZMA 3UQCA 3MIAA 5D1JA 3ZDIA 1IA9A 1ZYDA 4EBWA 3R02A 5C8NA 3D83A 4CTCA 5A6NA 4P90A 2QI8A 4TYHA 2JD5A 3OOMA 2AYPA 4GRBA 5HTCA 4B9DA 3BYOA 4USFA 4UMUA 1OIRA 3H4JA 3NR9A 4BTMA 1GIIA 1H4LA 3IW8A 3PXFA 3W2RA 4NM7A 2UZWE 3QZFA 4G2FA 2VN9A 3QQHA 4J8MA 5CY3A 4GVJA 1M2PA 3NWWA 4QMXA 1YI3A 3PA5A 4JQ8A 3IK3A 4MXCA 4ZTRA 1U54B 4MWIA 3WBLA 2FSMX 4C4HA 4NM3A 3COMA 3I6WA 4X3JA 2W4KA 3R7GA 4F65A 5FTGA 1ZXEA 3DAKA 4CT2A 3WZDA 3ULZA 2GTNA 4PDOA 2H9VA 4GT4A 1QPCA 3BLRA 1MQBA 2E9NA 2WTIA 3DY7A 4Y5QA 4EEVA 2C0IA 4IJPA 3TZ8A 2IW6A 2UZNA 3DNEA 4IXPA 1ZWSA 2XK8A 2XVDA 4FL2A 4W8DA 5L3AA 3M2WA 2EWAA 4HCVA 2CGXA 2XF0A 4FF8A 3VS7A 4F9CA 3BWJA 4O1PA 4PPAA 3IW4A 3VULA 3JVSA 3QCYA 4RX7A 4Q2AA 3MVJA 3BEGA 3QUEA 4TYGA 3SG9A 3CY3A 4EC9A 4KS7A 4Y5HA 3IW5A 3QD4A 2QOCA 4BZOA 4FK3A 3QTSA 5CZHA 1OL1A 3V8TA 3BYSA 4PRJA 3C5IA 5DT0A 4M3QA 5EI6A 3COHA 3F3VA 4EC8A 1P5EA 2CNVA 4JIKA 2HAKA 3MS9A 4M0ZA 4WNKA 5J79A 4QP2A 2BAKA 2UW5A 3E5AA 5IQBA 1W83A 2R3JA 3VBXA 5LARA 4PNKA 5J9ZA 3FKLA 4PX6A 5ETFA 3UQFA 2VZ6A 3EQRA 3LM5A 4PY1A 4GU6A 1XWSA 5IH6A 4QP9A 3R1SA 3ZM9A 1B39A 3HYHA 3PVGA 4TWCA 3G90X 3W2OA 3AD6A 3CJFA 1Q8ZA 5DYJA 2BTRA 2V0DA 4KIKA 4C4EA 3ZRLA 4BDBA 3N51A 1A9UA 1UKIA 3GBZA 3QWKA 4EOOA 2C6TA 4TYEA 2YEXA 5CT0A 2QOIA 3PIYA 4BDCA 3OW4A 3PDTA 1ZMVA 4AE6A 5HIEA 4O82A 2B53A 2BDWA 3VUDA 4BDDA 4DTKA 3TNHA 3LCKA 5LWMA 2ZM4A 3EFKA 1Q8YA 2VX3A 2YDIA 4TKSA 4TTHB 3E3PA 2B52A 1SVGA 2VTOA 4P7EA 2UZBA 3BHVA 3KXGA 4C38A 2IVSA 2WO6A 3F82A 2CSNA 4IZYA 1HCKA 3DQWA 2WOUA 2H96A 5EM5A 2QR8A 4K0YA 2UUEA 3ZZEA 4C35A 3G15A 2ITZA 3DJ7A 2YJRA 4JRVA 3BU6A 1NVQA 4RFMA 4D9TA 4CLIA 4FTLA 5AR2A 3Q6WA 4DGLC 4RC4A 5HCZA 5JGDA 3LVPA 4N0SA 3ZCLA 2CMWA 4RWKA 4IAZA 4Z9LA 2X9EA 2OXDA 4KIOA 5TT7A 4QMMA 3S2PA 1OIUA 2A2AA 5I9ZA 3OUNB 4EL9A 4ZJIA 2W1HA 5LVOA 3FMHA 1AQ1A 1UNLA 4I1ZA 4YJQA 3ZUUA 3OWKA 3KC3A 2BZHB 3ENMA 3RWPA 2ONLA 2XNOA 3C4WA 4FSQA 4FIHA 4QP8A 2EB3A 1FGIA 3AC5A 5DA3A 5HCXA 5JSMA 3MPMA 4J97A 3LFFA 1OM1A 4BTKA 3DK6A 2REIA 4IWPA 4YPSA 4DH1A 5ANJA 3SXSA 4F6WA 3GFWA 1YWNA 3Q9ZA 3VF8A 5AIKA 2CKPA 3EWHA 2EXCX 5CI7A 3SLSA 4C36A 3ET7A 2QONA 1AGWA 5AIRA 2V7OA 4K77A 3Q4UA 5LCKA 5K5XA 1U59A 2V5QA 2Y4PA 3HMPA 3SX9A 1JSVA 2XIRA 3DK7A 4J7BA 5TE0A 3TZ9A 3W2PA 5J1VA 5CVFA 5KCVA 3D7TA 2GHGA 5E8TA 1WBNA 3EOCA 3KKVA 4DHFA 3NUAA 3DTCA 3HMNA 4O0WA 3W2SA 3DFAA 4OW8A 4WHZA 5HU9A 2ETMA 2QCSA 4LFIA 3R8UA 2GSFA 4M69A 2VTNA 3N4VA 3TKIA 2PSQA 1UU7A 4CFMA 3WZUA 5LMBA 3NEWA 3RP9A 5CEMA 2ITYA 3OROA 4IBMA 4QP6A 5FG8A 3FDNA 2UVXA 2BHEA 3PY3A 2C6LA 3MFSA 3FI8A 2Z2WA 4MNEA 2J0LA 4ZXTA 5IH4A 4DTBA 4XH6A 5KZIA 3QTRA 4U5JA 5CWZA 5I4NA 4F1OA 4PF4A 4UYNA 4AFJA 4FEWA 1Q8UA 4F9BA 4MD8E 3VS5A 4I6BA 4MQ2A 3VUTA 2R3NA 4FL1A 2JIVA 5CLPA 3RKBA 3R04A 5HG8A 2GS7A 5E91A 4RVTA 3ZLYA 4A9TA 4ZY5A 4IB3A 4KD1A 4BC6A 4N4SA 3P0MA 3D0EA 3OG7A 4U7ZA 2OZAB 3BHUA 2JBPA 2OXYA 2HXQA 1U5RA 3TCPA 3VF9A 4C37A 1SNXA 4NU1A 4B6LA 4R8QA 5HLWA 5AUTA 3EYHA 3FMJA 2SRCA 1CMKE 3R83A 3W2CA 4A4OA 3ZZWA 2OK1A 2QOBA 3LXPA 3LPBA 4LOOA 4O0RA 2BKKA 3PTGA 5TF9A 4A9YA 4DEIA 3KREA 5HEZA 4OLIA 4AZTA 2WMSA 4C57A 4D4YA 5AFVA 2WTKC 3MJ2A 3WYXA 3DS6A 4DT8A 3BQCA 4BCFA 2X6EA 1JPAA 4KINA 1Z9XA 4RFZA 4KBCA 5FWKK 3F5UA 4L9IA 4QYEA 4F9YA 3ODYX 4GUBA 3UMWA 1KV1A 4FT0A 3AMBA 3V6RA 5GHVA 3WF6A 3TV4A 4QD6A 4BIDA 3CEKA 4H3QA 4DFXE 2YAAA 3FLYA 5AEPA 2C69A 4LG4A 4L44A 4YC8A 4YURA 5IH5A 4R5SA 2VTQA 1KOBA 4FVRA 4J95A 4YZ9A 2NRUA 4G3FA 3VAPA 4DITA 3BCEA 2CDZA 3PJCA 1WFCA 3I4BA 4IE9A 2E9PA 3VW6A 4O2PA 3BV2A 3SOCA 1FBNA 4QMWA 3QXOA 4FE2A 5BVFA 1GZOA 3ORZA 2X6DA 4IM2A 4GFMA 4D55A 4W4WA 4WNOA 4EK3A 2ZOQA 4FV6A 5EG3A 5H8EA 4I6FA 4DEDA 5FEDA 4D4SA 4ZS4A 3R2YA 3HP2A 1XH7A 4I0SA 5HICA 4LYNA 3KRRA 5IU2A 5GJDA 4GV1A 4EKLA 2W1CA 4YSMA 4JG6A 3F9NA 4L52A 5BYZA 3O96A 2QOHA 4X2JA 3TTIA 3AC8A 4OAVB 1XH9A 3NNVA 4C3FA 1B38A 2W5BA 1J7LA 4NEUA 4X3FB 3N9XA 5IQCA 2XJ1A 5M4FA 4LUDA 4CFUA 2J51A 1FPUA 3RM6A 4E3CA 5GIPE 5FM2A 4EK5A 4FG8A 5CU4A 3WIKA 3OCBA 3I0QA 3FPMA 4FBXA 1KSWA 3F3UA 4QMNA 2I40A 3KULA 1ERKA 4IWDA 4EJ7A 2YM4A 4F9AA 4MXAA 4WBBB 3RPSA 5J95A 3UP2A 5EQPA 4JRNA 4WNPA 4A9SA 1STCE 4G16A 3CSVA 3QHWA 4LRJA 4OTIA 4E4NA 3DV3A 2CNUA 2VV9A 1SNUA 3FWQA 4YJPA 4AN2A 2WTVA 3GC8A 4EOPA 2JFMA 4W9XA 2ZV2A 4IQ6A 4EHEA 2C0OA 3LHJA 3W55A 1UU9A 2VGPA 3PSDA 4RIWB 2QD9A 2BFYA 3HEGA 2XIZA 3PPJA 4IWQA 4F6UA 4GKIA 4V04A 4FTQA 3V5QA 3NW6A 3FBVA 3MY1A 4RA4A 2PMLX 4BI0A 4RIXB 2YWVA 3BYUA 3ROCA 5M53A 4F0GA 1J1CA 3W1FA 2WMQA 3BLHA 5AV1A 4IX4A 4GS6A 3RHKA 5CSPA 2PL0A 4CXAA 3ELJA 4UY9A 4R78A 2X8EA 2W1GA 2RG6A 3VUKA 2ITNA 5L6WL 3WF9A 1F5QA 3N4TA 3UO6A 2ZB0A 3DXNA 4IACA 5J7BA 1OL6A 1SVEA 4ZAUA 4L7FA 2XNNA 3S00A 4EH4A 2QOKA 1PXJA 1IG1A 4RIOA 4ASZA 2C6DA 3NYVA 3QLGA 1LEZA 3I81A 1TQMA 3QZIA 2B54A 2O8YA 3FZRA 4HZRA 4V05A 1O9UA 3UC4A 3RMFA 5LCJA 5IQAA 3ORPA 3CGOA 1UKHA 4R1YA 4YUQA 4JBQA 4IC8A 5E92A 1YOJA 4ONAA 1G8AA 2CPKE 2W17A 3AG9A 3VNTA 4BYIA 5IDNA 3H9OA 4IAIA 5CF5A 3JR1A 3PUPA 4A7CA 4YP8A 4BR3A 4RLKA 4L46A 4M97A 4XCUA 5E4HA 2YJSA 1YWVA 2IZUA 4CFNA 1ZYSA 4DBXA 3RZFA 5JFWA 4FV8A 4BHZA 4NL0A 2UVYA 1WBWA 3PRIA 5CEQA 4RWIA 1OKWA 3FC1X 1Y8GA 2RL5A 3WIGA 4MH7A 5CTPA 3VHKA 3MH1A 5HVYA 4BCNA 4EOQA 2VWIA 3SDJA 2J2IB 4HCTA 5IF1A 1M2RA 4RZVA 4AA4A 5CS6A 4BB4A 5FD2A 2PULA 5K5NA 3LQ5A 2I0HA 4Q9ZA 3VS1A 2XM9A 3UJGA 3VHEA 2VWYA 3LCSA 4XG9A 3NYXA 1ZMWA 3E3BX 3NAYA 4JT3A 2W9ZB 4NZWB 3E7OA 2QLQA 4F7JA 2ITWA 5BYLA 2X7GA 3CQWA 1E1VA 3VUIA 3T9TA 5I9XA 1NT2A 2QURA 3PXYA 4G31A 1CTPE 3FLQA 4JS8A 1XH6A 4AOTA 2ETKA 3HUCA 4EH8A 4Q5EA 1OL2A 4RVMA 1H1QA 4QPMA 1KE5A 3L8VA 1M7NA 3F69A 4FV2A 4I94A 3FI4A 1MP8A 4EWQA 5CEOA 3E93A 2PZPA 3G33A 3QXPA 3C13A 4WKQA 1FVVA 4X2GA 2I0EA 4WD5A 4XG6A 3D2IA 4UBAA 1VJYA 4MD7E 5AV4A 5E8UA 3EB0A 2FSTX 4BGGA 3L8PA 1NW1A 2A4LA 2HOGA 3G6HA 5BVDA 5DVRA 4LV8A 3PZEA 3RNYA 3RPYA 4ASXA 3LCTA 4UMQA 4ALUA 4LL0A 3Q4CA 2YDKA 3D5VA 4MWHA 3K5VA 2ZM1A 3KXNA 2IJMA 4ERKA 3CD8A 1OUYA 5M56A 2QU6A 4NTSA 5ANIA 2NRYA 1JKLA 5DWRA 2G2IA 3P4KA 3TN8A 1J3HA 1GOLA 1XJDA 3QTIA 4QYYA 4AGUA 4CZYB 1ZAOA 4BDGA 5M55A 5FBNC 4GT3A 3JVRA 1IEPA 3OHTA 2JKMA 3RJCA 5B2MA 4XYFA 4BZDA 1ZOHA 5C01A 4YPDA 2X7FA 5E8XA 3KA0A 5EYMA 3FAAA 4JX7A 4J53A 4B8MA 1UU8A 4BFMA 4O0UA 1Z57A 4E6AA 4F63A 3LJ0A 3DJ6A 3I1AA 3OEZA 3GUBA 3UOLA 4UWYA 4DGNA 3MESA 2ITOA 2R7BA 4YO6A 4PTCA 2PU8A 2W1IA 1YHSA 4XUFA 4OAUC 3NW7A 4KS8A 3UIXA 2W96B 1YDRE 4MXOA 5I3OA 5LQFA 2LAVA 4FSRA 4WSYA 3UDBA 4AX8A 5IA2A 4WG3A 1H07A 1ZMUA 3OEFX 4BDEA 4ZY4A 5HHWA 2AC5A 3E87A 3SXFA 3FLNC 5BVOA 3MY5A 3BZ3A 4O7ZA 5L2TA 2VO7A 4PPCA 5AJQA 3LOKA 1IAJA 5C4KA 2YIYA 4IVCA 5HTBA 5I9YA 5B2LA 5LVMA 3ALOA 2HZNA 2YCSA 1VZOA 1ZYJA 3T3UA 4G5JA 3UOKA 3QTXA 4QMSA 3KFAA 4B4LA 4FTMA 4CFWA 2YIQA 1Q4LA 2BROA 4RJ4A 4AZVA 3T9IA 3VIDA 3CTHA 5L2SA 3P79A 2HIWA 3B2TA 1VEBA 3Q60A 1UNGA 5ANEA 2YCQA 5ETAA 4FUXA 4C3PA 4DFNA 3DBEA 5I9WA 4QYGA 3CP9A 4JDKA 3CC6A 4C59A 2YIXA 3EQPA 3EQGA 4H3BA 4R77A 5AR7A 3CE3A 3LFDA 4AUAA 4O7TA 4IAKA 2DUVA 3BQRA 3K2LA 1YW2A 2VTIA 4TYJA 4O7RA 3QTUA 3LM0A 1OPJA 3MB7A 1XBCA 1L3RE 2BRHA 5K3YA 4B0GA 4L45A 3U51A 4DC2A 2BAQA 4BKZA 5H3QA 1I44A 4LV5A 4QO9A 4DH7A 3GCUA 3RAIA 2W5AA 1YI4A 4NSTA 5IQHA 4BDHA 2F7EE 2X8IA 3BV3A 3VQHA 4IMYA 2C5VA 3CCNA 4GYIA 2A27A 2BRMA 4BTJA 3PSCA 4I41A 3TNPC 3LQ3A 2BAJA 3PIXA 2PY3A 4YZCA 4YNEA 5LVLA 2H8HA 3R8MA 2BDJA 2C6KA 4KWPA 1LR4A 2JDOA 3P86A 4X3FA 2YZLA 1O6KA 2XA4A 3BIZA 3W32A 3UODA 2ZYBA 4BWXA 4QMYA 5ETIA 5IMEA 3P7AA 4LOPA 2WXVA 2YITA 2XKCA 3A60A 3GCVA 2CLXA 1JNKA 2Y4IB 4YSJA 2Y7JA 4HJOA 5HZNA 2ERKA 5ACBC 4EONA 4N6ZA 4MXZA 2H34A 3QYZA 1FVRA 4YR8A 4NH1A 4Z7HA 3KMMA 4KRCA 5AUWA 1G3NA 3F5PA 3TNIA 5I0BA 4CVAA 4N70A 2PYWA 2R3RA 4DFYA 5AWMA 3VS0A 4BHNA 1BI8A 3ODZX 4CQGA 3NNXA 4AA0A 5KMKA 5KMLA 4BCHA 3VBVA 3GU5A 4XEYA 4FZDB 2XK4A 2X2KA 4BI2A 3H3CA 3FL4A 5BVNA 4CLJA 3VC4A 3V01A 2HW6A 3ZRKA 2WTJA 3DAEA 5D12A 1DAWA 5D11A 4BZNA 4G5PA 1PW2A 4IX5A 4NKAA 4IM0A 4W4XA 4RIXA 2YA9A 4BRXA 2VNYA 3O8PA 4AW5A 4MQ1A 4ENXA 5JRSA 4WNMA 3OY3A 4V01A 3BU3A 2IW8A 3ZRMA 4BCJA 4LGHA 3JY9A 3QD2B 3KMWA 1FGKA 4GU9A 4XV2A 3TJDA 4RQKA 2I1MA 2OZOA 1OI9A 5DLSA 3Q4ZA 4I5PA 3U55A 4PL4A 2ITPA 3PWDA 3O50A 3HDMA 3TNWA 3UYTA 2C1AA 3MJ1A 4O7YA 4P2KA 5CF6A 4TRLA 3NNWA 3OCSA 2WD1A 5E9EA 3DKFA 4IAYA 4MTAA 2OWBA 4FTTA 5JH6A 2NNWB 2XK3A 2VTPA 3AMAA 3HKOA 3EQDA 1R0PA 3RK9A 4CQEA 2QO7A 5DPVA 3EN4A 3QKMA 1Q61A 4F0FA 2JGZA 4PPBA 4QMTA 4C2WA 4PP7A 3RCDA 1J7IA 2EB2A 3LFCA 1Q3DA 5ITAA 5ANOA 1OB3A 4XX9A 4FIJA 3K3IA 5HO6A 2IZTA 2WQBA 3K5UA 3QRUA 4JR3A 3R01A 4YHFA 2C3JA 2UW8A 3NUUA 4FZFB 4D9UA 3BHTA 3QU0A 5EOBA 2QQ7A 2G01A 2JDRA 3ORNA 3PE2A 2C6EA 3ZC5A 3PFQA 3DJ5A 3LW0A 3EYGA 4FT3A 4IB1A 5AR5A 4ASEA 2FSLX 3UOJA 3MVMA 1W82A 5F9EA 4GJ3A 5KBQA 3LFNA 1KV2A 4IIRA 1J7UA 5CAQA 2WMRA 3QCXA 2WMWA 3DLZA 5JZNA 1QPDA 5LMAA 1XKKA 5A4CA 2PWLA 1RDQE 3ID6C 5KHXA 2ZDUA 2QO9A 4K8AA 1BL6A 4X0MA 1J91A 5EYKA 5LVPA 3DTWA 3HMOA 1H24A 3RK5A 4G9CA 4L67A 4FTIA 4KA3A 1WCCA 2BZKB 4OTQA 5AUYA 4OR5A 5FQDC 4RC2A 5CNNA 3OC1A 5JEBA 1LPUA 3FYJX 4KIQA 1WBOA 3TV7A 4ACCA 1QMZA 5AADA 3AGLA 4PUZA 5FLFA 4TWOA 4FYNA 4MD9E 4RGJA 1SZMA 4H1JA 3KRJA 3ZYAA 5CF8A 2WFYA 4JAJA 3TV6A 3SRVB 3KU2A 4NW5A 4MKCA 4HVDA 2XRUA 3POOA 2BR1A 4JBOA 4FG7A 4S31A 1PYEA 2QKWB 1XH8A 4M66A 3GCPA 4UMTA 3DPKA 3G9NA 2F2UA 3HDNA 4QYHA 2XJ2A 2I0YA 3O17A 4X6RA 1Q5KA 3ORXA 3QQUA 4TWNA 4AAAA 4BICA 2QKRA 4NCTA 3IG7A 3EL7A 4LMUA 3QHRA 5ANKA 4CNHA 2XNMA 5CNOA 5T6KA 1XHAA 3TL8A 2VTRA 4O86A 3MPAA 3NLBA 3TJCA 5K4IA 2RFNA 2CKOA 2PUNA 5I3RA 4MCVA 2OSCA 4C02A 3ZBXA 3TDWA 2G9XA 1G5SA 3KXMA 5IUIA 2EXMA 2OJ9A 3FMNA 1OITA 3AT2A 4AN9A 5EKNA 3UP7A 1G8SA 1NVSA 2ITUA 5CXZA 4GG7A 4ASDA 4O84A 4EOSA 3GOPA 4D1SA 4AP7A 4D4RA 4C62A 4E93A 3O8UA 4JL9A 4DFBA 4ANOA 4HPTE 1R3CA 3FXXA 4ACMA 2PZRA 2GU8A 4G3EA 4MEDA 4P5ZA 3ZEWA 3CPBA 3KVWA 3QRTA 4EH7A 4EK8A 5FUTA 4BDKA 4CFVA 4A9RA 1K3AA 3A7FA 5AAEA 4ZTSA 3PE1A 2R4BA 4I5HA 2UZLA 3PSBA 3VS4A 2QOFA 1M17A 3IDCA 4EQMA 4YLKA 4AT5A 1KE7A 2FB8A 4EYMA 3OXIA 3F3ZA 3R7VA 4AG8A 1YHVA 5LXMA 3UVPA 5AAFA 2UW4A 4DGMA 4FOCA 4ZK5A 1RQQA 5LWNA 1YXVA 4ACDA 3FXZA 2I0VA 4HW7A 3F88A 2R9SA 3ATSA 4UYAA 2WEIA 3MWUA 2RFDA 3R30A 1OKYA 3QUPA 5CU0A 2C47A 5EM7A 3DBDA 4OTWA 5M57A 5M44A 1QCFA 3CQEA 4KBAA 4OBOA 4XRLA 1V0PA 3NAXA 4ZJJA 3U9NA 4FKGA 5CZIA 4I20A 4IZ7A 5M09A 4F09A 2C3IB 4EH3A 3A8WA 4GL9A 4L7SA 3CQUA 4ORKA 3HGKA 4FYOA 3GOKA 4EBVA 2PMNX 4XMOA 5HG7A 2DYLA 3I0OA 2J9MA 2Y8OA 3P5KA 4FTJA 3WZJA 4EUTA 3UPZA 2XK9A 3IQ7A 3IDBA 4ALVA 4L6QA 5C03A 3PVWA 3HRBA 4DT9A 3OCTA 4BBEA 3UZRA 1M7QA 3BGPA 5KMMA 2R3MA 2R64A 3MA3A 4FC0A 4RC3A 2E9UA 4X21A 5C8MA 4I22A 1H26A 4K6ZA 4O0VA 2YIWA 4DG0E 3UIUA 3OBGA 5HBEA 3BGQA 4UXQA 4EZ7A 4FKTA 4MXYA 1MRUA 5CSXA 4RJ5A 1OUKA 3B8QA 4AN3A 4G3DA 2Z7QA 2F7ZE 2R3IA 4L3JA 4XG3A 4JNWA 2WTKB 2XEZA 3P1AA 4G6OA 1LUFA 2Z02A 5HE3A 3ITZA 2Q83A 2UW0A 3I5NA 3PPZA 2XMYA 5HE0A 3SVVA 3JXWA 4JG8A 2YM3A 3BBWA 3PJ3A 2PZIA 2WTDA 4S33A 4ZTNA 2VUWA 4RX9A 4A9UA 5JK3A 2B9JA 3KRLA 5BX0A 3VRZA 3E8DA 3O7LB 2R7IA 4FUYA 1JKTA 2IWIA 3ZH8A 4I6QA 2P4IA 3KB7A 4B7TA 1P2AA 2PUUA 3NRMA 4ZTMA 3NDMA 3D15A 4RWLA 1FQ1B 2WQMA 3GQLA 2WAJA 3SAYA 3AD4A 4ZS0A 3RPRA 3SA0A 2YM8A 3S0OA 1PJKA 3DKGA 1XR1A 3VUGA 5CXHA 3RBWA 2WIHA 3H10A 3RTPA 2GS2A 4K33A 3R7EA 5HX6A 2BRNA 2Q0NA 2R3LA 3R00A 2RGPA 4MXXA 2XK7A 3ZFMA 2XB7A 4I0RA 3U8WA 4NFMA 3LMGA 3I7CA 1ZYLA 3WI6A 4U44A 3C7QA 3GXLA 3A8XA 3HRFA 4KBKA 1SMHA 1Q99A 1OVEA 4UXLA 4ZSGA 3JY0A 4YMJA 5JN2A 4DLJA 3OWLA 2J0MB 1MRYA 4DG2E 1JWHA 3R6XA 5T3QA 1J1BA 3GU6A 3HUBA 4IW0A 5HVJA 2ACXA 2J90A 3CLYA 4L3PA 4DFLA 3KXHA 3V8WA 4QMQA 3ORLA 1LEWA 4O0YA 4KKHA 1L8TA 3I6UA 1JKKA 5AA9A 2GNJA 3HX4A 4WUNA 1DI8A 2X1NA 3PA3A 4EK4A 2YERA 4FKUA 3EN6A 2BVAA 3C4FA 3NCGA 2JDSA 4Y8DA 5AP6A 4C2VA 4FV9A 4FKIA 4F1TA 4D1XA 1PXKA 2XNGA 4C7TA 2PVMA 3D2KA 3P7BA 4MBLA 3PRFA 2C30A 4AZEA 3PG3A 3VS6A 4UEUA 3R1YA 4FSZA 1P14A 2QVSE 3R21A 3TTJA 3IO7A 5J5SA 4HVGA 2NP8A 4GFOA 4H3PA 4TNBA 3V5JA 4O0XA 3GB2A 2OXXA 4O7NA 2UW7A 3KCKA 2XNPA 2R3GA 3QD3A 4EQUA 1U46A 3OT3A 5DT4A 2C6IA 5D9HA 1CSNA 3ALNA 4U80A 5FDXA 5HESA 3ZUTA 4IDVA 3L1SA 3W16A 1EH4A 3H0ZA 3QX4A 5KMIA 2HXLA 3M42A 4D2RA 3SD0A 1NA7A 4HVSA 3ZO1A 2HZ0A 4AW1A 4CCUA 5HD4A 2X0GA 1GZKA 3NYOA 5AX9A 5HO8A 3UIBA 3VUHA 1Q8WA 2C1BA 3LXKA 4QP7A 2HZ4A 4E6QA 3VJNA 3PJ1A 4FV0A 4IAFA 4ITHA 4U8ZA 3V5PA 4N57A 4EKKA 4WIHA 3KK8A 2W05A 4HGEA 4M84A 3FYKX 3ROYA 4CMUA 3KL8A 1Q97A 2UW3A 2XCKA 4XBUA 4ZZNA 3EQIA 5IPJA 1K2PA 1WVWA 1JLUE 1BKXA 3VQUA 4EZ5A 4O7VA 4HOKA 3VUMA 3FMDA 1H25A 4GFGA 4NJ3A 4TN6A 3ZM4A 5JT2A 3KQ7A 2VWWA 2WGJA 4LM5A 1CKPA 4A07A 4IZ5A 4DGGA 4TXCA 3SRVA 5KE0A 4X2NA 4AZSA 4A4XA 5BMMA 3R1QA 3NW5A 2A0CX 5T68A 5BQ0A 4QTCA 4YZBA 4CCBA 5DNRA 5CQUA 3VBYA 5E1EA 4FK6A 3MYGA 1UWHA 4ZY6A 2JDVA 3VS2A 1IAHA 2WOTA 5L8LA 3NSZA 3MDYA 2WU7A 3V3VA 4EH6A 3GT8A 3SQQA 2UZTA 4HGSA 5DFPA 4RX5A 5CU2A 1WBPA 5HNGA 3FY2A 2YIRA 4GSBA 1F0QA 5FDPA 4XV3A 4Y73A 2R5TA 2WELA 1U54A 2WPAA 3LFQA 5H8BA 2PK9A 4DEAA 4E26A 4FEXA 5TKDA 4FZAB 2H6DA 3RPVA 1O6LA 3POZA 3DT1A 1NVRA 1VR2A 3QQGA 2JLDA 3CPCA 4HYHA 3S4QA 5GINE 3OD6X 4F7SA 5CI6A 4FT5A 2W4JA 3EN7A 3QTZA 5AM6A 3DLSA 3L9PA 3FQEA 5FRIA 3H30A 1CKJA 4QNAA 5M06A 3WOWA 2CKEA 3ZOSA 4LOQA 3RAHA 2GNFA 4DEGA 4ZLOA 5I9VA 2HCKA 1YXSA 3FY0A 3E92A 4EHZA 5FXSA 4IFCA 2Z7SA 5G6VA 2VRXA 5IEYA 4DG3E 3LJ2A 4AU8A 1H1RA 2V22A 3NUSA 4DF3A 3OTUA 4FNYA 5JKGA 5F95A 1JKSA 2JAMA 3OXZA 4D28A 1IASA 2ZDTA 5CEPA 4G3CA 4Y85A 2A1AB 3FMLA 3KEXA 3QCSA 4IWOA 4NJDA 5C1QB 2NO3A 2F4JA 1P4OA 3C4ZA 4QTDA 4YLLA 3PP1A 3UGCA 2QG7A 3MN3A 4NW6A 3Q6UA 3R28A 2P2HA 3U9CA 3Q2JA 4IX6A 2F7XE 3FV8A 4JLCA 4AGWA 3EZVA 4JDIA 3THBA 3GVUA 2ZB1A 4FTRA 2RG5A 3I79A 4AW0A 2OJIA 4XJ0A 5HNIX 4R7IA 5IA4A 2HK5A 1H1SA 5L2WA 1CDKA 4FIFA 5C27A 4NIFB 5AM7A 3RAWA 4QPSA 4AGDA 3EQCA 4C8BA 5JFSA 3RINA 3C5UA 3DZQA 3Q04A 4DEBA 4YZDA 4CKJA 2C3KA 2RKUA 2R3OA 3BPRA 2ZVAA 3C0IA 4EORA 2QU5A 3G0FA 2R3KA 4J71A 4ZSLA 5HNBA 5TOZA 5FTOA 4MHAA 3ATTA 3LFAA 4R5YA 4J52A 1H08A 4BYJA 4MYGA 5I9UA 1TKIA 2VWUA 4NYEA 3HMIA 5BYYA 3PLAE 4OTHA 3OS3A 4XLVA 1PXIA 1CM8A 3SGCA 4EH9A 2XK6A 3UZTA 3DGKA 1Y57A 2F2CB 3OBJA 4R3RA 5AUZA 3PIZA 4L3LA 4YU2A 1YXXA 3OXTA 3FI3A 2NPQA 2PE1A 3KRXA 2JKKA 3GI3A 4MAOA 3IKAA 3E62A 4E4LA 3O51A 2VO6A 3GEQA 4DEEA 3UNJA 4C61A 2C3LA 4QYFA 4Y46A 1UU3A 1E1XA 3OUKA 3WZKA 1OL5A 5LMKA 4I5CA 1KE9A 3ZO4A 2HELA 4KRDA 5HBHA 3F7ZA 5EHLA 5EOLA 1OKZA 3FKNA 4ARKA 2CGVA 2UZOA 2IG7A 2Y6OA 4HYUA 3G51A 2P3GX 4UX9A 3W10A 4U40A 1YI6A 3AQVA 4RJ3A 4D58A 3QFVA 5J9YA 5AP1A 4UALA 3ACKA 5M08A 2VGOA 3BLQA 5CVGA 1IA8A 1WZYA 4BWKA 1ZOGA 3AD5A 3FZSA 1SM2A 4GT5A 3ORKA 4O38A 4EH2A 5KMJA 2PE2A 2GNGA 3L9LA 3TM0A 2VWVA 3Q5ZA 3BU5A 4L01A 5HI2A 1FMKA 2EU9A 2B1PA 2JC6A 3ZSIA 5JQ5A 3TUCA 2IPXA 2GTMA 4FSYA 1FINA 4L00A 4D2VA 4BCIA 4FEVA 3MY0A 3OZ6A 4OTPA 4K9YA 4NK9A 4F64A 3CTQA 1QL6A 3MH3A 5CAUA 1PMEA 2BUJA 4U81A 3D4QA 3EQBA 4J99A 4MK0A 3M11A 3OF0A 4GJ2A 5DRBA 3ZBFA 5HOAA 2O65A 2X8DA 4G6LA 4ERWA 4EYJA 4CYIA 5AV2A 3CD3A 3G2FA 1YVJA 5TO8A 1RE8A 4ZP5A 2GS6A 2O0UA 2YM6A 4PDPA 4AT4A 4F7LA 2YCRA 5EDQA 2Y0AA 5HU3A 4M7IA 4MF0A 4BDFA 5IISA 4PTGA 4UV0A 5AP0A 1JAMA 4S34A 2PMOX 2QODA 3MIYA 3WE4A 1W8CA 4PMMA 2PVRA 5ICPA 3RVGA 2PVKA 3MTFA 4K18A 4DH8A 2RSVA 1IRKA 1KOAA 4UZDA 4FTAA 3PG1A 2CN5A 3GU8A 4OGRA 3DA6A 3FQHA 4PDYA 3WZEA 2VTHA 3HNGA 3R2BA 4O1OA 2PVJA 5KMOA 1ZY4A 3UG2A 4FA2A 2J50A 4Y83A 2WMXA 1YDSE 2XYNA 3QC4A 5CAPA 4I4EA 2OZAA 4PWNA 2XKEA 3EKKA 4IAAA 4YHJA 4BDAA 2OIBA 3GQIA 4EH5A 3UTOA 4EWHA 4UMRA 4JDJA 4EUUA 4GK2A 1PYXA 3EKNA 2VWZA 2UZUE 3E8NA 3EFJA 2BIKB 5EQEA 2BMCA 2W1EA 1T46A 3K3JA 4HYSA 3ZONA 3LXLA 3U4WA 4ZOGA 4KSPA 3QRKA 5DR2A 3N4UA 4O2ZA 4D2PA 4C4IA 2UZEA 3AT3A 5D41A 4FVPA 1S9JA 3FQSA 4H58A 4JBVA 3R7IA 5AP7A 3UG1A 4D5HA 2PVFA 4DFZE 3FSFA 4RWJA 4USEA 2G1TA 5DH3A 4FTKA 4AA5A 4IX3A 5FP6A 2GCDA 1BUHA 3ACJA 4IANA 4BBFA 2ITQA 3C0GA 5AP5A 1JBPE 3R1NA 3PXRA 4OTGA 5F20A 3DFCB 4X7QA 2XYUA 2RFSA 2ETRA 5HKMA 5DGZA 2V7AA 3CGFA 4ZZOA 2J6MA 3D94A 3RM7A 5AUVA 3TUBA 3QRJA 2XS0A 3AC3A 1TQPA 4RIYB 5EK7A 3Q9YA 1BLXA 3QKLA 3KXXA 5GNKA 5BNJA 3PXQA 4EOLA 3BELA 3PWYA 5DR6A 2YDJA 4TT7A 2HY0A 4CSVA 1W84A 3VBWA 3O71A 3HMMA 3CXWA 4O0TA 3VO3A 3LIJA 3ZXZA 1KE8A 3HAMA 4YJUA 5GZ9A 3L9MA 4Q9SA 2GNLA 5LOHA 4K11A 4CMTA 3DBFA 4R7BA 5KBRA 4MBJA 4AQCA 4V0GB 2PVYA 3BEAA 5HE1A 2XIKA 3K54A 4ZJVA 1YRPA 2P2IA 4EK6A 4AF3A 3UBDA 4GK4A 3PYYA 3C4EA 4WO5A 4WG4A 3Q32A 1K9AA 4X2KA 3VN9A 4C4FA 4FGRA 5IQEA 4I24A 1H01A 1U5QA 5CSVA 3I5ZA 4E7WA 3O0GA 5CU3A 4TW9A 3FMEA 2B9HA 4ACGA 4NM5A 1DI9A 4IB0A 3LFSA 4NM0A 4QQJA 4CKIA 5I5ZA 4IH8A 1UV5A 4Z3VA 1OGUA 4I5MA 2J5EA 5DEYA 4C4JA 4CD0A 4JAIA 4RJ8A 4FV4A 4O21A 2XM8A 5C4LA 2YFXA 3FHIA 4AE9A 4IVBA 3BYVA 2WB8A 3FJQE 4FIGA 4RIWA 3V04A 3ZLSA 5D10A 5GIOE 2BCJA 4ID7A 2VWXA 2WHBA 3Q53A 3DKOA 3G5DA 3MH0A 4ANLA 2IO6A 3MVLA 2OKRA 3WE8A 1W0XC 2P33A 4TY1A 1H8FA 3ZXTA 4DEHA 4D0WA 3Q4TA 4GMYA 5CAOA 3NVMB 3CBLA 3F2AA 4FV1A 3QD0A 3ZFXA 5A4TA 2GMXA 1ZZ2A 5H8GA 3VBTA 4FT7A 4QQCA 5G1XA 3PJ8A 4M69B 4FVQA 4JG7A 4NTTA 3EIDA 3L8SA 4XOZA 4XRJA 4YTHA 4MF1A 3NUPA 4MX9A 2O2UA 3RALA 2YM7A 4AOJA 4ANSA 3CY2A 4F6SA 2PPQA 4BIEA 1YWRA 2KULA 3R73A 2RIOA 3GC0A 2BZIB 4GEOA 1JVPP 4DCEA 4GH2A 4GYGA 3U54A 2OIDA 2WQNA 3QLFA 1ZLTA 5FM3A 3QKKA 5DIAA 4FZ6A 3C4CA 2W9FB 1Y6AA 3QA8A 4FMQA 3QZGA 4RA5A 2ERZE 5IDPA 3EHAA 1Q62A 2J4ZA 4D1ZA 4ZTHA 2GQGA 4G1WA 5CALA 2FVDA 3EMGA 4UWBA 3AC1A 3QTWA 4PMSA 2BRBA 5K9IA 4KABA 5FXRA 1BYGA 2XZSA 5HO7A 4BCPA 3CJGA 4R3CA 5ACKA 4XHKB 3U4UA 3GGFA 1WBSA 2YWPA 4JXFA 5FXQA 3ZSGA 4I92A 3PLSA 4R6VA 5M51A 4NWMA 3C1XA 3CIKA 3TKHA 3PPKA 4E6DA 4XV9A 4YJVA 4JVGA 2IVUA 4DTAA 4BY9E 2CGUA 4PMTA 4RT7A 5K0KA 3IGOA 3ORIA 5L6PA 4R7HA 4I21A 2E9OA 5KUPA 3IS5A 4AZWA 1URCA 3PA4A 1M14A 2QNJA 2ZMCA 2JKQA 4YJNA 2YN8A 5EFQA 3KF4A 2ONLC 2O3PA 3F61A 3KMUA 3OWPA 2PMIA 3R7YA 2QOOA 3HV7A 3KF7A 2J7TA 1YQJA 4XP2A 2BIYA 2YCFA 4DE4A 2WMTA 4ITIA 3FSKA 2YZAA 5GJFA 2OH4A 3UOHA 2ZM3A 3RWQA 4HZSA 2B0QA 3D5UA 4BIBA 3V6SA 4IVAA 3MTLA 2JIUA 4CRLA 3RZBA 5AUUA 2LGCA 4KKEA 5KKRC 1DAYA 1SYKA 2GFSA 5J9LA 4Y72A 1ZYCA 2WZJA 5HCYA 4OTRA 3DDQA 4HYIA 4H1MA 3GP0A 1M52A 4FTOA 5M4CA 2CLQA 4K1BA 2PVLA 4GIIA 4FKLA 3R8VA 2WMVA 3A7GA 2OBJA 3V51A 1OIQA 4D2TA 4PL5A 4M8TA 1UNHA 4RLLA 4X2FA 4FIIA 4Y95A 4OTFA 4YC6A 3P7CA 4FKRA 4IDTA 3GC9A 3PZHA 3SHEA 3KULB 3HV5A 2Y9QA 2R2PA 2DQ7X 4M0YA 5DHJA 4AXAA 3ENHA 2GDOA 3OMVA 4FKOA 5D7AA 4IEBA 3DU8A 3HL7A 2OFVA 4FTCA 3SW4A 4ANMA 4HVHA 3G0EA 2UW6A 3KN5A 2VD5A 5K4JA 2R0UA 3PXKA 3LFBA 5E8WA 3BBTB 3QGWA 5CU6A 2BKZA 4DYMA 4QP4A 5ETCA 5CENA 2XNBA 5HG9A 4J1RA 3W33A 3LQ8A 2IN6A 4M67A 3BE2A 3SG8A 2ESMA 2VTTA 4GKHA 5TR6A 5KO1A 4BCOA 3EQHA 4OUCA 3TZMA 3L9NA 4KUJA 2W7XA 3FZTA 4FEQA 3ZO2A 4YZNA 3HA8A 4IB5A 5CEKA 2W06A 1YXUA 1H28A 5AP4A 1PF8A 4ZSJA 1DM2A 1Y8YA 4TZRA 3EN9A 5F1ZA 4WG5A 4ZZMA 4EHVA 4WBOA 1BMKA 1PXPA 3NUYA 2VX0A 1X8BA 1OPLA 4WUAA 5IA5A 3VBQA 4AT3A 3TKUA 1E9HA 3F2RA 1PXMA 4DA5A 4DBNA 3FL5A 2EUFB 3P78A 2JBOA 3NGAA 4BCKA 3LMIA 3QQLA 5AMNA 5FEEA 4QRCA 4D4VA 3SC1A 3II5A 3RGFA 3R63A 4BF2A 2XP2A 4MVFA 2P0CA 4U41A 3QX2A 4BDIA 3S3IA 4NUSA 3DKCA 2O64A 4IM3A 4QTBA 5IQDA 3CR0A 3BHHA 4QNYA 3A2CA 3BYMA 5C9CA 1WVXA 4RIYA 3HECA 4ANNA 4O27B 4KIPA 5FP5A 4F99A 5JQ8A 1P4FA 2PTKA 2Z7LA 3DQXA 4I3ZA 4DLIA 3EFLA 1GNGA 2HENA 3AGMA 3AOXA 4O6EA 4CTBA 4CYJA 2WU6A 2ITTA 4OT5A 4RVLA 2OU7A 5AA8A 3O7LD 4C3RA 3C51A 3EH9A 3F6XA 4PNIA 4U43A 4YBJA 4UN0C 3QQKA 4PV0A 3KVXA 4L43A
chains in the Genus database with same CATH superfamily
4HNFA 3R9RA 3HRCA 4I6HA 4M15A 5A4EA 2JDTA 3KY2A 4IJ9A 1V0BA 4JJRA 3QALE 3TZ7A 4I23A 4RZWA 4V0GA 4UZHA 4PDSA 3WYYA 3R7OA 2WIPA 2ZV7A 4QT1A 3IDPA 1H00A 4HGLA 1OZ1A 3M1SA 4YTCA 5IQGA 5H9BA 3VJOA 5IEXA 1WAKA 3S95A 5HGIA 4JIAA 4O7LA 4DH5A 1PXOA 2OF4A 4CGAA 4DCAA 1R78A 4E8AA 2R3HA 3KRWA 4Z16A 3Q96A 4O4EA 2XJ0A 1Q24A 4J98A 5F4NA 4KAOA 3U87A 2Z60A 4DN5A 4IC7A 4U45A 2C6OA 3DB6A 5CF4A 4BI1A 1MRVA 2G2HA 2XIYA 3PVUA 4NFNA 3WF8A 2PZ5A 2J0IA 1RJBA 3FHRA 3MH2A 4JBPA 3FLSA 5HBJA 2GNHA 3G9LX 2F57A 4WA9A 3CTJA 3W8LA 4N6YA 2V62A 4BDJA 4BGHA 4CV8A 4DAWA 5GZ8A 2VTSA 3ANRA 2B55A 5BUIA 3F3WA 3R0TA 4DFUA 4JDHA 2BDFA 4UWCA 3DXPA 1DS5A 1SVHA 3F66A 2R3QA 5A4LA 2C5NA 4BCGA 4FTUA 3UDSA 3LFEA 3FPQA 2BALA 4W4VA 3TEIA 2ZAZA 5CQWA 3BI6A 4PL3A 1HCLA 4OBPA 4WRGA 1XH5A 4PQNA 3UNZA 3EZRA 4YJTA 1MUOA 4YTFA 2HWPA 5CX9A 5DR9A 2BPMA 5EW9A 4FL3A 4ZSEA 3MFRA 4DH3A 5A54A 1TVOA 3LE6A 2YISA 3D7ZA 3OFMA 4E5AX 1U4DA 4MNFA 4Z7GA 5HQ0A 3EQFA 1S9IA 3UQGA 4ZMEA 5IA0A 1BX6A 1O6YA 1W7HA 4GG5A 2XEYA 3FC2A 5ANDA 3A7IA 3TXOA 2X9FA 3HLLA 4ZTQA 3O8TA 3R7UA 4BKYA 1PY5A 3COKA 3FKOA 3HZTA 4R1VA 3QCQA 1URWA 3CKXA 2YLFA 4FRFA 1GZ8A 4G17A 2VTJA 4AW2A 4CEGA 4LUEA 5KNJA 4F9WA 3GC7A 4F7NA 5EYCA 3OVVA 1PMUA 2BILB 3GU4A 4IFGA 3RAKA 3VWAA 5HX8A 4IADA 2FH9A 4AWIA 3O23A 3TACA 4KNBA 3QAME 2DS1A 5GZAA 4AOIA 4P4CA 1XQZA 4OBQA 3ZSHA 4CFXA 3UNKA 4QMPA 1APME 3DAJA 4E73A 3LJ1A 4RFYA 3A7HA 2UZDA 3PY1A 4RG0A 3FI2A 3QZHA 4KSQA 3R8LA 1OECA 4EHGA 5EHYA 2OIQA 4L42A 2QOLA 4KKGA 2ZMDA 5HIDA 1A48A 3NZ0A 4IHPA 3ORTA 5IA1A 3HAVA 3OW3A 4O4FA 4YC3A 1TQIA 3U6HA 4W9WA 4HVIA 5JGAA 1GAGA 3Q9WA 1H27A 2OLCA 1JQHA 3TYKA 4GCJA 2AC3A 2IZRA 4S32A 3CS9A 1PMVA 2QLUA 4U42A 3FEGA 2QHMA 5C8KA 4QPAA 1KWPA 2OI4X 5CSWA 5J87A 2FGIA 3ULIA 5LMKC 3HV3A 3PJ2A 2OH0E 3DBQA 5L6OA 4FOBA 5JZJA 2ZJWA 1Z5MA 2VTAA 4M68A 3D14A 2PUIA 4TWPA 4CZTA 3NS9A 2W99B 2X81A 3PVBA 5JFVA 4J96A 5EKOA 1H0WA 1Q8TA 3PXZA 1OBDA 4JX3A 3COIA 4I6LA 1OIYA 3UPXA 2ITXA 2W0JA 5GJGA 3ML1A 4QOXA 2FA2A 2O5KA 2X2LA 5DBXA 1R1WA 4F08A 3TWJA 2AQXA 4M14A 4BL1A 3NIEA 4ENYA 3VVHA 4Z55A 3ZLXA 3DXQA 4OT6A 4FSTA 4C4GA 5M07A 2PVNA 3NYNA 3TG1A 3BGZA 3FZPA 5K0XA 5DE2A 2QC6A 2B9FA 3D9VA 4YGAA 3ZMMA 4CFFA 4ZTLA 2UZVA 1FMOE 5EI8A 4FSWA 4O22A 3JYAA 3U6IA 4QP3A 4QMZA 2G2FA 4TNDA 3NVKI 3UO4A 2C5XA 3QYWA 4EOJA 4XG4A 2XKFA 3NIZA 4EQCA 4H05A 3D5WA 4FT9A 4AACA 5IA3A 2XIXA 5HE2A 2JFLA 4FR4A 3C4XA 1NXKA 4ZIMA 3GCQA 4FNWA 1BL7A 1Q3WA 3FZ1A 4BN1A 2VAGA 5JGBA 2UVZA 3V5LA 4QQTA 3R9NA 4TPTA 1FVTA 5ANGA 4LI5A 2EVAA 3CKWA 4AS0A 1PHKA 2R0IA 4D0XA 4DLIA 2OGVA 3MA6A 3NPCA 2ZV9A 3PP0A 5E1SA 2OFUA 5DOSA 3W2QA 1F3MC 4G9RA 3IONA 4RJ7A 3R9DA 4TL0A 3RPOA 5D7VA 5HD7A 5E7RA 1ST4A 3PY0A 2GQRA 2F49A 3BKBA 4H36A 5E8SA 3P23A 1R0EA 2E2BA 3QBNA 5B2KA 3QA0A 5E8YA 4NKSA 3P5JC 2W1FA 4WT6A 4ZMFA 2J0JA 5FGKA 3WF5A 4L8MA 3MBLA 4U0IA 3ZDUA 2C68A 2XUUA 3TT0A 4DINA 2JIIA 3MPTA 3D5XA 3P08A 4U97A 2XBJA 1H1WA 2PHKA 3HV4A 5E90A 2QG5A 5CT7A 3OY1A 2WEVA 3R22A 5JMSA 4UMPA 4FKVA 5BVEA 4FKWA 2YM5A 5BPYA 4D2SA 3NUNA 1YHWA 3A99A 3E88A 2GNIA 1OL7A 1XO2B 1PRYA 4W8EA 2OG8A 2B9IA 2C6MA 5DMZA 4EI4A 3B8RA 5KHWA 2ZV8A 2C5YA 3MI9A 1T45A 3DOGA 5AUXA 4CRSA 5L8KA 3A4OX 5CVHA 3L8XA 4U3ZA 1A06A 4L53A 2B4SB 3KXZA 1XH4A 2VTLA 4PTEA 2OICA 1LP4A 2E9VA 5CANA 2G15A 2WQEA 4UB7A 5AX3A 4RBLA 3VONA 5HLNA 5IUHA 4WRSA 3VRYA 2YAKA 4G3GA 5DG5A 4I93A 5IG1A 3A62A 4O0SA 3G6GA 1B6CB 2FO0A 3LAUA 4YJOA 5HTIA 4JI9A 5EHOA 4BWPA 1JOWB 2HW7A 4EZ3A 4ALWA 4QTEA 5EYDA 2X4FA 3V8SA 5DN3A 3LLAA 2RF9A 2WTCA 4APCA 4E20A 4AAYA 4QQ5A 3T3VA 5KZ0A 4KB8A 1V0OA 1Q41A 3MB6A 4XG8A 4JQEA 4ZEGA 5KMNA 3QRIA 1WBTA 4ACHA 1REJA 1KUTA 1QPJA 4RJ6A 4X3FC 4S30A 4YTIA 4A06A 3ZLWA 4YLJA 3FMMA 4D5KA 1XMLA 2IF8A 1UWJA 5HVKA 4BBMA 4QMUA 2PUPA 4RQVA 3UVQA 2P55A 3FXWA 2XAMA 4FKSA 3ZU7A 2Z7RA 3OT8A 2VTMA 1ZZLA 3MW1A 5J1WA 4HPUE 2DWBA 3E63A 4XBRA 3Q52A 4QTAA 4JOAA 3SXRA 3P9JA 4O83A 5A6OA 4FNZA 3PFYA 5J8IA 2WMAA 4PMPA 3WARA 5DRDA 2QO2A 4FV3A 3VS3A 3OTVA 2PZYA 5EM6A 4AZFA 3EL8A 3DB8A 2C0TA 3O2MA 5BUEA 3SKCA 3WF7A 2BFXA 5EW8A 1RW8A 2HZIA 3BWFA 4LQMA 3A7JA 3SOAA 1OGYA 5E8ZA 3R71A 2GHMA 5DEWA 5L4QA 3R8PA 2UW9A 1ND4A 4TYHB 2VO3A 5AP2A 1HOWA 3IOPA 3UO5A 3VW8A 5L8JA 4ZLZA 4ZLYA 2OF2A 3GNIB 2C4GA 4O6LA 2WNTA 3ORMA 1CKIA 2GPHA 4AGCA 4S2ZA 5CYIA 4O7SA 3C50A 3HVCA 4G34A 2XNEA 4FV5A 3BE9A 4GW8A 4QP1A 3BRBA 4ANBA 4FNXA 5B7VA 3W8QA 3ZTXA 5LJJA 3FLWA 3E8EA 3HV6A 3ERKA 2VU3A 1V1KA 4U9AA 2B7AA 4LGDA 4X6QC 2VNWA 4PP9A 3EN5A 5HLPA 3OCGA 5EDRA 4B8LA 4USDA 3FZOA 3F5GA 1W98A 3IW6A 5EW3A 4MBIA 1YOLA 3IPHA 4CKRA 4BTFA 1YDTE 2YLEA 3LXNA 4M12A 2OJJA 2R3FA 4E5WA 2WKMA 3MFUA 2QR7A 5HORA 4EOIA 3H9FA 4XG7A 5E8VA 3GENA 3UE4A 4XOYA 5AR3A 4G6NA 5CSHA 2IVTA 4D2WA 2XARA 3AT4A 3GU7A 5EH0A 4C33A 2BRGA 4AXDA 4RRVA 3ANQA 5AV3A 2VX1A 3UZPA 2CN8A 5IMXA 3BX5A 5L2IA 3T8OA 3OWJA 4F1MA 3H0YA 2GQSA 1UA2A 1JSTA 3W0SA 3QC9A 4BGQA 4CV9A 3Q5IA 4FODA 1WBVA 4P5QA 2VO0A 2X2MA 3ZS5A 3SW7A 4F70A 1WVYA 1KE6A 3A61A 3MGYA 3ZEPA 2J0KA 4E1ZA 3WILA 4RVKA 4QMVA 4NT4A 5JRQA 3W18A 4ANQA 4XG2A 2NYAA 4CT1A 2RFEA 1JSUA 2XH5A 3JPVA 1YKRA 5BMSA 4GUEA 3QTQA 3TUDA 5JFXA 2XCHA 3C0HA 3QL8A 4JQ7A 4O4DA 4RPVA 2JAVA 4FSUA 5AP3A 5BUJA 2F9GA 3IOKA 2Q0BA 3UVRA 2CNQA 4GIHA 1REKA 3B2WA 4E6CA 3MSSA 2XKDA 5C26A 4R3PA 3AMYA 5IZFA 4KIKB 4YNOA 5EQYA 1YOMA 3LCDA 3NMUF 3ZFYA 1Y6BA 2X4ZA 4YJRA 3AC4A 4EOMA 4BVUA 2AUHA 2X39A 4QMOA 3V5TA 2I7QA 1PXNA 2UV2A 3QQJA 4HGTA 1OPKA 1Y91A 2X7OA 5AAGA 1MQ4A 1QPEA 4E4MA 3I7BA 3QUDA 3UMXA 5A3XA 2ZFYA 1IR3A 2YHVA 3SV0A 3KN6A 1GIJA 3LLTA 4TYIA 2IVVA 3F2NA 5A46A 3ETAA 2OJGA 4GK3A 4O81A 2OJFE 3OOGA 4CG8A 5BVKA 1ZRZA 4E4XA 4LRMA 3ZHPC 3TDVA 2QHNA 2WMBA 4NCTC 2IZSA 5A9UA 5FEQA 3UYSA 2O63A 4FV7A 2FYSA 5F94A 2A19B 4U3YA 5HG5A 3QGYA 2CCHA 2JEDA 4C58A 3QWJA 4U79A 4ZSAA 4I4FA 3NX8A 1VYZA 4HCUA 4II5A 4FICA 2C5OA 4XNEA 3S1HA 3RI1A 3EFWA 5IUGA 1GZNA 3DBCA 4WSQA 4O7WA 3DDPA 3KK9A 1GJOA 5IEVA 3Q3BA 3REPA 3ZC6A 1OMWA 4Q5HA 3E8CA 2YABA 3FLZA 4FZ7A 2GHLA 5EDPA 3GCSA 4LMNA 3TIZA 5DT3A 1GY3A 3F5XA 3UDZA 1GIHA 4AFEA 2BZJA 4FTNA 2WQOA 3F3TA 1PXLA 1WMKA 4DGOA 4I0TA 4W4YA 2Y6MA 3H9RA 2IW9A 2BHHA 3HA6A 2HYYA 4FKPA 3DK3A 1PMNA 4QMLA 2WTWA 1OKVA 4FIEA 3LMHA 5KKRB 5M4UA 2Z8CA 3HP5A 3Q2MA 1VYWA 2JKOA 1M2QA 1ZARA 3D7TB 3IW7A 4K2RA 4FGBA 3I60A 4IZAA 4U6RA 4XS2A 4EOKA 3AKJA 2CHLA 3KIOC 5DI1A 3NUXA 2W1DA 5L2QA 3F7WA 4C0TA 5J5TA 2PE0A 5B0XA 3UC3A 4LDTA 3UIMA 2HWOA 1BI7A 4YHTA 1H0VA 3LZBA 4LL5A 3FUPA 4O91A 2FSOX 5KX8A 3EJ1A 3DZOA 2EXEA 2I6LA 1FOTA 5LVNA 4M13A 3UDTA 2PVHA 5AR8A 1ATPE 3GFEA 3NNUA 4FG9A 3A4PA 4FX3A 4NIFA 3NCZA 3C9WA 4JR7A 4MNEB 4E5BA 3Q9XA 5IQFA 1PKGA 2XRWA 3R9OA 2GFCA 3ZUVA 4HNIA 4RSSA 3QQFA 4BCQA 2VWBA 4OTDA 4C34A 4CZUA 2JITA 2CJMA 3TI1A 3ZO3A 3MFTA 1PKDA 3U6JA 4CMOA 5FBOA 3FE3A 1XBAA 5IQIA 2IEWA 5H2UA 4J8NA 4F4PA 4FKJA 4WOVA 5BVWA 3KCFA 2W1ZA 2W5HA 4GVAA 3KGAA 3E64A 5CEIA 4IVDA 1YXTA 3R9HA 2QOQA 3DCVA 3MVHA 4BCMA 3E7VA 3R8ZA 4BKJA 5A14A 1XBBA 3FMKA 3AXWA 4XP3A 2CKQA 2BTSA 4LV7A 1ZOEA 3RNIA 1NY3A 2W4OA 2XBAA 3LCOA 5FTQA 4RMZA 5J7HA 2R3PA 2YACA 5IKWA 2FUMA 4F0IA 5M4IA 1H1PA 4XLIA 4H39A 2J5FA 4CG9A 5AR4A 4XP0A 2CGWA 3TNQB 4B99A 4RX8A 4APPA 1OBGA 2HY81 3JUHA 2ITVA 3LKMA 5A4QA 3DNDA 3IECA 4O96A 4YO4A 3QF9A 4FSNA 3V5WA 5CAVA 2CCIA 5EM8A 3TIYA 4LRKA 1R39A 3AC2A 3MV5A 4XV1A 5HIBA 4FEUA 4LGGA 4FI1A 4A4LA 4ITJA 3RCJA 3RK7A 1UVRA 2WMUA 3OP5A 4FSMA 3RHXA 4EJNA 2OW3A 2KTYA 3JS2A 3IGGA 2Y4IC 5AV0A 1I09A 4YJSA 5CASA 4L68A 1ZY5A 5EI2A 3BHYA 3W0RA 2OO8X 2V55A 1AD5A 4FKQA 4YBKA 4YZMA 3UQCA 3MIAA 5D1JA 3ZDIA 1IA9A 3BL7A 1ZYDA 4EBWA 3R02A 5C8NA 3D83A 4CTCA 5A6NA 4P90A 2QI8A 4TYHA 2JD5A 3OOMA 2AYPA 4GRBA 5HTCA 4B9DA 3BYOA 4USFA 4UMUA 1OIRA 3H4JA 3NR9A 4BTMA 1GIIA 1H4LA 3IW8A 3PXFA 3W2RA 4NM7A 2UZWE 3QZFA 4G2FA 2VN9A 3QQHA 4J8MA 5CY3A 4GVJA 1M2PA 3NWWA 4QMXA 1YI3A 3PA5A 4JQ8A 3IK3A 4MXCA 4ZTRA 1U54B 4MWIA 3WBLA 2FSMX 4C4HA 4NM3A 3COMA 3I6WA 4X3JA 2W4KA 3R7GA 4F65A 5FTGA 1ZXEA 3DAKA 4CT2A 3WZDA 3ULZA 2GTNA 4PDOA 2H9VA 4GT4A 1QPCA 3BLRA 1MQBA 2E9NA 2WTIA 3DY7A 4Y5QA 4EEVA 2C0IA 4IJPA 3TZ8A 2IW6A 2UZNA 3DNEA 4IXPA 1ZWSA 2XK8A 2XVDA 4FL2A 4W8DA 5L3AA 3M2WA 2EWAA 4HCVA 2CGXA 2XF0A 4FF8A 3VS7A 4DHJA 4F9CA 3BWJA 4O1PA 4PPAA 3IW4A 3VULA 3JVSA 3QCYA 4RX7A 4Q2AA 3MVJA 3BEGA 3QUEA 4TYGA 3SG9A 4AXFA 3CY3A 4EC9A 4DDGA 4KS7A 4Y5HA 3IW5A 3QD4A 2QOCA 4BZOA 4FK3A 3QTSA 5CZHA 1OL1A 3V8TA 3BYSA 4PRJA 3C5IA 5DT0A 4M3QA 5EI6A 3COHA 3F3VA 4EC8A 1P5EA 2CNVA 4JIKA 2HAKA 3MS9A 4M0ZA 4WNKA 5J79A 4QP2A 2BAKA 2UW5A 3E5AA 5IQBA 1W83A 2R3JA 3VBXA 5LARA 4PNKA 5J9ZA 3FKLA 4PX6A 5ETFA 3UQFA 2VZ6A 3EQRA 3LM5A 4PY1A 4GU6A 1XWSA 5IH6A 4QP9A 3R1SA 3ZM9A 1B39A 3HYHA 3PVGA 4TWCA 3G90X 3W2OA 3AD6A 3CJFA 1Q8ZA 5DYJA 2BTRA 2V0DA 4KIKA 4C4EA 3ZRLA 4BDBA 3N51A 1A9UA 1UKIA 3GBZA 4DHIB 3QWKA 4EOOA 2C6TA 4TYEA 2YEXA 5CT0A 2QOIA 3PIYA 4BDCA 3OW4A 3PDTA 1ZMVA 4AE6A 5HIEA 4O82A 2B53A 2BDWA 3VUDA 4BDDA 4DTKA 3TNHA 3LCKA 5LWMA 2ZM4A 3EFKA 1Q8YA 2VX3A 2YDIA 4TKSA 4TTHB 3E3PA 2B52A 1SVGA 2VTOA 4P7EA 2UZBA 3BHVA 3KXGA 4C38A 2IVSA 2WO6A 3F82A 2CSNA 4IZYA 1HCKA 3DQWA 2WOUA 2H96A 5EM5A 2QR8A 4K0YA 3W0QA 2UUEA 3ZZEA 4C35A 3G15A 2ITZA 3DJ7A 2YJRA 4JRVA 3BU6A 1NVQA 4RFMA 4D9TA 4CLIA 4FTLA 5AR2A 2X0QA 3Q6WA 4DGLC 4RC4A 5HCZA 5JGDA 3LVPA 4N0SA 3ZCLA 2CMWA 4RWKA 4IAZA 4Z9LA 2X9EA 2OXDA 4KIOA 5TT7A 4QMMA 3S2PA 1OIUA 2A2AA 5I9ZA 3OUNB 4EL9A 4ZJIA 2W1HA 5LVOA 3FMHA 1AQ1A 1UNLA 4I1ZA 4YJQA 3ZUUA 3OWKA 3KC3A 2BZHB 3ENMA 3RWPA 2ONLA 2XNOA 3AKKA 3C4WA 4FSQA 4FIHA 4QP8A 2EB3A 1FGIA 3AC5A 5DA3A 5HCXA 5JSMA 3MPMA 4J97A 3LFFA 1OM1A 4BTKA 3DK6A 2REIA 4IWPA 4YPSA 4DH1A 5ANJA 3SXSA 4F6WA 3GFWA 1YWNA 3Q9ZA 3VF8A 5AIKA 2CKPA 3EWHA 2EXCX 5CI7A 3SLSA 4C36A 3ET7A 2QONA 1AGWA 5AIRA 2V7OA 4K77A 3Q4UA 5LCKA 5K5XA 1U59A 2V5QA 2Y4PA 3HMPA 3SX9A 1JSVA 2XIRA 3DK7A 4J7BA 5TE0A 3TZ9A 3W2PA 5J1VA 5CVFA 5KCVA 3D7TA 2GHGA 5E8TA 1WBNA 3EOCA 3KKVA 4DHFA 3NUAA 3DTCA 3HMNA 4O0WA 3W2SA 3DFAA 4OW8A 4WHZA 5HU9A 2ETMA 2QCSA 4LFIA 3R8UA 1W2FA 2GSFA 4M69A 2VTNA 3N4VA 3TKIA 2PSQA 1UU7A 4CFMA 3WZUA 5LMBA 3NEWA 3RP9A 5CEMA 2ITYA 3OROA 4IBMA 4QP6A 4O4BB 5FG8A 3FDNA 2UVXA 2BHEA 3PY3A 2C6LA 3MFSA 3FI8A 2Z2WA 4MNEA 2J0LA 4ZXTA 5IH4A 4DTBA 4XH6A 5KZIA 3QTRA 4U5JA 5CWZA 5I4NA 4F1OA 4PF4A 4UYNA 4AFJA 4FEWA 1Q8UA 4F9BA 4MD8E 3VS5A 4I6BA 4MQ2A 3VUTA 2R3NA 4FL1A 2JIVA 5CLPA 1ST0A 3RKBA 3R04A 5HG8A 2GS7A 5E91A 4RVTA 3ZLYA 4A9TA 4ZY5A 4IB3A 4KD1A 4BC6A 4N4SA 3P0MA 3D0EA 3OG7A 4U7ZA 2OZAB 3BHUA 2JBPA 2OXYA 2HXQA 1U5RA 3TCPA 3VF9A 4C37A 1SNXA 3W0MA 4NU1A 4B6LA 4R8QA 5HLWA 5AUTA 3EYHA 3FMJA 2SRCA 1CMKE 3R83A 3W2CA 4A4OA 3ZZWA 2OK1A 2QOBA 3LXPA 3LPBA 3PUFC 4LOOA 4O0RA 2BKKA 3PTGA 5TF9A 4A9YA 4DEIA 3KREA 5HEZA 4OLIA 4AZTA 2WMSA 4C57A 4D4YA 5AFVA 2WTKC 3MJ2A 3WYXA 3DS6A 4DT8A 3BQCA 4BCFA 2X6EA 1JPAA 4KINA 1Z9XA 4RFZA 4KBCA 5FWKK 4QDEA 3F5UA 4L9IA 4QYEA 4F9YA 3ODYX 4GUBA 3UMWA 1KV1A 4FT0A 3AMBA 3V6RA 5GHVA 3WF6A 3TV4A 4QD6A 4BIDA 3CEKA 4H3QA 4DFXE 2YAAA 3FLYA 5AEPA 2C69A 4LG4A 4L44A 4YC8A 4YURA 5IH5A 4R5SA 2VTQA 1KOBA 4FVRA 4J95A 4YZ9A 2NRUA 4G3FA 3VAPA 4DITA 3BCEA 2CDZA 3PJCA 1WFCA 3I4BA 4IE9A 2E9PA 3VW6A 4O2PA 3BV2A 3SOCA 1FBNA 4QMWA 3QXOA 4FE2A 5BVFA 1GZOA 3ORZA 2X6DA 4IM2A 4GFMA 4D55A 4W4WA 4WNOA 4EK3A 2ZOQA 4FV6A 5EG3A 5H8EA 4I6FA 4DEDA 5FEDA 4D4SA 4ZS4A 3R2YA 3HP2A 1XH7A 4I0SA 5HICA 4LYNA 3KRRA 5IU2A 5GJDA 4GV1A 4EKLA 2W1CA 4YSMA 4JG6A 3F9NA 4L52A 5BYZA 3O96A 2QOHA 4X2JA 3TTIA 3AC8A 4OAVB 1XH9A 3NNVA 4C3FA 1B38A 2W5BA 1J7LA 4NEUA 4X3FB 3N9XA 5IQCA 2XJ1A 5M4FA 4LUDA 4CFUA 2J51A 1FPUA 3RM6A 4E3CA 5GIPE 5FM2A 4EK5A 4FG8A 5CU4A 3WIKA 3OCBA 3I0QA 3FPMA 4FBXA 1KSWA 3F3UA 4QMNA 2I40A 3KULA 1ERKA 4IWDA 4EJ7A 2YM4A 4F9AA 4MXAA 4WBBB 3RPSA 5J95A 3UP2A 5EQPA 4JRNA 4WNPA 4A9SA 1STCE 4G16A 3CSVA 3QHWA 4LRJA 4OTIA 4E4NA 3DV3A 2CNUA 2VV9A 1SNUA 3FWQA 4YJPA 4AN2A 2WTVA 3GC8A 4EOPA 2JFMA 4W9XA 2ZV2A 4IQ6A 4EHEA 2C0OA 3LHJA 3W55A 1UU9A 2VGPA 3PSDA 4RIWB 2QD9A 3TMOA 2BFYA 3HEGA 2XIZA 3PPJA 4IWQA 4F6UA 4GKIA 4V04A 4FTQA 3V5QA 3NW6A 3FBVA 3MY1A 4RA4A 2PMLX 4BI0A 4RIXB 2YWVA 3BYUA 3ROCA 5M53A 4F0GA 1J1CA 3W1FA 2WMQA 3BLHA 5AV1A 4IX4A 4GS6A 3RHKA 5CSPA 2PL0A 4CXAA 3ELJA 4UY9A 4R78A 2X8EA 2W1GA 2RG6A 3VUKA 2ITNA 5L6WL 3WF9A 1F5QA 3N4TA 3UO6A 2ZB0A 3DXNA 4IACA 5J7BA 1OL6A 1SVEA 4ZAUA 4L7FA 2XNNA 3S00A 4EH4A 2QOKA 1PXJA 1IG1A 4RIOA 4ASZA 2C6DA 3NYVA 3QLGA 1LEZA 3I81A 1TQMA 3QZIA 2B54A 2O8YA 3FZRA 4HZRA 4V05A 1O9UA 3UC4A 3RMFA 5LCJA 5IQAA 3ORPA 3CGOA 1UKHA 4R1YA 4YUQA 4JBQA 4AXEA 4IC8A 5E92A 1YOJA 4ONAA 1G8AA 2CPKE 2W17A 3AG9A 3VNTA 4BYIA 5IDNA 3H9OA 4IAIA 5CF5A 3JR1A 3PUPA 4A7CA 4YP8A 4BR3A 4RLKA 4L46A 4M97A 4XCUA 5E4HA 2YJSA 1YWVA 2IZUA 4CFNA 1ZYSA 4DBXA 3RZFA 5JFWA 4FV8A 4BHZA 4NL0A 2UVYA 1TFFA 1WBWA 3PRIA 5CEQA 4RWIA 1OKWA 3FC1X 1Y8GA 2RL5A 3WIGA 4MH7A 5CTPA 3VHKA 3MH1A 5HVYA 4BCNA 4EOQA 2VWIA 3SDJA 2J2IB 4HCTA 5IF1A 1M2RA 4RZVA 4AA4A 5CS6A 4BB4A 4BJJB 5FD2A 2PULA 5K5NA 3LQ5A 2I0HA 4Q9ZA 3VS1A 2XM9A 3UJGA 3VHEA 2VWYA 3LCSA 4XG9A 3NYXA 1ZMWA 3E3BX 3NAYA 4JT3A 2W9ZB 4NZWB 3E7OA 2QLQA 4F7JA 2ITWA 5BYLA 2X7GA 3CQWA 1E1VA 3VUIA 3T9TA 5I9XA 1NT2A 2QURA 3PXYA 4G31A 1CTPE 3FLQA 4JS8A 1XH6A 4AOTA 2ETKA 3HUCA 4EH8A 4Q5EA 1OL2A 4RVMA 1H1QA 4O4CA 4QPMA 1KE5A 3L8VA 1M7NA 3F69A 4FV2A 4I94A 3FI4A 1MP8A 4EWQA 5CEOA 3E93A 2PZPA 3G33A 3QXPA 3C13A 4WKQA 1FVVA 4X2GA 2I0EA 4WD5A 4XG6A 1G8KA 3D2IA 4UBAA 1VJYA 4MD7E 5AV4A 5E8UA 3EB0A 2FSTX 4BGGA 3L8PA 1NW1A 2A4LA 2HOGA 3G6HA 5BVDA 5DVRA 4LV8A 3PZEA 3RNYA 3RPYA 4ASXA 3LCTA 4UMQA 4ALUA 4LL0A 3Q4CA 2YDKA 3D5VA 4MWHA 3K5VA 2ZM1A 3KXNA 2IJMA 4ERKA 3CD8A 1OUYA 5M56A 2QU6A 4NTSA 5ANIA 2NRYA 1JKLA 5DWRA 2G2IA 3P4KA 3TN8A 1J3HA 1GOLA 1XJDA 3QTIA 4QYYA 4AGUA 4CZYB 1ZAOA 4BDGA 5M55A 5FBNC 4GT3A 3JVRA 3NFFB 1IEPA 3OHTA 2JKMA 3RJCA 5B2MA 4XYFA 4BZDA 1ZOHA 5C01A 4YPDA 2X7FA 5E8XA 3KA0A 5EYMA 3FAAA 4JX7A 4J53A 4B8MA 1UU8A