4C36A

Pka-s6k1 chimera with compound 15e (cct147581) bound
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
338
structure length
335
Chain Sequence
ESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSYGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVLEYLPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
publication title The Discovery of Potent Ribosomal S6 Kinase Inhibitors by High-Throughput Screening and Structure-Guided Drug Design.
pubmed rcsb
source organism Bos taurus
molecule tags Transferase/inhibitor
total genus 105
structure length 335
sequence length 338
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c36A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c36A02
4Q2AA 3G90X 3E87A 4YJOA 3R9NA 4GKIA 4S34A 3VBQA 1Q62A 3A2CA 4YTHA 4FSNA 5CT0A 4BDEA 3SW7A 4FGBA 4DFZE 1TQIA 1FMOE 3PWYA 2CGUA 4QMZA 3MESA 1M14A 3PY1A 3KMMA 4I6FA 2FGIA 4H36A 4O0UA 4B0GA 5LQFA 1OBGA 2ZMDA 3PDTA 2C1BA 3BELA 2Z7QA 2EWAA 3W33A 2VX0A 3EQGA 3U54A 5J5SA 4G31A 4U0IA 3MFSA 1BUHA 4X3JA 3UVPA 4CMTA 3RJCA 3P1AA 5IUHA 2DQ7X 3HV7A 4LRKA 3IW4A 4QP8A 2ERZE 4E8AA 4AW1A 4IB3A 1TQPA 4EYJA 3RPSA 5IQBA 4PMMA 2XF0A 2J50A 5JSMA 2BAQA 1TQMA 5DN3A 3UC3A 4D2TA 1SM2A 3HRBA 5FBNC 4DTAA 3COIA 3FXWA 1FVVA 2DS1A 3L8PA 4JOAA 2C47A 2ZV2A 5F1ZA 1YWNA 2GHGA 4IAYA 4EK3A 5FXSA 3QALE 2OKRA 5IQAA 3R22A 1FMKA 3G0EA 1XQZA 2YM8A 3BE9A 3OBJA 4DN5A 3TTIA 5TR6A 2RF9A 2BROA 1BI7A 3REPA 2XBJA 3FPQA 4LL0A 3KXZA 3JVRA 3V3VA 3VUDA 4XRJA 5JFSA 2CDZA 3ODZX 2PZ5A 3H9OA 4QNAA 3CS9A 2VTQA 3PRFA 3BHYA 3RZFA 2UW4A 3EFLA 3C0GA 3F3TA 2REIA 3D14A 3LXNA 3PVUA 4NM0A 3W55A 3ZXTA 4AN9A 3NUSA 4L53A 4O21A 4AS0A 4QYHA 3EKNA 4JBQA 4RVLA 2C5NA 3NNWA 2W5AA 3O23A 4IAZA 5JT2A 1KUTA 3I0QA 5CQUA 4L42A 3QRIA 4I5MA 4YR8A 1OZ1A 1BMKA 3OCBA 5FLFA 5HE0A 2EXEA 3R7UA 3CQEA 4ZAUA 2VZ6A 4FKUA 3BBTB 2B9IA 5HO7A 2P55A 3SAYA 3ACKA 5JRQA 2PZYA 3A7IA 2XRUA 2VO3A 1UNGA 2XIKA 3U6JA 4FV1A 2W96B 1CKPA 3BPRA 2I6LA 4EQCA 4DH1A 3B8RA 4TYHB 4IFCA 3WE8A 3V5TA 3DY7A 4MVFA 4HVDA 2BPMA 2W0JA 4PDPA 4MKCA 4TWPA 3GCUA 4FIEA 5HEZA 5AX3A 5KMIA 2WIPA 3FI2A 5E8XA 4QMQA 5LVNA 4H3BA 4BCJA 1KE6A 3Q52A 1XHAA 1R39A 3RM7A 1JSUA 2ONLA 1RDQE 4Q5EA 4BGGA 4KRDA 2PVJA 4I4FA 4ZTHA 4BTKA 1OPLA 4HZSA 5BVOA 4O0RA 3ZLSA 4C7TA 4XG6A 4QMNA 3EQHA 4PPBA 4EH6A 3I81A 3LFSA 3AC2A 4TY1A 4YHJA 3EN5A 3V6SA 4EZ5A 3BZ3A 2JDOA 2OIBA 3CPBA 4LI5A 1XBCA 2GTNA 3F88A 5DPVA 3UIMA 3VVHA 4J99A 2EU9A 3VS4A 3NUPA 4ZTRA 1M2RA 2VTPA 3BLHA 3RGFA 5AP3A 5I9VA 4OAVB 3PXZA 3CTQA 3LAUA 4HZRA 2CCHA 4RIOA 4FV4A 4D58A 4EOPA 4M13A 4IBMA 4CV8A 2WMBA 1PY5A 3DAKA 1ZOEA 4G3EA 4G6NA 2AC5A 3OROA 1ZZLA 3EJ1A 4RC2A 3R1NA 3QTUA 5CYIA 4PPCA 4AZTA 4DBNA 4ZSJA 2UVYA 1JKTA 4F4PA 3UGCA 2CGVA 4FEQA 2WFYA 5DFPA 1QPEA 2P2HA 5EM8A 1APME 2VU3A 5FP5A 2B53A 3SXSA 2FA2A 2RGPA 3QRJA 4C2VA 4X21A 4XG9A 3DU8A 3R9HA 4H05A 2X7OA 3D9VA 3JUHA 2V55A 3OY3A 3QZGA 4K77A 4MX9A 5JGAA 3UPXA 3S0OA 4NM5A 3MA6A 3ZO4A 3U6IA 2WQNA 1IEPA 5B2MA 5KBRA 4X2KA 2OU7A 4JIKA 2BUJA 2W7XA 4LGGA 4BYIA 4H3PA 4RX9A 2ITPA 4K33A 4O0VA 3QZIA 4F1MA 3A7HA 3RALA 3HKOA 3GCVA 4ITJA 3ANQA 4FODA 4NJ3A 4BDHA 3PZEA 5FG8A 3Q9XA 2HW7A 2R3LA 3GNIB 4BWXA 3PLSA 5C03A 4TPTA 3VO3A 4ZLZA 3TKUA 3EQRA 4L7FA 2IW8A 2YLFA 3MN3A 5KMNA 3SDJA 4BI2A 1G5SA 3SOCA 3WBLA 2OFUA 4I5HA 4C4FA 4RFZA 3O7LB 1RW8A 1Y6AA 3HMNA 2AC3A 4K9YA 2OICA 3GC9A 2OIQA 5JK3A 3N51A 4IZ7A 2VNYA 3THBA 2PUNA 4X2NA 2HZ0A 4MXAA 2PZPA 5CAVA 4EK5A 4O7TA 3UNZA 3D5XA 3E8CA 5BUIA 4R1VA 4R3RA 5ANJA 3W2OA 3U9CA 2EVAA 4ZTLA 4FSZA 5B7VA 3KXMA 2WNTA 5FM2A 5AAEA 1WBNA 2I1MA 5T3QA 2X8DA 4D2RA 1J7IA 3T9IA 3ZO1A 1FVRA 5BVNA 1OIUA 4FE2A 2I40A 4X3FB 4GFOA 2G9XA 2X8EA 3QUPA 4Z3VA 2ZDTA 2UVXA 1K3AA 2HWPA 3BYUA 3FI4A 4FKSA 4FV7A 4IX3A 1W82A 4R6VA 5HIDA 5AA8A 5AV4A 4U40A 3RNIA 4I94A 3ZLWA 4DEEA 3GU7A 3HDNA 3HMIA 5JZNA 1WFCA 3QQHA 3MVMA 3TM0A 2EB2A 4I21A 2A27A 2P3GX 4CT1A 1UA2A 2QHMA 2B54A 1OL6A 4BC6A 1XR1A 3QC4A 3HAVA 2ETRA 2YAKA 3TL8A 1H25A 4K0YA 5AP1A 3DLSA 4CG8A 4RJ8A 2B4SB 3F5PA 2FSLX 2HIWA 3Q6WA 2UZLA 5EW3A 2B1PA 5EH0A 4BI0A 2C0IA 2XJ0A 2VAGA 1XH7A 2X6DA 3HUBA 4DFBA 1OUYA 4J53A 3OF0A 4RVTA 2ITWA 5IQFA 4BBMA 1CM8A 2X2LA 1Q99A 5KNJA 5CENA 2WTVA 4ANLA 3C50A 5E1EA 4WIHA 4RC4A 5IH6A 3FEGA 4D55A 2YIYA 5DG5A 4BYJA 3QX2A 1GY3A 5BNJA 2QOOA 5AUVA 2DWBA 1Y57A 3LQ8A 3R21A 4BKJA 4HYIA 5IDNA 2BAKA 2IJMA 2H6DA 2C3IB 2VWBA 2BDFA 3AGMA 4ALVA 1OI9A 3PTGA 5E8WA 4H39A 2VX1A 2BZJA 4AX8A 3R8VA 2BR1A 4CFMA 3V5QA 1QPJA 3H3CA 3PA3A 2C6TA 4CQEA 4N70A 2YWVA 3LZBA 5TT7A 5AIKA 4EONA 5HG7A 3A62A 3EFJA 3I1AA 4FV2A 5LCKA 4BCIA 3FYKX 4RLLA 4RRVA 4XV2A 3R6XA 4E6CA 4BCGA 4F63A 5JGDA 3TUBA 4MXXA 2BIKB 4MEDA 4ITIA 4J96A 4LOPA 5DE2A 3BYOA 4DT9A 5CSWA 3DZQA 3E7VA 4B9DA 4FSYA 4O7SA 2P4IA 2W1DA 5C1QB 2ETKA 3F5UA 3QRKA 2EB3A 4MBJA 2IZRA 2WQMA 2XNBA 4XG7A 3R7IA 3P78A 4YMJA 1GJOA 2PY3A 2WHBA 3IKAA 2CNQA 3MH2A 4KABA 2YCFA 4OTQA 2YERA 4AE9A 1OL5A 3MB7A 4E93A 5TE0A 2CNVA 4FT7A 3FUPA 2GMXA 2J4ZA 2XJ2A 2WMXA 4TWNA 4WRGA 3R9RA 1DAWA 2ITYA 3EQCA 3HV5A 4I20A 4S30A 2V22A 2ZB1A 1VR2A 2Z2WA 5DEWA 4M97A 4ANNA 3JY9A 4BCQA 2R3GA 4UMPA 4L44A 4DHFA 4EC8A 3ITZA 3Q3BA 3RAHA 2J0MB 4BDJA 4O0SA 3BHTA 5BVEA 3GU4A 4KB8A 3PJ1A 3COMA 4YUQA 2PK9A 2QKWB 1PXNA 5BYLA 4Y5QA 5EK7A 5L6PA 4QP4A 3BKBA 4KIPA 3V6RA 3ZZEA 3W2RA 4MCVA 3NUAA 4DCEA 4LYNA 3C5IA 1VEBA 2UV2A 2A19B 2OZOA 3OEZA 5HICA 3S3IA 1F5QA 4EZ3A 3FMLA 5M44A 2WTIA 1WZYA 3QKKA 4FZFB 1OM1A 4P5QA 4IWDA 3R28A 4QRCA 2R3FA 4XBUA 3ORKA 4XHKB 3PWDA 4YZMA 3H10A 4MWIA 4IW0A 5AUUA 4K1BA 2J6MA 4EKKA 4AT4A 4EOIA 2GHMA 3WZDA 4ITHA 2AUHA 2F2CB 4EHVA 4AA0A 4QTEA 2UZWE 4Q5HA 1T45A 5DH3A 3VS5A 5FTGA 4U44A 3BGQA 3EKKA 3QKLA 3RPVA 3LXKA 3QKMA 4YTIA 4AOTA 5AAGA 3TUCA 3PPKA 2UZBA 3PIYA 3KA0A 4TL0A 5CU6A 2DUVA 3LFDA 3K5UA 4HJOA 2YJRA 3NZ0A 4BI1A 4HVSA 3AT3A 2C3KA 3CGFA 2QHNA 3FLYA 3MY1A 3LM5A 3E88A 3NDMA 4BTJA 4DBXA 2B0QA 4BCHA 2FSMX 3BV2A 3L9NA 4I0RA 2Y6MA 1O6YA 3WZKA 4C59A 1CSNA 1PHKA 1Z57A 3EB0A 2R9SA 2W5HA 5HVJA 1JKLA 2I0EA 5LWMA 4EBVA 5EI6A 3ZONA 4EQUA 3R1SA 2O0UA 2BFXA 4DGGA 5BVWA 4TW9A 5DA3A 1EH4A 4XG4A 5LMAA 3ZYAA 3GQIA 3R8PA 3GXLA 1GZNA 1JKKA 3DDPA 4LRMA 1ZOGA 2X39A 3TG1A 5J1VA 4DF3A 4GK3A 3TKHA 4M69B 4FTNA 4RMZA 4D4VA 4L3PA 3AQVA 3DLZA 3QCXA 2OXXA 4R1YA 3G15A 2Y4IB 4YJPA 3M42A 2H8HA 2ITNA 4YP8A 1W7HA 3D15A 4IH8A 1FOTA 4CZYB 3EN6A 3KRXA 2C6KA 2YHVA 4WRSA 3H9FA 4J95A 5CAOA 4W9WA 2R7IA 5KUPA 4HYUA 3HMMA 2PMLX 2XNGA 3MVLA 2QU6A 3DBQA 1H07A 4JDHA 2BIYA 5K4JA 2C69A 3F7ZA 4OUCA 2ACXA 4U7ZA 1Y8GA 3G6HA 2HZNA 4R8QA 2QURA 2R3OA 5EYMA 3NEWA 3EQBA 4ZJVA 3Q2JA 1MRYA 4QMPA 3ETAA 3SX9A 3E3BX 2GDOA 4FUXA 4MD9E 4JBVA 4ASXA 4HOKA 2BRHA 4ZSGA 3DA6A 3A60A 4APCA 5CVGA 4UYNA 1JNKA 2GHLA 4QMLA 5D41A 3S4QA 5M06A 4TRLA 3DJ6A 5BVFA 4USDA 1OKYA 4FL2A 4IAAA 3UO5A 4C4IA 4XBRA 4PP7A 2QLQA 4G9CA 5M07A 4RQKA 3NYNA 2J5EA 3P08A 3VBTA 1DAYA 4JG8A 4HCUA 4QP7A 2QD9A 3LLAA 4MQ1A 3OOGA 3MWUA 1A06A 3QU0A 2OH0E 4BR3A 4F7JA 5B2LA 4WD5A 3HV4A 3ZC5A 5I3RA 2VWZA 2YIWA 5A4EA 4Z16A 5I3OA 2VWUA 3HECA 4QPSA 4X2GA 3ZLXA 1W0XC 1SMHA 4J8MA 5D7AA 2PUPA 4RPVA 2GNHA 3LMGA 4FSQA 3OTUA 3O50A 4FIFA 2NP8A 5HHWA 2QCSA 5HO6A 3ZH8A 4CG9A 3V5LA 3SOAA 4BFMA 3B2TA 4F7NA 2ZM3A 4XS2A 5C8MA 2BHHA 3FMHA 4IE9A 3QQJA 3D5UA 4I6HA 5IQHA 4AG8A 3ZFYA 1YDSE 4FZDB 5IA3A 4PL4A 3IGGA 1PMUA 4IM3A 3BE2A 3O96A 1ZYDA 4YLLA 4OTDA 5JQ8A 4V04A 4CYJA 4P2KA 2XKEA 3BU6A 4MD7E 5IEXA 4GRBA 2VV9A 4BY9E 3KB7A 4G9RA 4EC9A 1WBOA 3EFKA 4IADA 4KWPA 3QQLA 4R7BA 5E9EA 1CTPE 2PE2A 5CNOA 2GQRA 2Y4IC 1L3RE 5EI2A 4DYMA 2YISA 2IVSA 4DEBA 4A4OA 4FKVA 5M55A 3HRFA 4H3QA 3NUUA 3IQ7A 3UDBA 3VBYA 3GB2A 3ZS5A 4BDCA 3HUCA 3ZSHA 2AYPA 3G51A 2XS0A 4KIKB 4HVGA 2W4OA 4PL5A 3KF4A 5BUEA 2XZSA 4XMOA 1YOMA 4TTHB 4Y72A 4C36A 3GGFA 4QP9A 4GMYA 2W1GA 4GVAA 4YU2A 3UQFA 1WBVA 2R3RA 4ZJIA 4OTGA 1XH4A 5IA2A 3UNKA 5L2IA 3WI6A 2R5TA 4DGLC 2I0HA 4L3JA 2VO6A 2VTMA 3FQEA 2IO6A 2C4GA 5FP6A 3TIYA 3E64A 5GIPE 5DI1A 5M4CA 4PTGA 5CZIA 1UNLA 4OBPA 4TT7A 1M2PA 4FYNA 3DBCA 1VYWA 1ZMUA 4AE6A 1I09A 4BDFA 3FZSA 3TNHA 1GOLA 3ORLA 4FSWA 4WUAA 1WVYA 5HE2A 4E5BA 5CALA 4O1PA 1ZMWA 3EFWA 4IIRA 4CGAA 4LUEA 2IN6A 3VIDA 4F0GA 2PVFA 4FOCA 5EQYA 4KAOA 2IZSA 2OG8A 4RA4A 4EH4A 4ERKA 2QOBA 3FI8A 1JPAA 2PL0A 5D10A 2X7FA 5CEKA 5AX9A 2IVVA 3HP5A 3PIZA 3NR9A 3OXZA 3D0EA 4DH7A 4KSQA 2ZJWA 3KY2A 3PJCA 4RJ6A 1BYGA 4U81A 2Y4PA 5D9HA 3GT8A 2X1NA 3EN9A 3OFMA 4FIJA 4RX8A 5AUZA 3BIZA 4FIIA 3C7QA 2JITA 2XEZA 4U42A 3EIDA 3UOHA 3VRYA 3VS1A 1T46A 4AW2A 4LOOA 3VUKA 4WSYA 2V62A 3ZZWA 4EH7A 4TYHA 5CU0A 2WU6A 1NY3A 2UZEA 1U5QA 2FSTX 3U51A 2X8IA 2BTRA 4DH8A 1XBAA 4UXQA 2YCRA 4MF1A 3OC1A 5IMEA 1YXVA 4ZIMA 4AT5A 4DCAA 2YN8A 4O7VA 4FF8A 1STCE 2JEDA 4UV0A 3CD3A 3K54A 1Q41A 2B9HA 3UVRA 2ETMA 4U5JA 4Z9LA 3TV6A 4FUYA 4C2WA 3QZFA 3D94A 3MFUA 4QD6A 3OZ6A 5C01A 3HA8A 5AM6A 2YABA 4RBLA 4FTKA 3JVSA 4DGNA 1PXLA 3SVVA 5ACKA 2HZIA 4JNWA 2BAJA 2JAMA 1LUFA 3PXQA 3WF5A 4EH9A 4Y8DA 4O0WA 4DEHA 3DBDA 3EQPA 5JH6A 4DFYA 2W5BA 2CN5A 1BL7A 4EH5A 3RHKA 4AA5A 5T68A 4EJ7A 3V51A 3IOPA 5KBQA 2GNGA 5AUYA 5KX8A 2XNMA 4FTTA 4GYIA 3FZPA 4YJUA 5HVYA 5GZ8A 5FM3A 4A07A 5A46A 3LJ1A 3R8ZA 4CKJA 2PVLA 3FHIA 1P2AA 3EHAA 3QF9A 4FTOA 1KWPA 4EOKA 4XV1A 1Y6BA 4ZY5A 2E9NA 1R1WA 4FYOA 4CQGA 4DLIA 4L6QA 2Z7SA 3D2IA 3PIXA 3ZFXA 2JIUA 4DTKA 2X7GA 3PUPA 3TZ9A 5CEOA 4WNPA 3OBGA 2QO2A 3IDCA 4PDOA 5DGZA 5BQ0A 3QD4A 2XYNA 3CKWA 3GENA 3ZRMA 4BBFA 1IR3A 2WMQA 4V01A 1ZRZA 4AOJA 3FMEA 4XOYA 2YZLA 1PXJA 1Q97A 1H26A 2E2BA 3NRMA 4GT3A 1QL6A 1AQ1A 3QD0A 4IANA 1YXTA 5IZFA 1A9UA 1KV2A 3GC0A 2PE0A 3IDPA 4QMTA 3ORPA 5J9LA 2FO0A 2IVTA 3NLBA 3PRIA 4LUDA 4MNEA 3PSDA 2YA9A 5EYCA 3R9DA 4C4GA 5FXRA 1Q4LA 4XG2A 3KF7A 4BDAA 3QWJA 1UNHA 3F2NA 3UIXA 3EL7A 4O82A 2FH9A 5DRDA 3FXZA 3B8QA 4E6DA 4F7LA 2OWBA 3DS6A 3KCKA 4XYFA 3BWJA 3QTXA 3NUXA 4HGLA 4N4SA 5HCXA 2XIXA 3HLLA 5AP4A 3TXOA 4BIBA 4FKLA 4DEDA 1Q8WA 5EG3A 5CAQA 4WO5A 4CFXA 5KZ0A 5FQDC 5FDXA 3QQFA 3UIUA 4O2PA 5BMSA 4RSSA 5AJQA 4BWKA 1PMEA 4F6WA 3JPVA 2PYWA 2PVHA 4C37A 3S00A 4UB7A 1FINA 4A9UA 4E3CA 1OMWA 2JIIA 3RHXA 3OUNB 3KVWA 4ACGA 5E8YA 4PDSA 2C6IA 4AOIA 5HLPA 1SNUA 4F64A 5BVDA 2WQBA 2ZMCA 4X3FA 4C4EA 4I0TA 4FC0A 4RVMA 3LQ5A 3QLFA 4B7TA 2UW0A 4DH5A 5IU2A 2WOUA 4I5PA 3R00A 4F70A 4Z7GA 4QTDA 5FUTA 2QOIA 2ITXA 1OKVA 5I9YA 4BZDA 5IA1A 4TYIA 5H8BA 3CR0A 4OBQA 4RG0A 5CSXA 2YCSA 3RTPA 4EK8A 5EKOA 2R64A 4QMUA 5E8ZA 3AXWA 2QU5A 3QFVA 2CN8A 3BCEA 3GFEA 3PXFA 4EI4A 4XLVA 4O1OA 4GG7A 2E9PA 4Y85A 2C5OA 2HAKA 5F95A 3L8XA 3F69A 2YEXA 3DNEA 4JDJA 4ZLOA 2ZOQA 5CLPA 2E9UA 3JY0A 5HD7A 5F20A 5EKNA 4E1ZA 4FNZA 3GC8A 2A1AB 2JBOA 2I0YA 4IACA 4BN1A 5JKGA 4JRVA 2CKOA 4QQ5A 4I3ZA 4DLJA 3AOXA 4ZTQA 2P0CA 5C4KA 3KCFA 1ATPE 4FKGA 5ANDA 4AT3A 1FGKA 3TI1A 4O86A 4ENXA 3PJ2A 4L67A 4AGCA 3ACJA 4ZTSA 4GU6A 3UYTA 4K8AA 3JS2A 4E6AA 5DR2A 5J1WA 2G15A 3MPTA 2QOCA 2HY81 4JJRA 3E93A 2BVAA 3GCPA 3A61A 2X4FA 5AP0A 4GSBA 5DNRA 2XM9A 3BGZA 1O9UA 4F7SA 3PYYA 5I9WA 4QYFA 1AGWA 4BICA 2W05A 5FBOA 1TKIA 2PE1A 5FTOA 4ALUA 3DCVA 3P7BA 1YOJA 1UU9A 4IDTA 4NKAA 3HZTA 4GIIA 2NRUA 4RIYB 3O51A 5DLSA 1YXUA 3DTWA 3U87A 3ID6C 2QNJA 3ORIA 2Z02A 3VF9A 1HOWA 3PP1A 3RNYA 5HG5A 4FGRA 5J5TA 2QOLA 5LXMA 4P5ZA 4U9AA 4J7BA 1YI6A 2IVUA 2J7TA 3IPHA 4GS6A 3F6XA 5H2UA 3UODA 4O91A 5IEVA 5JQ5A 5CANA 3VULA 2GS6A 4D4SA 4QP6A 5J8IA 2GFCA 2OLCA 4FIHA 4H1MA 3KC3A 5A9UA 3DB6A 5M56A 2BRMA 3F5GA 3TIZA 3ZRKA 4NKSA 4FTAA 4IX5A 4UMQA 5L8KA 4O83A 2XNPA 5HG9A 4U3YA 3W2PA 4ASDA 4CSVA 1JSVA 2YAAA 3CGOA 5L8LA 2H34A 4PTCA 4PUZA 3R71A 3ORNA 3PXYA 1NVQA 4TWOA 5EDRA 5D7VA 5CVFA 1H4LA 4YGAA 5ANOA 4ZEGA 1KE8A 4MH7A 3VW8A 3ZBXA 4CD0A 3HGKA 2OW3A 3LPBA 3IO7A 4UMRA 1IG1A 4GK2A 2BZKB 1H00A 2C6MA 2W1HA 2X81A 3LM0A 4HCTA 4MNEB 4MXCA 1XJDA 4QP3A 3HDMA 4XG8A 4K18A 4ZSLA 3TNQB 4G3DA 3P23A 4YBJA 1Q8YA 4DG2E 4M12A 4AACA 2V7AA 4BIDA 4FI1A 3A7JA 2QKRA 5FGKA 1YHSA 1R3CA 4EBWA 4D1XA 5L2TA 3QYWA 3VBXA 2JDSA 4EHZA 4JIAA 2Y6OA 1PXKA 2WKMA 3QHRA 5LVPA 2E9OA 3CTHA 2XRWA 3ORMA 2HWOA 4FSMA 4YJNA 3TDVA 2KTYA 3MA3A 5HCZA 3TN8A 4DTBA 4YJQA 3E92A 5DRBA 4ZLYA 1B6CB 5HE1A 4E4MA 4OTRA 4CKIA 1KSWA 3U4WA 1G8SA 5EYKA 3ELJA 3KXHA 5C8NA 4E7WA 5CU3A 3GOKA 4ZY6A 2OJIA 1BKXA 5D11A 3E62A 3NYOA 4QTBA 1WBSA 4KBKA 3MYGA 3LJ0A 3WIKA 3AT4A 3KQ7A 1OITA 1H01A 3OXIA 3TNPC 4QMWA 1JQHA 1ZZ2A 3UC4A 4ACCA 5HVKA 4XCUA 3OD6X 3B2WA 3VUHA 1XKKA 4M7IA 2J9MA 2EUFB 1GAGA 2QC6A 3KKVA 3UE4A 1OIRA 1SVGA 2CMWA 2QI8A 3I7BA 3LVPA 3RKBA 4AW0A 5FWKK 3LHJA 4Y46A 4OT6A 5E91A 3T8OA 5HLWA 5GZAA 2XA4A 2J5FA 5CT7A 1P4FA 2XK8A 5CTPA 5E1SA 4YLKA 1TVOA 5HZNA 1YDTE 2HK5A 4AFJA 4CTBA 5I5ZA 2X2KA 3ZC6A 3RAKA 4F6SA 3RWQA 3UG1A 3VS6A 5CEIA 4BTFA 4K6ZA 4F08A 3MTFA 5GHVA 3RI1A 4GUEA 1U59A 4DAWA 5JFXA 4M69A 5J79A 2SRCA 4RIWB 3LLTA 2VUWA 5ANKA 3E8DA 4QQJA 4RC3A 2ZAZA 2ESMA 2Z60A 4NT4A 1U4DA 3SKCA 1JWHA 4QYEA 3G9NA 3BEAA 3SXRA 4DFNA 4WBBB 5AADA 1UKHA 1UWHA 3DZOA 3KXGA 3P86A 3VS7A 4HVHA 5AV2A 3V5WA 4N0SA 2X6EA 3RK7A 2GNJA 4E4LA 1XO2B 3KXXA 3F3ZA 3K5VA 1NXKA 4XRLA 1YI3A 3E5AA 3FKNA 2QOHA 3HMPA 2OO8X 1VZOA 4ANMA 4FV6A 4EOLA 3FKLA 3SLSA 5EM5A 3PVGA 3V04A 1M7NA 2JFLA 5F9EA 5IEYA 4MQ2A 4OTWA 2ZVAA 4PNIA 2BDJA 3R30A 4FR4A 5EYDA 2B55A 4FSUA 2IW9A 2PTKA 3EL8A 5EI8A 5J9ZA 1URCA 1Y8YA 4YURA 4PRJA 3QD3A 3LE6A 3MY0A 4XUFA 3D83A 4GT4A 1NW1A 3M2WA 2OK1A 1JVPP 4YPSA 4O7RA 4ORKA 1W8CA 4YLJA 3MH3A 4JL9A 4S31A 4CZUA 1YHWA 3BHUA 2HELA 3Q4UA 4YHFA 4FNYA 1CMKE 2JGZA 3KMWA 4J97A 4N6YA 4WT6A 3RAIA 3ZTXA 3RK9A 5CX9A 3TV7A 4CCBA 3HL7A 1BI8A 3Q9YA 3COHA 2Z7LA 1UU3A 4GL9A 3ZEWA 4U3ZA 2XNNA 5CEPA 3P0MA 2VTHA 4MD8E 1YQJA 2J0IA 4O0YA 1HCKA 2UZUE 5L2QA 3VWAA 4AZSA 3GVUA 4DG3E 3AC4A 2JFMA 2Y7JA 3ROCA 3GFWA 1GIHA 5J95A 4X3FC 2PPQA 3NCGA 4TKSA 5CVHA 3ZMMA 4DEGA 1L8TA 4C61A 3LFFA 1H1SA 2JBPA 5EFQA 3ATTA 4U6RA 4UWBA 3ZDUA 2VD5A 4PL3A 4UZHA 4EUTA 3WF8A 2QG5A 1JOWB 3KEXA 2PZRA 3N4VA 3LFEA 4GW8A 3AC5A 3UZTA 5DYJA 4BWPA 3VBVA 5H9BA 5HG8A 3CP9A 3ZOSA 2BDWA 5AWMA 3CY3A 3PLAE 4I5CA 1JLUE 2PVYA 4I23A 3O0GA 4FG8A 5AR5A 5DBXA 2C68A 3N9XA 4BCKA 1PXOA 1FQ1B 2HCKA 4C3PA 4CKRA 4YJTA 5CQWA 4K11A 2UVZA 3KN6A 4JS8A 3S95A 3PY3A 4J71A 3MIYA 3UOKA 3BLQA 2R3IA 3N4TA 3NIZA 2XKDA 4OR5A 3GUBA 4GJ2A 3DOGA 4FT3A 3DKFA 3QL8A 4NTTA 4HVIA 3EN7A 2BZIB 3H0YA 3C5UA 3D5WA 4M8TA 3Q96A 1ZOHA 2UZOA 4NTSA 5IPJA 3IS5A 4JBPA 4U43A 5GJDA 3UMWA 4A4XA 2IW6A 4RLKA 1U5RA 4ID7A 4P7EA 5EW8A 1Q8TA 3AMBA 3LW0A 4C58A 4ZZMA 4CFUA 5AA9A 4IEBA 2OJFE 4ZMEA 2NPQA 3NW6A 4KIKA 5ETCA 3N4UA 3CQWA 2VWXA 2JKMA 4LOQA 3MGYA 2W17A 4KKHA 4YJVA 4RJ3A 4ZY4A 2FSOX 4W4YA 3WF7A 4D28A 3OCTA 4YTCA 3W8QA 3ORXA 5L4QA 4L01A 4DGOA 4ZZOA 4OLIA 2W1FA 2BMCA 3CJGA 5AMNA 5BYYA 1ND4A 4ASEA 4MTAA 5KZIA 4D4YA 3BQRA 2PSQA 2RSVA 4HGEA 5KMJA 3V01A 3PSCA 4IM2A 4C62A 4RFYA 5E8VA 1LR4A 1YWVA 4J8NA 2WTKB 3DKOA 4O22A 2W9FB 2R3KA 4GCJA 3FMMA 4IC8A 4F09A 2F57A 3BYMA 3RCDA 4EOJA 3R9OA 3BEGA 4UYAA 5CEQA 4R77A 2GU8A 3JXWA 4YPDA 4FT5A 3O17A 4EKLA 5I0BA 2VTIA 4O7WA 4QMSA 3I60A 3C9WA 4GKHA 4PMTA 4EOSA 3COKA 3AT2A 5LVLA 3ZSGA 4U80A 4BB4A 1Q5KA 5IKWA 4BCPA 4OTIA 1U46A 3PVBA 3NS9A 3NX8A 4MXYA 5AEPA 4QPAA 2QOKA 4S2ZA 3A4PA 4QMYA 4ARKA 4AXAA 1RQQA 3F5XA 2CSNA 5CS6A 2JDRA 3HAMA 1H27A 2V7OA 4R5YA 4NFMA 2UUEA 3BYVA 5FXQA 3W2CA 4RFMA 3ENMA 4V0GB 4USEA 2UW7A 3MY5A 2I7QA 4C33A 2F7EE 2OZAB 3QQGA 3SRVB 4MXZA 5HX6A 3ZLYA 1WVXA 2XEYA 3EWHA 4OTFA 2WTJA 3PJ8A 3DXQA 4RWJA 2BCJA 4Z7HA 4B8MA 4Z55A 2XBAA 5BVKA 4FEVA 4EWQA 2RFSA 2YLEA 4G3CA 4KKEA 3P79A 3TCPA 1KE5A 2C3LA 3PPZA 1B38A 3D7ZA 4W8EA 5IQCA 2XM8A 3H30A 1P14A 5JMSA 1PF8A 3PA4A 3MV5A 4MXOA 3WZUA 5JFWA 2OF4A 4FL1A 3C4EA 4FIGA 4GV1A 5CY3A 4AFEA 3DT1A 4ZSEA 5HKMA 4EH2A 5IH4A 3TKIA 4F0FA 4YO6A 2QR8A 4DH3A 5HIEA 2QG7A 1JAMA 4HYHA 5FEDA 4KSPA 3RP9A 3FZOA 3I6UA 3GU5A 4MAOA 3R7OA 1REKA 5HI2A 5K5NA 2XK4A 1VYZA 2JKQA 1H1QA 4AWIA 5LMBA 1GIJA 4C4JA 2JKKA 5A54A 5HORA 4JI9A 1XBBA 3BHHA 4TYEA 2W1EA 4BCOA 4JQ8A 3R01A 4A7CA 4L3LA 3CIKA 4NM3A 3C4ZA 3CLYA 2XIYA 3QTSA 3QYZA 4PX6A 4TYGA 1CKJA 3G0FA 4CXAA 4KKGA 3V5PA 4FG7A 5L2WA 3LXLA 5KMMA 1ZMVA 3WZEA 4G5JA 5I9ZA 4FG9A 3KN5A 2OXYA 1DM2A 5TKDA 3T9TA 4F9CA 3LJ2A 2WTKC 1KOBA 2WEIA 3P4KA 5HLNA 3R04A 4E73A 2ERKA 4LV5A 4LV8A 5LCJA 2OJGA 4EH8A 2G01A 3TJDA 4G17A 4NU1A 4D5HA 4M0YA 1YHVA 4D0WA 4C57A 1Q24A 4U8ZA 5IA4A 5E8UA 3VW6A 4D5KA 3NW7A 1WBPA 4ONAA 4CVAA 3SGCA 2PUUA 1BLXA 2YIQA 4M84A 1W83A 3MFRA 2JAVA 3FMKA 3QQKA 4TNBA 4QTCA 3KRRA 4A4LA 3EQFA 2R3HA 3HRCA 2UZVA 2UW5A 1UKIA 4XV9A 4IC7A 4DFLA 5CAPA 3A8XA 3QCQA 3W32A 4MF0A 1MRUA 1XWSA 1RE8A 4XP0A 1F3MC 5IQIA 5TO8A 3K3JA 3TWJA 1IA8A 5DIAA 4D1ZA 2XCHA 3QCYA 3OCGA 3RZBA 3VF8A 2OIDA 3MH0A 4RIXB 2H96A 2OBJA 1I44A 5GIOE 3KRWA 2WMAA 4IZAA 4BVUA 2H9VA 3NYVA 4V05A 2QO7A 3RPOA 1NT2A 4JX7A 3R1YA 5IUGA 3VAPA 1OL1A 5JFVA 2O65A 5IDPA 4MNFA 3G2FA 5HBJA 1PXPA 1QCFA 3R7VA 4BKZA 2VTJA 1H28A 2HZ4A 3E8EA 3EZVA 2XYUA 3SG8A 1LP4A 1LEWA 4M67A 2G2HA 2F7XE 4MYGA 2XCKA 3SW4A 3OT8A 4YNOA 3ZXZA 3EYHA 4QYGA 2VGPA 5CF4A 4AGDA 4I1ZA 3I7CA 2QO9A 1MQBA 3GEQA 3QRUA 3D2KA 2WIHA 4C38A 3FKOA 2XKFA 4LGDA 4YC8A 2CCIA 2P2IA 4BF2A 4E4XA 3UPZA 4LQMA 3PFQA 3DAEA 3W18A 3WIGA 3UOJA 4YNEA 1IRKA 5FEQA 4B6LA 4XG3A 5M53A 4FV5A 2XKCA 3CD8A 4PPAA 1FGIA 2QOQA 5E90A 1OECA 2XK9A 3QLGA 2CNUA 1W98A 1ZYCA 5DVRA 4EOMA 3QTIA 1V1KA 2YITA 3NYXA 5IQEA 4L7SA 1WAKA 2ITOA 4WOVA 1GZOA 3HYHA 4FEXA 2A4LA 2BTSA 4D1SA 4RX7A 1NVSA 3NW5A 4NWMA 2W9ZB 3R83A 4FZ7A 3W2SA 4CZTA 2JC6A 3C13A 3QBNA 3KGAA 2X0GA 2JDVA 3IONA 3MVJA 5AR7A 3O7LD 4WUNA 2BKKA 4A9RA 3UZRA 4NSTA 1OIQA 4G3GA 3DPKA 4XJ0A 5A4LA 2NO3A 4IB0A 3V8TA 3FV8A 4O0XA 4IWPA 1J7UA 2NRYA 3UJGA 4FKWA 1OUKA 1CDKA 4FTQA 3BGPA 4LMUA 5L6WL 4BDGA 2ZYBA 4C34A 1KE7A 2LGCA 5AV1A 2RIOA 2B9FA 3DK6A 4TYJA 3ROYA 5C9CA 3JR1A 1PJKA 2J0LA 1OPKA 2YIRA 3HEGA 3VQHA 4GU9A 3QGYA 3BLRA 5E4HA 4H1JA 1SZMA 5BPYA 3FC2A 4EUUA 1Q3WA 3DGKA 3PXKA 3GQLA 3RM6A 3RPYA 3UO4A 2B9JA 4F99A 2UW3A 3FDNA 2FB8A 2GTMA 3OVVA 5HQ0A 3LQ3A 3UVQA 1LEZA 3Q60A 1MUOA 3NWWA 1BX6A 4JQ7A 2ZDUA 3EMGA 4RIYA 5KMKA 3AGLA 1M17A 4YHTA 5KMLA 3DBFA 4XOZA 4KINA 5EW9A 3W8LA 1WCCA 2JLDA 2XMYA 4ANSA 3ZBFA 4FVRA 4AZWA 3F3UA 4PMSA 2OFVA 4M66A 2GNFA 3FZTA 2VX3A 4JDIA 2V5QA 3EQIA 3MW1A 3UG2A 2EXMA 3E8NA 1YKRA 2Y9QA 3EN4A 3TZ8A 1H1RA 4JG7A 4O7ZA 1J1BA 2OGVA 1JSTA 3ULIA 2Q0NA 2WEVA 3DAJA 4X2FA 4PMPA 4O7YA 4FSTA 3BBWA 2F49A 4YC3A 3PY0A 1IAJA 2VTAA 5ANGA 3OXTA 5IUIA 4QOXA 4IJ9A 4L00A 2VNWA 3MJ2A 3OT3A 5EDQA 3VUIA 3ZO3A 3Q9WA 2YM5A 3DK7A 4BCFA 5DT4A 2PVRA 3ZM9A 3KK9A 4EK6A 5K0KA 4D9TA 2GS2A 1H08A 3QUDA 3AD6A 4J1RA 5KCVA 2A2AA 5LMKC 5AUWA 3TZMA 3NUNA 4DEAA 4EK4A 1MRVA 3EZRA 2WTCA 2YM3A 4RX5A 1CKIA 3FZRA 3ATSA 4ZSAA 5DWRA 4JAJA 5E7RA 2GSFA 5DEYA 1GZ8A 5TOZA 4FICA 1R78A 3JYAA 2VTLA 4G6OA 4GFMA 4AN3A 4D2WA 3CBLA 4O81A 5AR4A 5C27A 4UALA 2PULA 1P5EA 3FMJA 4UWYA 3VC4A 3D4QA 3RCJA 2WMTA 2XK3A 3UZPA 4TN6A 5AIRA 4IMYA 5ITAA 3LCTA 5AV3A 2X9FA 4FNWA 3IW6A 2GCDA 4TNDA 4BGHA 2BRGA 1SVEA 1E9HA 4UEUA 4OAUC 3H0ZA 4BRXA 1OPJA 2C6OA 1ERKA 2Q83A 1Q8ZA 3AC3A 3DNDA 4LGHA 4WNKA 5AP5A 4AGUA 3BYSA 4RT7A 4L8MA 4NK9A 4YZ9A 5A6NA 3H9RA 3HA6A 2PZIA 4O84A 2GFSA 4F9YA 4BBEA 2XJ1A 3SXFA 1OGUA 3F66A 4ZJJA 5H8GA 3W10A 5DT0A 4UMTA 5BYZA 3EH9A 3TT0A 3LFAA 3NGAA 4XH6A 4CFFA 3V5JA 5C26A 3QTQA 3FQSA 4W4XA 3NIEA 3C4FA 1HCLA 3Q53A 2YM6A 4DA5A 4IQ6A 4HCVA 3FC1X 3RVGA 4IFGA 5K3YA 3DFCB 2J2IB 3GU6A 3FHRA 3Q4TA 5EHYA 3WZJA 4Q9ZA 2X2MA 3OY1A 5ANIA 3UP7A 4JBOA 4IM0A 1PXIA 3FI3A 4D2PA 1PW2A 3WILA 1A48A 3MBLA 2XUUA 4U97A 4CCUA 4BHZA 2HOGA 3P9JA 1K9AA 2ITTA 2O63A 4EEVA 3LXPA 4FTIA 4WHZA 2NNWB 2HYYA 4FEUA 5BMMA 4FTRA 4RIWA 3L9MA 2CKEA 3SA0A 4QTAA 4FV9A 3CE3A 1J1CA 3O8PA 3Q9ZA 4E4NA 5FEEA 1FPUA 3IOKA 3Q32A 3SD0A 4O6LA 3T3UA 4CLJA 5IH5A 2JKOA 2WMUA 5ETAA 3UOLA 3FSKA 2C1AA 2YM4A 1SYKA 2GNIA 3DDQA 2GQGA 4EL9A 3DFAA 1V0BA 3Q6UA 1WVWA 4JX3A 3RINA 2C6EA 4L46A 4WG5A 4KIOA 1UWJA 5HE3A 4C35A 4YZCA 5GJGA 2RFDA 4NW5A 4CV9A 2O3PA 3KREA 4TWCA 1XH9A 4KBCA 4IB5A 4N6ZA 3GCQA 4OTHA 2R7BA 4CRSA 5AP7A 2O8YA 2OH4A 3C51A 4PV0A 3D5VA 4QP2A 1V0PA 3L9PA 2R3MA 4O38A 1WBWA 2WAJA 2WD1A 4FZ6A 4ZTNA 4GH2A 4BGQA 3BX5A 2W1ZA 3Q5ZA 2OI4X 4IVBA 3MTLA 1Z9XA 4BIEA 2V0DA 3ENHA 3DQWA 2C30A 3FLQA 3VUMA 4JG6A 4NUSA 5H3QA 4FEWA 4FSRA 3R7YA 1LPUA 2UZDA 4TZRA 1WMKA 2WOTA 2QQ7A 4FKOA 4IJPA 5ETIA 5AV0A 4IX4A 3O2MA 4ZS0A 3A99A 3FBVA 4IX6A 3ORZA 2VWWA 5EOLA 3DXPA 4L52A 3HV3A 4GIHA 4LMNA 3O8TA 2R3JA 3ZCLA 4W4VA 4ALWA 4I6QA 3UTOA 1GIIA 2PVKA 4D9UA 3FJQE 4E5WA 2YWPA 2EXCX 4U45A 5IQGA 1PKDA 5JEBA 2R3QA 5HNGA 1SVHA 4J52A 4BL1A 2IG7A 4EYMA 2VTNA 4DITA 4MBLA 3G33A 1PYEA 2Q0BA 3HMOA 4I93A 3OCSA 5HCYA 2F2UA 1DI9A 1OKWA 4XV3A 2BRBA 4UZDA 2BRNA 4C4HA 1E1VA 3BHVA 3EYGA 3AD5A 4OTPA 3FWQA 4RZWA 1U54B 5ANEA 3U8WA 3OTVA 4BCMA 4EWHA 5HTBA 5G6VA 4I24A 3VS0A 2VTTA 4Q9SA 3P7AA 5D1JA 2X4ZA 4XP2A 4F0IA 4C8BA 5IISA 5C4LA 1QMZA 4PQNA 4QNYA 5BX0A 3QXPA 4FTJA 5K0XA 3QAME 4YZDA 2VTSA 5E92A 3MH1A 4ZK5A 3ALOA 4D2SA 3D7TA 3F82A 3HV6A 2B7AA 4YJRA 3R0TA 4KS7A 4XEYA 1OKZA 2WMRA 3ZO2A 1W84A 3IW7A 3IW5A 2RKUA 4RJ4A 1P4OA 4CMUA 4DEIA 5HU3A 5KMOA 4NZWB 3GBZA 2VTRA 2QLUA 2WXVA 3HP2A 3ORTA 1ZWSA 4G16A 4GYGA 3OUKA 4II5A 2VO0A 3K3IA 4BKYA 3BU3A 1YRPA 4CNHA 2WB8A 4FZAB 3NNUA 4ZXTA 4NCTC 3A4OX 5EM7A 1PMNA 5CSHA 2YZAA 3HVCA 4FTMA 2ZV7A 4KIQA 2VWVA 5AAFA 2W06A 1X8BA 3I5NA 1FVTA 3LIJA 2CKPA 3PG3A 5A6OA 2PVMA 2OJ9A 4HPTE 4GG5A 2YACA 3OS3A 3I5ZA 3G5DA 4CRLA 2WELA 3QTWA 2GNLA 5LWNA 3FLNC 4B4LA 1IASA 5CF5A 3R73A 1Q61A 2PUIA 4MBIA 3WF6A 4BHNA 4RJ5A 3PZHA 5HO8A 2WO6A 4W4WA 3GOPA 4JAIA 4AAAA 4ACHA 3IW8A 3R63A 4J98A 1YOLA 2P33A 1FBNA 4A9SA 3MFTA 4GUBA 4L45A 4E6QA 3OWJA 4F9BA 2J0JA 3POOA 5AM7A 2XH5A 3R8MA 2E9VA 4QQCA 2PVNA 4AZEA 4E5AX 2LAVA 3DKGA 3TNIA 3OMVA 2CLXA 3DTCA 2BILB 3QXOA 4E26A 4IAKA 4OBOA 2ZM1A 4QYYA 3ZRLA 4WNMA 1Q3DA 3FPMA 4ACDA 3F7WA 1M7QA 5AR2A 4R3PA 4AQCA 3LOKA 4KRCA 4FOBA 3LKMA 2CLQA 4FNXA 2C6LA 2UZTA 1O6KA 2G1TA 5M4FA 3POZA 3VNTA 3GCSA 4K2RA 5K4IA 1ZY5A 4DG0E 2QONA 4HYSA 5CXHA 1IA9A 3MPMA 2YDJA 4UXLA 5JZJA 5M08A 2A0CX 3V8SA 5DR9A 3ZUUA 5DT3A 3OWPA 4UN0C 4CMOA 1QPCA 2R0IA 1DI8A 4GK4A 2HW6A 3TDWA 2C5XA 3WOWA 5CF8A 4AGWA 2C0OA 4FK3A 4NFNA 4EORA 4XNEA 1YWRA 3GI3A 4V0GA 4QO9A 2Y0AA 4I92A 5GNKA 3VS3A 5M09A 3MPAA 5B0XA 2Z7RA 5JRSA 3FXXA 4LFIA 2OZAA 1OB3A 1R0PA 3SRVA 2PU8A 1ZYSA 3VUGA 5L8JA 5A4TA 2CKQA 4G6LA 1DS5A 1OIYA 3F3WA 1H0VA 4FX3A 4P4CA 1IAHA 3UBDA 1OVEA 4O0TA 3DV3A 5LJJA 5HIBA 4BCNA 1VJYA 3G9LX 4DGMA 3KULA 2BFYA 3GC7A 4IZYA 4O96A 1J7LA 4S32A 5J7BA 3WARA 4JR7A 4G5PA 2ZB0A 1R0EA 2RL5A 2BZHB 2UW6A 2VGOA 3QRTA 4DE4A 2YFXA 4M15A 1F0QA 1K2PA 3C4XA 4F65A 3O8UA 5A4CA 5C8KA 5KE0A 3I79A 3VBWA 3VUTA 3R7GA 4WKQA 3FYJX 3FY0A 2PMOX 5F94A 4U79A 4C3RA 3VN9A 4Y5HA 4FK6A 4YZNA 5EM6A 2JIVA 4KUJA 4O6EA 3PP0A 4KBAA 2PHKA 4W8DA 5LVMA 4FMQA 5CEMA 4CFWA 2QR7A 4FV3A 4X6RA 3ZUTA 2IZUA 4FKIA 5DOSA 3VQUA 3R02A 5I9XA 4WA9A 3MDYA 4FKJA 3ZDIA 5DMZA 4JT3A 3F61A 3RAWA 3VJOA 2R3PA 4G34A 3CSVA 3NCZA 1RJBA 4QMVA 5M51A 3U6HA 3KVXA 3D7TB 3S1HA 4LM5A 5DHJA 5KHXA 3ZU7A 3DJ7A 3TNWA 5EHOA 5M57A 2UW9A 4ZP5A 3ULZA 2IPXA 5CU2A 2YJSA 1XH5A 3ERKA 4ANBA 4D4RA 3OWLA 2R4BA 4IXPA 4QP1A 3FL5A 2VTOA 4QPMA 3IK3A 1YXSA 4I0SA 2YDKA 4FV0A 4BZOA 2XK7A 4EJNA 4R7HA 4NIFA 1PMVA 4FT9A 4YJSA 3TZ7A 5H8EA 5LOHA 4MK0A 1OBDA 4XP3A 3QTZA 4EHEA 4JXFA 4RVKA 4B8LA 1J91A 4ERWA 5KO1A 3NMUF 4AZFA 1JBPE 1UU7A 1YI4A 3M11A 1H1WA 4I22A 4AF3A 1PRYA 3R8LA 4C3FA 2F7ZE 4H58A 4RIXA 3NPCA 3KFAA 3PJ3A 2WGJA 4FKTA 4YZBA 4DT8A 4FKRA 2GS7A 3NNXA 5E8SA 5ACBC 3A8WA 4PWNA 4FKPA 3VHEA 3O71A 1AD5A 4GJ3A 3MS9A 3I4BA 5TF9A 4NYEA 1KE9A 5CSVA 4RA5A 4CFNA 2ONLC 4KD1A 1J3HA 4EZ7A 1GNGA 2ITUA 3WF9A 5AR8A 5B2KA 3SV0A 4APPA 4YBKA 2OXDA 2KULA 4FV8A 4O2ZA 5GJFA 1S9JA 5HGIA 2R3NA 3F9NA 1ZXEA 3RBWA 4D2VA 4UX9A 3MB6A 4QMOA 2RFEA 2WTDA 3CXWA 5HNIX 3F2AA 4W9XA 2O5KA 1PXMA 2W1IA 3AC8A 3SC1A 3OHTA 3PXRA 3UMXA 3BU5A 5K9IA 4G3FA 4JR3A 3IDBA 2XIRA 1XH6A 3PE2A 4OT5A 4F6UA 3QCSA 4HGSA 4JVGA 5F4NA 4USFA 5IQDA 5A14A 4AP7A 2GQSA 3KXNA 3F3VA 5LMKA 4X0MA 3M1SA 4PNKA 3DKCA 3S2PA 2XP2A 5JGBA 2OJJA 4M68A 4CYIA 3ANRA 4FKQA 5ICPA 1MQ4A 4JDKA 5FDPA 5K5XA 2RG5A 4O7LA 3LMIA 2WZJA 4HGTA 4O27B 4IVDA 4RWLA 2VO7A 3UP2A 5FTQA 4YO4A 3E63A 4UMUA 3FE3A 4B99A 4CLIA 3C0IA 3EQDA 3MVHA 2OF2A 3PE1A 5EDPA 5HTIA 3MSSA 2CPKE 4AU8A 3QX4A 5LARA 4P90A 4RWIA 3NAYA 4X2JA 1UU8A 5CI6A 5LVOA 4BZNA 3QUEA 4R5SA 5CSPA 3UNJA 3HX4A 1ZY4A 3SG9A 4EOOA 3Q4ZA 1JKSA 3OW4A 2W1CA 4JQEA 3KULB 4WBOA 5EOBA 3QTRA 3FMDA 2VN9A 4FTUA 4UBAA 1XH8A 5BUJA 2G2IA 2FYSA 4QMMA 5L3AA 3UQGA 4WG3A 3TTJA 4ANOA 3CQUA 3DJ5A 4ENYA 3ZSIA 3CJFA 2PMIA 4F9WA 2C6DA 5AUTA 4PDYA 2I0VA 1O6LA 2C5VA 5AUXA 5CI7A 1KV1A 2WU7A 3UYSA 3DK3A 1H8FA 3FLSA 2UW8A 4S33A 5D12A 4BDKA 3GU8A 3PVWA 4HNFA 3R8UA 3A7GA 5EQEA 4BDDA 2WMSA 2O64A 4FBXA 2ITQA 3OOMA 5HESA 4C02A 1MP8A 1REJA 2ZV9A 4PY1A 4PP9A 3A7FA 3P7CA 4U41A 5JN2A 2PMNX 4NJDA 3QA0A 2IZTA 5HD4A 5J87A 4I41A 4AW5A 3QWKA 3Q5IA 4WSQA 5AP6A 1S9IA 4YC6A 3VHKA 4LL5A 3LFCA 4IB1A 2HENA 1PKGA 3OG7A 3WE4A 4A06A 3DQXA 2JD5A 3DB8A 4CTCA 5L2SA 4MWHA 1YW2A 3L1SA 5ETFA 1E1XA 5CXZA 5GINE 3Q04A 2CGWA 2QODA 4EQMA 2DYLA 3TACA 3TJCA 4R78A 3ZM4A 4F9AA 5J7HA 4LRJA 2RFNA 3C4WA 4N57A 4ZS4A 3L9LA 2YIXA 5HOAA 1SNXA 1YXXA 2B52A 2HXQA 4ZOGA 5AFVA 3CTJA 2XVDA 2BALA 4YTFA 3NVKI 3BV3A 2ITVA 1OL2A 3KRJA 3LCOA 3CCNA 3QA8A 4NM7A 2CGXA 5E8TA 3G6GA 2BHEA 5CNNA 5A3XA 4A9YA 4NIFB 4RGJA 1BL6A 5KKRB 1ZAOA 3CPCA 4M3QA 4C0TA 3PPJA 4CEGA 2F9GA 4ZMFA 5L6OA 3BI6A 4A9TA 4G2FA 3WYYA 3QC9A 1KOAA 4I6BA 4IZ5A 3TV4A 5IG1A 3I6WA 1NA7A 2UZNA 3E7OA 3PSBA 2VRXA 4G1WA 3RK5A 3W2QA 3R7EA 4E20A 1B39A 3U55A 1M2QA 2HXLA 3KK8A 4BDBA 4JRNA 4NW6A 5CU4A 5HNBA 3RWPA 3VS2A 4AZVA 4BDIA 2C0TA 4YSJA 3IECA 4O7NA 2FUMA 4IVCA 4AN2A 2HY0A 3KRLA 2QVSE 3C1XA 2R0UA 3E3PA 2XNOA 1ZYJA 4IWQA 4XX9A 4GFGA 5CF6A 3PA5A 2WPAA 2BKZA 2W99B 3LCSA 5CWZA 3WYXA 4ACMA 4FVQA 5HBHA 3AMYA 4EH3A 4R7IA 2XIZA 4RZVA 2CHLA 5HBEA 4ZTMA 1Y91A 3U9NA 3FQHA 2WTWA 4GT5A 5KHWA 4JLCA 4PTEA 2WMVA 4WG4A 3R2BA 4FTCA 3TUDA 3NVMB 2JDTA 2VWIA 3C4CA 4XLIA 5EHLA 2ZM4A 3BRBA 3Q2MA 5J9YA 3LMHA 3LFNA 3CC6A 2RG6A 3MIAA 5AR3A 3VJNA 4AA4A 3W16A 3UO6A 2YDIA 4DINA 3SQQA 3FZ1A 4MHAA 1G3NA 3FL4A 5M4IA 1Z5MA 2WQOA 5A4QA 1GZKA 1V0OA 2OSCA 3R1QA 4X7QA 3T3VA 1URWA 3MJ1A 3AC1A 4IAFA 5I9UA 4FVPA 3UIBA 3QGWA 2XNEA 3CKXA 3NAXA 4QQTA 3ZHPC 4KA3A 3SHEA 5I4NA 1G8AA 4UY9A 1ZYLA 3AMAA 3NNVA 3GP0A 5HTCA 5GZ9A 5IA0A 4QMXA 4ASZA 4F1OA 5IMXA 3V8WA 5HU9A 4LG4A 2PWLA 2XB7A 4F1TA 3ZUVA 5M4UA 3CY2A 4HPUE 4AUAA 3ET7A 3IGOA 4RWKA 3UQCA 4NCTA 4OW8A 5G1XA 5T6KA 3R2YA 4Y73A 3KU2A 3LFBA 4YSMA 3QHWA 3W1FA 5EQPA 3AG9A 3KL8A 3LCKA 3BWFA 3QQUA 5IA5A 2CJMA 3L8VA 4DFXE 4GVJA 4TXCA 4M14A 3IG7A 4WNOA 4UWCA 3H4JA 3QD2B 3ZEPA 1PYXA 1Q8UA 2WMWA 3LCDA 4HNIA 2J90A 4KNBA 2Z8CA 4NH1A 4X6QC 3FY2A 3L8SA 2C5YA 3FMNA 5FRIA 4FA2A 3DXNA 3ODYX 1H1PA 4DFUA 1ZLTA 4DC2A 4NEUA 4RJ7A 2ZV8A 5CAUA 5KKRC 4HW7A 3PG1A 4OGRA 3OW3A 4CT2A 2VWYA 3TEIA 1M52A 2YM7A 2O2UA 2X9EA 4PF4A 3I0OA 1YVJA 3U4UA 5AP2A 3OEFX 2W4JA 4Y83A 3OP5A 2XK6A 3MI9A 4IDVA 1H0WA 3KMUA 2FVDA 2ITZA 3CEKA 4L68A 4M0ZA 4IVAA 4IWOA 3HNGA 3OWKA 4L9IA 3ALNA 2YCQA 1YDRE 3FSFA 2QOFA 2R2PA 3DBEA 4EHGA 1OL7A 3RPRA 2J0KA 2IWIA 3FLWA 4IAIA 4QT1A 3VRZA 3ZFMA 4ANQA 1ZARA 4D0XA 1WBTA 3BQCA 3FAAA 3QZHA 4FL3A 4FT0A 5IF1A 4I4EA 1UVRA 4Y95A 5DR6A 2Y8OA 2C3JA 4R3CA 1UV5A 3FLZA 2GPHA 3II5A 5CZHA 4ZZNA 1QPDA 3RMFA 3NUYA 5FD2A 3F2RA 1NVRA 1H24A 4NL0A 3NSZA 3EOCA 2W4KA 4GEOA 3K2LA 4IHPA 3P5KA 4EOQA 4KS8A 4BTMA 5CASA 5HX8A 4FTLA 4CFVA 2F4JA 2G2FA 3AD4A 4RQVA 2WQEA 3LFQA 3Q4CA 1U54A 3C0HA 4L43A 2J51A
chains in the Genus database with same CATH superfamily
4Q2AA 3G90X 3E87A 4YJOA 3R9NA 4GKIA 4S34A 3VBQA 1Q62A 3A2CA 4YTHA 4FSNA 5CT0A 4BDEA 3SW7A 4FGBA 4DFZE 1TQIA 1FMOE 3PWYA 2CGUA 4QMZA 3MESA 1M14A 3PY1A 3KMMA 4I6FA 2FGIA 4H36A 4O0UA 4B0GA 5LQFA 1OBGA 2ZMDA 3PDTA 2C1BA 3BELA 2Z7QA 2EWAA 3W33A 2VX0A 3EQGA 3U54A 5J5SA 4G31A 4U0IA 3MFSA 1BUHA 4X3JA 3UVPA 4CMTA 3RJCA 3P1AA 5IUHA 2DQ7X 3HV7A 4LRKA 3IW4A 4QP8A 2ERZE 4E8AA 4AW1A 4IB3A 1TQPA 4EYJA 3RPSA 5IQBA 4PMMA 2XF0A 2J50A 5JSMA 2BAQA 1TQMA 5DN3A 3UC3A 4D2TA 1SM2A 3HRBA 5FBNC 4DTAA 3COIA 3FXWA 1FVVA 2DS1A 3L8PA 4JOAA 2C47A 2ZV2A 5F1ZA 1YWNA 2GHGA 4IAYA 4EK3A 5FXSA 3QALE 2OKRA 5IQAA 3R22A 1FMKA 3G0EA 1XQZA 2YM8A 3BE9A 3OBJA 4DN5A 3TTIA 5TR6A 2RF9A 2BROA 1BI7A 3REPA 2XBJA 3FPQA 4LL0A 3KXZA 3JVRA 3V3VA 3VUDA 4XRJA 5JFSA 2CDZA 3ODZX 2PZ5A 3H9OA 4QNAA 3CS9A 2VTQA 3PRFA 3BHYA 3RZFA 2UW4A 3EFLA 3C0GA 3F3TA 2REIA 3D14A 3LXNA 3PVUA 4NM0A 3W55A 3ZXTA 4AN9A 3NUSA 4L53A 4O21A 4AS0A 4QYHA 3EKNA 4JBQA 4RVLA 2C5NA 3NNWA 2W5AA 3O23A 4IAZA 5JT2A 1KUTA 3I0QA 5CQUA 4L42A 3QRIA 4I5MA 4YR8A 1OZ1A 1BMKA 3OCBA 5FLFA 5HE0A 2EXEA 3R7UA 3CQEA 4ZAUA 2VZ6A 4FKUA 3BBTB 2B9IA 5HO7A 2P55A 3SAYA 3ACKA 5JRQA 2PZYA 3A7IA 2XRUA 2VO3A 1UNGA 2XIKA 3U6JA 4FV1A 2W96B 1CKPA 3BPRA 2I6LA 4EQCA 4DH1A 3B8RA 4TYHB 4IFCA 3WE8A 3V5TA 3DY7A 4MVFA 4HVDA 2BPMA 2W0JA 4PDPA 4MKCA 4TWPA 3GCUA 4FIEA 5HEZA 5AX3A 5KMIA 2WIPA 3FI2A 5E8XA 4QMQA 5LVNA 4H3BA 4BCJA 1KE6A 3Q52A 1XHAA 1R39A 3RM7A 1JSUA 2ONLA 1RDQE 4Q5EA 4BGGA 4KRDA 2PVJA 4I4FA 4ZTHA 4BTKA 1OPLA 4HZSA 5BVOA 4O0RA 3ZLSA 2AQXA 4C7TA 4XG6A 4QMNA 3EQHA 4PPBA 4EH6A 3I81A 3LFSA 3AC2A 4TY1A 4YHJA 3EN5A 3V6SA 4EZ5A 3BZ3A 2JDOA 2OIBA 3CPBA 4LI5A 1XBCA 2GTNA 3F88A 5DPVA 3UIMA 3VVHA 4J99A 2EU9A 3VS4A 3NUPA 4ZTRA 1M2RA 2VTPA 3BLHA 3W0PA 3RGFA 5AP3A 5I9VA 4OAVB 3PXZA 3CTQA 3LAUA 4HZRA 2CCHA 4RIOA 4FV4A 4D58A 4EOPA 4M13A 4IBMA 4CV8A 2WMBA 1PY5A 3DAKA 1ZOEA 4G3EA 4G6NA 2AC5A 3OROA 1ZZLA 3EJ1A 4RC2A 3R1NA 3QTUA 5CYIA 4PPCA 4AZTA 4DBNA 4ZSJA 2UVYA 1JKTA 4F4PA 3UGCA 2CGVA 4FEQA 2WFYA 5DFPA 1QPEA 2P2HA 5EM8A 1APME 2VU3A 5FP5A 2B53A 3SXSA 2FA2A 2RGPA 3QRJA 4C2VA 4X21A 4XG9A 3DU8A 3R9HA 4H05A 2X7OA 3D9VA 3JUHA 2V55A 3OY3A 3QZGA 4K77A 4MX9A 5JGAA 3UPXA 3S0OA 4NM5A 3MA6A 3ZO4A 3U6IA 2WQNA 1IEPA 5B2MA 5KBRA 4X2KA 2OU7A 4JIKA 2BUJA 2W7XA 4LGGA 4BYIA 4H3PA 4RX9A 2ITPA 4K33A 4O0VA 3QZIA 4F1MA 3A7HA 3RALA 3HKOA 3GCVA 4ITJA 3ANQA 4FODA 4NJ3A 4BDHA 3PZEA 5FG8A 3Q9XA 2HW7A 2R3LA 3GNIB 4BWXA 3PLSA 5C03A 4TPTA 3VO3A 4ZLZA 3TKUA 3EQRA 4L7FA 2IW8A 2YLFA 3MN3A 5KMNA 3SDJA 4BI2A 1G5SA 3SOCA 3WBLA 2OFUA 4I5HA 4C4FA 4RFZA 3O7LB 1RW8A 1Y6AA 3HMNA 2AC3A 4K9YA 2OICA 3GC9A 2OIQA 5JK3A 3N51A 4IZ7A 2VNYA 3THBA 2PUNA 4X2NA 2HZ0A 4MXAA 2PZPA 4QDEA 5CAVA 4EK5A 4O7TA 3UNZA 3D5XA 3E8CA 5BUIA 4R1VA 4R3RA 5ANJA 3W2OA 3U9CA 2EVAA 4ZTLA 4FSZA 5B7VA 3KXMA 2WNTA 5FM2A 5AAEA 1WBNA 2I1MA 5T3QA 2X8DA 4D2RA 1J7IA 3T9IA 3ZO1A 1FVRA 5BVNA 1OIUA 4FE2A 2I40A 4X3FB 4GFOA 2G9XA 2X8EA 4FJVA 3QUPA 4Z3VA 2ZDTA 2UVXA 1K3AA 2HWPA 3BYUA 3FI4A 4FKSA 4FV7A 4IX3A 1W82A 4R6VA 5HIDA 5AA8A 5AV4A 4U40A 3RNIA 4I94A 3ZLWA 4DEEA 3GU7A 3HDNA 3HMIA 5JZNA 1WFCA 3QQHA 3MVMA 3TM0A 2EB2A 4I21A 2A27A 2P3GX 4CT1A 1UA2A 2QHMA 2B54A 1OL6A 4BC6A 1XR1A 3QC4A 3HAVA 2ETRA 2YAKA 3TL8A 1H25A 4K0YA 5AP1A 3DLSA 4CG8A 4RJ8A 2B4SB 3F5PA 2FSLX 2HIWA 3Q6WA 2UZLA 5EW3A 2B1PA 3W0MA 5EH0A 4BI0A 2C0IA 2XJ0A 2VAGA 1XH7A 2X6DA 3HUBA 4DFBA 1OUYA 4J53A 3OF0A 4RVTA 2ITWA 5IQFA 4BBMA 1CM8A 2X2LA 1Q99A 5KNJA 5CENA 2WTVA 4ANLA 3C50A 5E1EA 4WIHA 4RC4A 5IH6A 3FEGA 4D55A 2YIYA 5DG5A 4BYJA 3QX2A 1GY3A 5BNJA 2QOOA 5AUVA 2DWBA 1Y57A 3LQ8A 3R21A 4BKJA 4HYIA 5IDNA 2BAKA 2IJMA 2H6DA 2C3IB 2VWBA 2BDFA 3AGMA 4ALVA 1OI9A 3PTGA 5E8WA 4H39A 2VX1A 2BZJA 4AX8A 3R8VA 2BR1A 4CFMA 3V5QA 1QPJA 3H3CA 3PA3A 2C6TA 4CQEA 4N70A 2YWVA 3LZBA 5TT7A 5AIKA 4EONA 5HG7A 3A62A 3EFJA 3I1AA 4FV2A 5LCKA 4BCIA 3FYKX 4RLLA 4RRVA 4XV2A 3R6XA 4E6CA 4BCGA 4F63A 5JGDA 3TUBA 4MXXA 2BIKB 4MEDA 4ITIA 4J96A 4LOPA 5DE2A 3BYOA 4DT9A 5CSWA 3DZQA 3E7VA 4B9DA 4FSYA 4O7SA 2P4IA 2W1DA 5C1QB 2X0PA 2ETKA 3F5UA 3QRKA 2EB3A 4MBJA 2IZRA 2WQMA 2XNBA 4XG7A 3R7IA 3P78A 4YMJA 3UDZA 1GJOA 2PY3A 2WHBA 3IKAA 2CNQA 3MH2A 4KABA 2YCFA 4OTQA 2YERA 4AE9A 1OL5A 3MB7A 4E93A 5TE0A 2CNVA 4FT7A 3FUPA 2GMXA 2J4ZA 2XJ2A 2WMXA 4TWNA 4WRGA 2XAOA 3PFYA 3R9RA 1DAWA 2ITYA 3EQCA 3HV5A 4I20A 4S30A 2V22A 2ZB1A 1VR2A 2Z2WA 5DEWA 4M97A 4ANNA 3JY9A 4BCQA 2R3GA 4UMPA 4L44A 4DHFA 4EC8A 3ITZA 3Q3BA 3RAHA 2J0MB 4BDJA 4O0SA 3BHTA 5BVEA 3GU4A 4KB8A 3PJ1A 3COMA 4YUQA 2PK9A 2QKWB 1PXNA 5BYLA 4Y5QA 5EK7A 5L6PA 4QP4A 3BKBA 4KIPA 3V6RA 3ZZEA 3AKJA 3W2RA 4MCVA 3NUAA 4DCEA 4LYNA 3C5IA 1VEBA 2UV2A 2A19B 2OZOA 3OEZA 5HICA 3S3IA 1F5QA 4EZ3A 3FMLA 5M44A 1W2CA 2WTIA 1WZYA 3QKKA 4FZFB 1OM1A 4P5QA 4IWDA 3R28A 4QRCA 2R3FA 4XBUA 3ORKA 4XHKB 3PWDA 4YZMA 3H10A 4MWIA 4IW0A 5AUUA 4K1BA 2J6MA 4EKKA 4AT4A 4EOIA 2GHMA 3WZDA 4ITHA 2AUHA 2F2CB 4EHVA 4AA0A 4QTEA 2UZWE 4Q5HA 1T45A 5DH3A 3VS5A 5FTGA 4U44A 3BGQA 3EKKA 3QKLA 3RPVA 3LXKA 3QKMA 4YTIA 4AOTA 5AAGA 3TUCA 3PPKA 2UZBA 3PIYA 3KA0A 4TL0A 5CU6A 2DUVA 3LFDA 3K5UA 4HJOA 2YJRA 3NZ0A 4BI1A 4HVSA 3AT3A 2C3KA 3CGFA 2QHNA 3FLYA 3MY1A 3LM5A 3E88A 3NDMA 4BTJA 4DBXA 2B0QA 4BCHA 2FSMX 3BV2A 3L9NA 4I0RA 2Y6MA 1O6YA 3WZKA 4C59A 1CSNA 1PHKA 1Z57A 3EB0A 2R9SA 2W5HA 5HVJA 1JKLA 2I0EA 5LWMA 4EBVA 5EI6A 3ZONA 4EQUA 3R1SA 2O0UA 2BFXA 4DGGA 5BVWA 4TW9A 5DA3A 1EH4A 4XG4A 5LMAA 3ZYAA 2IF8A 3GQIA 3GXLA 1GZNA 1JKKA 3R8PA 3DDPA 4LRMA 1ZOGA 2X39A 3TG1A 1OGYA 5J1VA 4DF3A 4GK3A 3TKHA 4M69B 4FTNA 4RMZA 4D4VA 4L3PA 3AQVA 3DLZA 3QCXA 2OXXA 4R1YA 3G15A 2Y4IB 4YJPA 3M42A 2H8HA 2ITNA 4YP8A 1W7HA 3D15A 4IH8A 1FOTA 4CZYB 3EN6A 3KRXA 2C6KA 2YHVA 4WRSA 3H9FA 4J95A 5CAOA 4W9WA 2R7IA 5KUPA 4HYUA 3HMMA 2PMLX 2X0QA 2XNGA 3MVLA 2QU6A 3DBQA 1H07A 4JDHA 2BIYA 5K4JA 2C69A 3F7ZA 4OUCA 2ACXA 4U7ZA 1Y8GA 3G6HA 2HZNA 4R8QA 2QURA 2R3OA 5EYMA 3NEWA 3EQBA 4ZJVA 3Q2JA 1MRYA 4QMPA 3ETAA 3SX9A 3E3BX 2GDOA 4FUXA 4MD9E 4JBVA 4ASXA 4HOKA 2BRHA 4ZSGA 3DA6A 3A60A 4APCA 5CVGA 4UYNA 1JNKA 2GHLA 4QMLA 5D41A 3S4QA 5M06A 4TRLA 3DJ6A 5BVFA 4USDA 1OKYA 4FL2A 4IAAA 3UO5A 4C4IA 4XBRA 4PP7A 2QLQA 4G9CA 5M07A 4RQKA 3NYNA 2J5EA 3P08A 3VBTA 1DAYA 4JG8A 4AQKA 4HCUA 4QP7A 2QD9A 3LLAA 4MQ1A 3OOGA 3MWUA 1A06A 3QU0A 2OH0E 4BR3A 4F7JA 5B2LA 4WD5A 3HV4A 3ZC5A 5I3RA 2VWZA 2YIWA 5A4EA 4Z16A 5I3OA 2VWUA 3HECA 4QPSA 4X2GA 3ZLXA 1W0XC 1SMHA 4J8MA 5D7AA 2PUPA 4RPVA 2GNHA 3LMGA 4FSQA 3OTUA 3O50A 4FIFA 2NP8A 5HHWA 2QCSA 5HO6A 3ZH8A 4CG9A 3V5LA 3SOAA 4BFMA 3B2TA 4F7NA 2ZM3A 4XS2A 5C8MA 2BHHA 3FMHA 4IE9A 3QQJA 3D5UA 4I6HA 5IQHA 4AG8A 3ZFYA 1YDSE 4FZDB 5IA3A 4PL4A 3IGGA 1PMUA 4IM3A 2IEWA 3BE2A 3O96A 1ZYDA 4YLLA 4OTDA 5JQ8A 4V04A 4CYJA 4P2KA 2XKEA 3BU6A 4MD7E 5IEXA 4GRBA 2VV9A 4BY9E 3KB7A 4G9RA 4EC9A 1WBOA 3EFKA 4IADA 4KWPA 3QQLA 4R7BA 5E9EA 1CTPE 2PE2A 5CNOA 2GQRA 2Y4IC 1L3RE 5EI2A 4DYMA 2YISA 2IVSA 4DEBA 4A4OA 4FKVA 5M55A 3HRFA 4H3QA 3NUUA 3IQ7A 3UDBA 3VBYA 3GB2A 3ZS5A 4BDCA 3HUCA 3ZSHA 2AYPA 3G51A 2XS0A 4KIKB 4HVGA 2W4OA 4PL5A 3KF4A 5BUEA 2XZSA 4XMOA 1YOMA 4TTHB 4Y72A 4C36A 3GGFA 4QP9A 4GMYA 2W1GA 4GVAA 4YU2A 3UQFA 1WBVA 2R3RA 4ZJIA 4OTGA 1XH4A 5IA2A 3UNKA 5L2IA 3WI6A 2R5TA 4DGLC 2I0HA 4L3JA 2VO6A 2VTMA 3FQEA 2IO6A 2C4GA 5FP6A 3TIYA 3E64A 5GIPE 5DI1A 5M4CA 4PTGA 5CZIA 1UNLA 4OBPA 4TT7A 1M2PA 4FYNA 3DBCA 1VYWA 1ZMUA 4AE6A 1I09A 4BDFA 3FZSA 3TNHA 1GOLA 3ORLA 4FSWA 4WUAA 1WVYA 5HE2A 4E5BA 5CALA 4O1PA 1ZMWA 4O4EA 3EFWA 4IIRA 4CGAA 4LUEA 2IN6A 3VIDA 4F0GA 2PVFA 4FOCA 5EQYA 4KAOA 2IZSA 2OG8A 4RA4A 4EH4A 4ERKA 2QOBA 3FI8A 1JPAA 2PL0A 5D10A 2X7FA 5CEKA 5AX9A 2IVVA 3HP5A 3PIZA 3NR9A 3OXZA 3D0EA 4DH7A 4KSQA 2ZJWA 3KY2A 3PJCA 4RJ6A 1BYGA 4U81A 2Y4PA 5D9HA 3GT8A 2X1NA 3EN9A 3OFMA 4FIJA 4RX8A 5AUZA 3VONA 3BIZA 4FIIA 3C7QA 2JITA 2XEZA 4U42A 3EIDA 3UOHA 3VRYA 3VS1A 1T46A 4AW2A 4LOOA 3VUKA 4WSYA 2V62A 3ZZWA 4EH7A 4TYHA 5CU0A 3UDSA 2WU6A 1NY3A 2UZEA 1U5QA 2FSTX 3U51A 2X8IA 2BTRA 4DH8A 1XBAA 4UXQA 2YCRA 4MF1A 3OC1A 5IMEA 1YXVA 4ZIMA 4AT5A 4DCAA 2YN8A 4O7VA 4FF8A 1STCE 2JEDA 4UV0A 3CD3A 3K54A 1Q41A 2B9HA 3UVRA 2ETMA 4U5JA 4Z9LA 3TV6A 4FUYA 4C2WA 3QZFA 3D94A 3MFUA 4QD6A 3OZ6A 5C01A 3HA8A 5AM6A 2YABA 4RBLA 4FTKA 3JVSA 4DGNA 1PXLA 3SVVA 5ACKA 1XMLA 2HZIA 4JNWA 2BAJA 2JAMA 1LUFA 3PXQA 3WF5A 4EH9A 4Y8DA 4O0WA 4DEHA 3DBDA 3EQPA 5JH6A 4DFYA 2W5BA 2CN5A 1BL7A 4EH5A 3RHKA 4AA5A 5T68A 2XANA 4EJ7A 3V51A 3IOPA 5KBQA 2GNGA 5AUYA 5KX8A 3NFFB 2XNMA 4FTTA 4GYIA 3FZPA 4YJUA 5HVYA 5GZ8A 5FM3A 4A07A 5A46A 3LJ1A 3R8ZA 4CKJA 2PVLA 3FHIA 1P2AA 3EHAA 3QF9A 4FTOA 1KWPA 4EOKA 5BV3A 4XV1A 1Y6BA 4ZY5A 2E9NA 1R1WA 4FYOA 4CQGA 4DLIA 4L6QA 2Z7SA 3D2IA 3PIXA 3ZFXA 2JIUA 4DTKA 2X7GA 3PUPA 3TZ9A 5CEOA 4WNPA 3OBGA 2QO2A 3IDCA 4PDOA 5DGZA 5BQ0A 3QD4A 2XYNA 3CKWA 3GENA 3ZRMA 4BBFA 1IR3A 2WMQA 4V01A 1ZRZA 4AOJA 3FMEA 4XOYA 2YZLA 1PXJA 1Q97A 2XAMA 1H26A 2E2BA 3NRMA 4GT3A 1QL6A 1AQ1A 3QD0A 4IANA 1YXTA 5IZFA 1A9UA 1KV2A 3GC0A 2PE0A 3IDPA 4QMTA 3ORPA 5J9LA 2FO0A 2IVTA 3NLBA 3PRIA 4LUDA 4MNEA 3PSDA 2YA9A 5EYCA 3R9DA 4C4GA 5FXRA 1Q4LA 4XG2A 3KF7A 4BDAA 3QWJA 1UNHA 3F2NA 3UIXA 3EL7A 4O82A 2FH9A 5DRDA 3FXZA 3B8QA 4E6DA 4F7LA 2OWBA 3DS6A 3KCKA 4XYFA 3BWJA 3QTXA 3NUXA 4HGLA 4N4SA 5HCXA 2XIXA 3HLLA 5AP4A 3TXOA 4BIBA 4FKLA 4DEDA 1Q8WA 5EG3A 5CAQA 4WO5A 4CFXA 5KZ0A 5FQDC 5FDXA 3QQFA 3UIUA 4O2PA 5BMSA 4RSSA 5AJQA 4BWKA 1PMEA 4F6WA 3JPVA 2PYWA 2PVHA 4C37A 3S00A 4UB7A 1FINA 4A9UA 4E3CA 1OMWA 2JIIA 3RHXA 3OUNB 3KVWA 4ACGA 5E8YA 4PDSA 2C6IA 4AOIA 5HLPA 1SNUA 4F64A 5BVDA 2WQBA 2ZMCA 4X3FA 4C4EA 4I0TA 4FC0A 4RVMA 3LQ5A 3QLFA 4B7TA 2UW0A 4DH5A 5IU2A 2WOUA 4I5PA 3R00A 4F70A 4Z7GA 4QTDA 5FUTA 2QOIA 2ITXA 1OKVA 5I9YA 4BZDA 5IA1A 4TYIA 5H8BA 3CR0A 4OBQA 4RG0A 5CSXA 2YCSA 3RTPA 4EK8A 5EKOA 4MUQA 2R64A 4QMUA 5E8ZA 3AXWA 2QU5A 3QFVA 2CN8A 3BCEA 3GFEA 3PXFA 4EI4A 4XLVA 4O1OA 4GG7A 2E9PA 4Y85A 2C5OA 2HAKA 5F95A 3L8XA 3F69A 3W0RA 2YEXA 3DNEA 4JDJA 4ZLOA 2ZOQA 5CLPA 2E9UA 3JY0A 5HD7A 5F20A 5EKNA 4E1ZA 4FNZA 3GC8A 2A1AB 2JBOA 2I0YA 4IACA 4BN1A 5JKGA 4JRVA 2CKOA 4QQ5A 4AAYA 4I3ZA 4DLJA 3AOXA 4ZTQA 2P0CA 5C4KA 3KCFA 1ATPE 4FKGA 5ANDA 4AT3A 1FGKA 3TI1A 4O86A 4ENXA 3PJ2A 4L67A 4AGCA 3ACJA 4ZTSA 4GU6A 3UYTA 4K8AA 3JS2A 4E6AA 5DR2A 5J1WA 2G15A 3MPTA 2QOCA 2HY81 4JJRA 3E93A 2BVAA 3GCPA 3A61A 2X4FA 5AP0A 4GSBA 5DNRA 2XM9A 3BGZA 1O9UA 4F7SA 3PYYA 5I9WA 4QYFA 1AGWA 4BICA 2W05A 5FBOA 1TKIA 2PE1A 5FTOA 4ALUA 3DCVA 3P7BA 1YOJA 1UU9A 4IDTA 4NKAA 3HZTA 4GIIA 2NRUA 4RIYB 3O51A 5DLSA 1YXUA 3DTWA 3U87A 3ID6C 2QNJA 3ORIA 2Z02A 3VF9A 1HOWA 3PP1A 3RNYA 5HG5A 4FGRA 5J5TA 2QOLA 5LXMA 4P5ZA 4U9AA 4J7BA 1YI6A 2IVUA 2J7TA 3IPHA 4GS6A 3F6XA 5H2UA 3UODA 4O91A 4DHZA 5IEVA 5JQ5A 5CANA 3VULA 2GS6A 4D4SA 4QP6A 5J8IA 2GFCA 2OLCA 4FIHA 4H1MA 3KC3A 5A9UA 3DB6A 5M56A 2BRMA 3F5GA 3TIZA 3ZRKA 4NKSA 4FTAA 4IX5A 4UMQA 5L8KA 4O83A 2XNPA 5HG9A 4U3YA 3W2PA 4ASDA 4CSVA 1JSVA 2YAAA 3CGOA 5L8LA 2H34A 4PTCA 4PUZA 3R71A 3ORNA 3PXYA 1NVQA 4TWOA 5EDRA 5D7VA 5CVFA 1H4LA 4YGAA 5ANOA 4ZEGA 1KE8A 4MH7A 3VW8A 3ZBXA 4CD0A 3HGKA 2OW3A 3LPBA 3IO7A 4UMRA 1IG1A 4GK2A 2BZKB 1H00A 2C6MA 2W1HA 2X81A 3LM0A 4HCTA 4MNEB 4MXCA 1XJDA 4QP3A 3HDMA 4XG8A 4K18A 4ZSLA 3TNQB 4G3DA 3P23A 4YBJA 1Q8YA 4DG2E 4M12A 4AACA 2V7AA 4BIDA 4FI1A 3A7JA 2QKRA 5FGKA 1YHSA 1R3CA 4EBWA 4D1XA 5L2TA 3QYWA 3VBXA 2JDSA 4EHZA 4JIAA 2Y6OA 1PXKA 2WKMA 3QHRA 5LVPA 2E9OA 3CTHA 2XRWA 3ORMA 2HWOA 4FSMA 4YJNA 3TDVA 2KTYA 3MA3A 5HCZA 3TN8A 4DTBA 4YJQA 3E92A 5DRBA 4ZLYA 1B6CB 5HE1A 4E4MA 4OTRA 4CKIA 1KSWA 3U4WA 1G8SA 5EYKA 3ELJA 3KXHA 5C8NA 4E7WA 5CU3A 3GOKA 4ZY6A 2OJIA 1BKXA 5D11A 3E62A 3NYOA 4QTBA 1WBSA 4KBKA 3MYGA 3LJ0A 3WIKA 3AT4A 3KQ7A 1OITA 1H01A 3OXIA 3TNPC 4QMWA 1JQHA 1ZZ2A 3UC4A 4ACCA 5HVKA 4XCUA 3OD6X 3B2WA 3VUHA 1XKKA 4M7IA 2J9MA 2EUFB 1GAGA 2QC6A 3KKVA 3UE4A 1OIRA 1SVGA 2CMWA 2QI8A 3I7BA 3LVPA 3RKBA 4AW0A 5FWKK 3LHJA 4Y46A 4OT6A 5E91A 3T8OA 5HLWA 5GZAA 2XA4A 2J5FA 5CT7A 1VLRA 1P4FA 2XK8A 5CTPA 5E1SA 4YLKA 1TVOA 5HZNA 1YDTE 2HK5A 4AFJA 4CTBA 5I5ZA 2X2KA 3ZC6A 3RAKA 4F6SA 3RWQA 3UG1A 3VS6A 5CEIA 4BTFA 4K6ZA 4F08A 3MTFA 5GHVA 3RI1A 4GUEA 1U59A 4DAWA 5JFXA 4M69A 5J79A 2SRCA 4RIWB 3LLTA 2VUWA 5ANKA 3E8DA 4QQJA 4RC3A 2ZAZA 2ESMA 2Z60A 4NT4A 1U4DA 3SKCA 1JWHA 4QYEA 3G9NA 3BEAA 3SXRA 4DFNA 4WBBB 5AADA 1UKHA 1UWHA 3DZOA 3KXGA 3P86A 3VS7A 4HVHA 5AV2A 3V5WA 4N0SA 2X6EA 3RK7A 2GNJA 4E4LA 1XO2B 3KXXA 3F3ZA 3K5VA 1NXKA 4XRLA 1YI3A 3E5AA 3FKNA 2QOHA 3HMPA 2OO8X 1VZOA 4ANMA 4FV6A 4EOLA 3FKLA 3SLSA 3ML1A 5EM5A 3PVGA 3V04A 1M7NA 2JFLA 5F9EA 5IEYA 4MQ2A 4OTWA 2ZVAA 4PNIA 2BDJA 3R30A 4FR4A 5EYDA 2B55A 4FSUA 2IW9A 2PTKA 4O4DA 3EL8A 5EI8A 5J9ZA 1URCA 1Y8YA 4YURA 4PRJA 3QD3A 3LE6A 3MY0A 4XUFA 3D83A 4GT4A 1NW1A 3M2WA 2OK1A 1JVPP 4YPSA 4O7RA 4ORKA 1W8CA 4YLJA 3MH3A 4JL9A 4S31A 4CZUA 1YHWA 3BHUA 2HELA 4DHJA 3Q4UA 4YHFA 3PUFC 4FNYA 1CMKE 2JGZA 3KMWA 4J97A 4N6YA 4WT6A 3RAIA 3ZTXA 3RK9A 5CX9A 3TV7A 4CCBA 3HL7A 1BI8A 3Q9YA 3COHA 2Z7LA 1UU3A 4GL9A 3ZEWA 4U3ZA 2XNNA 5CEPA 3P0MA 2VTHA 4MD8E 1YQJA 2J0IA 4O0YA 1HCKA 2UZUE 5L2QA 3VWAA 4AZSA 3GVUA 4DG3E 3AC4A 2JFMA 2Y7JA 3ROCA 3GFWA 1GIHA 5J95A 4X3FC 2PPQA 3NCGA 4TKSA 5CVHA 3ZMMA 4DEGA 1L8TA 4C61A 3LFFA 1H1SA 2JBPA 5EFQA 3ATTA 4U6RA 4UWBA 3ZDUA 2VD5A 4PL3A 4UZHA 4EUTA 3WF8A 2QG5A 1JOWB 3KEXA 2PZRA 3N4VA 3LFEA 4GW8A 3AC5A 3UZTA 5DYJA 4BWPA 3VBVA 5H9BA 5HG8A 3CP9A 3ZOSA 2BDWA 5AWMA 3CY3A 4JMQA 3PLAE 4I5CA 1JLUE 2PVYA 4I23A 3O0GA 4FG8A 5AR5A 5DBXA 2C68A 3N9XA 4BCKA 1PXOA 1FQ1B 2HCKA 4C3PA 4CKRA 4YJTA 5CQWA 4K11A 2UVZA 3KN6A 4JS8A 3S95A 3PY3A 4J71A 3MIYA 3UOKA 3BLQA 2R3IA 3N4TA 3NIZA 2XKDA 4OR5A 3GUBA 4GJ2A 3DOGA 4FT3A 3DKFA 3QL8A 4NTTA 4HVIA 3EN7A 2BZIB 3H0YA 3C5UA 3D5WA 4M8TA 3BL7A 3Q96A 1ZOHA 2UZOA 4NTSA 5IPJA 3IS5A 4JBPA 2X0OA 4U43A 5GJDA 3UMWA 4A4XA 2IW6A 4RLKA 1U5RA 4ID7A 4P7EA 5EW8A 1Q8TA 4AXEA 3AMBA 3LW0A 4C58A 4ZZMA 4CFUA 5AA9A 4IEBA 2OJFE 4Z