4C36A

Pka-s6k1 chimera with compound 15e (cct147581) bound
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
338
structure length
335
Chain Sequence
ESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSYGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVLEYLPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
publication title The Discovery of Potent Ribosomal S6 Kinase Inhibitors by High-Throughput Screening and Structure-Guided Drug Design.
pubmed rcsb
source organism Bos taurus
molecule tags Transferase/inhibitor
total genus 105
structure length 335
sequence length 338
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c36A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c36A02
1OECA 4GK3A 3EQBA 3Q96A 1NA7A 5EK7A 4CZUA 3WZEA 4BI0A 2X39A 4H1MA 3ANRA 4FOBA 2QI8A 5EQEA 3QFVA 4AZWA 5C4KA 3B8QA 4Y95A 1GZNA 1VZOA 3B8RA 2JDRA 3DOGA 5L2IA 3C13A 3HV7A 4L3JA 2GDOA 1H08A 5AA9A 4MBLA 3TKHA 1ATPE 4NM3A 3W2OA 1WCCA 1HCLA 3IS5A 1RQQA 3NAXA 3R6XA 2IVUA 1VYZA 2JD5A 4KUJA 4JRVA 4FTCA 4O7VA 2I6LA 2R3RA 1U46A 3FMHA 5ETFA 5CAVA 3I7BA 4TWOA 3TL8A 4AOIA 2SRCA 4U44A 1T46A 1V0OA 2J9MA 3QTRA 5ACBC 4XG8A 2BFXA 4OW8A 1Q8ZA 3TT0A 5M44A 5CEIA 5BMSA 4N0SA 4UWBA 3U6JA 2WQMA 2QOFA 3F3UA 3LMIA 2W4KA 2YWPA 4EQMA 4AA5A 1KUTA 4HCUA 3L8SA 5ANIA 2OSCA 3S95A 4EONA 4O7WA 4JDIA 4TPTA 3LFNA 2QC6A 4H58A 5EFQA 3N9XA 1OM1A 5KMJA 4NZWB 5JFXA 4ZTSA 1U54B 3GGFA 3PRIA 4FNWA 5KMIA 5KMKA 3A7JA 3W32A 4D0XA 4RQVA 3F6XA 4M97A 4C4FA 4YHFA 4RIOA 4WG5A 4NTTA 3HMNA 4DH1A 3E87A 3REPA 3BBTB 1OKYA 3RI1A 1L3RE 4O1PA 5CENA 4FV1A 3UNZA 5AA8A 5FDXA 3QBNA 4HNIA 3FQEA 4Q2AA 1JQHA 3KRXA 1Q61A 2W4OA 4BC6A 3CJFA 1UU3A 2W1HA 1CMKE 2ITWA 2UZNA 2CHLA 1YXVA 2W05A 1Y6BA 4OTPA 5HGIA 1NVSA 4R7IA 3ZO2A 5J8IA 1QCFA 2RG6A 4GIIA 5TT7A 1SMHA 2PVRA 3FLQA 3L9MA 4AXAA 2QCSA 1FVRA 2CGVA 2Y0AA 3OHTA 3UMXA 1UU9A 3R71A 5CF6A 2Y9QA 5HBHA 4RJ7A 5ANGA 4JX3A 4CTBA 4JAIA 4YC3A 4B8MA 4RJ4A 5KO1A 5KHWA 5CI7A 1ZMWA 2BR1A 2PE2A 2BVAA 2XP2A 5HNIX 4P5ZA 4D1XA 4BGHA 2HOGA 2XB7A 3EN4A 4KAOA 2J5FA 4P4CA 2HWPA 4MYGA 4E93A 4GYIA 2C68A 3FQSA 4J71A 3HP5A 5GJFA 4BF2A 5HE1A 4LGHA 2J50A 4DCAA 4AOJA 5ACKA 3ZC5A 1J1BA 4L8MA 2IZTA 1ZLTA 5C03A 4NKAA 3SOAA 2ESMA 4QOXA 3ORTA 5LWMA 5HI2A 4YUQA 1Y91A 4IX4A 4F64A 3WYXA 3BEGA 3JY0A 3GI3A 2Y8OA 3PDTA 3FBVA 3QYZA 3C1XA 5FM3A 5HNBA 3UC3A 3W55A 1G3NA 5KUPA 3QYWA 3U54A 3PZHA 3A60A 4F65A 3KULB 4FKTA 3FSFA 3BYOA 4BI2A 3S0OA 4HZSA 3RHXA 3NCZA 5DFPA 4WBOA 3QRKA 1M2RA 4DEEA 4JR7A 4BCPA 4C4EA 4FEUA 1LPUA 3Q60A 5EQPA 4CG9A 2PE0A 5LOHA 4PNIA 3FPMA 2QHNA 2W99B 4FTNA 4E7WA 5L2WA 5AMNA 4UMUA 4TNBA 3L9PA 4WD5A 5JGDA 2WTVA 2QG7A 2ZV9A 3VC4A 3SC1A 4NU1A 4EK4A 4USFA 3ROCA 4E20A 3DBQA 2ACXA 3PXQA 4C2WA 2ZM4A 4O83A 3A7HA 5E1SA 5CQWA 3VUTA 3NZ0A 1Q5KA 2C6KA 4JI9A 5AUXA 4F63A 5GIOE 3QL8A 2IZSA 4BBEA 4O91A 3F5GA 4IBMA 4CKJA 1NW1A 4RC2A 2X7OA 2PU8A 3FZTA 3HVCA 5BVWA 4U80A 2J0MB 4AGWA 4MK0A 2PL0A 4FEXA 3QWJA 4AG8A 5JGAA 3E93A 2E9UA 4IIRA 1TQIA 2HZNA 2X8DA 2ZDUA 4NWMA 3ROYA 1OBGA 2P0CA 1XBAA 3EKKA 3P7AA 4IM3A 5DE2A 3MIAA 5BNJA 5C8KA 4AWIA 3NMUF 4FV4A 2W17A 4XCUA 2YM7A 4HGSA 4I6QA 4BIDA 2XKFA 3PRFA 4M69A 4YJOA 4R7HA 4FIJA 5DPVA 2P3GX 2BAKA 2WZJA 2OI4X 2JDSA 2R3GA 1QPCA 4C02A 4MNEA 2VO6A 4DGGA 1O6LA 2PY3A 3L1SA 4WNOA 3R7OA 3PIXA 4FTJA 3SG8A 3KF4A 1SM2A 4I94A 4RWJA 2ETKA 3FDNA 2CGWA 2AC3A 4GW8A 3SXRA 4EZ3A 5CXZA 3ZRMA 5AEPA 2YISA 2IW8A 3UJGA 3CGFA 2VTQA 3C5UA 2PYWA 2XNGA 3DV3A 2G9XA 3ZM4A 3NIZA 2B9FA 4PDSA 5F9EA 3RZFA 3P79A 4BCOA 5JRSA 2HXQA 5HO7A 4KS7A 3HMMA 3T3UA 5JMSA 2PMNX 4F70A 3JS2A 4OT5A 3QGWA 2QR7A 5BUEA 4YBJA 4FSZA 5L6PA 3TG1A 4ERWA 4Z55A 4MBJA 3UZRA 3NLBA 4AZTA 2PUUA 4QNAA 3C4CA 2W1GA 1KE5A 4WOVA 4ANNA 4NTSA 3RPOA 4BDJA 2C6IA 3F9NA 1Z9XA 4LV8A 3ZLSA 4QTDA 3R2YA 3BELA 2JIVA 4U45A 4KBKA 5KNJA 2YM3A 3P4KA 3VF9A 3SW4A 4EH9A 2F7XE 5HORA 1H0WA 4FODA 1M17A 3R1QA 4Z9LA 4O0VA 4YZNA 3M2WA 4OBQA 5L2QA 3MFSA 2CN8A 3QQGA 3R7IA 4E6QA 4DFUA 2BRNA 4QNYA 4C59A 4DH3A 5AFVA 2QR8A 3C4FA 4C62A 3ORZA 1ZY4A 3KY2A 4PX6A 3VW8A 3WILA 4ASEA 2PULA 4JXFA 4XOYA 1GIJA 4LL5A 2I0EA 5M4FA 3HNGA 3I5ZA 4C4JA 1ZRZA 4HJOA 4G3DA 3KCFA 4NH1A 4F9WA 2EU9A 3MA3A 3AQVA 1FGIA 3JUHA 4IM0A 4ZK5A 2YIWA 2YHVA 5CXHA 3TIZA 4D2WA 4ZS0A 2XIKA 3UIMA 5A6NA 3HECA 4JG7A 4PDOA 3KXXA 2CJMA 3Q4CA 4R3RA 4TYJA 5BVKA 5B7VA 5EI2A 5HG9A 2WEIA 2OIBA 2B1PA 4PL5A 5ITAA 4O2PA 2YDKA 3OTUA 1ZARA 3COMA 2PK9A 2CLQA 3FY0A 4AN3A 4RG0A 1A9UA 3ZBFA 1ZXEA 2P33A 3OEFX 4JG8A 2UZLA 5IZFA 2E9PA 1M7NA 3NUSA 5AX3A 4YTIA 5LVMA 4J96A 4FVPA 3V01A 4KA3A 4BI1A 3RAWA 3POZA 4ZMEA 3HRBA 3R9OA 3EMGA 2VN9A 4WNPA 2VWZA 3F2AA 4II5A 3IDPA 2B52A 4AQCA 4CLJA 4IQ6A 1H1SA 4Y73A 5BVEA 4BGGA 2NO3A 3NGAA 4CV9A 3AT4A 2CDZA 5JKGA 1SZMA 2JAVA 2A19B 2GFCA 1JNKA 2FH9A 3CD3A 2EB2A 1AQ1A 2R5TA 1WAKA 2X2MA 4FNZA 4FV3A 5JEBA 1JOWB 4FL2A 2BILB 4FTUA 4GJ2A 5DWRA 4ZIMA 2HAKA 5FEQA 4JDKA 3FYKX 3DXQA 4N4SA 4AFJA 4CMUA 4D2TA 3OTVA 3TKUA 3UODA 2O3PA 4FL1A 1OL1A 3VUMA 4EC9A 3HUCA 5FTGA 1XH9A 4TYHB 4F7SA 2OFUA 4XH6A 3ZSIA 2XMYA 4MHAA 1FINA 4QMQA 5J5SA 2R3PA 3WZUA 3UGCA 3HYHA 3DB6A 4AZEA 4C33A 2UUEA 5J95A 2B53A 3O23A 5L4QA 4BBMA 2JBOA 1PXKA 2OZAB 3BE2A 2VTAA 3MESA 4K18A 4EWHA 2ZV7A 5D10A 3BLQA 1Q3DA 4D9UA 5DT3A 3V5LA 5B2KA 3CY2A 5J79A 1JSUA 2VTOA 3TZ8A 2GNLA 5DI1A 3LMGA 5DNRA 4AA4A 2VV9A 5AP3A 2CCIA 3MGYA 1QPDA 2JKKA 3QTZA 3TZ9A 4HVHA 3NUYA 2C6OA 2CKPA 3IDCA 3DKGA 3QQUA 4XV2A 3MIYA 4KSPA 3MJ1A 4YO6A 3F66A 3RPSA 2YCRA 4IACA 1Q3WA 2ERZE 3DJ6A 4EORA 5AUZA 5I4NA 4OAUC 2GQGA 3ENMA 4FE2A 4S2ZA 2CSNA 4GUEA 4E4NA 3MPTA 2YA9A 5KMNA 1FQ1B 2YM4A 2UZOA 4FSRA 5HD4A 2XK6A 3MYGA 1PXPA 2QOKA 4QMWA 3G33A 3ZZEA 4AT5A 4H05A 1YOJA 4FKOA 4BHZA 3TCPA 3P0MA 4FC0A 5TR6A 4G3CA 3EOCA 2J90A 3OEZA 4J98A 3K3IA 4LL0A 5E1EA 5HOAA 3PA3A 4Z7GA 3UO5A 3RK7A 1Q24A 4GG7A 4W4VA 4HW7A 4I4FA 2NPQA 4ZTQA 4XS2A 3DBFA 4DHFA 3N4VA 3NUXA 2F2UA 5EM8A 5HBJA 2OF2A 3AOXA 4GU6A 4QMXA 3QD0A 1DAWA 5DRBA 3VUHA 2YJSA 3Q32A 3U9CA 3NUPA 2X2LA 2ITUA 1SNXA 4EH3A 1XH6A 3DBEA 3R7EA 3V04A 4RPVA 3GC7A 3WF8A 4DFBA 3PXKA 4FTMA 3D7TA 5IPJA 1NXKA 3LXPA 1R3CA 2WKMA 1O6KA 1QL6A 4I20A 3NNVA 5FG8A 4P90A 4GRBA 2HCKA 5HCXA 5M51A 4EUTA 3THBA 4W9XA 2PPQA 1WBVA 3UOKA 4PMMA 5BYZA 4P2KA 4GKHA 2XH5A 3ORMA 2WFYA 3LKMA 4EQUA 3GFWA 1H0VA 3KMUA 3R8LA 2WQNA 5CT7A 3U4WA 4BIEA 4EOIA 3TV6A 3GQIA 4A9RA 5LMBA 5HLWA 1OBDA 4ITJA 4JDHA 2ITOA 3QWKA 5EYKA 4DYMA 2WMWA 1WBPA 4HOKA 1YWRA 5ANJA 3EQIA 5IMXA 3LXNA 3D4QA 3F61A 3OWJA 4FEQA 3WYYA 3L8XA 2C3IB 3BX5A 3D7TB 5FXSA 4EHVA 5B2MA 4MXYA 5LMKC 5FDPA 2PUIA 5E8UA 2OK1A 2WTDA 3PA4A 4K77A 3GFEA 4Y5QA 2H6DA 4DFNA 5A54A 4RVTA 3ZU7A 2Y4IC 5JK3A 4ZP5A 3POOA 3VJOA 3FJQE 4I41A 2ETMA 5I9ZA 3HDMA 3SW7A 5C9CA 2GSFA 4F9BA 4M67A 4IAAA 4UYAA 4WHZA 3U55A 2A0CX 5EHOA 3NSZA 1XBBA 4L53A 3I60A 4L7FA 1MRUA 5FP6A 3FXWA 3IECA 3NW7A 2V0DA 4IVAA 5CSHA 5HG5A 5HO6A 2BRGA 5BX0A 5IU2A 2ONLC 3AT2A 1OVEA 1KE7A 3BHVA 4O2ZA 3UNJA 4B9DA 3HAMA 3GUBA 3HL7A 3VIDA 2W4JA 3IW7A 4U7ZA 3ENHA 4QMZA 2XF0A 5CS6A 4XMOA 2JIUA 5BVOA 4FVQA 3BYVA 5BYLA 1RW8A 4ORKA 1UVRA 2GHLA 1ZYSA 2XNPA 4YR8A 2QOLA 3TTIA 5A9UA 4YO4A 2WO6A 5DVRA 2PHKA 2R3KA 3E63A 3LHJA 5K3YA 4XG6A 1MQBA 2C4GA 1OL2A 4QQJA 4G3EA 3DK6A 2X8IA 4UZDA 3VBXA 1W83A 3B2TA 3IKAA 4IAIA 4KSQA 3W1FA 1UKHA 2G1TA 3H0YA 1JKTA 2JFMA 2C0TA 4RJ8A 4PQNA 3O96A 4DITA 4DBXA 4ZY5A 4IW0A 2JKOA 3HUBA 4EOMA 2XM8A 4I4EA 4ID7A 3NPCA 4RFMA 2A1AB 5GZ8A 4GEOA 3ZO1A 4E73A 2PMOX 1WVYA 5A4CA 3PPZA 3BWFA 3MW1A 4FK6A 3R9NA 4CMTA 1XWSA 2PZ5A 4QO9A 3KXNA 4ZEGA 4BHNA 1IASA 4YJPA 4FTKA 3L9LA 3LCSA 4FSQA 3G51A 2OZOA 2PWLA 3C0IA 3P7BA 2F9GA 3QXPA 4UALA 3VO3A 3P5KA 1K2PA 3BIZA 3IGGA 5HESA 2WIPA 2O5KA 4M13A 4F0FA 1PYXA 3ANQA 3H9OA 3RK5A 1Z5MA 4OTFA 4O27B 5HE3A 3PUPA 1K3AA 4BZOA 2FO0A 2W96B 3CBLA 3DTCA 3T9TA 3UOJA 3LFFA 1RDQE 3QQLA 3FHRA 4O0XA 4ZOGA 4XG4A 3TI1A 3BU3A 2QURA 5EH0A 5C8MA 3V8WA 3DXPA 2VX1A 4ZY4A 3SXFA 4QYHA 5AUWA 1JSVA 2X4FA 3V8SA 5JN2A 1WBOA 1V0BA 1MP8A 5CWZA 4G6OA 3EJ1A 3K2LA 4F9CA 4M0ZA 4AU8A 4CLIA 2UZUE 4W9WA 3AC3A 5CVFA 2E9OA 3RAIA 3PLSA 4L67A 2XJ2A 3F82A 4BZDA 4S32A 5KZ0A 3R7VA 5CASA 2ITNA 2X4ZA 3PY3A 4CV8A 4EHGA 1STCE 3BLHA 3V6RA 3QD2B 2C0IA 3NNWA 4ACCA 4IZAA 3HEGA 3M42A 5KX8A 4QMLA 4RVLA 5L2TA 3U87A 4DAWA 4U41A 5KBRA 2B0QA 4L43A 4KIKB 3A4OX 3Q6WA 3RCJA 4XOZA 4A9TA 3VUKA 1G5SA 1EH4A 2JAMA 4TYGA 5EDRA 3TJDA 4U8ZA 4DH7A 4EJNA 4PP7A 4GKIA 1L8TA 1YW2A 3BHYA 3R22A 3PVGA 4BCGA 2O64A 3DS6A 2ITPA 4IZYA 3D5VA 4XG2A 5AV3A 1OUYA 4HCTA 3HV4A 3UVRA 3UC4A 2ZMCA 1YVJA 3P78A 3UMWA 2ITQA 3ZH8A 4ENXA 3HAVA 1J3HA 2XJ0A 3SAYA 3TNWA 1Q62A 2P55A 2WMXA 5I9XA 4C34A 3S00A 1DI9A 5LMKA 4YLJA 3E64A 4Z3VA 4FSYA 1SVEA 2WU6A 3PJ2A 4RC4A 4XHKB 5HLPA 4MWIA 4XG7A 3U51A 4RJ6A 5JSMA 2FSMX 4EOKA 2RIOA 5FEDA 5GIPE 3GU6A 4MBIA 5LVOA 2HWOA 4L3PA 3VBQA 4C3RA 2OFVA 2VD5A 2ONLA 4FZ7A 3GCSA 2FSOX 2VTJA 4K9YA 4FKUA 4RVKA 1T45A 5IH5A 3R00A 5JFWA 4ZJVA 3GC0A 3GENA 4A4XA 4FKQA 4B6LA 5FM2A 3OD6X 4FIGA 4F4PA 3UPXA 4B99A 1V0PA 5LWNA 1IRKA 4QQCA 3F3WA 5EW9A 2Z02A 3QZIA 2Y4IB 4C2VA 5H2UA 2ZM1A 3R28A 4YPDA 2FA2A 4IFGA 2GU8A 2XK7A 4FSMA 5DMZA 4RLLA 2FB8A 4KD1A 1PMVA 5HX8A 3MVMA 1WBTA 2X6EA 4EC8A 4KRDA 3ZLXA 1Y8YA 2OLCA 2R3LA 5L3AA 3PJCA 3DBCA 3FMEA 2VRXA 4D5KA 4JG6A 2WMQA 3F5PA 4D58A 5DT4A 3V51A 5B0XA 4PTCA 4E5WA 3DXNA 5AM6A 3ULIA 2CNQA 4R7BA 4AE9A 4CNHA 1KV1A 2WTCA 4CCBA 1OL6A 4BCHA 4D1SA 5JRQA 3UYSA 1H1QA 2YLFA 4EBVA 5HU9A 3I79A 1PMUA 2WHBA 4I5PA 2I0YA 4I24A 3BU5A 5AAFA 1REKA 4CG8A 1UWJA 4EH6A 4D2RA 4QP2A 1FOTA 4A06A 2I40A 2X9EA 4CT2A 5AAGA 2F4JA 5A14A 3DNEA 1U4DA 5AUTA 2UW9A 1OL5A 5TE0A 4C61A 3UBDA 2C6EA 3PJ1A 4QP9A 4DGNA 4IADA 4JNWA 3LLTA 4OTWA 5DR9A 5LVPA 4LMUA 5M4CA 2BAJA 3CKXA 2BKZA 2UZBA 1OPJA 3OUKA 3ZO4A 1U54A 1FVVA 2YIRA 3ORLA 5HICA 1Q4LA 3PG3A 4FT7A 4J52A 3RCDA 1P4FA 5EW8A 4O96A 3PXRA 5ANEA 3W2CA 1APME 4UV0A 5JFSA 4BDCA 3EZVA 4QD6A 2VTLA 2I0HA 2E9NA 2OJJA 4CFFA 2OJIA 3AG9A 3SDJA 4AW1A 3DNDA 5BVNA 2B55A 1OKZA 2GNGA 2YFXA 2ETRA 3BEAA 3KXZA 4MNFA 1BUHA 3EN7A 3BWJA 4L3LA 3EYHA 4R1YA 2J5EA 4FTIA 4FNYA 4I0SA 3QCSA 5AUYA 5KE0A 4YZCA 1MRVA 4AGUA 4C38A 4D4YA 4FKIA 3U4UA 4X2GA 5AV0A 1J7IA 5IA0A 5AX9A 4DN5A 2WELA 1YI6A 3FMLA 2UVZA 4MF1A 3RM6A 2GS2A 2WMUA 4ALVA 3E8NA 4MXCA 4AAAA 4NW5A 5DEWA 4RRVA 4WSYA 3VS0A 4BCMA 5IA1A 4AW5A 1R0EA 2ITVA 3R1NA 3OXZA 3IGOA 4FV7A 2BIYA 5E8WA 2QNJA 4HCVA 4RZWA 5HVJA 3ZS5A 3PWDA 3M11A 4QP7A 5ETCA 5HTIA 4DEIA 4EEVA 4UMPA 3ZO3A 4FEWA 3RMFA 3CTJA 4WKQA 4I1ZA 3EQCA 2WAJA 3ALNA 5DT0A 3OFMA 2WPAA 4MD8E 4DEGA 4RWKA 1JKKA 3HA8A 4HGEA 4Z7HA 1TQMA 3MY5A 2QOIA 3GVUA 5G6VA 4HVDA 5FLFA 4QMUA 2QKWB 3ACJA 2RFNA 3F88A 4K0YA 1U5RA 2OICA 5HIBA 2YITA 4WO5A 5TKDA 3ZYAA 4BDGA 5E8XA 4EH8A 3BQRA 5EKOA 2C5NA 5C1QB 4FR4A 3ACKA 3EL8A 4U42A 4HYSA 4O6LA 1HCKA 5CNNA 3DZQA 3EHAA 4MQ2A 4NCTC 4R8QA 3MS9A 4JIAA 4G16A 2A4LA 3KULA 4V0GB 1YRPA 2BCJA 2HY0A 5AP1A 3OT8A 4PNKA 4YJNA 4ZJIA 1M2PA 5IQFA 3QLGA 3C5IA 1W98A 3R1SA 4UXQA 4X7QA 3CGOA 4UZHA 3VNTA 4CEGA 2PVHA 3AT3A 4LV5A 4MAOA 4YBKA 4PY1A 4C7TA 2R0UA 3P9JA 2OXDA 2VTPA 2VTMA 1XH4A 3F3TA 3OWLA 3AC1A 2G2HA 4J97A 4HGLA 3RP9A 3UVQA 3DCVA 3F7ZA 4GK2A 2PUPA 1JAMA 2F57A 3AD4A 3R0TA 4FKVA 4AACA 2XNNA 5BVFA 3UQFA 1B38A 2Y4PA 4Y46A 2C5XA 2UZEA 3H10A 4G9CA 3TUBA 3I7CA 3MVLA 4UEUA 4I22A 4DTBA 2BRBA 3R7GA 4N6ZA 2YM5A 3EYGA 1ZYJA 2WTIA 2PZRA 1PF8A 2VX3A 3VAPA 2IJMA 3ORNA 3DAEA 4ACDA 3F7WA 4F6WA 4RIWA 1QPEA 3ALOA 4GL9A 4F1TA 4BRXA 1R78A 5E9EA 4IC8A 4D28A 5C01A 3UPZA 4CFVA 1ZMUA 1IEPA 3OY1A 4EOLA 4FI1A 3QKMA 3R21A 5CNOA 1H8FA 5M56A 2EB3A 3K54A 1UWHA 4OUCA 2XNMA 4DC2A 3LFAA 1UU7A 3AMAA 3PTGA 4IZ5A 5CSWA 1U59A 4L68A 4BDKA 3T8OA 3ORXA 4MTAA 2C3LA 3LE6A 3QX4A 4MXOA 4J95A 1J7UA 3ORKA 2Y6MA 4BL1A 5A46A 4YC6A 1KE9A 3QTWA 4FIFA 4MEDA 4EK3A 4RIWB 1LEWA 5I0BA 3RINA 3UZPA 4IB0A 5T6KA 2VWBA 1OKWA 4ASDA 3D14A 4UBAA 3H30A 5HKMA 4E5BA 5L2SA 3R8PA 3Q4UA 4W4XA 3Q52A 5FUTA 3OW3A 5DYJA 2OH4A 2DS1A 3F69A 2R3JA 3OWKA 4O0SA 2WTJA 1PHKA 5EHYA 3WOWA 5IQCA 5E8ZA 4EK5A 3FKOA 2YIXA 2BALA 2BTRA 4X2FA 4PV0A 4XBRA 5BPYA 4YGAA 3V3VA 3MJ2A 4OTHA 5CAPA 5EYCA 3KMMA 3KVXA 4TN6A 5HX6A 4LMNA 4ZTRA 3A8XA 3G9LX 4QYYA 5AR2A 2CGXA 3W2SA 2VZ6A 4D2VA 4HVSA 4CKRA 4YSMA 3NUUA 2C1AA 5E91A 4ZLZA 5L6OA 1PYEA 2OG8A 4FTTA 5IA5A 3MFUA 4ANSA 3BKBA 2RFEA 3HV6A 4I0TA 5CANA 4CGAA 3G5DA 1FMOE 5FGKA 2UVYA 2NNWB 4AGDA 3EZRA 2QOCA 4CFWA 1JKLA 3A2CA 3FAAA 3KK9A 3CQUA 4R3PA 4K11A 4K6ZA 5EM5A 1X8BA 3NEWA 3R8UA 3LAUA 5M53A 3ZM9A 3CJGA 3IPHA 3LCTA 2JC6A 3LJ2A 4W8DA 5DA3A 4B7TA 5KHXA 5IQEA 4C36A 3HGKA 4JIKA 4NK9A 4YJTA 2I7QA 1OPLA 3NS9A 4QMSA 3R73A 3H9RA 3WI6A 4MXXA 1CKIA 2P2HA 3UYTA 3GCVA 1ND4A 3QC4A 4EOSA 1KV2A 1H07A 4YZDA 3HRFA 4MQ1A 2UW5A 4EH5A 4F7NA 4KNBA 2XKDA 3W2PA 4QPMA 2RGPA 5C4LA 4NCTA 3PE1A 2ZJWA 5CVHA 5CTPA 5L6WL 3ZCLA 4D4VA 2J2IB 3R04A 4S31A 5BMMA 4BWKA 3EFWA 2AUHA 2PVLA 2W9ZB 3CIKA 4E1ZA 4UWCA 3LFBA 2XBJA 4WG4A 1OIRA 4XRLA 2YCSA 2IVSA 4QMOA 2VX0A 2O8YA 1SYKA 2EXEA 2HENA 4YZBA 5A3XA 4L00A 5CEOA 5AR4A 3GQLA 3VS6A 2W1IA 2NRYA 3RVGA 2OXXA 3ZUVA 3LZBA 3O8TA 4XV3A 2WMBA 3VBTA 3OT3A 4B4LA 2JGZA 3EQDA 2HZ0A 1Z57A 5I3OA 2XBAA 5AIRA 4EH7A 2OXYA 3OW4A 1PMNA 1XBCA 5DN3A 5CY3A 3H9FA 5AV2A 2CKQA 4ZTHA 3QGYA 2JBPA 3SVVA 1MRYA 4ANMA 5AIKA 3TUCA 2GHGA 4J99A 1CM8A 4TW9A 2GCDA 4G6LA 5M4UA 3P7CA 4A7CA 3VUDA 3DKCA 3R8ZA 4BICA 3BV3A 4U3ZA 3JYAA 2OW3A 4G9RA 4GT5A 3GU4A 4F1OA 3NUAA 1DI8A 4X2KA 4O7LA 3EQPA 4X3FC 4D1ZA 5K0XA 4RVMA 1GZOA 3C50A 3BE9A 4GCJA 4MCVA 1YI3A 2R3NA 4XV9A 3UTOA 3DZOA 3EN9A 4IDVA 4BTJA 4JL9A 2EWAA 3NIEA 2CPKE 4GYGA 1DAYA 4R5YA 3KVWA 4TYHA 5KCVA 2Q83A 3N4TA 4ALWA 3R7UA 2O65A 4DEHA 1UKIA 4MF0A 1YXSA 3AXWA 3VWAA 4PPAA 5J7BA 3RKBA 2C3KA 1JWHA 3A7FA 2XYNA 4IH8A 3CTQA 4IM2A 4DLIA 3HLLA 5H8BA 2OZAA 4JR3A 4L7SA 1DM2A 5I9UA 4D55A 3D83A 3FMDA 3ZDIA 4EOQA 4CFXA 2BRHA 2GNJA 4FK3A 3TV4A 4CD0A 4Z16A 4ZAUA 5CU2A 2WMRA 2R3QA 3IW4A 3VW6A 4BWXA 2RFSA 2X6DA 3D5XA 4U6RA 4FL3A 1IAJA 4GU9A 2VTHA 2FYSA 2PUNA 1BI7A 1FMKA 3TNIA 3FZRA 2XK4A 5HG8A 2UZDA 3IW5A 3VF8A 3WF6A 5F94A 2OGVA 3DT1A 1VR2A 4FX3A 2BHHA 3MFTA 2BHEA 3Q2JA 4CVAA 2WTKB 3K5UA 3RZBA 2J0IA 4YZ9A 3JXWA 2JKQA 2UZWE 1OMWA 3LFCA 3LFSA 3OZ6A 4AS0A 5HTCA 1H4LA 2EXMA 2O0UA 3ZLYA 4FSWA 2FSTX 2OJ9A 4FV9A 3W8QA 1OIUA 5HHWA 4FGBA 3W33A 5CEPA 2RF9A 4YU2A 2PVKA 3OXTA 3V6SA 3WF9A 5HLNA 5L8LA 5J1VA 4I92A 1AGWA 2G2FA 4G17A 4IWDA 3PP1A 4PP9A 3EQHA 4E6AA 3VUGA 1F5QA 5CAOA 3CLYA 3NCGA 2QKRA 1JLUE 3OC1A 3PWYA 3QRUA 2OU7A 4LQMA 2REIA 3WIGA 3O51A 4HPTE 4MXZA 5D7VA 5AWMA 3UIBA 3W2RA 2IWIA 5J87A 3GB2A 2PSQA 3HV5A 2Z2WA 1GAGA 2RG5A 4BCQA 5AUUA 3OWPA 4LOOA 4QTAA 5HNGA 5LMAA 1SVHA 4BBFA 3DB8A 3PFQA 2QOHA 4WA9A 2PE1A 4S33A 2CN5A 2BTSA 4I93A 3TEIA 1SVGA 1OIYA 5HE2A 3TDVA 5FQDC 2BZHB 5GJDA 3JVSA 1VYWA 4IVDA 3ZFMA 2C6DA 5HCYA 3EQGA 5BVDA 2PZYA 3T9IA 4YPSA 5HCZA 2YM6A 2GNHA 4OGRA 4RJ5A 4APPA 1WVWA 4IC7A 3MFRA 3FYJX 4JS8A 2RKUA 4AE6A 2PVFA 2EVAA 4RJ3A 3LCOA 1LR4A 3FZOA 3PJ3A 1YDRE 3L8PA 3QTXA 4X6QC 4FV0A 4IMYA 4NKSA 4AF3A 4C3FA 5IDPA 4DINA 1K9AA 4HPUE 3IW8A 4OTDA 5HVYA 2YWVA 3JY9A 3R83A 5CSPA 2JITA 4YTCA 4BDAA 2WTWA 3G2FA 1QMZA 3VS1A 3F2NA 4CXAA 4BTMA 5K5NA 3TNQB 4QMTA 4C3PA 2ERKA 1O9UA 3Q9ZA 2IW6A 5IEVA 3UOHA 4JVGA 2HW6A 4EL9A 1XO2B 2QO7A 1JVPP 3KK8A 2R3HA 3VBWA 4F9YA 2XYUA 3ZFXA 3DBDA 4ASXA 3E8EA 2C5YA 3BHUA 5CU3A 5E8VA 3ZZWA 1YXTA 1ZMVA 3R63A 2HELA 3VBYA 4I5HA 2XCHA 3DAJA 1OITA 5K0KA 3WE4A 3VHEA 4XEYA 4AFEA 4EOPA 5J5TA 3I1AA 3Q53A 4TY1A 4H3PA 4NJ3A 2BKKA 4BR3A 3BYSA 4KKEA 3V5JA 3M1SA 4FV6A 4X3FA 4YLKA 1KE6A 3LM5A 2QOQA 2XZSA 5IEXA 2Q0BA 3DKFA 3FUPA 3ERKA 1VJYA 3S4QA 4BFMA 5CF4A 2XIZA 4RA5A 2ZM3A 2UW4A 3FHIA 5A4LA 2R2PA 1JBPE 1H28A 3MDYA 3BQCA 3DGKA 3LOKA 1AD5A 5AP5A 4E26A 4EZ7A 1REJA 4HVIA 1OB3A 4YJRA 5J7HA 3AMYA 3SRVB 2W1ZA 4FT0A 4I6HA 4DEBA 5FXQA 1BX6A 5JT2A 3VS7A 4WRSA 4HYIA 4IFCA 4RX5A 3QCXA 5C26A 4FG7A 4LI5A 3AGLA 4TZRA 4U97A 4X3FB 4RWLA 4D0WA 5IUHA 2V22A 3QC9A 3O71A 4FZDB 1XKKA 1FVTA 4XNEA 4I0RA 4Q5EA 3CKWA 3V5TA 2WNTA 1YHSA 2VTTA 4XLIA 4MXAA 2WQOA 4UMRA 1HOWA 1OUKA 4KKHA 2AYPA 4R3CA 1TQPA 1YI4A 4G34A 2NRUA 3GCPA 4AT4A 2XKEA 3OROA 3LM0A 4Y83A 3E62A 3D5UA 3COHA 3TUDA 2G15A 3PSDA 4F6UA 5K5XA 4GJ3A 3A99A 2F2CB 1BYGA 4XBUA 4CTCA 2C5VA 2W1EA 4JDJA 4NSTA 3OG7A 4AN9A 1H1PA 4QTEA 3CEKA 2UW8A 3FLSA 4QRCA 4AX8A 3ZUTA 4BTKA 5A4TA 4O7RA 3E3PA 2C1BA 3B2WA 3RAHA 5EHLA 2FSLX 4P5QA 5DR6A 5IH4A 2RFDA 4IJPA 3RNYA 3QHRA 4BTFA 1LP4A 4Y8DA 3TXOA 1W7HA 4ZTLA 2Y6OA 2V62A 3TNPC 4FZFB 3GC9A 3PG1A 3GU8A 5IMEA 4G5PA 2PZIA 2UZVA 3DTWA 3ELJA 1GIIA 3ORPA 1PXLA 4JOAA 5FBOA 4ZTMA 5IQBA 3QZHA 5DGZA 5AM7A 4PF4A 3ZONA 5GZAA 4N57A 1MUOA 2PVMA 3QA8A 3SHEA 5JH6A 5AUVA 2RSVA 2WQEA 3BGPA 3NYOA 4FKWA 3LIJA 3ZSGA 5KZIA 4KIKA 5I9WA 3KXHA 3MH2A 3EQFA 5HBEA 3ODYX 4MH7A 3D2KA 3AC8A 1IAHA 3NYVA 4FUYA 3KXGA 3VRZA 1P14A 5HO8A 1H26A 3SX9A 2W0JA 2WMTA 3G0EA 4IAYA 3FZPA 3CQEA 4U5JA 5IH6A 2PVYA 3Q5IA 5DHJA 1Q41A 2XRWA 3DLZA 1OL7A 2OH0E 4LGGA 4R5SA 2XEZA 4WBBB 5H8EA 4FKSA 3A62A 1R1WA 3QQKA 2LAVA 5KKRB 1Y57A 2DQ7X 4L52A 4TRLA 4DLJA 5L8KA 4ZSLA 2YLEA 4PMTA 3P23A 4GK4A 4LRMA 4EWQA 2GHMA 4ACHA 1OIQA 4IDTA 3C0GA 3CPCA 1E1XA 4L01A 5GINE 5T68A 4PDPA 5FBNC 4IANA 3ITZA 3CD8A 4AA0A 4ZZOA 4TTHB 2X1NA 4EZ5A 3MVHA 1IR3A 4OBOA 4D4RA 5EQYA 2YAKA 3VULA 3DFAA 3MH1A 2CKOA 2PTKA 4KBAA 3HV3A 4ERKA 1URCA 2JKMA 1NVRA 2DWBA 3C4ZA 2IZRA 1CDKA 3ZMMA 3FC2A 3D0EA 1E1VA 5FEEA 3OBJA 2BPMA 4BKJA 4KB8A 5CLPA 1M7QA 3HA6A 2CGUA 3NVKI 1JSTA 3NYNA 1P5EA 4F9AA 3C0HA 4GT3A 5FTQA 5LCKA 5HZNA 1ZOEA 4HZRA 3CE3A 4UYNA 5F20A 4YURA 2YJRA 2XNOA 4IJ9A 1Q97A 2YABA 3C4WA 4YHTA 2GPHA 3AD5A 3E7OA 2W1FA 4ZSJA 3PJ8A 5FD2A 4A4LA 4DGLC 4EKLA 1J7LA 4RT7A 5EI6A 2Z7RA 4CFMA 3QAME 4GVJA 5HEZA 3UE4A 1YWNA 2B9HA 2FUMA 2V5QA 2W1CA 3NNXA 4O7SA 3EB0A 1KE8A 3OCSA 3NNUA 3NRMA 3PXZA 4R1VA 1ZYLA 3WF7A 3AC5A 4DTKA 5IQDA 3CP9A 3LXLA 4BCIA 4OBPA 4A9UA 3PVBA 4D2SA 1YHWA 4P7EA 2ZV2A 4C8BA 2PVJA 2QQ7A 3EFKA 1B6CB 4J7BA 3MPMA 4JT3A 2R64A 4TWNA 4TT7A 2YDIA 4FIEA 2YIQA 3WE8A 3QLFA 2QLQA 2H96A 4PPBA 2Z8CA 5GZ9A 2XKCA 4MWHA 4HNFA 2ITXA 4X21A 2R4BA 4E8AA 3T3VA 4Q9SA 4YZMA 1YWVA 5E8YA 1BI8A 1F0QA 3E88A 3I81A 3PYYA 3SV0A 4FIIA 2YZAA 4OAVB 3ZEWA 3MH0A 4G1WA 4FA2A 1TVOA 2R3MA 5C27A 4NT4A 2GS6A 4BGQA 4EOJA 3K5VA 2BIKB 2VWVA 4RIXB 1Q8UA 3DK3A 3QA0A 3UP7A 1B39A 3NW5A 2H34A 1WBNA 4NUSA 4OR5A 3QKLA 2Y7JA 2F7EE 3C7QA 4HVGA 1ERKA 5ICPA 4AZVA 2R3OA 2WB8A 4DG0E 2BZIB 3GCUA 1CKJA 5ANDA 5M57A 4AZSA 5CI6A 2WIHA 4XJ0A 5AR5A 2V55A 4NM0A 4C37A 4CFUA 2XNBA 3JR1A 3CY3A 3QU0A 4RX9A 5IQAA 2HIWA 4XV1A 5AR3A 5ETAA 3II5A 4CKIA 2XIXA 3E5AA 2BDJA 2XK8A 4QMPA 4ZSEA 5AR7A 2CKEA 4U81A 4BKYA 4G31A 1UNHA 3I4BA 4YJSA 4ZLYA 4USEA 1FPUA 3FE3A 2IW9A 3G0FA 4DGOA 5IQGA 1PY5A 5A4QA 3V8TA 5CEQA 3QTQA 4M14A 4FIHA 4GMYA 3R30A 5E4HA 4OTIA 4WRGA 3MY0A 5LXMA 2UW3A 2VAGA 3D2IA 3R2BA 4TWPA 4ZS4A 4FYOA 3F3ZA 2J0JA 3KB7A 3WZJA 4FNXA 1URWA 4WUAA 2C0OA 3IO7A 4LGDA 4F08A 3U6IA 4CYJA 3PZEA 1GOLA 2OJFE 3MV5A 4MKCA 3Q9XA 3FLYA 3MH3A 1KOAA 1ZZLA 4C4IA 4E4LA 5IEYA 3QUEA 2A27A 4E3CA 4QP3A 3Q9WA 4BYIA 2O63A 2YM8A 3ZEPA 4L45A 3TNHA 3W18A 4NM5A 4V0GA 4GIHA 3KC3A 3IOPA 4D2PA 1W84A 3R9RA 2VWIA 2UV2A 3PE2A 4ITHA 5FP5A 2B54A 3BI6A 4BDIA 4FKGA 4JBVA 4X0MA 3R8VA 4YHJA 3CQWA 2VO3A 4F0IA 3QZFA 5EOBA 4EQCA 2JDTA 5HIEA 2NP8A 3C4EA 3RGFA 2I1MA 5B2LA 4O7NA 1XQZA 2WMVA 3A7GA 3GU7A 3LVPA 5EYMA 4A07A 4IB1A 5IA4A 4NYEA 3OOGA 3D7ZA 3D9VA 5GNKA 3ZHPC 4DA5A 2GNIA 4BY9E 3VN9A 3Q4TA 4V01A 3VVHA 4F0GA 1YQJA 4GG5A 4KINA 3KRRA 4L44A 3EL7A 3COKA 2VGOA 3GOKA 4H3BA 5D41A 5TO8A 3UG1A 2ZB0A 4FICA 2ZVAA 1WBSA 2C3JA 2QOOA 3KU2A 1S9JA 3NX8A 3FLWA 5HTBA 4K2RA 3ODZX 3CCNA 3FMNA 4D4SA 2F49A 2QOBA 4QTBA 2JEDA 2BZKB 3QD4A 2F7ZE 1H1RA 2XVDA 3TN8A 4DFYA 3DKOA 5HD7A 4QMVA 3BHHA 1ZAOA 2QO9A 2VUWA 2W5BA 2G01A 4FTRA 2Z7SA 2XJ1A 2H8HA 4GFMA 3ZOSA 4UX9A 4YP8A 3UP2A 4AP7A 1WMKA 4V04A 3RWPA 1ZY5A 3DY7A 3E8DA 4DF3A 3QQHA 3DAKA 4FSNA 2GTNA 2Z7LA 3O8UA 2OKRA 3FMMA 4TNDA 5DIAA 2ZYBA 4JQ7A 4M7IA 4GVAA 3PA5A 3FSKA 4XP3A 4XRJA 4E5AX 3NDMA 4K8AA 4M84A 5EOLA 5JZNA 5ANKA 3R9HA 3ID6C 4O0YA 4LRJA 4QMMA 3BLRA 1J1CA 2YIYA 3F5UA 1W8CA 2PMLX 4PTGA 4AT3A 5EKNA 1H01A 3GEQA 3DDQA 1ZYDA 3IG7A 4O22A 5KMMA 4FGRA 3BRBA 4FT3A 4JJRA 4WG3A 3RWQA 4F99A 4BVUA 2C6MA 1UNGA 3SD0A 3VRYA 3AC2A 4IAZA 4FUXA 2R0IA 5E8SA 3L9NA 4AUAA 3W8LA 5H3QA 2UVXA 2DYLA 3PVUA 4FV5A 4IAFA 1KOBA 4KWPA 1GJOA 2YEXA 4M68A 4AGCA 4QYGA 4C4HA 3HDNA 3HX4A 4DGMA 3CSVA 3KGAA 3NWWA 4ZY6A 2ZV8A 3TACA 4B0GA 5EDPA 5JGBA 5M06A 3KRJA 3QRJA 2WTKC 2ZOQA 4FTLA 3GNIB 4QPSA 5IUGA 3FKNA 4ANQA 2QU5A 5K4IA 4UB7A 3EIDA 1FBNA 4IWQA 5I3RA 4RIYA 4PWNA 3ETAA 5CT0A 4ZSGA 3MPAA 4ITIA 5EG3A 2I0VA 4O6EA 3KF7A 2XIYA 3G6HA 3SOCA 1XH7A 4RFYA 3QRIA 4QTCA 3JPVA 4ZZMA 2EXCX 3VBVA 3VJNA 3VS4A 4H36A 1H00A 2C47A 3PXFA 4O38A 3RAKA 5IQHA 5I9YA 4KBCA 5CALA 4PPCA 2RL5A 4AW0A 5E7RA 3ZRLA 4WIHA 4ANBA 4EK8A 3L8VA 3OCTA 4U9AA 2OBJA 3LFQA 3I5NA 3RNIA 2FVDA 3FZSA 3A4PA 5FXRA 3JVRA 3BPRA 3BYMA 3FI2A 4JQEA 2X0GA 5T3QA 4QQTA 2B7AA 4RIYB 3KREA 2J7TA 4O82A 1H24A 2OF4A 4DEDA 1WFCA 1M2QA 4FTOA 2HY81 3RPVA 5F4NA 3E8CA 3TZ7A 4N70A 3F3VA 2YDJA 3IDBA 4E4XA 3LQ3A 1I44A 1PXIA 2R3IA 2W7XA 3W10A 3ZRKA 3HRCA 3QALE 3IONA 4F6SA 5EYDA 4DH8A 1PXOA 4HGTA 4Q9ZA 4E6CA 2Z7QA 3SGCA 4TXCA 4ZXTA 1IA8A 4YJUA 4MD9E 2VWXA 1BL6A 2JDVA 2VWYA 4RX7A 4KKGA 4NJDA 3DJ7A 3DU8A 1WVXA 1YOLA 3LQ5A 4FTAA 3GCQA 3EN5A 4CMOA 3FMJA 4CQEA 3U9NA 4LUEA 4J8NA 4H1JA 2VTRA 4JQ8A 5HU3A 4EH4A 3LCDA 2XUUA 3SXSA 4UXLA 5LCJA 5CSXA 4QPAA 5J9YA 2IPXA 5DR2A 1BMKA 4OLIA 5EI8A 4A9SA 4BDDA 4M69B 2X81A 5FRIA 3V5QA 1ZZ2A 3VS5A 1JKSA 1Q8TA 2PVNA 3DQWA 3GC8A 4I5MA 3RBWA 3TJCA 4DT8A 1WBWA 2C69A 3GOPA 1KWPA 4QYFA 3C51A 3BBWA 4S34A 5HE0A 2H9VA 5DLSA 4C4GA 5J9ZA 4BCKA 4JBQA 3EQRA 1GIHA 4MNEB 3DA6A 3QUPA 4O7YA 5F1ZA 4RZVA 1PXMA 4FMQA 4EH2A 4USDA 3Q5ZA 1VEBA 2IO6A 2OIQA 3KN6A 2KTYA 4DH5A 1G8AA 3SQQA 3CS9A 4G3FA 2QU6A 4RBLA 4L6QA 3PIZA 2XK3A 4ZSAA 2GNFA 1BL7A 2R3FA 3S3IA 1G8SA 4DTAA 1GY3A 4YJVA 5CVGA 4KIPA 4YLLA 4RGJA 4FEVA 3A8WA 5IUIA 4OTRA 1R39A 4RX8A 4UY9A 5E92A 5G1XA 4GFOA 2J0LA 4FKLA 2HYYA 4JRNA 3CC6A 4NIFA 4N6YA 2YCQA 4U3YA 3WF5A 4XG3A 4E4MA 5BQ0A 5CEKA 1YKRA 3FL4A 1OGUA 4X3JA 3NR9A 3LQ8A 3HP2A 4M66A 4CZTA 3KN5A 3PLAE 3QRTA 4U0IA 4Y5HA 3R8MA 3R9DA 3RPYA 3D5WA 4FVRA 5CF8A 2ZMDA 2QHMA 5CZIA 4DG2E 2WU7A 3AGMA 5HQ0A 1PW2A 3PVWA 2B9IA 3IQ7A 4LFIA 3TIYA 3ULZA 3QHWA 4QP1A 5AP7A 3MTLA 3NYXA 4PRJA 5HIDA 4FSTA 3LCKA 3QD3A 3LW0A 4ARKA 4BCFA 1IG1A 2X7FA 4R6VA 3OUNB 1UNLA 3OF0A 1MQ4A 4NIFB 4JBOA 4O86A 4ZTNA 1BLXA 3MA6A 2GQSA 4E6DA 3VQHA 3ZC6A 2OJGA 5IISA 4FT5A 4TYEA 2XEYA 3FLNC 4F7JA 3KMWA 4K33A 2ITYA 5CAQA 4ZMFA 5D12A 4MVFA 3EH9A 3MB7A 3ZFYA 3FV8A 2P2IA 3NVMB 4L46A 1Y8GA 4J8MA 2E2BA 2J6MA 2ZB1A 4XX9A 4YJQA 3SLSA 3FEGA 3BGZA 3O17A 2OWBA 5A4EA 4FV8A 4LG4A 4FKJA 5JQ5A 5LVLA 5LJJA 2W9FB 4W8EA 4ASZA 3MWUA 3LFEA 4PL4A 3FQHA 3LJ0A 2BMCA 3RHKA 4BDBA 4R78A 1UV5A 4W4WA 3C4XA 5H9BA 2UZTA 4M8TA 4F09A 4X6RA 2WOUA 2XRUA 2KULA 3O7LD 3QKKA 3KKVA 4OTQA 4C58A 3F2RA 1NT2A 2CLXA 4ZZNA 3P08A 4FOCA 5K4JA 1W82A 1UA2A 1ZYCA 3OS3A 4BDFA 3TDWA 3VHKA 4CYIA 3E92A 3IK3A 4ACGA 5KMOA 4TYIA 3V5WA 5E8TA 2BROA 3UQGA 4FBXA 1DS5A 3PP0A 4O0UA 3WBLA 3FLZA 2VNYA 2GS7A 4O7ZA 5M08A 3OCGA 5DOSA 3OCBA 4X2JA 4XP2A 3TZMA 4D5HA 1M14A 4F1MA 1OPKA 2AC5A 3KRWA 4I23A 3HMOA 5TOZA 3FWQA 3F5XA 1YXXA 3AC4A 3ET7A 4FTQA 4IWPA 4C57A 3VS2A 4EYMA 5BUJA 4M12A 4LYNA 5CU4A 2GQRA 1GNGA 4GS6A 2VWUA 3O7LB 4BZNA 2C5OA 4FKPA 4XLVA 4EJ7A 4F7LA 2IVVA 4IZ7A 5KKRC 3UQCA 3G15A 5IA3A 5HVKA 4CRLA 4QP4A 3Q9YA 3E7VA 4M0YA 2IN6A 3U6HA 4O0WA 4EI4A 4G2FA 2HW7A 2WXVA 4Q5HA 3NW6A 2GMXA 3Q6UA 5GJGA 1PKDA 3QX2A 4XG9A 4IX6A 1V1KA 4ANOA 4IVCA 3Q04A 4PTEA 2BAQA 2O2UA 3A7IA 3BYUA 3DLSA 4I3ZA 3LLAA 2ZDTA 4WUNA 4BIBA 5LVNA 2J4ZA 4BKZA 3I6WA 3UO6A 2CMWA 5AR8A 3QZGA 5LQFA 5AP0A 4PL3A 5M07A 2VNWA 2QD9A 5I5ZA 1A06A 3LPBA 3U8WA 5DEYA 4CSVA 4FT9A 4QMNA 3FXZA 1LEZA 3CXWA 3FL5A 3KRLA 2P4IA 5CX9A 1XHAA 5KBQA 3OVVA 3ATTA 4QYEA 2QG5A 3PIYA 3FI4A 5CYIA 3S2PA 2IZUA 2GFSA 1P4OA 3H3CA 2J0KA 5EDQA 3DPKA 3OXIA 3ZUUA 3GXLA 4QP6A 3VQUA 2V7AA 3Q2MA 3I0OA 3HKOA 4IB3A 5CF5A 1XH5A 2JLDA 3FY2A 3FXXA 2YACA 3MBLA 4IE9A 4XP0A 1H27A 3QXOA 1OKVA 3PY0A 5ANOA 4WNKA 3FMKA 3PPJA 1YXUA 4M15A 4DFLA 1YHVA 3EFJA 4GT4A 2J51A 1SNUA 3W16A 2XNEA 1RE8A 4D9TA 4EOOA 4TL0A 3KFAA 3N4UA 1OZ1A 2VTIA 4DCEA 1UU8A 3O8PA 4O7TA 4JLCA 3FPQA 3DFCB 2V7OA 1YDTE 3BU6A 4S30A 3OP5A 5CAUA 5CU0A 3CPBA 1XJDA 5F95A 4IB5A 1I09A 4QT1A 4FZAB 4ANLA 3SRVA 4CRSA 4BWPA 4YTFA 5M55A 4FG9A 1KSWA 2VO7A 4APCA 3EKNA 3WIKA 2WOTA 2JFLA 1J91A 4DE4A 4O84A 5M09A 4AN2A 1FGKA 2WQBA 4DBNA 1YOMA 4EUUA 3G9NA 4V05A 1H25A 3SKCA 4RFZA 4FSUA 2QVSE 2ZAZA 3UZTA 4HYUA 2DUVA 2OO8X 3WZDA 4B8LA 4KS8A 2W5HA 2G2IA 2YERA 4NFMA 3BGQA 4EHEA 5H8GA 2XA4A 3H0ZA 5CU6A 1JPAA 3D15A 3R7YA 4EHZA 2PMIA 4I6BA 4J1RA 2HK5A 2VTSA 4O0RA 3ZXZA 2W06A 2XS0A 3K3JA 3ZBXA 4EK6A 5A6OA 2BRMA 4H39A 4DFZE 4I6FA 2X7GA 4I21A 3DK7A 3OMVA 4J53A 3UDBA 3ATSA 1NY3A 5IQIA 3SG9A 4JAJA 3QCYA 3FI8A 2WMSA 3BHTA 2W5AA 4K1BA 4YMJA 5JQ8A 1A48A 5DRDA 5IKWA 4CZYB 4BB4A 4BCJA 4CFNA 4BN1A 5IF1A 4ACMA 2FGIA 4PMSA 3MVJA 3ZXTA 4IX3A 5EW3A 4NEUA 1Y6AA 3MI9A 3TM0A 3ZSHA 1PXJA 2PZPA 4PMPA 5TF9A 3QQJA 5LARA 3BZ3A 5D7AA 4EKKA 1O6YA 5C8NA 4UMTA 4O81A 2VWWA 4IAKA 3EFLA 4YNEA 1S9IA 2QODA 3HZTA 4NW6A 3R01A 4JBPA 4Y85A 4YSJA 4PUZA 5CSVA 5J1WA 3LMHA 5AAEA 4CCUA 3S1HA 3LFDA 4ALUA 3PPKA 1U5QA 3OBGA 2XM9A 3ZDUA 2WD1A 3VS3A 3QF9A 3EWHA 1GZ8A 3G90X 5GHVA 3GBZA 4L9IA 5EM7A 5ETIA 3IOKA 2CNVA 3MSSA 3KEXA 5E90A 3KCKA 1W0XC 3RPRA 5AV1A 5AADA 4O1OA 4U43A 2UW7A 3R02A 2X2KA 1PXNA 5CQUA 5FWKK 3RK9A 1OI9A 3BCEA 2R9SA 2BUJA 2EUFB 3D94A 2XIRA 3RJCA 4IEBA 2IG7A 2VTNA 2UW0A 3NUNA 4RQKA 5DBXA 2CCHA 2XCKA 4QP8A 3LXKA 5AJQA 1P2AA 2C30A 1H1WA 3PSCA 1F3MC 4YTHA 4KRCA 1ZOGA 3QTIA 4FF8A 4FYNA 2W1DA 4GFGA 5D1JA 5KMLA 2JDOA 1ZOHA 2R7IA 3TKIA 1IA9A 4WT6A 2WMAA 4WSQA 5CZHA 3QCQA 3QTSA 4KIQA 1CSNA 2GTMA 4YC8A 5D9HA 3UNKA 5IDNA 3PSBA 4ONAA 3KL8A 5D11A 3TTJA 2YZLA 2Z60A 5JZJA 5K9IA 3TWJA 4RWIA 4LM5A 4RC3A 4BDEA 2B9JA 2QLUA 4I5CA 4CT1A 2VGPA 4QQ5A 3CR0A 5HG7A 4DT9A 5BYYA 3UG2A 2X8EA 3HMIA 3KXMA 4RSSA 2IVTA 3Q3BA 4RMZA 5AP4A 2QONA 3OY3A 2C6LA 1PRYA 4AW2A 2X9FA 3LJ1A 3MN3A 1R0PA 3MB6A 3QUDA 5M4IA 4DEAA 4IHPA 4ENYA 4BDHA 5AV4A 2WEVA 3QTUA 4H3QA 4U40A 5FTOA 4MD7E 4GSBA 2ITZA 3OOMA 4FG8A 4L42A 4LRKA 4NFNA 4W4YA 4RLKA 3RALA 4KABA 4U79A 4UN0C 4AOTA 4QMYA 3N51A 3P86A 3RTPA 4A4OA 5IA2A 3O2MA 1NVQA 3I0QA 3RM7A 4A9YA 4ZJJA 4UMQA 4WNMA 4O0TA 1GZKA 3W2QA 3ZLWA 4BYJA 4DFXE 2CNUA 1M52A 3UIXA 3SA0A 5EM6A 3BV2A 3UOLA 1TKIA 2YAAA 4TKSA 1E9HA 1YDSE 3A61A 4XYFA 2OIDA 3H4JA 4ZLOA 3FC1X 3P1AA 3G6GA 3C9WA 3MY1A 4O21A 1BKXA 4LOPA 2C6TA 3I6UA 2BFYA 1LUFA 3Q4ZA 3WZKA 3ZTXA 2YN8A 2UW6A 2ITTA 2VO0A 3COIA 3O50A 2HZIA 1CTPE 1Q8YA 3PY1A 4PDYA 4LOQA 1PMEA 5CEMA 4LUDA 3MTFA 4AZFA 1XR1A 1XH8A 3V5PA 3GU5A 3TV7A 4RIXA 2R7BA 3FZ1A 3UIUA 1ZWSA 2LGCA 5J9LA 4FV2A 5L8JA 4G3GA 2BDFA 3GP0A 4EYJA 2HZ4A 1Q99A 3PXYA 4XUFA 4Y72A 4MX9A 4OT6A 4YNOA 3QQFA 3HMPA 5DG5A 3NAYA 3R1YA 2YCFA 4GV1A 2A2AA 4IX5A 3UO4A 4CQGA 1Q8WA 4FZ6A 2QO2A 3DJ5A 5IG1A 4HYHA 1WZYA 4GUBA 3KA0A 4NM7A 5AP6A 4G5JA 3E3BX 3AMBA 3DQXA 1QPJA 4NL0A 4TWCA 5DH3A 4GH2A 2WGJA 4UWYA 3IW6A 2BDWA 4C35A 1RJBA 1PJKA 2E9VA 3EN6A 3KQ7A 4IWOA 4RA4A 4X2NA 3CTHA 2Q0NA 4FKRA 4IXPA 4EBWA 5BUIA 2XK9A 3UVPA 4JX7A 4C0TA 2BZJA 3DDPA 3GT8A 4G6NA 5I9VA 3VUIA 4OTGA 2B4SB 5AP2A 4IVBA 3FKLA 2VU3A 4M3QA 2JIIA 1CKPA 4DG3E 4KIOA 3O0GA 1PKGA 3FI3A 2HXLA 3ORIA 5JFVA 3AD6A 4BCNA 3WARA 4R77A
chains in the Genus database with same CATH superfamily
1OECA 4GK3A 3EQBA 3Q96A 1NA7A 5EK7A 4CZUA 3WZEA 4BI0A 2X39A 4H1MA 3ANRA 4FOBA 2QI8A 5EQEA 3QFVA 4AZWA 5C4KA 3B8QA 4Y95A 1GZNA 1VZOA 3B8RA 2JDRA 3DOGA 5L2IA 3C13A 3HV7A 1ST0A 4L3JA 2GDOA 1H08A 3UDSA 5AA9A 4MBLA 3TKHA 1ATPE 4NM3A 3W2OA 1WCCA 1HCLA 3IS5A 1RQQA 3NAXA 3R6XA 2IVUA 1VYZA 2JD5A 4KUJA 4JRVA 4FTCA 4O7VA 2I6LA 2R3RA 1U46A 3FMHA 5ETFA 5CAVA 3I7BA 4TWOA 3TL8A 4AOIA 2SRCA 4U44A 1T46A 1V0OA 2J9MA 3QTRA 5ACBC 4XG8A 2BFXA 4OW8A 1Q8ZA 3TT0A 5M44A 5CEIA 5BMSA 4N0SA 4UWBA 3U6JA 2WQMA 2QOFA 3F3UA 3LMIA 2W4KA 2YWPA 4EQMA 4AA5A 1KUTA 4HCUA 3L8SA 5ANIA 2OSCA 3S95A 4EONA 4O7WA 4JDIA 4TPTA 3LFNA 2QC6A 4H58A 5EFQA 3N9XA 1OM1A 5KMJA 4NZWB 5JFXA 4ZTSA 1U54B 3GGFA 3PRIA 4FNWA 5KMIA 5KMKA 3A7JA 3W32A 4D0XA 4RQVA 3F6XA 4M97A 4C4FA 4YHFA 4RIOA 4WG5A 3W0PA 4NTTA 3HMNA 4DH1A 3E87A 3REPA 3BBTB 1OKYA 3RI1A 1L3RE 4O1PA 5CENA 4FV1A 3UNZA 5AA8A 5FDXA 3QBNA 4HNIA 3FQEA 4Q2AA 1JQHA 3KRXA 1Q61A 2W4OA 4BC6A 3CJFA 1UU3A 2W1HA 3AKJA 1CMKE 2ITWA 2UZNA 2CHLA 1YXVA 2W05A 1Y6BA 4OTPA 5HGIA 1NVSA 4R7IA 3ZO2A 5J8IA 1QCFA 2RG6A 4GIIA 5TT7A 1SMHA 2PVRA 3FLQA 3L9MA 4AXAA 4F78A 2QCSA 1FVRA 2CGVA 2Y0AA 3OHTA 3UMXA 2XALA 1UU9A 3R71A 5CF6A 2Y9QA 5HBHA 4RJ7A 5ANGA 4JX3A 4CTBA 4JAIA 4YC3A 4B8MA 4RJ4A 5KO1A 5KHWA 5CI7A 1ZMWA 2BR1A 2PE2A 2BVAA 2XP2A 5HNIX 4P5ZA 4D1XA 4BGHA 2HOGA 2XB7A 3EN4A 4KAOA 2J5FA 4P4CA 2HWPA 4MYGA 4E93A 4GYIA 2C68A 3FQSA 4J71A 3HP5A 5GJFA 4BF2A 5HE1A 4LGHA 2J50A 4DCAA 4AOJA 5ACKA 3ZC5A 1J1BA 4L8MA 2IZTA 1ZLTA 5C03A 4NKAA 3SOAA 2ESMA 4QOXA 3ORTA 5LWMA 5HI2A 4YUQA 1Y91A 4IX4A 4F64A 3WYXA 3BEGA 3JY0A 3GI3A 2Y8OA 3PDTA 3FBVA 3QYZA 3C1XA 5FM3A 5HNBA 3UC3A 3W55A 1G3NA 5KUPA 3QYWA 3U54A 3PZHA 3A60A 4F65A 3KULB 4FKTA 3FSFA 3BYOA 4BI2A 3S0OA 4HZSA 3RHXA 3NCZA 5DFPA 4WBOA 3QRKA 1M2RA 4DEEA 4JR7A 4BCPA 4C4EA 4FEUA 1LPUA 3Q60A 5EQPA 4CG9A 2PE0A 5LOHA 4PNIA 3FPMA 2QHNA 2W99B 4FTNA 4E7WA 5L2WA 5AMNA 3W0RA 4UMUA 4TNBA 3L9PA 4WD5A 5JGDA 2WTVA 2QG7A 2ZV9A 3VC4A 3SC1A 4NU1A 4EK4A 4USFA 3ROCA 4E20A 3DBQA 2ACXA 3PXQA 4C2WA 2ZM4A 4O83A 3A7HA 5E1SA 5CQWA 3VUTA 3NZ0A 1Q5KA 2C6KA 4JI9A 5AUXA 4F63A 5GIOE 3QL8A 2IZSA 4BBEA 4O91A 3F5GA 4IBMA 4CKJA 1NW1A 4RC2A 2X7OA 2PU8A 3FZTA 3HVCA 5BVWA 4U80A 2J0MB 4AGWA 4MK0A 2PL0A 4FEXA 3QWJA 4AG8A 5JGAA 3E93A 2E9UA 4IIRA 1TQIA 2HZNA 2X8DA 2ZDUA 4NWMA 3ROYA 1OBGA 2P0CA 1XBAA 3EKKA 3P7AA 4IM3A 5DE2A 3MIAA 5BNJA 5C8KA 4AWIA 3NMUF 4FJVA 4FV4A 2W17A 4XCUA 2YM7A 4HGSA 4I6QA 4BIDA 2XKFA 3PRFA 4M69A 4YJOA 4R7HA 4FIJA 5DPVA 2P3GX 2X0QA 2BAKA 4DHJA 2WZJA 2OI4X 2JDSA 2R3GA 1QPCA 4C02A 4BJJA 4MNEA 2VO6A 4DGGA 1O6LA 2PY3A 3L1SA 4WNOA 3R7OA 3PIXA 4FTJA 3SG8A 3KF4A 1SM2A 4I94A 4RWJA 2ETKA 4QDEA 3FDNA 2CGWA 2AC3A 4GW8A 3SXRA 4EZ3A 5CXZA 4DDIA 3ZRMA 5AEPA 2YISA 2IW8A 3UJGA 3CGFA 2VTQA 3C5UA 2PYWA 2XNGA 3DV3A 2G9XA 3ZM4A 3NIZA 2B9FA 4PDSA 5F9EA 3RZFA 3P79A 4BCOA 5JRSA 2HXQA 5HO7A 4KS7A 3HMMA 3T3UA 5JMSA 4AAYA 2PMNX 4F70A 3JS2A 4OT5A 3QGWA 2QR7A 5BUEA 4YBJA 4FSZA 5L6PA 3TG1A 4ERWA 4Z55A 4MBJA 3UZRA 4DHIB 3NLBA 4AZTA 2PUUA 4QNAA 3C4CA 2W1GA 1KE5A 4WOVA 4ANNA 4NTSA 3RPOA 4BDJA 2C6IA 3F9NA 2AEGA 1Z9XA 4LV8A 3ZLSA 4QTDA 3R2YA 4AXDA 3BELA 2JIVA 4U45A 4KBKA 5KNJA 2YM3A 3P4KA 3VF9A 3SW4A 4EH9A 2F7XE 5HORA 1H0WA 4FODA 1M17A 3R1QA 4Z9LA 4O0VA 4YZNA 3M2WA 4OBQA 5L2QA 3MFSA 2CN8A 3QQGA 3R7IA 4E6QA 4DFUA 2BRNA 4QNYA 4C59A 4DH3A 5AFVA 2QR8A 3C4FA 4C62A 3ORZA 1ZY4A 3KY2A 4PX6A 3VW8A 3WILA 4ASEA 2PULA 4JXFA 4XOYA 1GIJA 4LL5A 2I0EA 5M4FA 3HNGA 3I5ZA 4C4JA 1ZRZA 4HJOA 4G3DA 3KCFA 4NH1A 4F9WA 2EU9A 3MA3A 3AQVA 1FGIA 3JUHA 4IM0A 4ZK5A 2YIWA 2YHVA 5CXHA 3TIZA 4D2WA 4ZS0A 2XIKA 3UIMA 5A6NA 3HECA 4JG7A 4PDOA 3KXXA 2CJMA 3Q4CA 4R3RA 4TYJA 5BVKA 5B7VA 5EI2A 5HG9A 2WEIA 2OIBA 2B1PA 4PL5A 5ITAA 4O2PA 2YDKA 3OTUA 1ZARA 3COMA 2PK9A 2CLQA 3FY0A 4AN3A 4RG0A 1A9UA 3ZBFA 1ZXEA 2P33A 3OEFX 4JG8A 2UZLA 5IZFA 2E9PA 1M7NA 3NUSA 5AX3A 4YTIA 5LVMA 4J96A 4FVPA 3V01A 4KA3A 4BI1A 3RAWA 3POZA 4ZMEA 3HRBA 3R9OA 3EMGA 2VN9A 4WNPA 2VWZA 3F2AA 4II5A 3IDPA 2B52A 4AQCA 4CLJA 4IQ6A 1H1SA 4Y73A 5BVEA 4BGGA 2NO3A 3NGAA 4CV9A 3AT4A 2CDZA 5JKGA 1SZMA 2JAVA 2A19B 2GFCA 1JNKA 2FH9A 3CD3A 2EB2A 1AQ1A 2R5TA 1WAKA 2X2MA 4FNZA 4FV3A 5JEBA 1JOWB 4FL2A 2BILB 4FTUA 4GJ2A 5DWRA 4ZIMA 2HAKA 5FEQA 4JDKA 3FYKX 3DXQA 4N4SA 4AFJA 4CMUA 4D2TA 3OTVA 3TKUA 3UODA 2O3PA 4FL1A 1OL1A 3VUMA 4EC9A 3HUCA 5FTGA 1XH9A 4TYHB 4F7SA 2OFUA 4XH6A 3ZSIA 2XMYA 4MHAA 1FINA 4QMQA 5J5SA 2R3PA 3WZUA 3UGCA 3HYHA 3DB6A 4AZEA 4C33A 2UUEA 5J95A 2B53A 3O23A 5L4QA 4BBMA 2JBOA 1PXKA 2OZAB 3BE2A 2VTAA 3MESA 4K18A 4EWHA 2ZV7A 5D10A 3BLQA 1Q3DA 4D9UA 5DT3A 3V5LA 5B2KA 3CY2A 5J79A 4QEBA 1JSUA 2VTOA 3TZ8A 2GNLA 5DI1A 3LMGA 5DNRA 4AA4A 2VV9A 5AP3A 2CCIA 3MGYA 1QPDA 2JKKA 3QTZA 3TZ9A 4HVHA 3NUYA 2C6OA 2CKPA 3IDCA 3DKGA 3QQUA 4XV2A 3MIYA 4KSPA 3MJ1A 4YO6A 3F66A 3RPSA 2YCRA 4IACA 2XAOA 1Q3WA 2ERZE 3DJ6A 3NFFB 4EORA 5AUZA 5I4NA 4OAUC 2GQGA 3ENMA 4FE2A 4S2ZA 2CSNA 4GUEA 4E4NA 3MPTA 2YA9A 5KMNA 1FQ1B 2YM4A 2UZOA 4FSRA 5HD4A 2XK6A 3MYGA 1PXPA 2QOKA 4QMWA 3G33A 3ZZEA 4AT5A 4H05A 1YOJA 4FKOA 4BHZA 3TCPA 3P0MA 4FC0A 5TR6A 4G3CA 3EOCA 2J90A 3OEZA 4J98A 3K3IA 4LL0A 5E1EA 5HOAA 3PA3A 4Z7GA 3UO5A 3PFYA 3RK7A 1Q24A 4GG7A 4W4VA 4HW7A 4I4FA 2NPQA 4ZTQA 4XS2A 3DBFA 4DHFA 3N4VA 3NUXA 2F2UA 5EM8A 5HBJA 2OF2A 3AOXA 4GU6A 4QMXA 3QD0A 4AXEA 1DAWA 5DRBA 3VUHA 2YJSA 3Q32A 3U9CA 3NUPA 2X2LA 2ITUA 1SNXA 4EH3A 1XH6A 3DBEA 3R7EA 3V04A 4RPVA 3GC7A 3WF8A 4DFBA 3PXKA 4FTMA 3D7TA 5IPJA 1NXKA 3LXPA 1R3CA 2WKMA 1O6KA 1QL6A 4I20A 3NNVA 5FG8A 4P90A 4GRBA 2HCKA 5HCXA 5M51A 4EUTA 3THBA 4W9XA 2PPQA 1WBVA 3UOKA 4PMMA 5BYZA 4P2KA 4GKHA 2XH5A 3ORMA 2WFYA 3LKMA 4EQUA 3GFWA 1H0VA 3KMUA 3R8LA 2WQNA 5CT7A 3U4WA 4BIEA 4EOIA 3TV6A 3GQIA 4A9RA 5LMBA 5HLWA 1OBDA 4ITJA 4JDHA 2ITOA 3QWKA 5EYKA 4DYMA 2WMWA 1WBPA 4HOKA 1YWRA 5ANJA 3EQIA 5IMXA 3LXNA 3D4QA 2X0PA 3F61A 3OWJA 4FEQA 3WYYA 3L8XA 2C3IB 3BX5A 3D7TB 5FXSA 4EHVA 5B2MA 4MXYA 5LMKC 5FDPA 2PUIA 5E8UA 2OK1A 2WTDA 3PA4A 4K77A 3GFEA 4Y5QA 2H6DA 4DFNA 5A54A 4RVTA 3ZU7A 2Y4IC 5JK3A 4ZP5A 3POOA 3VJOA 3FJQE 4I41A 2ETMA 5I9ZA 3HDMA 3SW7A 5C9CA 2GSFA 4F9BA 4O4DA 4M67A 4IAAA 4UYAA 4WHZA 3U55A 2A0CX 5EHOA 3NSZA 1XBBA 4L53A 3I60A 4L7FA 1MRUA 5FP6A 3FXWA 3IECA 3NW7A 2V0DA 4IVAA 5CSHA 5HG5A 5HO6A 2BRGA 5BX0A 5IU2A 2ONLC 2NYAA 3AT2A 1OVEA 1KE7A 3BHVA 4O2ZA 3UNJA 4B9DA 3HAMA 3GUBA 3HL7A 3VIDA 2W4JA 3IW7A 4U7ZA 3ENHA 4QMZA 2XF0A 5CS6A 4XMOA 2JIUA 5BVOA 4FVQA 3BYVA 5BYLA 1RW8A 4ORKA 1UVRA 2GHLA 1ZYSA 2XNPA 4YR8A 2QOLA 3TTIA 5A9UA 4YO4A 2WO6A 5DVRA 2PHKA 2R3KA 3E63A 3LHJA 5K3YA 4XG6A 1MQBA 2C4GA 1OL2A 4QQJA 4G3EA 3DK6A 2X8IA 4UZDA 3VBXA 1W83A 3B2TA 3IKAA 4IAIA 4KSQA 3W1FA 1UKHA 2G1TA 3H0YA 1JKTA 2JFMA 2C0TA 4RJ8A 4PQNA 3O96A 4DITA 4DBXA 4ZY5A 1W2CA 4IW0A 2JKOA 3HUBA 4EOMA 2XM8A 4I4EA 4ID7A 3NPCA 4RFMA 2A1AB 5GZ8A 4GEOA 3ZO1A 4E73A 2PMOX 1WVYA 5A4CA 3PPZA 3BWFA 3MW1A 4FK6A 3R9NA 4CMTA 1XWSA 2PZ5A 4QO9A 3KXNA 4ZEGA 4BHNA 1IASA 4YJPA 4FTKA 3L9LA 3LCSA 4FSQA 3G51A 4DDGA 2OZOA 2PWLA 3C0IA 3P7BA 3VONA 2F9GA 3QXPA 4UALA 3VO3A 3P5KA 1K2PA 3BIZA 3IGGA 5HESA 2WIPA 2O5KA 4M13A 4F0FA 1PYXA 3ANQA 3H9OA 3RK5A 1Z5MA 4OTFA 4O27B 5HE3A 3PUPA 1K3AA 4BZOA 2FO0A 2W96B 3CBLA 3DTCA 3T9TA 3UOJA 3LFFA 1RDQE 3QQLA 3FHRA 4O0XA 4ZOGA 4XG4A 3TI1A 3BU3A 2QURA 5EH0A 5C8MA 3V8WA 3DXPA 2VX1A 4ZY4A 3SXFA 4QYHA 5AUWA 1JSVA 2X4FA 3V8SA 5JN2A 1WBOA 1V0BA 1MP8A 5CWZA 4G6OA 3EJ1A 3K2LA 4F9CA 4M0ZA 4AU8A 4CLIA 2UZUE 4W9WA 3AC3A 5CVFA 2E9OA 3RAIA 3PLSA 4L67A 2XJ2A 3F82A 4BZDA 4S32A 5KZ0A 3R7VA 5CASA 2ITNA 2X4ZA 3PY3A 4CV8A 4EHGA 1STCE 3BLHA 3V6RA 3QD2B 2C0IA 3NNWA 4ACCA 4IZAA 4JMQA 3HEGA 3M42A 3O5AA 5KX8A 4QMLA 4RVLA 5L2TA 3U87A 4DAWA 4U41A 5KBRA 2B0QA 4L43A 4KIKB 3A4OX 3Q6WA 3RCJA 4XOZA 4A9TA 3VUKA 1G5SA 1EH4A 2JAMA 4TYGA 5EDRA 3TJDA 4U8ZA 4DH7A 4EJNA 4PP7A 4GKIA 1L8TA 1YW2A 3BHYA 3R22A 3PVGA 4BCGA 2O64A 3DS6A 2ITPA 4IZYA 3D5VA 4XG2A 5AV3A 1OUYA 4HCTA 3HV4A 3UVRA 3UC4A 2ZMCA 1YVJA 3P78A 3UMWA 2ITQA 3ZH8A 4ENXA 3HAVA 1J3HA 2XJ0A 3SAYA 3TNWA 1Q62A 2P55A 2WMXA 5I9XA 4C34A 3S00A 1DI9A 5LMKA 4YLJA 3E64A 4Z3VA 4FSYA 1SVEA 2WU6A 3PJ2A 4RC4A 4XHKB 5HLPA 4MWIA 4XG7A 3U51A 4RJ6A 5JSMA 2FSMX 4EOKA 2RIOA 5FEDA 5GIPE 3GU6A 4MBIA 5LVOA 2HWOA 4L3PA 3VBQA 4C3RA 2OFVA 3BLAA 2VD5A 2ONLA 4FZ7A 3GCSA 2FSOX 2VTJA 4K9YA 4FKUA 4RVKA 1T45A 5IH5A 3R00A 5JFWA 4ZJVA 3GC0A 3GENA 4A4XA 4FKQA 4B6LA 5FM2A 3OD6X 4FIGA 4MUQA 4F4PA 4FRFA 3UPXA 4B99A 1V0PA 5LWNA 1IRKA 4QQCA 3F3WA 5EW9A 2Z02A 3QZIA 2Y4IB 4C2VA 5H2UA 2ZM1A 3R28A 4YPDA 2FA2A 4IFGA 2GU8A 2XK7A 4FSMA 5DMZA 4RLLA 2FB8A 4KD1A 1PMVA 5HX8A 3MVMA 1WBTA 2X6EA 4EC8A 4KRDA 3ZLXA 1Y8YA 2OLCA 2R3LA 2X0OA 5L3AA 3PJCA 3DBCA 3FMEA 2VRXA 4D5KA 4JG6A 2WMQA 3F5PA 4D58A 5DT4A 3V51A 5B0XA 4PTCA 4E5WA 3DXNA 5AM6A 3ULIA 2CNQA 4R7BA 4AE9A 4CNHA 1KV1A 2WTCA 4CCBA 1OL6A 4BCHA 4D1SA 5JRQA 3UYSA 1H1QA 2YLFA 4EBVA 4AQKA 5HU9A 3I79A 1PMUA 2WHBA 4I5PA 4I6LA 2I0YA 4I24A 3BU5A 5AAFA 1REKA 4CG8A 1UWJA 4EH6A 4D2RA 4QP2A 1FOTA 4A06A 1G8JA 2I40A 2X9EA 4CT2A 5AAGA 2F4JA 5A14A 3DNEA 1U4DA 5AUTA 2UW9A 1OL5A 5TE0A 4C61A 3UBDA 2C6EA 3PJ1A 4QP9A 4DGNA 4IADA 4JNWA 3LLTA 4OTWA 5DR9A 5LVPA 4LMUA 5M4CA 2BAJA 2XARA 3CKXA 2BKZA 2UZBA 1OPJA 3OUKA 3ZO4A 1U54A 1FVVA 2YIRA 3ORLA 5HICA 1Q4LA 3PG3A 4FT7A 4J52A 3RCDA 1P4FA 5EW8A 4O96A 3PXRA 5ANEA 3W2CA 1APME 4UV0A 5JFSA 4BDCA 3EZVA 3AKLA 4QD6A 2VTLA 1OGYA 2I0HA 2E9NA 2OJJA 4CFFA 2OJIA 3AG9A 3SDJA 4AW1A 3DNDA 5BVNA 2B55A 1OKZA 2GNGA 2YFXA 2ETRA 3BEAA 3KXZA 4MNFA 1BUHA 3EN7A 3BWJA 4L3LA 3EYHA 4R1YA 2J5EA 4FTIA 4FNYA 4I0SA 3QCSA 5AUYA 5KE0A 4YZCA 1MRVA 4AGUA 4C38A 4D4YA 4FKIA 3U4UA 4X2GA 5AV0A 1J7IA 5IA0A 5AX9A 4DN5A 2WELA 1YI6A 3FMLA 2UVZA 4MF1A 3RM6A 1W2FA 2GS2A 2WMUA 4ALVA 3E8NA 4MXCA 4AAAA 4NW5A 5DEWA 4RRVA 4WSYA 1TZDA 3VS0A 4BCMA 5IA1A 4AW5A 1R0EA 2ITVA 3R1NA 3OXZA 3IGOA 4FV7A 2BIYA 5E8WA 2QNJA 4HCVA 4RZWA 5HVJA 3ZS5A 3PWDA 3M11A 4QP7A 5ETCA 5HTIA 4DEIA 4O4FA 4EEVA 4UMPA 3ZO3A 4FEWA 3RMFA 3CTJA 4WKQA 4I1ZA 3EQCA 2WAJA 3ALNA 5DT0A 3OFMA 2WPAA 4MD8E 4DEGA 4RWKA 1JKKA 3HA8A 4HGEA 4Z7HA 1TQMA 3MY5A 2QOIA 3GVUA 5G6VA 4HVDA 5FLFA 4QMUA 2QKWB 3ACJA 2RFNA 3F88A 4K0YA 1U5RA 2OICA 5HIBA 2YITA 4WO5A 5TKDA 3ZYAA 4BDGA 5E8XA 4EH8A 3BQRA 5EKOA 2C5NA 5C1QB 4FR4A 3ACKA 3EL8A 4U42A 4HYSA 4O6LA 1HCKA 5CNNA 3DZQA 3EHAA 4MQ2A 4NCTC 4R8QA 3MS9A 4JIAA 4G16A 2A4LA 3KULA 4V0GB 1YRPA 2BCJA 2HY0A 5AP1A 3OT8A 4PNKA 4YJNA 4ZJIA 1M2PA 5IQFA 3QLGA 3C5IA 1W98A 3R1SA 4UXQA 4X7QA 3CGOA 4UZHA 3VNTA 4CEGA 2PVHA 3AT3A 4LV5A 4MAOA 4YBKA 4PY1A 4C7TA 2R0UA 3P9JA 2OXDA 2VTPA 2VTMA 1XH4A 3F3TA 3OWLA 3AC1A 2G2HA 4J97A 4HGLA 3RP9A 3UVQA 3DCVA 3F7ZA 4GK2A 2PUPA 1JAMA 2F57A 3AD4A 3R0TA 4FKVA 4AACA 2XNNA 5BVFA 3UQFA 1B38A 2Y4PA 4Y46A 2C5XA 2UZEA 3H10A 4G9CA 3TUBA 3I7CA 3MVLA 4UEUA 4I22A 4DTBA 2BRBA 3R7GA 4N6ZA 2YM5A 3EYGA 1ZYJA 2WTIA 2PZRA 1PF8A 2VX3A 3VAPA 2IJMA 3ORNA 3DAEA 4ACDA 3F7WA 4F6WA 4RIWA 1QPEA 3ALOA 4GL9A 4F1TA 4BRXA 1R78A 5E9EA 4IC8A 4D28A 5C01A 3UPZA 4CFVA 1ZMUA 1IEPA 3OY1A 4EOLA 4FI1A 3QKMA 3R21A 5CNOA 1H8FA 5M56A 2EB3A 3K54A 1UWHA 4OUCA 2XNMA 4DC2A 3LFAA 1UU7A 3AMAA 3PTGA 4IZ5A 5CSWA 1U59A 4L68A 4BDKA 3T8OA 3ORXA 4MTAA 2C3LA 3LE6A 3QX4A 4MXOA 4J95A 1J7UA 3ORKA 2Y6MA 4BL1A 5A46A 4YC6A 1KE9A 3QTWA 4FIFA 4MEDA 4EK3A 4RIWB 1LEWA 5I0BA 3RINA 3UZPA 4IB0A 5T6KA 2VWBA 1OKWA 4ASDA 3D14A 4UBAA 3H30A 5HKMA 4E5BA 5L2SA 3KIOC 3R8PA 3Q4UA 4W4XA 3Q52A 5FUTA 3OW3A 5DYJA 2OH4A 2DS1A 3F69A 2R3JA 3OWKA 4O0SA 2WTJA 1PHKA 5EHYA 3WOWA 5IQCA 5E8ZA 4EK5A 3FKOA 2YIXA 2BALA 2BTRA 4X2FA 4PV0A 4XBRA 5BPYA 4YGAA 3V3VA 3MJ2A 4OTHA 5CAPA 5EYCA 3KMMA 3KVXA 4TN6A 5HX6A 3W0QA 4LMNA 4ZTRA 3A8XA 3G9LX 4QYYA 5AR2A 2CGXA 3W2SA 2VZ6A 4D2VA 4HVSA 4CKRA 4YSMA 3NUUA 2C1AA 5E91A 4ZLZA 5L6OA 1PYEA 2OG8A 4FTTA 5IA5A 3MFUA 4ANSA 3BKBA 2RFEA 3HV6A 4I0TA 5CANA 4CGAA 3G5DA 1FMOE 5FGKA 2UVYA 2NNWB 4AGDA 3EZRA 2QOCA 4CFWA 1JKLA 3A2CA 3FAAA 3KK9A 3CQUA 4R3PA 4K11A 4K6ZA 5EM5A 1X8BA 3NEWA 3R8UA 3LAUA 5M53A 3ZM9A 3CJGA 3IPHA 3LCTA 2JC6A 3LJ2A 4W8DA 5DA3A 4B7TA 5KHXA 5IQEA 1W2DA 4C36A 3HGKA 4JIKA 4NK9A 4YJTA 2I7QA 1OPLA 3NS9A 4QMSA 3R73A 3H9RA 3WI6A 4MXXA 4LV7A 1CKIA 2P2HA 3UYTA 3GCVA 1ND4A 3QC4A 4EOSA 1KV2A 1H07A 4YZDA 3HRFA 4MQ1A 2UW5A 4EH5A 4F7NA 4KNBA 2XKDA 3W2PA 4QPMA 2RGPA 5C4LA 4NCTA 3PE1A 2ZJWA 5CVHA 5CTPA 5L6WL 3ZCLA 4D4VA 2J2IB 3R04A 4S31A 5BMMA 4BWKA 3EFWA 2AUHA 2PVLA 2W9ZB 3CIKA 4E1ZA 4UWCA 3LFBA 2XBJA 4WG4A 1OIRA 4XRLA 2YCSA 2IVSA 4QMOA 2VX0A 2O8YA 1SYKA 2EXEA 2HENA 4YZBA 5A3XA 4L00A 5CEOA 5AR4A 3GQLA 3VS6A 2W1IA 2NRYA 3RVGA 2OXXA 3ZUVA 3LZBA 3O8TA 4XV3A 2WMBA 3VBTA 3OT3A 4B4LA 2JGZA 3EQDA 2HZ0A 1Z57A 5I3OA 2XBAA 5AIRA 4EH7A 2OXYA 3OW4A 1PMNA 1XBCA 5DN3A 5CY3A 3H9FA 5AV2A 2CKQA 4ZTHA 3QGYA 2JBPA 3SVVA 1MRYA 4ANMA 5AIKA 3TUCA 2GHGA 4J99A 1CM8A 4TW9A 2GCDA 4G6LA 5M4UA 3P7CA 4A7CA 3VUDA 3DKCA 3R8ZA 4BICA 3BV3A 4U3ZA 3JYAA 2OW3A 4G9RA 4GT5A 3GU4A 4F1OA 3NUAA 1DI8A 4X2KA 4O7LA 3EQPA 4X3FC 4D1ZA 5K0XA 4RVMA 1GZOA 3C50A 3BE9A 4GCJA 4MCVA 1YI3A 2R3NA 4XV9A 3UTOA 3DZOA 3EN9A 4IDVA 4BTJA 4JL9A 2EWAA 3NIEA 2CPKE 4GYGA 1DAYA 4R5YA 3KVWA 4TYHA 5KCVA 2Q83A 3N4TA 4ALWA 3R7UA 2O65A 4DEHA 1UKIA 4MF0A 1YXSA 3AXWA 3VWAA 4PPAA 5J7BA 3RKBA 2C3KA 1JWHA 3A7FA 2XYNA 4IH8A 3CTQA 4IM2A 4DLIA 3HLLA 5H8BA 2OZAA 4JR3A 4L7SA 1DM2A 5I9UA 4D55A 3D83A 1G8KA 3BL9A 3FMDA 3ZDIA 4EOQA 4CFXA 2BRHA 2GNJA 4FK3A 3TV4A 4CD0A 4Z16A 4ZAUA 5CU2A 2WMRA 2R3QA 3IW4A 3VW6A 4BWXA 3W0NA 2RFSA 2X6DA 3D5XA 4U6RA 4FL3A 1IAJA 4GU9A 2VTHA 2FYSA 2PUNA 1BI7A 1FMKA 3TNIA 3FZRA 2XK4A 5HG8A 2UZDA 3IW5A 3VF8A 3WF6A 5F94A 2OGVA 3DT1A 1VR2A 4FX3A 2BHHA 3MFTA 2BHEA 3Q2JA 4CVAA 2WTKB 3K5UA 3RZBA 2J0IA 4YZ9A 3JXWA 2JKQA 2UZWE 1OMWA 3LFCA 3LFSA 3OZ6A 4AS0A 5HTCA 1H4LA 2EXMA 2O0UA 3ZLYA 4FSWA 2FSTX 2OJ9A 4FV9A 3W8QA 3NFGB 1OIUA 5HHWA 4FGBA 3W33A 5CEPA 2RF9A 4YU2A 2PVKA 3OXTA 3V6SA 3WF9A 5HLNA 5L8LA 5J1VA 4I92A 1A