4AGUA

Crystal structure of the human cdkl1 kinase domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
290
structure length
277
Chain Sequence
EKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFARLLTRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLKGCLHMDPTERLTCEQLLHHPYFENIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human Cdkl1 Kinase Domain
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords CYCLIN-DEPENDENT KINASE-LIKE 1
total genus 86
structure length 277
sequence length 290
chains with identical sequence B, C
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4aguA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aguA01
3K5VA 4ORKA 1PKGA 3BCEA 3UODA 4QRCA 3VW6A 4FKUA 4HOKA 4F09A 4FZDB 4HZRA 3VS5A 5HLWA 4L9IA 4LL0A 3PJCA 4AZEA 1W8CA 2UVYA 2QOFA 2XK4A 1YRPA 4NK9A 2XF0A 4FT5A 4E26A 3PE1A 3BV2A 4GS6A 4LMNA 5GZ9A 5JQ5A 4X2JA 1BMKA 2ZV8A 3D2IA 4K18A 3VF8A 2O64A 3RP9A 4D1XA 3MESA 4FT0A 4P5QA 5L2WA 3FMKA 2WMBA 4UMPA 2J7TA 5CF5A 4ACMA 4XRLA 5FXRA 1JKSA 4FUYA 4MBLA 4KRDA 3WIKA 5L6WL 2WMVA 3FC1X 4GCJA 4ZJJA 2V5QA 3NUPA 3ZBXA 5L3AA 5E9EA 3CS9A 3OROA 4HYHA 1VJYA 3ZZWA 1W0XC 5CF4A 2J0KA 3PVGA 3LAUA 5EHLA 4S34A 4G6NA 5AP6A 2BDWA 4EH2A 3Q4CA 2EB2A 4MF0A 4FUXA 3DBCA 4RX5A 2QOHA 1R0EA 3UNZA 1G8SA 4KB8A 4CZUA 2QOBA 2C68A 1T46A 3HV4A 4K33A 4CYIA 2GNGA 3PZEA 3DXPA 3AOXA 3MVHA 2P55A 2UZBA 2EXEA 3ORLA 4BCJA 2HAKA 4AT5A 3OD6X 4DEGA 3KL8A 2QG7A 4F65A 3E3BX 4XG3A 3GQLA 2X8DA 3KA0A 3M1SA 5ACBC 3VUKA 5M51A 3R8PA 4CKRA 3CEKA 5DRDA 4UWCA 1CMKE 5AV0A 4BDEA 5HTBA 2QR7A 1KV1A 4MNEB 1P4FA 4YNOA 4FT9A 4QYYA 3COHA 5EFQA 3E7VA 4BTKA 4YZCA 1J3HA 3QUDA 5CXZA 5IA0A 1MRYA 4H39A 1FINA 5IUIA 3HYHA 3K3JA 5E1EA 3R9OA 3VBVA 5E91A 4DH5A 4F6UA 3EQBA 4FBXA 2QOQA 2HW6A 3MB6A 4ACDA 1Y6BA 5B2MA 2B9JA 4FSZA 2IJMA 4H58A 5CSWA 2W1DA 5LMBA 2RFEA 4PPAA 4EONA 3DJ5A 3RK9A 4ACHA 4F9BA 4GMYA 4H3QA 1GZKA 2B52A 1XH9A 2BRHA 4DTAA 1YDSE 5BUEA 5EM8A 4RJ5A 3D7TB 4ZSAA 3R8VA 1OVEA 4LMUA 5IH5A 4FKVA 3D2KA 4ZSLA 4ZZMA 4I23A 3UG1A 5K4JA 2ONLA 2XNMA 4M15A 1Y8YA 1MRVA 3C4FA 4OTIA 3EN5A 3OFMA 5JN2A 2QOKA 2QC6A 3ZS5A 3NPCA 4O7ZA 4DG3E 4LGDA 4YZ9A 4PTEA 1I09A 4USDA 4J53A 4BN1A 3EYHA 3FKLA 3QYZA 3I6UA 1Q8WA 4BCOA 4FSQA 3F7WA 3TNWA 1ZZLA 3IW4A 4BDHA 2XUUA 1OKVA 4FNZA 5IUGA 3OTUA 3AQVA 4IDTA 3IKAA 4MKCA 3R7OA 4PTGA 4RG0A 3PDTA 4QYHA 3R01A 2CGUA 5AJQA 1OL6A 3SW4A 4AT3A 4DEAA 4AOTA 5AA8A 4NL0A 4TWCA 2CKOA 4J71A 3LCTA 2X1NA 2JDSA 2J6MA 3V8WA 2HY0A 1OUYA 2OSCA 2OI4X 4BDIA 3V3VA 2HCKA 1QL6A 3BGPA 3C1XA 2IW6A 4ZLYA 3NUYA 2BAJA 3FLYA 3F3VA 4XG4A 4YTHA 4ZK5A 4FTCA 4IMYA 2YIWA 5DT0A 3QC4A 5BVFA 3O7LB 4FL2A 3ZZEA 4YR8A 1JKLA 5H3QA 4TZRA 3WYXA 3BHVA 1V0PA 2ZVAA 5L8LA 3MH1A 4L52A 4ZAUA 3P08A 4EH8A 1QPJA 3DQXA 1QPDA 4H36A 5AUWA 3IW6A 4UMUA 4PDYA 3W33A 2Q0NA 3AMAA 4YZBA 3PE2A 4MXXA 4FTIA 4E73A 2ITXA 1EH4A 3LIJA 2WIHA 4BDFA 3L8XA 3DNDA 4KUJA 4EHZA 1OIUA 3GCPA 4I21A 4O0YA 4LGGA 2C6MA 3PSBA 1BUHA 2XYNA 4FT7A 4O96A 4RWLA 4CNHA 3A4PA 5HE0A 5K4IA 5IDPA 1SZMA 1GJOA 1ZY5A 2I40A 3EN6A 3DB8A 4BTJA 4EKKA 4Z7HA 2GQGA 3R1NA 2C1BA 5JRQA 2C3JA 5HGIA 3D15A 5HBEA 4DEDA 3T3UA 5J1WA 3VO3A 4GU6A 4ZIMA 4ZS4A 3IDCA 3HRFA 4U8ZA 4QD6A 4ZZNA 4FTMA 2XJ0A 4HGTA 4BI0A 5I9WA 2XJ1A 3PIYA 1Q99A 3CR0A 3IW8A 4BZOA 5IF1A 3CC6A 3BI6A 5BVEA 1SVGA 3QHWA 4QQTA 5EW8A 3TTJA 4TKSA 5LXMA 4H1MA 4U3ZA 4FODA 3SG8A 3LQ8A 3FYKX 4R5YA 4S33A 4F6SA 3BYSA 2YCFA 1LEZA 4CV9A 3B8RA 4ASEA 3FSFA 4FYNA 4FTKA 3KF7A 2C6KA 3R63A 3MB7A 2LAVA 5J9LA 3HRBA 2CNQA 3KVXA 4MD9E 5HBHA 1WBVA 4QTEA 3VQHA 1OBDA 2J5FA 4EOOA 1CDKA 3ALNA 2ITWA 3OBJA 3TT0A 3P1AA 5K9IA 4I3ZA 3QCQA 4DEEA 4DBNA 2XP2A 3BU3A 3A61A 4JIAA 4XLVA 1UWJA 1YOMA 4WKQA 5ETAA 4WG4A 2BMCA 4HVSA 3ORMA 2RF9A 3WYYA 2OGVA 5B2LA 4QP2A 4BB4A 4V0GB 4GIIA 1Q24A 1KE8A 4EOLA 4YLLA 3I1AA 3QUEA 3UVPA 3VJNA 3LMIA 2W96B 2IPXA 3DS6A 1H26A 5FEQA 4RIYA 3HX4A 2BIKB 3W2CA 3K2LA 4ENYA 3QD2B 3UZRA 4QP4A 2PUIA 5AV4A 3JVSA 3KRLA 2F9GA 4UYAA 4RIYB 3S00A 5DR6A 2UZDA 4QMWA 4UMRA 5LVPA 1Y6AA 1UNGA 3OWLA 3V01A 2XEYA 3LM5A 5H8BA 4BCGA 2QOLA 5CEIA 3AT2A 3PRIA 2GNFA 4C7TA 1Q41A 4DAWA 4AA4A 2QOIA 3G2FA 2WFYA 2WTJA 3EB0A 2R3RA 1YXTA 1ZARA 3AC1A 3PG1A 4IAKA 4QP9A 5IQFA 3DKFA 5J95A 4OAVB 3GBZA 3ZFMA 4WNMA 4DGLC 1DI8A 4FGRA 1BL7A 5F9EA 1ZYLA 1Y8GA 2R2PA 4A4XA 4ZMEA 2YFXA 5M4UA 2JIIA 3UZTA 1VR2A 2B4SB 4KSPA 3RCDA 4ZSGA 4FIEA 3TDVA 4LV5A 4RZVA 4YUQA 5AR7A 4PDPA 5AR5A 4ZSJA 4IAAA 4RWJA 4TNDA 3WBLA 2QHMA 4D2VA 2WMWA 4FZFB 2G01A 3WF7A 3F2NA 5L6PA 3ANRA 3C0HA 4JAJA 4XV1A 3MFTA 4O2PA 3QFVA 4E5BA 4F6WA 4G2FA 4A4LA 1ND4A 3GU8A 3Q9XA 5B7VA 2FYSA 3DBEA 4IEBA 1OB3A 1YDTE 3G6HA 3HDNA 4TN6A 3LFBA 4IVDA 3PVBA 4IAIA 1QMZA 4EC8A 2GDOA 3FPQA 1KSWA 3SXSA 1FVTA 4HYSA 2OJGA 1VEBA 4M7IA 3F6XA 5E8YA 4FE2A 1KE7A 4BHZA 3Q9ZA 1JKTA 5JQ8A 2A1AB 3ORTA 2XZSA 3QWKA 3RNYA 4RJ3A 4RWKA 4CV8A 5J9ZA 5M06A 1LEWA 4EI4A 2DS1A 2BKZA 4AW0A 1REKA 3FZ1A 4D5HA 1Z57A 5J9YA 5IA2A 2XM8A 2FVDA 3LLAA 3OXIA 3MW1A 3F7ZA 4W4WA 2VTNA 3ZSGA 4X2NA 2G15A 4RGJA 5HE2A 4C36A 2OXDA 2YWPA 3UMWA 4EK3A 4RFYA 3OCSA 4DHFA 4O7VA 5KMJA 1G8AA 3MS9A 4NT4A 3F3TA 3OT3A 4TNBA 2QONA 4BGQA 3POOA 2I7QA 5E8XA 2NP8A 4YLKA 2X2LA 3UPZA 5L2TA 4YTIA 4X3JA 4AFJA 3A4OX 4FVPA 3GCSA 3Q32A 3ZDIA 4DITA 3QD4A 4MWIA 2GTMA 5DGZA 5KBRA 3GU7A 4I6FA 5EG3A 2CCHA 4C3FA 3TXOA 4AW2A 3GOPA 2YISA 4M66A 2BILB 1PHKA 1H4LA 4C34A 3WILA 3FY2A 1OPLA 4P7EA 2WQMA 4D4YA 4JDHA 1W84A 1GIIA 2ZV7A 1IG1A 3AD6A 4TW9A 1WFCA 3VBTA 2YJSA 4ZJVA 1YQJA 2ITQA 3LXNA 4IX4A 2ITNA 4YGAA 4BKYA 4C58A 4FV4A 2ZM4A 3QWJA 4I5PA 2EB3A 2PPQA 2JFLA 1K2PA 2FH9A 1S9JA 4JQ8A 4RJ7A 3VHKA 4UZHA 5HCZA 3FXZA 4FIGA 3UP2A 3QXPA 1OM1A 4X3FB 3QRUA 4XX9A 1JWHA 4O1PA 4KRCA 1TVOA 4OUCA 3SKCA 4RA5A 1MUOA 4IWOA 4UWYA 4EUTA 4E3CA 3OCGA 3CE3A 4U44A 1WBPA 4FT3A 5D10A 3TUCA 2PZPA 3GP0A 4O83A 1YI3A 1ZAOA 3OXZA 3A7HA 2Z60A 3V6RA 4CXAA 2DQ7X 2C5NA 4YPSA 3EN7A 1NVSA 4HCTA 3VUMA 4MBIA 4G34A 4J1RA 4BDDA 3BLHA 1CKJA 3FI2A 2CNUA 2UUEA 4EH5A 3LFQA 2WD1A 3HKOA 1STCE 3RPRA 3F88A 5D11A 3ZU7A 3HV6A 4FV2A 5F20A 4OBQA 4ZY4A 5EYKA 2C1AA 4BY9E 1UKHA 2VX0A 4X3FA 4M68A 4PP9A 4XHKB 5FBNC 3TTIA 3LQ3A 1TQIA 3A2CA 2UZLA 3D5UA 3VC4A 4BDKA 4DBXA 1YI4A 4IHPA 5C4LA 2VO3A 5HLNA 4EK6A 3KXHA 4XBRA 3P7AA 2XM9A 3KXZA 1B39A 4DLIA 3R1YA 4BI1A 3IS5A 4M14A 2E9OA 2RFSA 3DFCB 3FDNA 4R3PA 4XG2A 2C3IB 2OKRA 3MI9A 4APPA 3R2YA 3UQCA 1YWRA 4EHGA 1I44A 1GIJA 3ZBFA 4IZ7A 5CZIA 2GHGA 2JFMA 3CD8A 3VNTA 4PL3A 4QOXA 2GCDA 1OKWA 3BYOA 3KXXA 4KS8A 4NU1A 3ZMMA 3ELJA 3JY0A 4F9AA 3BEAA 4W8DA 3HVCA 5CANA 4A07A 4ONAA 3EWHA 4AE9A 2VTTA 1WBNA 2QLQA 2R64A 3ATSA 3Q2MA 2WO6A 4EJ7A 4E5WA 3FBVA 2PK9A 2VTHA 3EQFA 4BICA 4E20A 2BROA 2XBJA 1BI8A 2PE2A 4IANA 1OECA 4LRMA 3ZOSA 4N4SA 5GIPE 4KAOA 3FQHA 4DE4A 2DWBA 3DNEA 4C4EA 2HY81 2RFDA 4FSTA 4IFGA 4IVCA 5IMEA 4PRJA 4YP8A 1GIHA 3QQLA 1F0QA 3WI6A 4E4LA 3NZ0A 2BRGA 4MXYA 2OH0E 5E90A 5BUJA 2YZAA 1LR4A 2WQNA 2ZM3A 3ZRKA 3GUBA 1XH4A 2VWYA 3DBQA 5DG5A 4O0WA 2O2UA 3NYNA 5HG5A 1DAWA 3NNUA 5CQUA 1Q97A 2PYWA 2W1IA 4IX3A 4R7BA 3EQRA 4NCTC 5KMLA 3AT3A 5AM7A 2R0IA 1IEPA 1M17A 4AP7A 5IKWA 2OJIA 4XS2A 3C5UA 4JOAA 3A8XA 2PUUA 4ZTSA 4CQEA 3AC2A 4KWPA 5F1ZA 2GHLA 3U6HA 4GFOA 4R7IA 2UZUE 4A9YA 4EK8A 2XIYA 2EWAA 2VTQA 4BTFA 2J9MA 4YTCA 3DLSA 3P78A 1H1RA 1YKRA 4L7SA 3TCPA 4BDAA 2P2HA 5EKOA 3QUPA 4M13A 2BZHB 5HNIX 2W1HA 3CJGA 4FIIA 3KCFA 3LZBA 1J7IA 2VX1A 2XCHA 3BRBA 4QMSA 4EOKA 3Q4ZA 4F9CA 4YZMA 1RQQA 4C4IA 3OBGA 4GL9A 2J0JA 5TE0A 3JVRA 3L8VA 3PPKA 2GQRA 3R2BA 3QTSA 3QCXA 2UZWE 3UJGA 4FKGA 2VWVA 4QPMA 5CZHA 4YSJA 3GFWA 3PIZA 4YHFA 3TACA 2VV9A 2IZUA 3VBYA 3L9NA 4NWMA 4QMUA 4BDGA 3PLSA 3FEGA 2JBPA 4XG8A 4Z7GA 4EKLA 4NZWB 4BGGA 2HK5A 2PMIA 3FMEA 4IAYA 4USFA 5DRBA 2E9UA 4PTCA 4F08A 4BKJA 5LCJA 3FMJA 2BHEA 3EOCA 3A7IA 1J1CA 3OVVA 4Y85A 2JIUA 3UO6A 3EQGA 4IWPA 5E8UA 4U5JA 4FZ7A 5ETFA 4IDVA 4ZSEA 4AZFA 3R04A 4HGSA 4E7WA 2I1MA 5FUTA 3KGAA 4L67A 1NVRA 5FDPA 4LI5A 5CENA 1O9UA 1OIQA 2BRNA 3NNXA 1Q61A 4B99A 2WAJA 2C0OA 2RG5A 3Q53A 5TT7A 4U7ZA 4AXAA 4TYJA 3E64A 3EQCA 3PVWA 3EYGA 4CKIA 3H0YA 3VUDA 3ZDUA 3EN9A 4N6YA 3UGCA 2X7FA 3DK7A 5CEQA 5IQHA 4FIHA 5IISA 3A7GA 3AC3A 3ZO1A 4HGLA 5DT4A 5GJDA 2NNWB 4ZTLA 4U9AA 3RI1A 3NDMA 3RM7A 2CGWA 3G0EA 4M69A 3PXRA 1IASA 3E7OA 5ANJA 4MQ1A 3QX2A 3RALA 2JDTA 4NEUA 4DLJA 4KKEA 4G5PA 3MVLA 5C8NA 4WD5A 1ZZ2A 4R78A 3OY1A 2HELA 3BGQA 1OI9A 4C0TA 2J0LA 2AC5A 4W9WA 3SXFA 5AV1A 2R3NA 4LG4A 4IVAA 4F1MA 2VWZA 3JR1A 5HORA 3PLAE 2J2IB 3FWQA 1KOAA 3MPMA 5DLSA 3L9LA 2A27A 3SW7A 4FKLA 3QLFA 4BIEA 4JBPA 3T9IA 1CKIA 2UZEA 4YJVA 2R3HA 1U46A 1OKZA 3ZO3A 2GNLA 3H9FA 4CT2A 3GC0A 2IZTA 1MQBA 4F0IA 4FA2A 2C5XA 4KIKA 4N70A 5GJGA 4FEVA 5E8WA 4B8LA 3TM0A 3O17A 4AZVA 2OJ9A 4IM2A 4C4GA 2V0DA 2YITA 5JGAA 2XIZA 3QRKA 4QTBA 3HAMA 5JK3A 4G31A 3PG3A 1OL7A 3QTXA 4FIJA 1UNLA 3HUCA 4L43A 3R1SA 3ZTXA 3DLZA 4DN5A 2HOGA 3UBDA 2JKMA 5EHYA 2B53A 4FV6A 3EQIA 2C5YA 2HZIA 4IX5A 4KABA 4RVKA 4YJOA 3ZH8A 4AFEA 4CFNA 4E93A 2HXLA 4A9SA 2QI8A 2JDOA 4NM0A 5ANIA 5L2QA 4KIOA 4QO9A 3ZEPA 2BTSA 2R3FA 2CLXA 4AACA 4XRJA 5AR2A 4IJ9A 1LUFA 3TZ7A 4BKZA 4E1ZA 3IOKA 5HX6A 3NUSA 4U40A 5F4NA 4DGGA 4TYGA 4TRLA 4EHVA 3KK8A 2Z7QA 3QTZA 4M0ZA 5H8EA 2ZMCA 2J4ZA 2YIQA 3DFAA 2OIBA 4BBEA 1J7UA 1IAHA 4BC6A 1ZXEA 3D0EA 4QTCA 3KVWA 1Q5KA 3JPVA 2JKOA 3BU6A 5CF8A 4EWQA 5AP7A 4G9CA 5HIEA 1RW8A 5HICA 4RJ6A 2OO8X 4QP6A 2PE1A 4MEDA 2W4JA 3TN8A 4UY9A 3D4QA 3FXWA 3OT8A 1YWNA 1OUKA 2W06A 2OG8A 2JD5A 3FUPA 4QMOA 4X0MA 4RMZA 5AUUA 5IQCA 1WCCA 3JXWA 2WIPA 3ORPA 4XLIA 4TY1A 3FHIA 3C4EA 1FMKA 1H01A 3EQHA 3RK5A 5ANEA 4A9RA 5GZ8A 5IH4A 3OOGA 4MHAA 3HV7A 4IB1A 4N0SA 4NM7A 3V8TA 4QMLA 5A54A 3IONA 5GINE 2X4ZA 2Y6OA 4G3GA 2UVXA 5AM6A 2A2AA 4UXQA 3V5WA 3CQUA 5KMIA 4YJUA 4NYEA 2V62A 5ETCA 1HCLA 3U4UA 2ETMA 2EU9A 3I0QA 2ZYBA 3QD3A 3VBQA 4AGCA 4BCPA 3RBWA 3UNKA 2UVZA 4JQEA 3D94A 3SD0A 4A06A 3RHXA 3NWWA 4M84A 3A60A 4FNWA 5CU3A 3AGLA 3PY1A 5AP5A 1CTPE 3WE4A 5BNJA 4UZDA 5J79A 3RAIA 2CCIA 3GVUA 3Q9WA 4EOJA 4L68A 2VGOA 1Q62A 5IQGA 3BPRA 3EFWA 4KKGA 3R83A 3D83A 1RDQE 2IVUA 2ZDTA 3PXQA 4J99A 4WG5A 2OW3A 3W8QA 4RJ4A 4DT8A 4D9UA 4RIXA 2RFNA 1KUTA 5DOSA 5E8SA 3L9PA 4M12A 4Y95A 1PXLA 4AW1A 5ITAA 2VTSA 4CFUA 4O27B 4KD1A 3QCYA 3SX9A 2YZLA 2XS0A 3CQWA 2J0IA 1VZOA 4EH4A 3LXLA 2VTMA 4DFNA 5DN3A 3UIMA 3ZFXA 3ZYAA 4O86A 5IEVA 3O8UA 2C0IA 4GG5A 4BFMA 2VNYA 5FG8A 5M4IA 2GTNA 2FB8A 3NX8A 4FV0A 3RINA 4DFLA 2O65A 4I0SA 2VNWA 4FV1A 3RAWA 3AG9A 3E8DA 4R7HA 3W16A 2QO7A 5F95A 5I9VA 4I92A 2ZV2A 3O50A 4GG7A 1LPUA 3S3IA 3PZHA 1ZMUA 5EM7A 1WBSA 5FTOA 2Z02A 1PYXA 2EVAA 3BELA 5I9UA 4D4SA 3EFKA 3LFFA 3PXKA 1ZLTA 4EH3A 1XH8A 3V5TA 3QRJA 3ODYX 5TOZA 3FPMA 3KXNA 5C8MA 4U42A 4C59A 4GIHA 5HNGA 2PZRA 3ULIA 2UZTA 4CD0A 1MP8A 3TUBA 3RWQA 3O0GA 3IDPA 5H8GA 3NW7A 3PUPA 4QP3A 2WPAA 4RC2A 5FD2A 5KKRB 3TUDA 5JFVA 3MTLA 3PXFA 2NPQA 5TO8A 3HEGA 3U9CA 5GZAA 3FHRA 5E4HA 4HCUA 3FMMA 4QQJA 2WTIA 5D41A 1H28A 5KNJA 5FEDA 3AC5A 3CY2A 3GB2A 4FSWA 4O91A 4X2GA 3WARA 2CGVA 4EOPA 3D14A 2I0EA 4PMTA 4AN3A 2W1EA 2H96A 2C0TA 3NIZA 4DFZE 4ZTRA 4I93A 3U54A 1E1XA 3UO5A 4G16A 4FV8A 4RFMA 2PWLA 3W2QA 4HPUE 4IM3A 1E9HA 3Q4UA 4G17A 3HMOA 3KXGA 2IZRA 4HZSA 4Q9SA 4XV2A 4ANBA 5HNBA 4F99A 3F5XA 5FWKK 5BQ0A 4I6BA 1IA8A 5IMXA 5EKNA 1M2PA 2CDZA 3VULA 4CKJA 2JC6A 4NKAA 4Q5HA 4ANLA 3AC8A 4L53A 3MH3A 5AEPA 4CYJA 4FC0A 1H0WA 3KK9A 1X8BA 1CM8A 5IU2A 2WMTA 3TDWA 1PMUA 2W7XA 4QP7A 2CNVA 3TWJA 1U4DA 2B1PA 3BE9A 4WO5A 2QQ7A 3IOPA 3V5LA 3AD4A 5HG7A 4YJSA 2A0CX 4DGOA 4O7RA 4FMQA 1XBBA 3KRRA 2ZAZA 1TKIA 2C47A 2XRUA 2WMRA 3MTFA 4J52A 3FV8A 3LFDA 3AD5A 3SQQA 3NSZA 4CTBA 2OXXA 5L6OA 5LARA 2OH4A 4IQ6A 3UZPA 3N4UA 5DIAA 5EDPA 3RJCA 4HJOA 5LVNA 4U80A 3KB7A 1O6YA 3BYMA 1M2RA 2JIVA 2AC3A 3JYAA 4G6OA 3R22A 4ITHA 4F63A 5FTQA 1S9IA 4EBWA 2BHHA 2BZKB 3SV0A 2YCRA 2WTDA 3ZEWA 5I0BA 3G15A 2FSTX 3C4WA 4EORA 4I41A 3Q3BA 3CXWA 3TKHA 4O1OA 3DKGA 3QA0A 1YHSA 4DCEA 1ZOHA 4FTTA 1HOWA 5I5ZA 5EQEA 2XNGA 4MD7E 2P3GX 5D7VA 3U8WA 4EYMA 3MH2A 4XOZA 4BDCA 3CTJA 5LJJA 2QODA 2C6TA 5AAGA 3VS7A 4MWHA 2I6LA 4IZYA 4A4OA 4CZYB 2NO3A 4MXAA 3R02A 5CALA 3U51A 4Q2AA 3F69A 3Q04A 3VAPA 5IEXA 2VTAA 2ACXA 4GRBA 4MNFA 3C50A 3RKBA 4CEGA 5AR8A 2FO0A 4Z55A 4S32A 4NW6A 2OZAA 3VUHA 1F3MC 3CSVA 3I81A 4ERWA 4PDSA 1YXSA 4BI2A 2W17A 4OTWA 4AF3A 5C1QB 4H3BA 1PMEA 2HWPA 4LL5A 2CKPA 2WKMA 2HZNA 3SOAA 5CYIA 1M14A 2DUVA 2GS2A 3VQUA 3D5XA 1YXVA 2YCSA 2YIXA 4R1YA 3R8LA 3UQGA 4CG9A 4FL1A 5G6VA 3EN4A 5A4LA 1WVYA 4NFMA 2CLQA 5CAPA 4K6ZA 1FBNA 2WTVA 4XUFA 3U87A 3FSKA 4MK0A 4OBOA 4YPDA 5HIBA 4O7SA 2VX3A 1OMWA 2XNNA 5D9HA 3NVKI 4C38A 1V0BA 4CMTA 3OW4A 2W1ZA 1FOTA 3H4JA 5HE3A 3R7IA 5BVWA 1XWSA 4WOVA 4YLJA 3VF9A 1H24A 4JDKA 3NCZA 1JOWB 4PUZA 3V5JA 2F2CB 1UU8A 3GOKA 2EXMA 2P0CA 4HGEA 5CNNA 4ANOA 4LOQA 5KMMA 5J1VA 5CT0A 4OTQA 4F9WA 2R9SA 4P5ZA 3QF9A 4MX9A 4B9DA 2W9FB 3PY0A 2V7OA 4DH1A 3QQUA 3PA3A 5DVRA 3C4XA 1YOJA 3ZXZA 4V05A 3C13A 4MH7A 2OJFE 1OITA 4ZY6A 3I6WA 5ANGA 2B9HA 2CN8A 4S2ZA 4ZXTA 4UYNA 5IUHA 1R39A 3HV3A 5DEYA 3RPVA 2B55A 2RG6A 2R4BA 3FMDA 4IAFA 4OW8A 4XV9A 3AXWA 3DGKA 3EIDA 4GT4A 4YJNA 4I20A 2XJ2A 3ORIA 3RM6A 2VTJA 2GS7A 2PMLX 2YDIA 3E62A 3ITZA 3FLNC 4UEUA 3HGKA 3S4QA 4JT3A 3ZRMA 3D5VA 4JJRA 1U59A 3PP0A 4W8EA 3O7LD 4XP3A 2H9VA 2GNHA 2P33A 4X2KA 3L8SA 4ZOGA 5EYCA 1YOLA 4YBJA 3TKIA 4O7NA 5IA4A 3QQKA 2CGXA 5BYZA 5M44A 3O8PA 5HLPA 2YM8A 3W8LA 1XO2B 1XQZA 2WMAA 5L8JA 2X0GA 1H25A 2QNJA 3G51A 2R3PA 3DY7A 5M57A 2V55A 2YDKA 1TQMA 4ALWA 4ANSA 3OW3A 3O51A 4BRXA 4TYIA 4CSVA 3SRVA 4TYHA 3POZA 5HO6A 2B9FA 5FBOA 5F94A 3TEIA 4WA9A 5EI8A 2PUPA 3EMGA 5CEOA 4K9YA 2R3IA 4OTRA 1UU7A 4JLCA 3UC4A 3ZM9A 3FLQA 4O7LA 3LCDA 2WXVA 5KZIA 4KSQA 4FKTA 3ODZX 4JRNA 1V0OA 2XRWA 3VS4A 5AP4A 3NYXA 5KX8A 4GKHA 3SC1A 5AV2A 3KMMA 4ZTMA 3LFEA 4O82A 5CVHA 1PRYA 4JIKA 3HNGA 3ZC5A 2WTCA 4FX3A 4CFVA 4CGAA 5HVYA 3NYVA 3GC9A 5J5TA 2XKFA 3CBLA 3G0FA 4KS7A 4UMTA 2KTYA 3R8UA 1ERKA 3WZKA 5AX9A 3VHEA 4PWNA 3BE2A 4CFXA 5I9XA 1H1PA 2WTKC 2OK1A 5HCXA 5HOAA 5CSPA 1WMKA 4G1WA 4B6LA 4FSMA 4OT5A 4NM5A 3TJDA 2X9FA 4II5A 3C0GA 4NJ3A 4AT4A 3KREA 2PVKA 2GU8A 5CX9A 5LQFA 3NLBA 1JNKA 4JAIA 2BRBA 5CAOA 1HCKA 4R6VA 5HU3A 5IQBA 1M7NA 3GU5A 3IDBA 2GMXA 3PVUA 3QLGA 2F7EE 4J7BA 3U4WA 3EFLA 4QT1A 2JLDA 4FL3A 3TIZA 1IAJA 5G1XA 2WEIA 4J95A 4RT7A 4BDBA 1H08A 1PYEA 4RIOA 5M09A 3R7GA 4GJ2A 4EUUA 2PVMA 1P2AA 3QRIA 2VAGA 4GK4A 3HMMA 3MJ2A 3W32A 3VRZA 4YC6A 4NJDA 5JMSA 4AZWA 4CFWA 3R21A 4PQNA 4RX7A 2PY3A 4OGRA 3OEZA 1XBAA 2Y0AA 3VUIA 5AA9A 3GGFA 1PXMA 2P4IA 2UZNA 4LUEA 3NCGA 3R28A 1KWPA 2X9EA 2O0UA 1PXKA 3ANQA 4FV9A 4NH1A 4D2SA 4RC3A 3FI4A 5AP0A 3L8PA 2X8IA 3DAJA 3Q60A 3C0IA 1PF8A 3F5UA 3QL8A 2REIA 2JDVA 2YCQA 3R71A 3II5A 5AMNA 5DT3A 5AAFA 4ALUA 5M4CA 4D5KA 3BYVA 5HU9A 4LQMA 4DFYA 2Y7JA 5CEPA 5EQPA 4FV7A 4RJ8A 3TNHA 5BVOA 1GOLA 3ORZA 4JS8A 4U45A 3FKNA 3R00A 4L3PA 4O7TA 2I0HA 3MY5A 3R0TA 4IVBA 4CFFA 4ERKA 4XH6A 4PPBA 1UVRA 3IPHA 5CI6A 4EH7A 2FSLX 3FMLA 4QTDA 3RAHA 4MBJA 3LMHA 4I4EA 2Y8OA 5FDXA 4OTGA 3DTCA 3JS2A 2OXYA 3V04A 5JFWA 5KUPA 2QKWB 5AIRA 2JKKA 4FEWA 4KBKA 3CY3A 4JG8A 4KIQA 1SMHA 4I22A 4GKIA 2ETRA 2YLEA 3FZTA 2JITA 3DJ7A 3GT8A 4L44A 4D55A 5M08A 1GZOA 5AR3A 2BDJA 4EHEA 2BIYA 2QO2A 3GCVA 5CU2A 3HP2A 4BCHA 4O0VA 2F49A 2OIDA 3P7CA 4DTKA 2PVYA 2W99B 2BAQA 4HNFA 2VTOA 3BQCA 3D9VA 4I6HA 4K11A 3SOCA 5T3QA 4ASXA 4E6AA 5IG1A 3MN3A 2F7ZE 2C4GA 3Q6UA 4BIBA 4LUDA 4FTUA 4JX7A 1SNUA 4JDIA 1JKKA 4RIWA 4FICA 4ACGA 3TL8A 4MTAA 3K5UA 3C51A 2WHBA 3A62A 4M3QA 2BDFA 4L8MA 3UTOA 2XA4A 3LFNA 5I9YA 3Q96A 1IA9A 3KC3A 2A4LA 3R1QA 3MSSA 3C4ZA 3S1HA 4I5MA 2VGPA 3G5DA 5CU4A 3WF8A 2CKEA 3P86A 4LV8A 2AYPA 3LHJA 4JDJA 4IADA 2ERKA 3UYSA 4BZDA 3PA5A 1H0VA 2WMSA 2JAVA 1W98A 2IO6A 3V5QA 4IE9A 3BWJA 1Q4LA 3PP1A 5CLPA 3AMBA 4V01A 5DHJA 4X6QC 4FSRA 4X7QA 2F7XE 3W2PA 3E87A 3MIYA 3ORKA 1XKKA 2X6EA 3G9NA 1W82A 3MPTA 4Z9LA 5T68A 3WE8A 3R8MA 3DDPA 4AN2A 3NIEA 5HHWA 4ENXA 5FRIA 3HLLA 4F7LA 4XBUA 5FXQA 4GYGA 3VVHA 2V22A 2VZ6A 3PXZA 4DEHA 4DFUA 1O6KA 5EI6A 4J97A 4BYIA 3NEWA 3OEFX 3PPJA 4FSNA 5HKMA 4DC2A 4FTAA 3VBWA 5CU6A 4C37A 4LYNA 4QMXA 1Q8TA 4E6CA 4EOIA 3AC4A 3QTWA 2ESMA 4ACCA 2LGCA 1OZ1A 3MBLA 4TL0A 3A99A 5A6NA 1XR1A 1WVWA 1UU3A 2R7BA 4BZNA 3WF5A 3KMWA 5FGKA 4E4MA 2WTKB 3DZOA 3N4VA 2OF2A 4UBAA 4GVJA 3WZDA 2VO7A 4XV3A 2PUNA 2WMQA 3T3VA 3DBFA 3R9RA 4V0GA 1R78A 5H9BA 5HE1A 3ET7A 2F57A 3DDQA 3AT4A 4IB3A 2XNEA 4AW5A 3E63A 3COMA 3EL8A 3R9DA 4AAAA 3HMIA 4EZ7A 4L00A 4XJ0A 3RCJA 2FA2A 3Q9YA 2RKUA 3LM0A 3T9TA 3B8QA 3HMPA 1PJKA 3U6JA 3S95A 4L46A 5KE0A 3RK7A 2W9ZB 3TV4A 5HEZA 3QGWA 4PMSA 4EOQA 1ATPE 4QQ5A 4MVFA 2VD5A 4QMYA 2B54A 4KA3A 3RMFA 3UOJA 3KY2A 1TQPA 2VN9A 3LCSA 5E92A 1OL1A 1H27A 1P4OA 4K2RA 3ZFYA 5CAQA 5IEYA 1SYKA 3PA4A 3FJQE 2VTRA 1JPAA 1UV5A 4E6QA 4QP1A 4OT6A 4PPCA 1JSTA 3UDBA 4ZP5A 2VTPA 3E3PA 2ITVA 3O23A 1JSUA 2G2FA 4IZ5A 2XIKA 4JX3A 5HVKA 3I7BA 4IXPA 4CMOA 5HBJA 5KO1A 2WNTA 4YU2A 3NUUA 3CTQA 5CASA 2HYYA 5L2IA 3SHEA 5CI7A 2BFXA 1ZWSA 1URWA 2WQOA 4F0GA 3L1SA 3MYGA 5EH0A 1OIRA 2OZAB 1Z5MA 3ALOA 3RPYA 1R1WA 2Z8CA 5DI1A 2DYLA 4EOMA 4H3PA 3D7TA 4AOJA 1MRUA 2R3OA 4I4FA 1NY3A 5BX0A 2IVTA 5IA5A 3GC7A 4GK3A 2FSOX 2BUJA 4EBVA 4YURA 3QC9A 4CCUA 5KCVA 4YSMA 5HVJA 1ZMVA 2GNJA 5JRSA 3LCKA 3PTGA 1B6CB 3ZHPC 3WIGA 3CGFA 4OTFA 4GK2A 5BMSA 4I5CA 3E92A 4F1OA 5M55A 2ETKA 3SLSA 4IIRA 5DPVA 4YNEA 2O8YA 3ZO2A 4RQVA 5J87A 3UOLA 1Q8YA 3DZQA 4TWNA 2C5OA 4MNEA 4R3RA 3ZXTA 1APME 2XKCA 3NNWA 4D2RA 4EQUA 1E1VA 2QLUA 3V8SA 4UXLA 5HD7A 3CCNA 2J0MB 4RA4A 4GT5A 1IR3A 4BYJA 1NW1A 1YXXA 1ZOEA 4FSYA 4D28A 4PNKA 5DEWA 4HPTE 1CKPA 3TNPC 4C4HA 1FGIA 3G6GA 3DCVA 3BYUA 3CP9A 4FSUA 5L2SA 3DXNA 4QPSA 4D2TA 4QMPA 3P9JA 2SRCA 2XNBA 4JBQA 2X81A 3Q2JA 2VTIA 1URCA 4FNYA 4CTCA 5HD4A 2HZ0A 3L9MA 3CPCA 3E93A 1W83A 3FAAA 1G5SA 3BZ3A 3F5GA 4G3EA 1OBGA 2IVSA 2ERZE 4O38A 5DWRA 5DFPA 3BX5A 3F3WA 2P2IA 5J7HA 4JG6A 5BVNA 4GW8A 4U79A 3KKVA 1GNGA 1VYWA 2X39A 4DG2E 2ZDUA 4ZLZA 4RRVA 4ASDA 3BBTB 4NTTA 1Y91A 3DQWA 1OL2A 4AWIA 5ICPA 4IAZA 2XK7A 3QAME 2XH5A 2J5EA 4GEOA 4C2WA 2R3MA 1ZMWA 1FPUA 3P4KA 3Q6WA 4O21A 1NXKA 5EHOA 3E8EA 2WTWA 4N6ZA 3ZRLA 4F7SA 2W5BA 5CT7A 4D0XA 2VUWA 3QZHA 3SXRA 1DM2A 3FY0A 5A4TA 4TTHB 3FI8A 1MQ4A 4FVRA 5K0KA 1YW2A 4TPTA 3K3IA 4AGDA 4AU8A 3FQSA 5JKGA 4D4RA 4ZLOA 4U3YA 5CQWA 2VO0A 4WUAA 1YXUA 4FTLA 4F1TA 2XBAA 3DBDA 4YHTA 5JSMA 1A48A 4JR3A 1GZNA 2QD9A 5FEEA 3NGAA 3ZLWA 3QYWA 3N4TA 4FV5A 2YABA 3BEGA 3GEQA 2YHVA 5AV3A 5DE2A 3HA8A 2YAAA 4O7YA 4C35A 5LWNA 3JY9A 4PL5A 3OWKA 4FG7A 4FTNA 3O71A 1RJBA 5C27A 4U6RA 4BTMA 5JFXA 1J7LA 2CJMA 3KRXA 2PMOX 2UZVA 4HYUA 2B0QA 2Y6MA 3ID6C 2PSQA 2Y4PA 4MYGA 3BGZA 3NUXA 4LRKA 2QU6A 2W0JA 4PL4A 4YC8A 3OWJA 4JG7A 5AIKA 3TI1A 4IWQA 4Y5HA 4F70A 2WMXA 2ZB0A 4FKPA 5CY3A 5EM6A 4H05A 3MY0A 3DU8A 5LOHA 4XG7A 2C6IA 2E9VA 1WVXA 3KCKA 3C4CA 3FZOA 4FTRA 4MXCA 1L8TA 3MGYA 4FKJA 3TKUA 1P14A 2IN6A 4ZS0A 1H1WA 3BHUA 3Q5ZA 5AP2A 2J90A 1YWVA 3DAKA 3FLSA 5ACKA 3S2PA 5EQYA 4QMNA 2KULA 3BWFA 2Z7LA 4WNOA 3HRCA 1SVHA 2UW4A 4PY1A 1PXIA 4N57A 4O84A 4A7CA 4OR5A 3ENMA 5T6KA 3F3ZA 2O5KA 5LMAA 4O0XA 5TKDA 3GU6A 3IK3A 1VYZA 2X7OA 2YJRA 4IX6A 4AGUA 5A4EA 4FYOA 1U54A 5IH6A 3GCQA 4UALA 3TZ8A 1QCFA 4AA0A 3SA0A 3UIBA 3KN6A 2XKDA 3UIXA 4WNKA 3CD3A 4O0TA 1B38A 2PHKA 3FL5A 3ZLYA 1W7HA 3B2TA 2QOCA 3MA6A 4BWXA 3TV7A 4UB7A 5M4FA 2ITTA 4IZAA 3THBA 4HW7A 3KRJA 4P2KA 4UN0C 3R73A 4U81A 5IQEA 4G5JA 2QHNA 1CSNA 3MY1A 1U5RA 2E9PA 4XCUA 5AUXA 4EQMA 2W1FA 5HTIA 1YI6A 1AGWA 4CCBA 2VWWA 3H0ZA 3IG7A 4L45A 2HENA 2CHLA 4K8AA 1PXJA 1WBTA 3QZFA 3GU4A 4JL9A 3PSCA 4B4LA 4O7WA 4A9TA 3LQ5A 3FQEA 3RZBA 5K5NA 3R7UA 4L6QA 3V51A 4K0YA 2BRMA 3SG9A 1QPCA 5EW3A 4FKQA 2BAKA 3OZ6A 3QHRA 1U54B 2W1CA 4Q5EA 2ITZA 3ZCLA 4QMMA 4ANNA 4R77A 4DYMA 5H2UA 3JUHA 3EH9A 4YJTA 3TNIA 4TWOA 4B7TA 3OUKA 4EL9A 4EH6A 1JQHA 4ZY5A 4ZMFA 2CMWA 3SDJA 3VIDA 2O3PA 3BHYA 4L42A 3BLQA 2PZYA 3U55A 4IB0A 5A14A 1F5QA 1PXNA 1Q8UA 2ITPA 2PULA 4IH8A 3E8CA 4O0SA 4FG9A 4RX8A 3DB6A 4FKIA 1UWHA 4U43A 5J7BA 2XYUA 3W2SA 1BKXA 1ZYDA 2C69A 4M69B 1L3RE 4BWPA 5HCYA 4JNWA 4QPAA 4RPVA 4X2FA 5CVGA 3RWPA 2FGIA 1NA7A 3ERKA 3FL4A 2Z7RA 4U97A 3DXQA 4ITJA 3F2RA 5E1SA 5FP6A 4ASZA 5DNRA 3HUBA 2H8HA 2J51A 2ZM1A 3QU0A 3MIAA 4RIXB 3LOKA 1ZOGA 3U9NA 3IW7A 4NIFA 3ZSIA 5CSHA 5IA3A 2XMYA 5A4QA 2CSNA 2NRYA 4I5HA 5AFVA 2NRUA 3N51A 4FKOA 4ZTHA 5B0XA 2HWOA 4X21A 4IWDA 3QQGA 4DINA 3W10A 2WB8A 3EHAA 3TJCA 3ULZA 5CU0A 4J8MA 4YJQA 4AN9A 4HNIA 4C4JA 2BALA 3W55A 4UMQA 5KHXA 5J8IA 2I0YA 2YEXA 3A8WA 3QZIA 4MQ2A 3VWAA 4YMJA 4YO6A 5DA3A 3UP7A 1NVQA 3NUNA 4BF2A 4BCMA 3U6IA 4EZ3A 4QMQA 2CKQA 3EQDA 4QMTA 2HW7A 1XH5A 4KBAA 3DK6A 3KULB 4X6RA 5AUZA 3REPA 3VS0A 3FZSA 4BCKA 4D1SA 3QX4A 3P0MA 1BYGA 5KHWA 3UYTA 4F4PA 2ZOQA 1PXPA 4F7NA 4OLIA 3F66A 4UV0A 4WHZA 5CSXA 4AG8A 4CZTA 2OF4A 1FVVA 3UVRA 5AADA 5K5XA 4FKSA 4QTAA 2QR8A 2Y4IC 3TV6A 3I5ZA 1Q3DA 5IQAA 4FI1A 3LW0A 3QZGA 4GH2A 1SVEA 4LFIA 3QD0A 4RBLA 3E5AA 2R3JA 4CMUA 4TYHB 3RVGA 4AGWA 2WEVA 4C57A 2WOTA 5CF6A 5BYLA 4RFZA 3NAXA 4YJPA 1OL5A 1YHVA 2QCSA 4IC7A 4I0TA 2UZOA 1BLXA 1OPJA 1UKIA 2BTRA 2OICA 3ZO4A 3UG2A 4IFCA 3EKNA 4FEQA 4XP2A 4PP7A 4W4VA 3QKKA 4JVGA 5D1JA 3PSDA 1KE6A 3QKLA 4L3LA 4W4YA 2FUMA 4C4FA 3W2OA 4GUBA 4QNAA 1R3CA 4O2ZA 4C2VA 4OAUC 4FOBA 4BL1A 1JSVA 3F2AA 3QQFA 3ATTA 4BWKA 2VWIA 4MAOA 5A4CA 4K1BA 3M42A 5I9ZA 1KV2A 4KINA 1UA2A 4BIDA 4JI9A 3OY3A 4FTJA 5E8VA 4D1ZA 5K0XA 4HVGA 2YM3A 2OFUA 4J98A 2QVSE 1KE5A 4C02A 5CEKA 5JGDA 2G2HA 3QQHA 2YIRA 5IDNA 3VUTA 4FZ6A 5EI2A 2X8EA 3PJ3A 5C26A 3QA8A 2UW5A 2OWBA 3KF4A 5CTPA 2PE0A 4QYGA 3IW5A 4D2PA 3GQIA 3H30A 2G1TA 3GCUA 4E5AX 4JR7A 1LP4A 3QXOA 1M52A 3OXTA 4FK3A 4I24A 4Y8DA 1PY5A 3I4BA 4O81A 3V6SA 3WF6A 3C7QA 2XIRA 3QGYA 3DTWA 4A9UA 4ZZOA 2GPHA 4EQCA 1V1KA 4S30A 5CS6A 4HVDA 4RWIA 2VRXA 5AX3A 3CGOA 1U5QA 4WRGA 5M07A 5GIOE 2IVVA 1BL6A 3CJFA 4L3JA 3PJ2A 2W4OA 2G2IA 2YM7A 3R8ZA 3VBXA 3R7VA 4E4XA 2UW6A 5I4NA 3R30A 1WBOA 4F64A 2R3LA 3NYOA 3ZUVA 2PZ5A 4Y73A 5LMKC 2GQSA 3COKA 2WQEA 3OCBA 3F9NA 4GYIA 1ZYSA 3FMHA 3PWDA 3AMYA 3PRFA 3IO7A 5HO8A 3RAKA 4CG8A 3DT1A 4WBOA 3SVVA 5IQIA 1WBWA 3H10A 3GXLA 2Q0BA 2YN8A 4FTQA 3ZUUA 4D4VA 5JZJA 3OF0A 4RLKA 5D12A 2PVFA 4JRVA 4AS0A 4EJNA 4KIKB 5CAVA 1JAMA 3LFSA 2B7AA 2GSFA 3LFCA 4XEYA 2PU8A 3VS3A 4GU9A 5IPJA 4C62A 4IM0A 4F7JA 5DR9A 3ZC6A 3O8TA 3OUNB 3NVMB 4GUEA 3OTVA 2OIQA 5HZNA 3WZJA 5E7RA 5M53A 4OBPA 5C9CA 4R1VA 4NUSA 3FZPA 3ENHA 4KNBA 1T45A 2XB7A 3E8NA 3R7EA 4HVHA 3OC1A 2UW3A 3QQJA 1PKDA 2OBJA 3P7BA 4ZTQA 4AZTA 2GHMA 4EWHA 3QRTA 4TT7A 2PL0A 1OGUA 1FMOE 3FZRA 3RZFA 5DBXA 3MPAA 3NAYA 4C33A 5LMKA 3N9XA 3GI3A 4NIFB 4CFMA 3KULA 1PW2A 4W4XA 5FP5A 5KMOA 3A7JA 2ITYA 4O6EA 4C3RA 1H8FA 4RZWA 4WNPA 3TZMA 5HG8A 2QO9A 4NCTA 3EZVA 4MD8E 3ZLSA 2Y4IB 4UWBA 5LCKA 2BKKA 2H6DA 2IW9A 3QBNA 4FVQA 2WZJA 3QKMA 2WU6A 4FZAB 4EYJA 1PMVA 4DFBA 2ITOA 4ZTNA 1YHWA 2IG7A 3RNIA 4E4NA 3RPOA 2X7GA 3RGFA 2BZJA 2W4KA 4IC8A 1XH6A 2ITUA 5A3XA 2IW8A 2XK3A 3LVPA 3NS9A 2H34A 2OZOA 2XKEA 2PVJA 2XEZA 1M7QA 2GFCA 2VO6A 4JQ7A 3KN5A 1WZYA 2G9XA 3LE6A 3GC8A 2V7AA 3HAVA 4FKRA 4AX8A 4DT9A 1GZ8A 2C6EA 3P79A 4YZNA 2W1GA 3W2RA 2VTLA 3V5PA 4BCQA 4GFGA 4GJ3A 2W05A 4ANMA 4EC9A 3T8OA 4KKHA 5CXHA 3UOKA 1OKYA 5HIDA 5FM3A 3MDYA 4PMPA 4P90A 3MA3A 4WIHA 3H9RA 5TR6A 2ZJWA 3IGOA 4MF1A 5GJFA 3M2WA 5HTCA 4CRLA 4R8QA 4FGBA 3NW5A 2UW8A 5IA1A 1UNHA 5C03A 1AD5A 3Q52A 4GSBA 4U0IA 3W18A 3KU2A 3PWYA 4IB5A 3FC2A 4AE6A 2XVDA 3F82A 3MVMA 5CVFA 3DPKA 5AUVA 3QTQA 3VN9A 4FEXA 2BR1A 3BHHA 2JBOA 2JGZA 3OOMA 3VS6A 3GFEA 5HESA 3EQPA 3QCSA 3LMGA 2YWVA 4BGHA 1JLUE 3PFQA 5AUYA 3DKOA 2JAMA 3D5WA 3UMXA 2BVAA 3PYYA 5AAEA 4OTHA 3ETAA 2R3QA 2RGPA 4S31A 3RTPA 1G3NA 4EH9A 4OTPA 4HYIA 4O0RA 3IGGA 4GVAA 4J8NA 4PDOA 3SRVB 4E8AA 4YBKA 4JXFA 5EDRA 3VRYA 4H1JA 4Y83A 3OCTA 1FQ1B 2PZIA 3LXPA 4GFMA 5TF9A 3ROCA 4RX9A 1QPEA 3OS3A 3DK3A 4BBFA 3P5KA 3KXMA 2YLFA 5CNOA 3AGMA 5EOLA 1AQ1A 3KRWA 3LJ1A 3OG7A 2PVNA 4EOSA 5HX8A 4NM3A 4M97A 4ZEGA 3UO4A 3LCOA 2JKQA 4Z16A 1H00A 2FSMX 3KMUA 5ANKA 4YHJA 4RLLA 3GNIB 5EW9A 4DH8A 3ACKA 3VJOA 4RIWB 4FR4A 2GFSA 3EL7A 4I1ZA 4UX9A 3PY3A 4R3CA 5DMZA 4EK4A 1H1QA 3BKBA 2VWXA 3C9WA 3MJ1A 4IJPA 5AUTA 2PMNX 3W1FA 3PXYA 5HG9A 4QYFA 5FTGA 3CIKA 2PVLA 1ZY4A 3G9LX 3QTRA 2E2BA 4QQCA 2WELA 4BCIA 4DF3A 5L8KA 4EEVA 3BLRA 5A9UA 2QOOA 3COIA 5EM5A 2F2UA 5HI2A 3FLWA 4XG6A 4FEUA 4QYEA 5A6OA 4W9XA 5C01A 5KMKA 3KQ7A 4O6LA 3FXXA 3P23A 4PX6A 5JT2A 4WT6A 4NTSA 4XMOA 1ZYCA 1KOBA 2WU7A 1XH7A 3ORXA 4BCFA 1BX6A 3HL7A 2IZSA 3I60A 5LVMA 3HMNA 3HV5A 4TWPA 3BV3A 4PV0A 2EUFB 3LPBA 1GY3A 2R3KA 5AR4A 3LKMA 4LOPA 3B2WA 2QURA 4BCNA 1Z9XA 3KFAA 4B8MA 4GV1A 3CKWA 4RVMA 4JBOA 4CLIA 2PVRA 1R0PA 4D0WA 1DI9A 3DV3A 3HZTA 3FLZA 3VUGA 5BVDA 3PJ1A 4I6QA 4L01A 4TYEA 3ZONA 3OHTA 4V04A 5EDQA 2PTKA 2EXCX 5IZFA 2YM5A 2XNPA 4AOIA 3VW8A 1Y57A 2WQBA 2YA9A 3I5NA 3PPZA 2HIWA 3O2MA 4J96A 1YDRE 5ETIA 3FE3A 5C8KA 2YAKA 4KBCA 1KE9A 2VWUA 4PMMA 4Y46A 5ANDA 1GAGA 2A19B 2R0UA 4G9RA 1ZRZA 4QNYA 4C61A 2R7IA 3LFAA 4ARKA 2BFYA 5DR2A 5C4KA 4FG8A 4G3CA 2I0VA 3HECA 3KEXA 5FM2A 5I3OA 5FQDC 4DTBA 3ROYA 3I0OA 4EK5A 2W5HA 2RSVA 3TIYA 4ANQA 1A9UA 4FIFA 3BBWA 4PNIA 1NT2A 1Q3WA 4AZSA 2OJJA 3MFSA 3MFUA 4USEA 3G33A 1J91A 5JFSA 4APCA 4D2WA 2F4JA 4RVLA 4RVTA 1ZYJA 5EOBA 4ZJIA 2R5TA 4JBVA 3F5PA 2YDJA 1WAKA 4CRSA 5JH6A 4M67A 2QG5A 4DFXE 2UV2A 2GS6A 3DKCA 3MWUA 5CAUA 3DA6A 3UNJA 2QU5A 3OWPA 4WG3A 4EZ5A 3SGCA 4CT1A 3WOWA 5KKRC 2PVHA 2HXQA 4YC3A 1SM2A 1DS5A 4IBMA 2CN5A 2HZ4A 4CVAA 3EZRA 4GT3A 4C3PA 4AQCA 3QTIA 3H9OA 2YM4A 3R6XA 4D58A 4M0YA 3VS1A 2BCJA 2YM6A 2XCKA 1OIYA 4TXCA 3EFJA 4FF8A 4ALVA 4WSYA 2ZB1A 3DJ6A 4NW5A 5KZ0A 1M2QA 3IQ7A 2ZMDA 4FK6A 4FV3A 4I0RA 2YIYA 5FXSA 4AUAA 3K54A 5L4QA 4L7FA 1RE8A 2X2KA 1FVRA 3ZUTA 5A46A 4ITIA 4Q9ZA 3PJ8A 3G90X 3OP5A 3ZSHA 4CQGA 3EJ1A 4LRJA 3TNQB 3RHKA 1J1BA 5E8TA 2C30A 2X6DA 5LVLA 5BUIA 1P5EA 2Z2WA 3NW6A 3PIXA 3SAYA 1IRKA 4DGMA 2E9NA 4FNXA 4XNEA 4BBMA 3CPBA 2XIXA 3TG1A 1PMNA 2UW7A 4NKSA 5ANOA 4AA5A 3FYJX 5HQ0A 3MFRA 4KIPA 2JDRA 3LJ0A 5BYYA 1FGKA 3EKKA 5GHVA 2Y9QA 4CLJA 3H3CA 3R9NA 4PF4A 5FLFA 5AWMA 4BVUA 4DEBA 2YERA 4XYFA 5CEMA 2AUHA 5M56A 4DCAA 5AP1A 4K77A 3O96A 4Y5QA 3NR9A 2QKRA 3R7YA 3Q5IA 3CLYA 5EYMA 2XNOA 3UOHA 1H1SA 5E8ZA 3NNVA 1O6LA 4MXOA 4FTOA 3S0OA 2CPKE 1XBCA 5JGBA 3VS2A 1OPKA 4E6DA 4LOOA 3CQEA 4HVIA 5JEBA 2J50A 3BQRA 1A06A 3WZEA 1SNXA 3F3UA 2W5AA 2C5VA 3F61A 4I94A 3MV5A 4P4CA 4XP0A 3BIZA 4IACA 5EK7A 5GNKA 3UIUA 3CKXA 5BPYA 1YVJA 3NMUF 2YACA 4F9YA 4Z3VA 2C6DA 2XK6A 5LWMA 4YO4A 4FOCA 5CWZA 3UC3A 3NRMA 4YJRA 2BPMA 3WZUA 4DH3A 5BVKA 2X4FA 2VWBA 2B9IA 3R9HA 1K3AA 4O0UA 4C8BA 2C6LA 3LJ2A 4WRSA 4DG0E 4BDJA 2VU3A 2BZIB 3D7ZA 4MXZA 3Q4TA 2X2MA 2OFVA 4FKWA 4G6LA 2OU7A 4QP8A 3DAEA 4R5SA 4WUNA 3WF9A 3ACJA 4XOYA 1PXOA 2UW9A 3QTUA 5JZNA 2C3LA 5LVOA 3I7CA 3GENA 4WBBB 3ORNA 5D7AA 1REJA 5IQDA 1XJDA 2XK8A 1DAYA 4BHNA 3FMNA 3E88A 3M11A 4IW0A 4WSQA 1JVPP 1UU9A 4NSTA 5I3RA 2ONLC 3RPSA 5AP3A 3BU5A 4YZDA 3UQFA 2RL5A 3CTHA 3HP5A 5DYJA 4BR3A 5BMMA 4NFNA 4M8TA 2GNIA 4RSSA 4RQKA 3A7FA 5CSVA 4B0GA 4G3FA 3LXKA 3DOGA 4ID7A 3OMVA 2XK9A 4OTDA 2C3KA 2R3GA 3FI3A 2Z7SA 4LGHA 4QMVA 4O22A 1H07A 4LM5A 2C6OA 2WMUA 5EYDA 4DA5A 4G3DA 2OLCA 4RC4A 3MVJA 4DH7A 2WOUA 3UVQA 4YTFA 1K9AA 3UE4A 4D9TA 3UPXA 3HA6A 3C5IA 4X3FC 2RIOA 3FKOA 3LLTA 3BHTA 2JEDA 3ZLXA 1BI7A 4U41A 5KBQA 4MCVA 3NUAA 2Q83A 5J5SA 1XHAA 5K3YA 3ZM4A 3HDMA 2IWIA 3TZ9A 4F0FA 1Q8ZA 4XG9A 4DGNA 4HCVA 1JBPE 2O63A 3MH0A 3IECA 3I79A 3QALE 2UW0A 5HO7A 4Y72A 4DEIA 5DH3A 2ZV9A 2WGJA 4QMZA 5B2KA 5KMNA
chains in the Genus database with same CATH superfamily
3K5VA 4ORKA 1PKGA 3BCEA 3UODA 4QRCA 3VW6A 4FKUA 4HOKA 4F09A 4FZDB 4HZRA 3VS5A 5HLWA 4L9IA 4LL0A 3PJCA 4AZEA 2AEGA 1W8CA 2UVYA 2QOFA 2XK4A 1YRPA 4NK9A 2XF0A 4FT5A 4E26A 4DHJA 3PE1A 3BV2A 4GS6A 4LMNA 5GZ9A 5JQ5A 4X2JA 1BMKA 2ZV8A 3D2IA 4K18A 3VF8A 2O64A 3RP9A 4D1XA 3MESA 4FT0A 4P5QA 5L2WA 3FMKA 2WMBA 4UMPA 2J7TA 5CF5A 4ACMA 4XRLA 5FXRA 1JKSA 4FUYA 4MBLA 4KRDA 3WIKA 5L6WL 2WMVA 3FC1X 4GCJA 4ZJJA 2V5QA 3NUPA 3ZBXA 5L3AA 5E9EA 3CS9A 3OROA 4HYHA 1VJYA 3ZZWA 1W0XC 5CF4A 2XAOA 2J0KA 3PVGA 3LAUA 5EHLA 4S34A 4G6NA 5AP6A 2BDWA 4EH2A 3Q4CA 2EB2A 4MF0A 4FUXA 3DBCA 4RX5A 2QOHA 1R0EA 3UNZA 1G8SA 1W2DA 4KB8A 4CZUA 2QOBA 2C68A 1T46A 3HV4A 4K33A 4CYIA 2GNGA 3PZEA 3DXPA 3PFYA 3AOXA 3MVHA 2P55A 2UZBA 2EXEA 3ORLA 4BCJA 2HAKA 4AT5A 3OD6X 4DEGA 3KL8A 2QG7A 4F65A 3E3BX 4XG3A 3GQLA 2X8DA 3KA0A 3M1SA 5ACBC 3VUKA 5M51A 3R8PA 4CKRA 3CEKA 5DRDA 4UWCA 1CMKE 5AV0A 4BDEA 5HTBA 2QR7A 1KV1A 4MNEB 1P4FA 4YNOA 4FT9A 4QYYA 3COHA 5EFQA 3E7VA 4BTKA 4YZCA 1J3HA 3QUDA 5CXZA 5IA0A 1MRYA 4H39A 1FINA 5IUIA 2NYAA 3HYHA 3K3JA 5E1EA 3R9OA 3VBVA 5E91A 4DH5A 4F6UA 3EQBA 4FBXA 2QOQA 2HW6A 3MB6A 4ACDA 1Y6BA 5B2MA 2B9JA 4FSZA 2IJMA 4H58A 5CSWA 2W1DA 3PDTA 5LMBA 2RFEA 4PPAA 4EONA 3DJ5A 3RK9A 4ACHA 4F9BA 4DDGA 4GMYA 4H3QA 1GZKA 2B52A 1XH9A 2BRHA 4DTAA 1YDSE 5BUEA 5EM8A 4RJ5A 3D7TB 4ZSAA 3R8VA 1OVEA 4LMUA 5IH5A 4FKVA 3D2KA 4ZSLA 4ZZMA 4I23A 3UG1A 5K4JA 2ONLA 2XNMA 4M15A 1Y8YA 1MRVA 3C4FA 4OTIA 3EN5A 1ST0A 3ML1A 3OFMA 5JN2A 2QOKA 2QC6A 3ZS5A 3NPCA 4O7ZA 4DG3E 4LGDA 4YZ9A 4PTEA 1I09A 4USDA 4J53A 4BN1A 3EYHA 3FKLA 3QYZA 3I6UA 1Q8WA 4BCOA 4FSQA 3F7WA 3TNWA 1ZZLA 3IW4A 4BDHA 2XUUA 1OKVA 4FNZA 5IUGA 3OTUA 3AQVA 4IDTA 3IKAA 4MKCA 3R7OA 4PTGA 4RG0A 3NFGB 4QYHA 3R01A 2CGUA 5AJQA 1OL6A 1XMLA 3SW4A 4AT3A 4DEAA 4AOTA 5AA8A 4NL0A 4TWCA 2CKOA 4J71A 3LCTA 2X1NA 2JDSA 2J6MA 3V8WA 2HY0A 1OUYA 2OSCA 2OI4X 4BDIA 3V3VA 2HCKA 1QL6A 3KIOC 3BGPA 3C1XA 2IW6A 4ZLYA 3NUYA 2BAJA 3FLYA 3F3VA 4XG4A 4YTHA 4ZK5A 4FTCA 4IMYA 2YIWA 5DT0A 3QC4A 5BVFA 3O7LB 4FL2A 3ZZEA 4YR8A 1JKLA 5H3QA 4TZRA 3WYXA 3BHVA 1V0PA 2ZVAA 5L8LA 3MH1A 4L52A 4ZAUA 3P08A 4EH8A 1QPJA 3DQXA 1QPDA 4H36A 5AUWA 3IW6A 4UMUA 4PDYA 3W33A 2Q0NA 3AMAA 4YZBA 3PE2A 4MXXA 4FTIA 4E73A 4DDIA 2ITXA 1EH4A 3LIJA 2WIHA 4BDFA 3L8XA 3DNDA 4KUJA 4EHZA 1OIUA 1W2FA 3GCPA 4I21A 4LGGA 4O0YA 2C6MA 3PSBA 1BUHA 2XYNA 4FT7A 4O96A 4RWLA 4CNHA 3A4PA 5HE0A 5K4IA 5IDPA 1SZMA 1GJOA 1ZY5A 2I40A 3EN6A 3DB8A 4BTJA 4EKKA 4Z7HA 2GQGA 3R1NA 2C1BA 5JRQA 2C3JA 5HGIA 3D15A 5HBEA 4DEDA 3T3UA 5J1WA 3VO3A 4GU6A 4ZIMA 4ZS4A 3IDCA 3HRFA 4U8ZA 4QD6A 4ZZNA 4FTMA 2XJ0A 4AQKA 4HGTA 4BI0A 5I9WA 2XJ1A 3PIYA 1Q99A 3CR0A 3IW8A 4BZOA 5IF1A 4AAYA 3CC6A 3BI6A 5BVEA 1SVGA 3QHWA 4QQTA 5EW8A 3TTJA 4TKSA 5LXMA 4H1MA 4U3ZA 4FODA 3SG8A 3LQ8A 3FYKX 4R5YA 4S33A 4F6SA 3BYSA 2YCFA 1LEZA 4CV9A 3B8RA 4ASEA 3FSFA 3BL7A 4FYNA 4FTKA 3KF7A 2C6KA 3R63A 3MB7A 2LAVA 5J9LA 3HRBA 2CNQA 3KVXA 4MD9E 5HBHA 1WBVA 4QTEA 3VQHA 1OBDA 2J5FA 4EOOA 1CDKA 3ALNA 2ITWA 3OBJA 3TT0A 3P1AA 5K9IA 4I3ZA 3QCQA 4DEEA 4DBNA 2XP2A 3BU3A 3A61A 4JIAA 4XLVA 1UWJA 1YOMA 4WKQA 5ETAA 4WG4A 2BMCA 4HVSA 3ORMA 2RF9A 3WYYA 2OGVA 5B2LA 4QP2A 4BB4A 4V0GB 4GIIA 1Q24A 1KE8A 4EOLA 4YLLA 3I1AA 3QUEA 3UVPA 3VJNA 3LMIA 2W96B 2IPXA 3DS6A 1H26A 5FEQA 4RIYA 3HX4A 3UDTA 2BIKB 3W2CA 3K2LA 4ENYA 3QD2B 3UZRA 4QP4A 2PUIA 5AV4A 3JVSA 3KRLA 2F9GA 4UYAA 4RIYB 3S00A 5DR6A 2UZDA 4QMWA 4UMRA 5LVPA 1Y6AA 1UNGA 3OWLA 3V01A 2XEYA 3LM5A 5H8BA 4BCGA 2QOLA 5CEIA 3AT2A 3PRIA 2GNFA 4C7TA 1Q41A 4DAWA 4AA4A 2QOIA 3G2FA 2WFYA 2WTJA 3EB0A 2R3RA 1YXTA 1ZARA 3AC1A 3PG1A 4IAKA 4QP9A 5IQFA 3DKFA 5J95A 4OAVB 3GBZA 3ZFMA 4WNMA 4DGLC 1DI8A 4FGRA 1BL7A 5F9EA 1ZYLA 1Y8GA 2R2PA 4A4XA 4ZMEA 2YFXA 5M4UA 2JIIA 3UZTA 1VR2A 2B4SB 4KSPA 3RCDA 4ZSGA 4FIEA 3TDVA 4LV5A 4RZVA 4YUQA 5AR7A 4PDPA 5AR5A 4ZSJA 4IAAA 4RWJA 4TNDA 3WBLA 2QHMA 4D2VA 2WMWA 4FZFB 2G01A 3WF7A 3F2NA 5L6PA 4QDVA 3ANRA 3C0HA 4JAJA 4XV1A 3MFTA 4O2PA 3QFVA 4E5BA 4F6WA 4G2FA 4A4LA 1ND4A 3GU8A 3Q9XA 5B7VA 3DBEA 2FYSA 4IEBA 1OB3A 1YDTE 3G6HA 3HDNA 4TN6A 3LFBA 4IVDA 4QEBA 3PVBA 4IAIA 1QMZA 4EC8A 2GDOA 3FPQA 1KSWA 3SXSA 1FVTA 4HYSA 2OJGA 1VEBA 4M7IA 3F6XA 5E8YA 4FE2A 1KE7A 4BHZA 3Q9ZA 1JKTA 5JQ8A 2A1AB 3ORTA 2XZSA 3QWKA 3RNYA 4RJ3A 4RWKA 4CV8A 5J9ZA 5M06A 1LEWA 4EI4A 2DS1A 2BKZA 4AW0A 1REKA 3FZ1A 4D5HA 1Z57A 5J9YA 5IA2A 2XM8A 2FVDA 3LLAA 3OXIA 3MW1A 3F7ZA 4O4DA 4W4WA 2VTNA 3ZSGA 4X2NA 2G15A 4RGJA 5HE2A 4C36A 2OXDA 2YWPA 3UMWA 4EK3A 4RFYA 3OCSA 4DHFA 4O7VA 5KMJA 1G8AA 3MS9A 4NT4A 3F3TA 3OT3A 4TNBA 2QONA 4BGQA 3POOA 2I7QA 5E8XA 2NP8A 4YLKA 2X2LA 3UPZA 5L2TA 4YTIA 4X3JA 4AFJA 3A4OX 4FVPA 3GCSA 3Q32A 3ZDIA 4DITA 3QD4A 4MWIA 2GTMA 5DGZA 3W0OA 5KBRA 3GU7A 4FRFA 4I6FA 5EG3A 2CCHA 4C3FA 3TXOA 4AW2A 3GOPA 2YISA 4M66A 2BILB 1PHKA 1H4LA 4C34A 3WILA 3FY2A 1OPLA 4P7EA 2WQMA 1VLRA 4D4YA 4JDHA 1W84A 1GIIA 2X0OA 2ZV7A 1IG1A 3AD6A 4TW9A 1WFCA 3VBTA 2YJSA 4ZJVA 1YQJA 2ITQA 3LXNA 4IX4A 2ITNA 4YGAA 4BKYA 4C58A 4FV4A 2ZM4A 3QWJA 4I5PA 2EB3A 2PPQA 2JFLA 1K2PA 2FH9A 1S9JA 4JQ8A 4RJ7A 3VHKA 4UZHA 5HCZA 3FXZA 4FIGA 3UP2A 3QXPA 1OM1A 4X3FB 3QRUA 4XX9A 1JWHA 4O1PA 4KRCA 1TVOA 4OUCA 3SKCA 4RA5A 1MUOA 4IWOA 4UWYA 4EUTA 4E3CA 3OCGA 3CE3A 4U44A 1WBPA 4FT3A 5D10A 3TUCA 2PZPA 3GP0A 4O83A 1YI3A 1ZAOA 3OXZA 3A7HA 2Z60A 3V6RA 4CXAA 2DQ7X 2C5NA 4YPSA 3EN7A 1NVSA 4HCTA 3VUMA 4MBIA 4G34A 4J1RA 4BDDA 3BLHA 1CKJA 3FI2A 2CNUA 2UUEA 4EH5A 3LFQA 2WD1A 3HKOA 1STCE 3RPRA 3F88A 5D11A 3ZU7A 3W0NA 3HV6A 4FV2A 5F20A 4OBQA 4ZY4A 5EYKA 3AKLA 2C1AA 4BY9E 1UKHA 2VX0A 4X3FA 4M68A 4PP9A 4XHKB 5FBNC 3TTIA 3LQ3A 1TQIA 3A2CA 2UZLA 3D5UA 3VC4A 4BDKA 4DBXA 1YI4A 4IHPA 5C4LA 2VO3A 5HLNA 4EK6A 3KXHA 4XBRA 3P7AA 2XM9A 3KXZA 1B39A 4DLIA 3R1YA 4BI1A 3IS5A 4M14A 2E9OA 2RFSA 3DFCB 3FDNA 4R3PA 4XG2A 2C3IB 2OKRA 3MI9A 4APPA 3R2YA 3UQCA 1YWRA 4EHGA 1I44A 1GIJA 3ZBFA 4IZ7A 5CZIA 2GHGA 2JFMA 3CD8A 3VNTA 4PL3A 4QOXA 4BJJB 2GCDA 1OKWA 3BYOA 3KXXA 4KS8A 4NU1A 3ZMMA 3ELJA 3JY0A 4F9AA 3BEAA 4W8DA 3HVCA 5CANA 4A07A 4ONAA 3EWHA 4AE9A 2VTTA 1WBNA 2QLQA 2R64A 3ATSA 3Q2MA 2WO6A 4EJ7A 2X0PA 4E5WA 3FBVA 2PK9A 2VTHA 3EQFA 4BICA 4E20A 2BROA 2XBJA 1BI8A 2PE2A 4IANA 1OECA 4LRMA 3ZOSA 4N4SA 5GIPE 4KAOA 3FQHA 4DE4A 2DWBA 3DNEA 4C4EA 2ZFYA 2HY81 2RFDA 4FSTA 4IFGA 4IVCA 5IMEA 4PRJA 4YP8A 1GIHA 3QQLA 1F0QA 3WI6A 4E4LA 3NZ0A 2BRGA 4MXYA 2OH0E 5E90A 5BUJA 2YZAA 1LR4A 2WQNA 2ZM3A 3ZRKA 3GUBA 1XH4A 2VWYA 3DBQA 5DG5A 4O0WA 2O2UA 3NYNA 5HG5A 1DAWA 3NNUA 5CQUA 1Q97A 2PYWA 2W1IA 4IX3A 4R7BA 3EQRA 4NCTC 5KMLA 3AT3A 5AM7A 2R0IA 1IEPA 1M17A 4AP7A 5IKWA 2OJIA 4XS2A 3C5UA 4JOAA 3A8XA 2PUUA 4ZTSA 4CQEA 3AC2A 4KWPA 5F1ZA 2GHLA 3U6HA 4GFOA 4R7IA 2UZUE 4A9YA 4EK8A 2XIYA 2EWAA 2VTQA 4BTFA 2J9MA 4YTCA 3DLSA 3P78A 1H1RA 1YKRA 4L7SA 3TCPA 4BDAA 2P2HA 5EKOA 3QUPA 4M13A 2BZHB 5HNIX 2W1HA 3CJGA 4FIIA 3KCFA 3LZBA 1J7IA 2VX1A 2XCHA 3BRBA 4QMSA 4EOKA 3Q4ZA 4F9CA 4YZMA 1RQQA 4C4IA 3OBGA 4GL9A 2J0JA 5TE0A 3JVRA 3L8VA 3PPKA 2GQRA 3R2BA 3QTSA 3QCXA 2UZWE 3UJGA 4FKGA 2VWVA 4QPMA 5CZHA 4YSJA 3GFWA 3PIZA 4YHFA 3TACA 2VV9A 2IZUA 3VBYA 3L9NA 4NWMA 4QMUA 4BDGA 3PLSA 3FEGA 2JBPA 4XG8A 4Z7GA 4EKLA 4NZWB 4BGGA 2HK5A 4LDTA 2PMIA 3FMEA 4IAYA 4USFA 5DRBA 2E9UA 4PTCA 4F08A 4BKJA 5LCJA 3FMJA 2BHEA 3EOCA 3A7IA 1J1CA 3OVVA 4Y85A 2JIUA 3UO6A 3EQGA 4IWPA 5E8UA 4U5JA 4FZ7A 5ETFA 4IDVA 4ZSEA 4AZFA 3R04A 4HGSA 4E7WA 2I1MA 5FUTA 3KGAA 4L67A 1NVRA 5FDPA 4LI5A 5CENA 3P5JC 1O9UA 1OIQA 2BRNA 3NNXA 1Q61A 4B99A 2WAJA 2C0OA 2RG5A 3Q53A 5TT7A 4U7ZA 4AXAA 4TYJA 3E64A 3EQCA 3PVWA 3EYGA 4CKIA 3H0YA 3VUDA 3ZDUA 3EN9A 4N6YA 3UGCA 2X7FA 3DK7A 5CEQA 5IQHA 4FIHA 5IISA 3A7GA 3AC3A 3ZO1A 4HGLA 5DT4A 5GJDA 2NNWB 4DHIB 4ZTLA 4U9AA 3RI1A 3NDMA 3RM7A 2CGWA 3G0EA 4M69A 3PXRA 1IASA 3E7OA 5ANJA 4MQ1A 3QX2A 3RALA 2JDTA 4NEUA 4DLJA 4KKEA 4G5PA 3MVLA 5C8NA 4WD5A 1ZZ2A 4R78A 3OY1A 2HELA 3BGQA 1OI9A 4C0TA 2J0LA 2AC5A 4W9WA 3SXFA 5AV1A 2R3NA 4LG4A 4IVAA 4F1MA 2VWZA 3JR1A 5HORA 3PLAE 2J2IB 3BL9A 3FWQA 3VONA 1KOAA 3MPMA 5DLSA 3L9LA 2A27A 3SW7A 4FKLA 3QLFA 4BIEA 4JBPA 3T9IA 1CKIA 2UZEA 4YJVA 2R3HA 1U46A 4QDEA 1OKZA 3ZO3A 2GNLA 3H9FA 4CT2A 3GC0A 2IZTA 1MQBA 4F0IA 4FA2A 2C5XA 4KIKA 4N70A 5GJGA 4FEVA 5E8WA 4B8LA 3TM0A 3O17A 4AZVA 2OJ9A 4IM2A 4C4GA 2V0DA 2YITA 5JGAA 2XIZA 3QRKA 4QTBA 3HAMA 5JK3A 4G31A 3PG3A 1OL7A 3QTXA 4FIJA 1UNLA 3HUCA 4L43A 3R1SA 3ZTXA 3DLZA 4DN5A 2HOGA 3UBDA 2JKMA 5EHYA 2B53A 4FV6A 3EQIA 2C5YA 2HZIA 4IX5A 4KABA 4RVKA 4YJOA 3ZH8A 4AFEA 4CFNA 4E93A 2HXLA 4A9SA 2QI8A 2JDOA 4NM0A 5ANIA 5L2QA 4KIOA 4QO9A 3ZEPA 2BTSA 2R3FA 2CLXA 4AACA 4XRJA 5AR2A 4IJ9A 1LUFA 3TZ7A 4BKZA 4E1ZA 3IOKA 5HX6A 3NUSA 4U40A 5F4NA 4DGGA 4TYGA 4TRLA 4EHVA 3KK8A 2Z7QA 3QTZA 4M0ZA 5H8EA 2ZMCA 2J4ZA 2YIQA 3DFAA 2OIBA 4BBEA 1J7UA 1IAHA 4BC6A 1ZXEA 3D0EA 4QTCA 3KVWA 1Q5KA 3JPVA 2JKOA 3BU6A 5CF8A 4EWQA 5AP7A 4G9CA 5HIEA 1RW8A 5HICA 4RJ6A 2OO8X 4QP6A 2PE1A 4MEDA 2W4JA 3TN8A 4UY9A 3D4QA 3FXWA 3OT8A 1YWNA 1OUKA 2W06A 2OG8A 2JD5A 3FUPA 4QMOA 4X0MA 4RMZA 5AUUA 5IQCA 1WCCA 3JXWA 2WIPA 3ORPA 4XLIA 4TY1A 3FHIA 3C4EA 1FMKA 1H01A 3EQHA 3RK5A 5ANEA 4A9RA 5GZ8A 5IH4A 3OOGA 4MHAA 3HV7A 4IB1A 4N0SA 4NM7A 3V8TA 4QMLA 5A54A 3IONA 5GINE 2X4ZA 2Y6OA 4G3GA 2UVXA 5AM6A 4LV7A 2A2AA 4UXQA 3V5WA 3CQUA 5KMIA 4YJUA 4NYEA 2V62A 5ETCA 1HCLA 3U4UA 2ETMA 2EU9A 3I0QA 2ZYBA 3QD3A 3VBQA 4AGCA 4BCPA 3RBWA 3UNKA 2UVZA 4JQEA 3D94A 3SD0A 4A06A 3RHXA 3NWWA 4M84A 3A60A 4FNWA 5CU3A 3AGLA 3PY1A 5AP5A 1CTPE 3WE4A 5BNJA 4UZDA 5J79A 3RAIA 2CCIA 3GVUA 3Q9WA 4EOJA 4L68A 2VGOA 1Q62A 5IQGA 3BPRA 3EFWA 4KKGA 3R83A 3D83A 1RDQE 2IVUA 2ZDTA 3PXQA 4J99A 4WG5A 2OW3A 3W8QA 4RJ4A 4DT8A 4D9UA 4RIXA 2RFNA 1KUTA 5DOSA 5E8SA 3L9PA 4M12A 4Y95A 1PXLA 4AW1A 5ITAA 2VTSA 4CFUA 4O27B 4KD1A 3QCYA 3SX9A 2YZLA 2XS0A 3CQWA 2J0IA 1VZOA 4EH4A 3LXLA 2VTMA 4DFNA 5DN3A 3UIMA 3ZFXA 3ZYAA 4O86A 2X0QA 5IEVA 3O8UA 2C0IA 4GG5A 4BFMA 4I6LA 2VNYA 5FG8A 5M4IA 2GTNA 2FB8A 3NX8A 4FV0A 3RINA 4DFLA 2O65A 4I0SA 2VNWA 4FV1A 3RAWA 3AG9A 3E8DA 4R7HA 3W16A 2QO7A 5F95A 5I9VA 4I92A 2IF8A 2ZV2A 3O50A 4GG7A 1LPUA 3S3IA 3PZHA 1ZMUA 5EM7A 1WBSA 5FTOA 2Z02A 1PYXA 2EVAA 3BELA 5I9UA 4D4SA 3EFKA 3LFFA 3PXKA 1ZLTA 4EH3A 1XH8A 3V5TA 3QRJA 3ODYX 5TOZA 3FPMA 3KXNA 5C8MA 4U42A 4C59A 4GIHA 5HNGA 2PZRA 3ULIA 2UZTA 4CD0A 1MP8A 3TUBA 3RWQA 3O0GA 3IDPA 5H8GA 3NW7A 3PUPA 4QP3A 2WPAA 4RC2A 5FD2A 5KKRB 3TUDA 5JFVA 3MTLA 3PXFA 2NPQA 5TO8A 3HEGA 3U9CA 5GZAA 3FHRA 5E4HA 4HCUA 3FMMA 4QQJA 2WTIA 5D41A 1H28A 5KNJA 5FEDA 3PUFC 3AC5A 3CY2A 3GB2A 4FSWA 4O91A 4X2GA 3WARA 2CGVA 4EOPA 3D14A 2I0EA 4PMTA 4AN3A 2W1EA 2H96A 2C0TA 3NIZA 4DFZE 4ZTRA 4I93A 3U54A 1E1XA 3UO5A 4G16A 4FV8A 4RFMA 2PWLA 3W2QA 4HPUE 4IM3A 1E9HA 3Q4UA 4G17A 3HMOA 3KXGA 2IZRA 4HZSA 4Q9SA 4XV2A 4ANBA 5HNBA 4F99A 3F5XA 5FWKK 5BQ0A 4I6BA 1IA8A 5IMXA 5EKNA 1M2PA 2CDZA 3VULA 4CKJA 2JC6A 4NKAA 4Q5HA 4ANLA 3AC8A 4L53A 3MH3A 5AEPA 4CYJA 4FC0A 1H0WA 3KK9A 1X8BA 1CM8A 5IU2A 2WMTA 3TDWA 1PMUA 2W7XA 4QP7A 2CNVA 3TWJA 1U4DA 2B1PA 3BE9A 4WO5A 2QQ7A 3IOPA 3V5LA 3AD4A 5HG7A 4YJSA 2A0CX 4DGOA 4O7RA 4FMQA 1XBBA 3KRRA 2ZAZA 1TKIA 2C47A 2XRUA 2WMRA 3MTFA 4J52A 3FV8A 3LFDA 3AD5A 3SQQA 3NSZA 4O4CA 4CTBA 2OXXA 5L6OA 5LARA 2OH4A 4IQ6A 1TFFA 3UZPA 3N4UA 5DIAA 5EDPA 3RJCA 4HJOA 5LVNA 4U80A 3KB7A 1O6YA 3BYMA 1M2RA 2JIVA 2AC3A 3JYAA 4G6OA 3R22A 4ITHA 4F63A 5FTQA 1S9IA 4EBWA 2BHHA 2BZKB 3SV0A 2YCRA 2WTDA 3ZEWA 5I0BA 3G15A 2FSTX 3C4WA 4EORA 4I41A 3Q3BA 3CXWA 3TKHA 4O1OA 1XMMA 3DKGA 3QA0A 1YHSA 4DCEA 1ZOHA 4FTTA 1HOWA 5I5ZA 5EQEA 2XNGA 4MD7E 2P3GX 5D7VA 3U8WA 4EYMA 3MH2A 4XOZA 4BDCA 3CTJA 5LJJA 2QODA 2C6TA 5AAGA 3VS7A 4MWHA 2I6LA 4IZYA 4A4OA 4CZYB 2NO3A 4MXAA 4AXFA 3R02A 5CALA 3U51A 4Q2AA 3F69A 3Q04A 3VAPA 5IEXA 3W0RA 2VTAA 2ACXA 4GRBA 4MNFA 3C50A 3RKBA 4CEGA 5AR8A 2FO0A 4Z55A 4S32A 4NW6A 2OZAA 3VUHA 1F3MC 3CSVA 3I81A 4ERWA 4PDSA 1YXSA 4BI2A 2W17A 4OTWA 4AF3A 5C1QB 4H3BA 1PMEA 2HWPA 4LL5A 2CKPA 2WKMA 2HZNA 3SOAA 5CYIA 1M14A 2DUVA 2GS2A 3VQUA 3D5XA 1YXVA 2YCSA 2YIXA 4R1YA 3R8LA 3UQGA 4CG9A 4FL1A 5G6VA 3EN4A 5A4LA 1WVYA 4NFMA 2CLQA 5CAPA 4K6ZA 1FBNA 2WTVA 4XUFA 3U87A 3FSKA 4MK0A 4OBOA 4YPDA 5HIBA 3AKJA 4O7SA 2VX3A 1OMWA 2XNNA 5D9HA 3NVKI 4C38A 3O5AA 1V0BA 4CMTA 4O4FA 3OW4A 2W1ZA 1FOTA 3H4JA 5HE3A 3R7IA 5BVWA 1XWSA 4WOVA 4YLJA 3VF9A 1H24A 4JDKA 3NCZA 1JOWB 4PUZA 3V5JA 2F2CB 1UU8A 3GOKA 2EXMA 2P0CA 4HGEA 5CNNA 4ANOA 4LOQA 5KMMA 5J1VA 5CT0A 4OTQA 4F9WA 2R9SA 4P5ZA 3QF9A 4MX9A 4B9DA 2W9FB 3PY0A 2V7OA 4DH1A 3QQUA 3PA3A 5DVRA 3C4XA 1YOJA 3ZXZA 4V05A 3C13A 4MH7A 2OJFE 1OITA 4ZY6A 3I6WA 5ANGA 2B9HA 2CN8A 4S2ZA 4ZXTA 4UYNA 5IUHA 1R39A 3HV3A 5DEYA 3RPVA 2B55A 2RG6A 2R4BA 3FMDA 4IAFA 4OW8A 4XV9A 3AXWA 3DGKA 3EIDA 4GT4A 4YJNA 4I20A 2XJ2A 3ORIA 3RM6A 2VTJA 2GS7A 2PMLX 2YDIA 3E62A 3ITZA 3FLNC 4UEUA 3HGKA 3S4QA 4JT3A 3ZRMA 3D5VA 4JJRA 1U59A 3PP0A 4W8EA 3O7LD 4XP3A 2H9VA 2GNHA 2P33A 4X2KA 3L8SA 4ZOGA 5EYCA 1YOLA 4YBJA 3TKIA 4O7NA 5IA4A 3QQKA 2CGXA 5BYZA 5M44A 3O8PA 5HLPA 2YM8A 3W8LA 1XO2B 1XQZA 2WMAA 5L8JA 2X0GA 1H25A 2QNJA 3G51A 2R3PA 3DY7A 5M57A 2V55A 2YDKA 1TQMA 4ALWA 4ANSA 3OW3A 3O51A 4BRXA 4TYIA 4CSVA 3SRVA 4TYHA 3POZA 5HO6A 2B9FA 5FBOA 5F94A 3TEIA 4WA9A 5EI8A 2PUPA 3EMGA 5CEOA 4K9YA 2R3IA 3NFFB 4OTRA 1UU7A 4JLCA 3UC4A 3ZM9A 3FLQA 4O7LA 3LCDA 2WXVA 5KZIA 4KSQA 4FKTA 3ODZX 4JRNA 1V0OA 2XRWA 3VS4A 5AP4A 3NYXA 5KX8A 2XALA 4GKHA 3SC1A 5AV2A 3KMMA 4ZTMA 3LFEA 4O82A 5CVHA 1PRYA 4JIKA 3HNGA 3ZC5A 2WTCA 4FX3A 4CFVA 4CGAA 5HVYA 3NYVA 3GC9A 5J5TA 2XKFA 3CBLA 3G0FA 4KS7A 4UMTA 2KTYA 3R8UA 1ERKA 3WZKA 5AX9A 3VHEA 4PWNA 3BE2A 4CFXA 5I9XA 1H1PA 2WTKC 2OK1A 5HCXA 5HOAA 5CSPA 1WMKA 4G1WA 4B6LA 4FSMA 4OT5A 4NM5A 3TJDA 2X9FA 4II5A 3C0GA 4NJ3A 4AT4A 3KREA 2PVKA 2GU8A 5CX9A 5LQFA 3NLBA 1JNKA 4JAIA 2BRBA 5CAOA 1HCKA 4R6VA 5HU3A 5IQBA 1M7NA 3GU5A 3IDBA 2GMXA 3PVUA 3QLGA 2F7EE 4J7BA 3U4WA 3EFLA 4QT1A 2JLDA 4FL3A 3TIZA 1IAJA 5G1XA 2WEIA 4J95A 4RT7A