4AGUA

Crystal structure of the human cdkl1 kinase domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
290
structure length
277
Chain Sequence
EKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFARLLTRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLKGCLHMDPTERLTCEQLLHHPYFENIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human Cdkl1 Kinase Domain
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords CYCLIN-DEPENDENT KINASE-LIKE 1
total genus 86
structure length 277
sequence length 290
chains with identical sequence B, C
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4aguA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aguA01
2JKKA 3R8PA 4F64A 5HO7A 2IN6A 1UU8A 3NZ0A 2A0CX 2XM8A 4IB5A 4KIKB 4F7JA 4H05A 4XMOA 3W10A 4DN5A 1OUYA 4JJRA 5BVNA 4EOKA 2PTKA 3GU8A 4U81A 3TTJA 4Z55A 4CTBA 2X6DA 4AAAA 4HYIA 2P33A 3GBZA 4RWIA 4RSSA 3KQ7A 2QKWB 2UW0A 2YDJA 4IZAA 1Q62A 4GEOA 3WF7A 4CMUA 3PYYA 5ETAA 4M66A 1J7LA 1VR2A 3EH9A 3BU5A 4AW0A 3KMMA 4EH5A 1M52A 2FH9A 3D83A 3TNHA 4YU2A 5LCKA 3U9CA 4XH6A 3W16A 4I0RA 4OTHA 3VBTA 3ZOSA 2PMOX 4U80A 2ITVA 4JBOA 3TUCA 2C6TA 4K11A 5B2LA 5BVFA 2C5YA 2VZ6A 3LXPA 3QTSA 4IXPA 5LWMA 2R3NA 4KSPA 4LMNA 5DNRA 3UBDA 3A7JA 4CYIA 3F3UA 2VO6A 3QCQA 4J98A 2OICA 3I5ZA 3TKIA 3E8EA 4JG7A 4I20A 1M7NA 2UW4A 3ZMMA 5I9WA 4KRCA 3GVUA 3GFWA 2YIQA 1MRYA 3F2RA 2F7XE 4NCTA 5BX0A 4ENYA 2PE0A 4RFZA 3RM6A 5KBQA 4K8AA 4BCOA 2BAKA 5EDRA 4ZZMA 3D2IA 4ERWA 2XUUA 3OVVA 4QYFA 2QI8A 4E26A 4FKQA 5HX8A 4EOJA 5IH6A 4QMPA 4FT3A 2VTLA 5L2IA 4IAIA 1P5EA 5DI1A 4BGQA 4CFWA 5LMBA 5E8VA 3C4WA 5FDXA 3OEFX 4EK5A 5C4KA 4X3FC 5H9BA 5EQEA 1O6LA 3P08A 4RX9A 5EI8A 5J9ZA 5IUGA 2IZSA 4IMYA 3VQHA 4OTWA 3PIZA 2WD1A 2J6MA 1SZMA 3BX5A 3DBEA 5DRDA 2BMCA 5DRBA 2B53A 2E9VA 2XNNA 3GOKA 4Y46A 3VS7A 5M44A 4MWHA 2PUNA 5CU4A 5I4NA 4V0GA 4EWQA 3T9IA 2CGVA 2RSVA 4JX3A 4RIOA 4RFMA 3UGCA 5AIKA 3FMDA 3GEQA 4AGDA 3C0HA 2HAKA 3SG9A 5CY3A 3NNWA 4RVMA 3CC6A 2I6LA 5AR3A 3FUPA 4TYHA 4CG9A 3BHUA 2B9FA 4BR3A 4XRLA 4HNIA 4DEBA 3TN8A 3DK3A 3R8LA 4A7CA 2R3KA 1XH5A 5HIDA 4C3FA 5CEOA 4MCVA 4BIDA 5DYJA 2F7EE 4J52A 1FGIA 4DITA 2HZNA 4II5A 5HTIA 3N4VA 1LUFA 4UY9A 4RIYA 5CSVA 3RM7A 3PE2A 4OLIA 5HHWA 3RK5A 1Q4LA 2BRHA 3KULA 4O21A 5J5TA 2BRNA 3HL7A 2H9VA 4GMYA 2XJ0A 2Y6OA 3NUUA 3RPYA 5IA0A 1FVRA 4ORKA 4FTCA 2W1ZA 2IPXA 2WQBA 3H0YA 3FKOA 3ZLYA 5AV0A 3T9TA 1Q99A 4DEIA 2JLDA 2WHBA 2WTWA 4MH7A 3TJCA 2GNHA 5CNNA 4YO6A 2DS1A 2OW3A 4I6FA 3OP5A 4GUBA 3DNDA 4UWBA 3LXKA 4RMZA 4N6ZA 4IX5A 1OKZA 4DAWA 2C3LA 3WZUA 4AGUA 1JBPE 5J79A 2CKPA 4FEWA 3CPBA 3ZS5A 1PY5A 1DI8A 3KN5A 5EHOA 5FEQA 3V5WA 5HLWA 2HOGA 4RA5A 2GTNA 4IQ6A 4GV1A 3F3VA 5A4CA 2UVXA 4NL0A 5HKMA 4Y5QA 2Z7RA 1ZOEA 4GJ2A 2OIDA 2Y6MA 2W0JA 4HCTA 5JGAA 4G9CA 4TT7A 4FYNA 2WTJA 3ZO2A 1KE6A 1PHKA 3O17A 3QTIA 3HMOA 5I3RA 4E93A 2JBPA 3BWJA 5DEWA 3N51A 3EN4A 4MBJA 3VUHA 3QQLA 3PA3A 3LCKA 2ZAZA 2F57A 4HOKA 4ACDA 1MRVA 2PE1A 5F4NA 5HORA 4F1MA 5I5ZA 4TY1A 2Y4IB 4U9AA 4RQKA 4C36A 3TJDA 5M57A 4Y72A 4I1ZA 2EWAA 2PVMA 4QTAA 4CNHA 5LCJA 2W9FB 2X8DA 3DAKA 1KE7A 1WBOA 3BLRA 4BYIA 3RHXA 1H24A 4NJ3A 1ZMUA 1MQ4A 3PIYA 4I5PA 2VWXA 2XIXA 4BCIA 3ZFMA 4XLIA 3KRLA 4HPTE 4WG4A 4O7TA 3ET7A 2HWOA 1P2AA 3FMEA 3C7QA 4R1YA 1OL6A 1WAKA 2UZBA 3LE6A 4D4SA 4NYEA 2YJRA 3FMNA 4GVAA 2OJIA 2BIYA 1OPLA 4JX7A 4O22A 2J0MB 3KVWA 4C57A 4RJ6A 3FMHA 3UO5A 3PJ2A 3UVQA 4I4FA 4QMQA 5E8YA 3MVHA 5HQ0A 4F9CA 4DGNA 2WO6A 4JVGA 2WQMA 4LL5A 2HW6A 2I40A 5B2MA 4O0UA 4ARKA 5KMKA 3VHEA 3UQFA 4O83A 2WTKB 2GFSA 4GT3A 1YXTA 2Q0BA 1YOMA 4BWPA 4NSTA 1W83A 3LFAA 5JT2A 4YC8A 4QPMA 3QQGA 4YBKA 5FXQA 4R7HA 4M68A 3PSDA 2QNJA 3MFRA 4MXOA 2UW9A 2IVUA 5JKGA 4PTEA 1GIJA 3IK3A 1GNGA 3FXZA 2XBAA 3QQUA 4GVJA 4DH5A 2QR7A 4YR8A 4F7LA 5IQAA 3U54A 1YWVA 3SRVA 3EQRA 1JNKA 3Q32A 4PF4A 2YCRA 3BCEA 3GQIA 5IA2A 2QONA 4A4XA 5KZIA 5I9UA 3Q96A 2OIQA 5FM3A 3ULIA 4GFOA 3OUKA 4DFZE 4PMPA 3P23A 5AUUA 2R0UA 3Q6WA 4I6BA 2IW8A 5IPJA 2R9SA 5TR6A 3KN6A 4QRCA 3BU3A 5LVMA 4BHZA 3HMNA 1YXSA 3I79A 2OJGA 4XX9A 4GW8A 4F1TA 4CZUA 2OJ9A 3R9NA 4AOIA 4IB1A 2UZVA 3LW0A 4ZY6A 3RAHA 4PP7A 2PZYA 1O6KA 2OI4X 3HA8A 5AP6A 1SNUA 4OW8A 4CZYB 4AT5A 2Y9QA 4I5MA 3SC1A 4JAJA 3QZIA 4UV0A 4S34A 3DNEA 3S95A 2JIIA 3GFEA 4L01A 1GZKA 4O0TA 3VJNA 2Q83A 3LJ2A 5J1WA 1H27A 2XKDA 5CXZA 2VTTA 5I9XA 5EQYA 2J51A 2X2MA 3OW4A 4O6LA 3DZQA 3PRIA 3ZCLA 4RX7A 4YJUA 4GUEA 3QCSA 4IB3A 2DYLA 3C50A 3CXWA 3LCTA 3MV5A 3RZFA 3NUXA 4YLJA 2YCFA 4G1WA 3SDJA 4DEEA 3R8MA 2W96B 3P9JA 4DHFA 1UKHA 3KF7A 5JGBA 4M15A 4RIWB 2EVAA 4RLKA 5LVOA 3NYNA 2WEIA 3P5KA 2GNLA 4CMOA 5CSPA 5JGDA 5FUTA 4I6QA 2ERZE 1UNHA 3DXQA 3W2SA 4PUZA 4LMUA 3R73A 4GJ3A 4XRJA 1JQHA 4ZLOA 3TKUA 4CFMA 3R2YA 1TKIA 4O82A 5AJQA 4MK0A 4A9SA 4OAUC 3TKHA 2CSNA 2YFXA 4BCNA 2CGWA 1Y6AA 5A4LA 4HYUA 3HGKA 2BCJA 3GP0A 4XUFA 4YJRA 3EN5A 4F0IA 3NR9A 3LVPA 5JEBA 3QA0A 4IEBA 4FKUA 3FZ1A 4BI0A 3BYUA 4A4LA 4F7NA 3HUCA 1H1SA 3FV8A 2R64A 2EXMA 3R9OA 5CF6A 2QOCA 2BDJA 3IW8A 3Q2MA 3I6WA 5C1QB 3R04A 4G6NA 4J7BA 4I93A 5H2UA 3QTXA 4ANQA 3CCNA 3HV3A 2OBJA 5C26A 3ANRA 1IEPA 3DB8A 4P5QA 3KRWA 5ANJA 4G3DA 2Z7LA 2X2KA 2JC6A 2J90A 4FV7A 4U42A 3RAIA 2VWYA 4UMPA 1XKKA 2XJ2A 2YACA 4DYMA 4O7RA 2FSLX 4O7ZA 1J3HA 2XKFA 2XNBA 4V01A 4ENXA 4K33A 3HECA 5BQ0A 3DBDA 4CKJA 2RG6A 3E92A 3UG1A 3FXXA 3BI6A 4J71A 3DFAA 5D10A 3G33A 1UV5A 4O7VA 4Q2AA 1OBDA 2BRBA 5IA5A 3FZOA 3BYVA 3QKLA 3QQFA 4BICA 5AAEA 4J1RA 5FTOA 3V6SA 2UZNA 5CEKA 2YEXA 5D11A 3B8RA 5GHVA 2VWWA 5EM7A 4OTIA 4AOTA 3KRJA 5IH5A 3JPVA 4D4RA 4IAAA 4MQ2A 3RZBA 5FG8A 4C2WA 2VWIA 1O9UA 3COIA 4MBLA 3UOKA 2QO9A 3MFSA 5A4TA 3IS5A 4CEGA 3VC4A 3MH1A 1WVXA 3AGLA 4FV6A 3WIGA 4JR7A 2C5VA 4FKIA 3BGZA 2J0KA 5AAGA 4DTKA 3RTPA 4CLIA 5GNKA 5CX9A 2C6LA 3KK8A 1ZYSA 3OMVA 3PRFA 5AM6A 4ITHA 3EQDA 4ZXTA 2XJ1A 4AT4A 1ZWSA 2ITWA 3QYWA 3V3VA 3VS3A 4RVTA 5E8UA 5IA4A 1RDQE 1GY3A 1JWHA 4XCUA 4YZ9A 4U5JA 2XIZA 3DZOA 3U4UA 4DFXE 3UMWA 2OXYA 2HY0A 2QLQA 2V5QA 3FPMA 4BRXA 2PVRA 4CXAA 4EUUA 2VRXA 1J7IA 3W55A 2FGIA 4QO9A 2WKMA 3I4BA 3VS0A 4OTDA 3LJ0A 5L4QA 4JLCA 4MYGA 3D7ZA 4C02A 3TUDA 5AV1A 4TNDA 3G51A 4ZSJA 1OB3A 2IW6A 1IAHA 4QQ5A 1L8TA 3VBVA 2WMSA 2GS6A 4EK8A 2B54A 2W1EA 2PVKA 3NLBA 4F6SA 4J97A 4QTDA 2PMLX 2IJMA 5EDQA 1Y8YA 2F2UA 3MA3A 2BZHB 4GFMA 4RJ7A 3SLSA 4QMZA 4EOMA 3FQEA 4PDPA 4Y83A 3KFAA 2OFVA 3UIMA 2WMXA 3BELA 2PMNX 4BBFA 4EOLA 4F9YA 3E88A 2IVSA 2DQ7X 2R3PA 3CIKA 1OM1A 3LPBA 4GT5A 4MQ1A 4YBJA 2XH5A 3W2CA 4CFUA 3ZM4A 4FNXA 4CSVA 5M4IA 3FI8A 3PUPA 1YXUA 3WF5A 4CQEA 2OU7A 3KB7A 3UP2A 4RJ3A 3ATSA 4FKLA 4HGSA 5LVNA 3RK7A 1KOAA 4RC4A 5EHLA 4OT6A 3VUDA 5KMLA 1XQZA 3LMGA 3SOCA 3QGWA 4LG4A 5AUZA 3NCZA 2YIWA 5HBEA 5C8KA 5DGZA 2GNFA 3KMWA 4GKHA 4AN3A 1OL1A 2QU6A 2PZPA 4W8DA 5GJDA 5I3OA 2HXQA 5G1XA 3LIJA 2R3RA 3NGAA 4KABA 3IGOA 4R6VA 4K77A 3H9FA 1B38A 3NX8A 2PZRA 3DDQA 4FTJA 2O64A 4CFXA 3PVUA 4OTRA 3FQSA 3E8NA 2PK9A 3O8TA 4FIGA 5C01A 5L6OA 5ANOA 3ALOA 1JKSA 5ETCA 3OT3A 3O50A 4YP8A 2F9GA 2PL0A 3LQ8A 4YTIA 4NEUA 2C0OA 2PUUA 3L9LA 4LRJA 3MPMA 4EONA 1XBAA 4GU6A 3GNIB 3QHWA 3WF8A 3MESA 2IZRA 3I5NA 5CLPA 2QURA 4C3PA 5IQGA 3RP9A 3NW6A 1M2PA 5E8ZA 4EZ3A 5JSMA 4QYYA 5EHYA 3E93A 3TDVA 3Q2JA 1Z9XA 5HBHA 2JAMA 4BY9E 5AP4A 3UIXA 4NIFB 2NO3A 3EQBA 4LV5A 1LR4A 4BDHA 3QRUA 5AR2A 4RJ4A 2BTRA 3EL8A 4CCUA 3ID6C 3IW5A 4DEGA 5HU3A 2GQSA 2XEZA 5AA9A 4PTGA 3FI2A 3MB7A 4KS8A 5M4CA 4FNYA 1H28A 3CGOA 1KE9A 3SQQA 5HLPA 3IDCA 2ZYBA 3QTUA 1IR3A 3MVMA 5AV4A 3HYHA 3G0EA 4YGAA 2W17A 3ATTA 1WBPA 3F7WA 4I94A 5EH0A 3TACA 1H1RA 4JQ7A 4YJOA 3IG7A 1ZMVA 4FSQA 3OW3A 3IQ7A 4BKZA 4E6DA 5CEPA 3LFEA 4FNZA 2QHNA 4DLIA 3AOXA 4QYHA 5HG5A 4DG2E 4APPA 1UNGA 3ORNA 4R5SA 3FL4A 4FT0A 4I5CA 4X2KA 2XMYA 5AMNA 3P0MA 5HNBA 3MSSA 5BMMA 5KX8A 1HOWA 3BPRA 3C0IA 3PZEA 3F5XA 3F5GA 3EKNA 4DCAA 3VBWA 3PJ8A 1YI6A 2O2UA 2R3JA 3MYGA 5EOLA 3CPCA 5IF1A 5CI7A 3NEWA 4O2ZA 3SW4A 4XYFA 3KGAA 1Y91A 5LMKC 3NYXA 5GZAA 2PSQA 3R1QA 5IMXA 3PLAE 4QMOA 3FKNA 3SVVA 1JKLA 3MH0A 1AGWA 4IM2A 4OTGA 4YJPA 1GZ8A 4IFGA 4B8LA 4DG0E 2QOHA 3PJCA 2GNJA 3ZC5A 2VV9A 3DS6A 3ULZA 2F2CB 4BWXA 4K2RA 4FKJA 3ERKA 3QAME 1ZXEA 4QP9A 2WIPA 4F08A 4L52A 2WTIA 2XNGA 4MKCA 5E9EA 4FZDB 1JSUA 1CKPA 5M07A 4KKEA 5FBNC 1W8CA 5L6PA 3QRIA 3A7HA 3SKCA 4BDDA 2ESMA 2VU3A 3OF0A 4NT4A 2W1HA 2B7AA 5AR8A 3ZSGA 4EHEA 2H34A 3QTZA 1Y57A 3NYVA 4LUEA 5CAVA 4ZS0A 2PUIA 1DAYA 4WUNA 3E8DA 3GC8A 5KMNA 3PXFA 4ZY4A 1M7QA 1U5RA 4MD9E 4UEUA 3SW7A 4NU1A 3AC2A 3TNQB 2V22A 5AP5A 4FKRA 2CMWA 2B9IA 3G9NA 3ANQA 4RIXB 5DA3A 3O71A 3V5PA 4UX9A 2PVNA 3DA6A 3FLNC 1ZY4A 3MVLA 4C4GA 3K54A 3O96A 3EMGA 4XV3A 4G6OA 2WEVA 5CT7A 4XEYA 3Q4CA 4Q9ZA 2PVLA 3PXKA 5LARA 2XNPA 1Y6BA 4I22A 4BCPA 4U97A 3K3JA 4G3FA 1KE8A 4G3GA 4PNIA 4RWLA 2F7ZE 1PYEA 3KXHA 1PXOA 4YHTA 1Q8ZA 5GZ9A 1S9IA 4LL0A 5HE3A 2X0GA 3FY2A 3U87A 4X7QA 4BDCA 4YMJA 3NNXA 3NWWA 2QVSE 4O0XA 1H4LA 4KNBA 4HW7A 4G5PA 1YWNA 5DIAA 3DXNA 4WRGA 2HZ4A 2Z2WA 4AZEA 2C3JA 5IUIA 3UP7A 4BYJA 4QMSA 2KULA 3QC4A 2BHEA 2OH4A 3EOCA 4IH8A 4E6AA 2YZAA 4BDBA 4A9UA 4XP2A 4BIBA 3IDBA 5LVLA 3C9WA 3FC1X 3MJ2A 2WGJA 3W1FA 1U54B 1UU3A 4FTOA 4A06A 3P7CA 3SRVB 2UV2A 4G2FA 4IC7A 4FEUA 2PVHA 5M56A 4C35A 4I23A 4M3QA 5BVKA 4DFLA 2ZMCA 3MI9A 4YZBA 2WU7A 4AOJA 4EORA 1OL5A 1U4DA 2GS7A 3II5A 4ACHA 3FLWA 3O23A 5DN3A 4KIKA 1YVJA 5IQDA 2C68A 3OEZA 4PDYA 2BDWA 3AC3A 4AW2A 5EQPA 4XOYA 4V0GB 2YERA 2W1DA 3TV6A 2ITNA 1BUHA 3FDNA 3MN3A 4FEXA 4KIPA 4Y95A 2WIHA 5HD4A 3OCTA 4FKSA 3CJFA 4L45A 2JBOA 1U5QA 2UVZA 3F9NA 2H6DA 3A8XA 3LZBA 5D9HA 4F4PA 3FYJX 2Z60A 2BKZA 4I6HA 1H0WA 4GS6A 2HZ0A 3A4PA 3FMMA 2RKUA 4F70A 4FSYA 2WPAA 3F2NA 5A14A 1B6CB 5A6OA 4IAKA 3CR0A 2UZTA 4I0TA 3KY2A 3WF6A 3PSBA 1CKJA 4HVHA 4I92A 1H26A 3IKAA 4L46A 4O91A 3IONA 3TNWA 3LJ1A 4ID7A 4ZSLA 3EN6A 3A7IA 5GIPE 5JH6A 4K1BA 4O6EA 1I09A 5ITAA 2CN8A 4EI4A 4ZMEA 3L8XA 2YA9A 3VBYA 1PMNA 2B9HA 1E1VA 4L68A 4WBBB 3JVRA 2JAVA 3Q9XA 3TG1A 3HEGA 4ASZA 4JBPA 4O7YA 5E1EA 4O38A 5E8SA 1XJDA 3ORXA 5K0KA 1PXMA 1WCCA 3AC1A 1Y8GA 3EKKA 4K6ZA 3OXIA 2R7IA 4DH3A 1FBNA 2XNEA 3Q53A 2QOKA 1F3MC 3IO7A 4XJ0A 4ZTSA 4AA0A 3CEKA 4ZK5A 2R4BA 3HAVA 3H9OA 4PWNA 4ZJJA 4G17A 5KNJA 5J9LA 1QPCA 2ONLC 3FMJA 4IBMA 1BX6A 4IIRA 3CD3A 4Z3VA 5DR6A 3REPA 5CVHA 4FG7A 3C4ZA 3FXWA 5GINE 1QCFA 3ZZEA 4U40A 3ETAA 3VUIA 3G15A 2W1CA 2E9UA 3D0EA 3DLSA 4XV2A 2CGXA 4PV0A 4B7TA 4Q5EA 4CQGA 3FLQA 3V01A 4AFJA 1ZZ2A 4FL3A 3DKGA 4GIHA 3P78A 4B0GA 4H1JA 4YSJA 3RNIA 4GL9A 4YJQA 5AFVA 4ZIMA 2QOOA 4ALUA 5F9EA 5HLNA 3TZ8A 5M08A 4AS0A 4UB7A 4FTIA 3VO3A 4H3BA 2WB8A 1PKGA 1YOLA 2RFNA 4O0WA 2FUMA 3DKOA 4M84A 4NJDA 4YC6A 3QU0A 3UZPA 3PPJA 1OI9A 3R63A 1OPJA 2JKOA 3LFFA 4MF1A 1CTPE 2OSCA 3C4CA 4KWPA 4ZTLA 5JFVA 1LEZA 1YHWA 1YDTE 3I81A 2CCHA 3KULB 4CRLA 2J7TA 2OFUA 3R7OA 4BBMA 1W98A 1GIHA 3PG3A 4AW5A 3HV6A 1GOLA 2YWPA 5H8BA 1ZZLA 4FV0A 2PUPA 4JOAA 1URCA 1LEWA 3BGQA 4FSMA 5D7VA 5HD7A 1OIQA 1A48A 4KBCA 4ZTHA 4IE9A 3Q5ZA 4TZRA 5CEIA 4PX6A 3POOA 3MFUA 4MXXA 5IU2A 5IZFA 2V55A 2P2IA 4ITJA 5ACBC 2GNGA 1LPUA 1UWHA 2W99B 3ORKA 3W2OA 4ZLZA 5AUTA 4ERKA 4E7WA 1O6YA 5BVDA 5CF5A 2WU6A 3LCSA 3PWYA 4W4XA 3R2BA 3RALA 3Q04A 4WO5A 1OKYA 3JS2A 1XBCA 2YM3A 4HYHA 3BEGA 3VS1A 4BGHA 4R7BA 4QNYA 3L9PA 1FINA 5JZNA 4D2RA 3TNPC 4S30A 3AT2A 3C0GA 2P4IA 1LP4A 3NDMA 4F65A 2PZ5A 4RJ8A 5K3YA 3S2PA 4WT6A 5HNGA 1UNLA 1DM2A 2JDTA 4OTQA 4XBUA 4BZNA 5M53A 1ERKA 2GPHA 4GCJA 3V5TA 4W8EA 1OIYA 5CWZA 5FP5A 3UOHA 3D94A 2WTDA 2WMQA 1ZRZA 3QQHA 4RC2A 1M17A 3PFQA 4GRBA 4G3EA 2GU8A 5CVGA 4CYJA 3A99A 4TRLA 4JDJA 3LAUA 1YRPA 1Q8TA 3B2WA 5CSXA 2YM4A 4FICA 3IECA 5AUXA 3GOPA 3BHVA 3OC1A 4YSMA 4R77A 1WBWA 2B9JA 3PVBA 5HBJA 4RZWA 1T46A 2A2AA 3VUKA 4IX6A 5K5NA 4LI5A 4EOOA 3ZHPC 2CKEA 3A62A 4MD8E 4WSQA 4AWIA 2ZMDA 5J87A 5CXHA 2W4JA 1PXIA 4NTTA 4IM0A 3AMBA 2X4ZA 2Z7SA 2C5OA 2GCDA 3CQUA 4DGGA 4D5HA 2XKCA 5IEXA 3R7UA 4YJNA 3GC7A 3P4KA 3U51A 3AD4A 4EQCA 4NUSA 2YZLA 5FTGA 3S0OA 2V62A 3FZTA 3FKLA 2CN5A 2RL5A 3HP5A 5HCYA 4ZJIA 3R0TA 3UODA 4C4IA 2C30A 3AT3A 4RJ5A 3FC2A 2JD5A 3F66A 3H4JA 3RJCA 3HP2A 4O7NA 1U59A 1NXKA 3AG9A 1FMKA 3TV7A 1E1XA 3PJ1A 2Y4IC 2ACXA 3PPKA 4M69A 5AUWA 4BI1A 4HVGA 2QCSA 1WVWA 3F3ZA 3LXNA 3UVPA 5JQ5A 2WOUA 5J95A 4PPAA 3TV4A 4WD5A 3Q9WA 1W84A 4F09A 3P1AA 4NFMA 3MPAA 4LRMA 5HCZA 5L2SA 2BAQA 2OO8X 3ACJA 2HK5A 2W7XA 3I0QA 4PTCA 4BFMA 3BE2A 4D58A 1QPJA 5BUEA 1ZMWA 4DA5A 3NCGA 4F6UA 3RVGA 4X3JA 1TQPA 2BHHA 4S32A 2XYNA 3S4QA 4KAOA 1OIUA 1HCLA 4I41A 4EH2A 5HG7A 4U3YA 2C6DA 5M4UA 1VZOA 4JBVA 5EFQA 2OH0E 3WZJA 4QQTA 5GZ8A 4C33A 5L2TA 5A46A 3AQVA 4JS8A 3VRYA 4E5BA 5JRQA 2WTKC 3ZO1A 2Y8OA 3H9RA 4MX9A 5DLSA 3RPRA 1OITA 2R0IA 4H39A 3MGYA 4ITIA 3V8TA 3NMUF 2YJSA 2YAKA 1KWPA 4I3ZA 4FV9A 4QPAA 3RCDA 3QYZA 5HIEA 2J0JA 1DI9A 3W32A 3NNUA 2XRUA 4RWJA 2W1GA 3IDPA 4APCA 4ACMA 2F49A 4QP2A 4PL5A 3ZBFA 2GMXA 3QCYA 4LM5A 1WBTA 4B9DA 1KUTA 4BTMA 2RFEA 5AX3A 3VW6A 4TW9A 5DMZA 5J5SA 3C5IA 2ZOQA 3ITZA 4J53A 4JQ8A 2VNWA 4UALA 2CKQA 3KXNA 3QD2B 4YZDA 4TTHB 5H8EA 1NA7A 3FBVA 3PDTA 4FKGA 3BBTB 4XLVA 4RX5A 1JSTA 1URWA 5FXSA 1OVEA 3HKOA 1SMHA 3RWPA 4DH1A 3ZDUA 3H10A 3C51A 4YLLA 5CSWA 4AN2A 4IDTA 2AC5A 3DB6A 3QD0A 3ZRMA 3EQHA 3QC9A 5L8JA 2JDRA 4PL3A 2I1MA 2ETMA 4X2FA 2XK8A 3OXTA 4JDKA 2HCKA 4TPTA 4P90A 5FQDC 4E8AA 3MY1A 2HELA 2RGPA 4FT7A 1PYXA 4RZVA 4UZDA 1QL6A 4IWDA 4ZSEA 1REJA 4DFNA 5L2QA 5HI2A 3BIZA 4J96A 3PSCA 4U6RA 3UMXA 5IG1A 1R0EA 2I7QA 4QTEA 3FWQA 3QD4A 3SAYA 5CAPA 4OTFA 3TDWA 1YXXA 2CDZA 3DGKA 4OUCA 2XK4A 5BPYA 3CQWA 5AEPA 5DEYA 2JITA 5HVYA 3UO4A 3HDMA 4HPUE 2O3PA 4AGCA 4FZ7A 4QOXA 4YUQA 2ONLA 4M67A 4FKWA 1QPEA 3G6HA 5KHXA 3FHRA 2VO3A 5CT0A 1VYZA 4OTPA 3GXLA 4PP9A 3NUYA 3FLYA 3C1XA 4WRSA 3TI1A 1PXKA 4IVAA 4MXYA 3FQHA 5EI6A 3F5UA 3ZEWA 3UOLA 5IISA 1SNXA 3G90X 4DGOA 3LFSA 1ATPE 2G2IA 3D4QA 3GC9A 4WNPA 4PMTA 3RNYA 3D7TB 1OKVA 3PY1A 3ZYAA 3PXZA 2QG7A 3OY3A 3RHKA 2FYSA 4EZ5A 4MXCA 1PXPA 3GCPA 5HE1A 4IW0A 4EKLA 3THBA 3JR1A 5M06A 1PRYA 2QG5A 1Q41A 4EC9A 4FL2A 4FGBA 3FAAA 2R5TA 5IQEA 2C47A 2B1PA 3R22A 4BKYA 3JVSA 5CZIA 3SXSA 4KIOA 4FC0A 3AC8A 3TZ7A 4E73A 3OHTA 3CKXA 2RIOA 3OWKA 3HX4A 4FIIA 1A9UA 3TL8A 3ZUTA 2PVYA 4O0SA 3KVXA 4DFUA 3OTUA 4FSZA 1VJYA 2O8YA 3R30A 3OUNB 4AE9A 3LFQA 4DH8A 3UDBA 2AC3A 3L9NA 3IW6A 3QA8A 1J91A 5CAQA 1M2RA 3FZRA 4GYIA 5DT0A 4BTFA 3HAMA 4KRDA 4WNMA 3R28A 5C4LA 2GHLA 3AD6A 3QQKA 4MNEB 4UMQA 4L67A 4EJNA 5CQWA 4CFFA 3UQGA 2JDSA 4ZZOA 4P7EA 3LCOA 2ZV2A 3R8UA 1XR1A 4YZNA 5J8IA 4ZZNA 4M97A 1ZYJA 1OL2A 1YDSE 2W06A 3AD5A 3EYHA 3UNJA 3VUMA 4E6CA 3S3IA 3FE3A 4JBQA 5BYLA 4L6QA 4NKAA 4NCTC 2UW5A 3ZTXA 3QHRA 1UWJA 5CALA 3PE1A 1OBGA 3QBNA 4ZY5A 2BRGA 4DLJA 2SRCA 3HV7A 1XO2B 3IOKA 5KHWA 2Z8CA 5IQHA 3CTJA 4AA4A 3OOGA 5T6KA 1JAMA 2FSTX 4E4XA 2YCSA 1VYWA 4H58A 1OMWA 2YM8A 4O2PA 4DEHA 1DS5A 2A1AB 2PHKA 3DJ6A 4XHKB 4ANNA 4PPCA 4C4JA 4H3PA 1NVQA 4YHFA 2E9OA 3Q60A 5KMJA 3EFWA 4F99A 3C4FA 3EIDA 4D55A 3FLZA 1Q8UA 2BFXA 2JFLA 4LOPA 2WAJA 4IACA 3C4XA 1PMVA 5DG5A 1BI8A 3ODZX 4E5AX 3P7BA 3SG8A 4EK3A 5C27A 4NKSA 5DH3A 1P4FA 3OBJA 2UVYA 4MNFA 5HCXA 4M69B 5HESA 3O8UA 5EKNA 3QUPA 4AN9A 4ZJVA 2Y4PA 4HCUA 5DWRA 5E8XA 5GJGA 3WILA 3NRMA 3FL5A 4FYOA 4YJTA 3PJ3A 1YDRE 3ZEPA 3QLGA 4QQJA 3MY5A 4LV8A 4EC8A 1YI4A 4ZEGA 3L8PA 3I7BA 4HJOA 5KO1A 3SGCA 2FSMX 5ICPA 1KE5A 5LQFA 4F63A 4BIEA 3CY2A 2W5HA 4ZOGA 1E9HA 3BHHA 4C58A 2C0IA 4DG3E 1P14A 2PU8A 3A8WA 4CTCA 3KMUA 4D9TA 1TVOA 2XNOA 5AX9A 2C5XA 4JRNA 4USDA 3R9RA 2CCIA 2VWZA 4CKIA 2X6EA 1REKA 4D0WA 5BVEA 1V0BA 1CM8A 2XRWA 1YQJA 3OFMA 3QGYA 1I44A 3CGFA 1R78A 2GSFA 3QRTA 4GT4A 3EWHA 3OCBA 3OG7A 1DAWA 2HZIA 4U8ZA 4G5JA 4M13A 3ACKA 2ZM1A 5EDPA 1MP8A 1QPDA 4EH3A 2JDVA 3OWPA 3BGPA 4FTAA 5L2WA 2VGPA 3ZO4A 2OG8A 1FGKA 3L8VA 4ANBA 3OWJA 3ZSHA 3COKA 4L3LA 2IW9A 1CKIA 4O1PA 4YC3A 2E9NA 3FI3A 5KCVA 2XM9A 2O63A 3CQEA 1NT2A 4DBNA 3OY1A 3TXOA 1W82A 1UU9A 4RQVA 4FF8A 3HA6A 2OZAA 3KXZA 2O5KA 4K0YA 4G34A 4FIEA 1AQ1A 1TQMA 3E62A 4BDIA 3HVCA 4HVDA 1OGUA 4YNEA 4PRJA 4FVRA 4NM0A 4C8BA 3L9MA 3W2QA 4FOCA 2GFCA 3QLFA 3F5PA 4BI2A 1JPAA 3R71A 2QOBA 5EG3A 4FUXA 2OK1A 5L3AA 2XYUA 3NPCA 1Q24A 2HYYA 4PY1A 3E7OA 5AP1A 2C0TA 2WOTA 5K9IA 3MVJA 1H8FA 3ZBXA 3PG1A 4G31A 3L8SA 4JRVA 3N4TA 4DGMA 4FV4A 2ITQA 3PIXA 4IAFA 2BKKA 4GSBA 2JEDA 5EM8A 5FGKA 1Q8WA 4QP3A 3G9LX 5D7AA 4L9IA 4FT9A 2XB7A 4QQCA 4FV3A 1OIRA 5KZ0A 4AZVA 3RPVA 4E5WA 2QC6A 4R1VA 4AZFA 4FKPA 4RIXA 5CQUA 2UZUE 3R01A 3WYXA 4YTCA 5CZHA 3O0GA 2UZDA 3ZZWA 2ITZA 4FKTA 5E8WA 5C8NA 2QU5A 3Q6UA 4D9UA 2X2LA 5ANIA 5IEVA 2OGVA 5JFWA 5AIRA 2ITPA 1F0QA 3IGGA 3CS9A 4LUDA 5FEDA 4KB8A 4S33A 2EXEA 3ROYA 3DKCA 5AP2A 3EZVA 3WARA 2VTSA 5M55A 4FTRA 4BCKA 4HVIA 1OL7A 3BWFA 4FV2A 4RFYA 3KCFA 5FP6A 4UYAA 3NIEA 1RQQA 3P79A 5DHJA 4AACA 2FB8A 5I9ZA 2HWPA 2XCHA 4BDFA 4LGGA 2VTAA 4CKRA 4EKKA 3NW5A 2UZOA 4EH6A 2NPQA 5DOSA 5IH4A 3QWKA 3RCJA 3WE8A 2R3GA 2WMTA 3CKWA 4IB0A 2C3IB 3Q9YA 4LGDA 4Q9SA 3UE4A 3Q4UA 5H8GA 3ZFYA 4RLLA 3ZM9A 4S31A 1FQ1B 3FSKA 4FMQA 5FRIA 5KKRC 1VEBA 1SVHA 3VS4A 3FPQA 3CLYA 3ZH8A 5A4QA 2OKRA 5AA8A 1NW1A 3VJOA 2OXXA 2QO7A 1AD5A 3G5DA 3NW7A 1RJBA 4ASXA 4E4MA 1BLXA 4AXAA 5KMIA 3QZHA 3UNKA 5HEZA 3GB2A 2WQEA 5T68A 3PLSA 4NW6A 2OWBA 3DV3A 5L8KA 4A4OA 4C61A 1ZOGA 3EB0A 5IQFA 4D0XA 1V0PA 3JY0A 2YM7A 3KK9A 2AYPA 3ZLWA 5JK3A 2BUJA 4XV9A 4ZS4A 3DQXA 3ZXZA 4O7SA 4X6QC 1OECA 3D15A 2ZM3A 5BYZA 3VS6A 4D1XA 2QR8A 3DAJA 2YABA 4C4FA 1Q97A 2H96A 4E6QA 3MDYA 3DQWA 3GENA 1BL7A 3MTFA 4X3FA 4YNOA 3VVHA 4FSWA 2ITOA 4HGTA 3NUNA 5EK7A 3UQCA 2X7GA 4YPDA 3F69A 4FTTA 3HMPA 5KMMA 4NM5A 3A7GA 3ENMA 4ZSGA 4NFNA 3R7VA 5KUPA 4UMUA 3GT8A 3M2WA 2O65A 4J8NA 4WOVA 3AMAA 1Q3DA 3U6HA 1W7HA 2UZEA 4EOPA 2EU9A 2WZJA 1ZAOA 2YIYA 3LFDA 2GQRA 4JDIA 4TYEA 2XP2A 3W8QA 1MRUA 5AADA 2R3QA 2VTIA 4M14A 4XG4A 5T3QA 3EQPA 4DINA 1XH9A 1WMKA 3PXRA 4JIKA 2UW7A 4R3PA 4CT1A 1P4OA 4IVBA 5J1VA 3R21A 1IASA 4FEQA 4IZ7A 4L53A 4NH1A 5CI6A 4CMTA 2GDOA 3EFJA 4J95A 4XG6A 3MFTA 4QNAA 5BUJA 2VTJA 3UPZA 3KXMA 2IVVA 1ZARA 4IC8A 4P2KA 2HW7A 3R8ZA 4TWOA 5A6NA 3DFCB 4FKOA 2UZWE 4DH7A 4YZMA 5HVJA 4C2VA 4RC3A 5TO8A 4QP8A 3FZPA 1ZY5A 1F5QA 4EOIA 4KS7A 4AG8A 4OBOA 3UVRA 5K4IA 4P4CA 1V1KA 5KKRB 3E64A 3KU2A 4PNKA 5ANDA 4O81A 4AZTA 4J99A 4D1ZA 2W05A 5GIOE 4V05A 3HNGA 2NRYA 4AZSA 4EZ7A 5LOHA 3BLQA 4UMTA 4UMRA 3FHIA 3EQIA 4LGHA 4FZAB 4N6YA 3SXFA 3MBLA 2Z7QA 3EYGA 3KEXA 4USFA 5FXRA 3D14A 3H0ZA 3KF4A 4FTLA 4WG3A 5ANKA 5HGIA 1RW8A 1NVRA 5AWMA 1ZYCA 2CHLA 4IJ9A 2PE2A 4FK6A 3RAKA 3PVGA 2VAGA 2HENA 3RI1A 4JG8A 4CV8A 2IZTA 4QMLA 5F94A 2FVDA 4TWCA 1WFCA 2OZAB 3AC4A 3LFNA 5EI2A 4S2ZA 4Y5HA 4FR4A 4AQCA 3KC3A 3UZRA 2J5FA 3POZA 2JKMA 2J50A 4MXZA 3NUSA 4GK2A 4EL9A 3DK6A 2OJFE 4GIIA 4X0MA 3V8WA 3ODYX 5K5XA 2JFMA 4XV1A 2YAAA 4BTJA 5IUHA 1ND4A 2XK9A 4CFNA 4BDAA 2DUVA 4TNBA 3V04A 4CZTA 3DKFA 5ANGA 1H08A 2GHGA 4JI9A 5B2KA 5LMKA 5IQCA 3E63A 4BCGA 2CKOA 3UYSA 4GU9A 2C6OA 1XH4A 2X81A 4X2JA 5CU2A 5CU6A 1MQBA 5G6VA 4FSRA 4CRSA 1PMUA 2XBJA 3AC5A 4IVCA 3SX9A 1JLUE 2BPMA 4KIQA 4LRKA 4MNEA 2EXCX 1H01A 4EK6A 3MIAA 4IWPA 3NVMB 3IPHA 4GFGA 4BBEA 4JAIA 2BIKB 2W1FA 4EQMA 2XCKA 2FO0A 4L8MA 3KXGA 1GZNA 2EB3A 2UZLA 4EH8A 1H00A 5L6WL 3LXLA 3EFKA 3COHA 4ZTNA 3LCDA 3NNVA 4UXQA 1BL6A 4F9BA 4N0SA 5ETFA 3KCKA 4FGRA 1K9AA 3Q4ZA 1PW2A 3HMMA 4I0SA 2ITYA 2UW6A 4XG9A 5CTPA 4Z7HA 4TYIA 4ALVA 5L8LA 3UG2A 5DFPA 2YCQA 2OIBA 2PULA 1OUKA 2GHMA 1ZYLA 3IW4A 4W9XA 5LWNA 3HRCA 3TUBA 2BVAA 3V5JA 2DWBA 1PKDA 3I60A 2E2BA 2V0DA 2C1AA 3ZRLA 3QXPA 3C4EA 3DDPA 4NK9A 4DCEA 4AA5A 3A4OX 3JUHA 2WQNA 1JOWB 3JYAA 2CLQA 4MF0A 4L43A 3BKBA 3R00A 3B8QA 2XKEA 3SD0A 4HGLA 1W0XC 4KKHA 5HIBA 3T8OA 4BCQA 5ETIA 4CD0A 4O0YA 3DOGA 3BLHA 3R1NA 3HUBA 4YZCA 3M1SA 2RF9A 5EYCA 3U6JA 4IX4A 4F0FA 4B99A 2QLUA 3DXPA 2V7OA 3B2TA 4FX3A 4NZWB 2R3FA 3GUBA 3KKVA 4JQEA 2UUEA 3WIKA 4MAOA 3RPSA 2QOFA 4U44A 4QMWA 3VAPA 3VBXA 4KBAA 3TWJA 5I9VA 1R1WA 3VUTA 4I21A 4EYMA 4FTKA 5KMOA 1WVYA 3UC4A 2PY3A 3BV2A 4CCBA 2UW3A 3UTOA 4OBQA 2GS2A 1A06A 2HIWA 3U8WA 3QZGA 4W4YA 3UO6A 2PWLA 4BZOA 3QF9A 2ZV7A 4FL1A 5IA3A 3K3IA 4DT9A 5EYKA 4DEAA 2WMUA 5HNIX 2A4LA 3E3BX 2VUWA 4AGWA 1B39A 1L3RE 1U46A 2J4ZA 3HMIA 3HV4A 4GK4A 3CTHA 1ZYDA 3QTQA 1M2QA 4RGJA 4X3FB 2CLXA 3DY7A 4XP0A 4OR5A 3W18A 3JXWA 4Z7GA 4DF3A 2QOQA 3AXWA 2WNTA 3EL7A 3MTLA 5A3XA 4ANMA 4FSNA 4D4YA 5E90A 4EHZA 3PY3A 5IDPA 1GAGA 1IG1A 4QMNA 5LXMA 4L42A 4L3PA 4QMVA 3IW7A 4F0GA 2QODA 5AAFA 4PDSA 2AUHA 5E4HA 1WBNA 2E9PA 3VWAA 5TKDA 3ZC6A 3BQRA 3QCXA 4FVPA 3WZDA 4XP3A 5I9YA 1UVRA 3I7CA 3GU5A 2QHMA 4MHAA 2XS0A 3QRJA 2CNUA 1Z57A 2HY81 2I0VA 2WMRA 4PQNA 4RRVA 4YLKA 3RBWA 1IAJA 3UJGA 2YISA 2JIUA 2ZV9A 3HZTA 3S1HA 4ANOA 4TYHB 2G01A 5CAUA 3RPOA 5IQBA 2VTPA 4FTUA 2WFYA 4FUYA 1J1BA 5AR7A 5TT7A 4I4EA 1S9JA 2VO7A 3DJ5A 4PMSA 3TIZA 2I0HA 2XIRA 4EEVA 4TL0A 2XIYA 2G2HA 3ZSIA 3KA0A 4EHGA 2R3MA 3UPXA 3TZMA 4YTFA 2P55A 4QPSA 2BR1A 3QUDA 4FSTA 5AUYA 2RFSA 4RIYB 3T3VA 2I0EA 3VF8A 5CANA 5I0BA 3QXOA 5IEYA 2YM5A 4UN0C 3GU4A 3IOPA 4EJ7A 2NRUA 2EUFB 4MTAA 5ANEA 5TOZA 3DJ7A 1V0OA 4IANA 3G2FA 4ACGA 4EUTA 5B0XA 2YLEA 5CEMA 4ANSA 5CU3A 1WBVA 5JRSA 5M4FA 4NWMA 2CNVA 1MUOA 4QMUA 3ZRKA 5HZNA 3LLAA 2OLCA 1UA2A 3Q52A 3R8VA 3F61A 3DBFA 3E8CA 4OAVB 1OPKA 2XK7A 2WQOA 4NIFA 2PVFA 3SV0A 1STCE 4NM7A 3LM5A 5FM2A 2ZM4A 4G9RA 2B0QA 4H1MA 2P3GX 4HNFA 3A60A 2BAJA 4DFYA 4BGGA 3N9XA 2PZIA 3R6XA 4QT1A 5CF4A 3NAXA 5HX6A 3F88A 2XVDA 2IO6A 4EH9A 2A27A 5HICA 2YITA 5F1ZA 5TF9A 3E7VA 3OZ6A 4RWKA 3LMIA 4MBIA 4XG2A 2C6IA 1H25A 2P2HA 4AE6A 2XK6A 4MEDA 2VWUA 1J7UA 1EH4A 2YWVA 1Q61A 3ZLXA 3HV5A 1BMKA 3QTWA 3ROCA 4JDHA 5DR2A 1UKIA 2OZOA 4B4LA 5J7HA 1XWSA 4RA4A 3K2LA 4D2PA 3CBLA 3PXYA 4EH4A 2ZDUA 2IVTA 4UWCA 5BYYA 3OS3A 3PVWA 4IZYA 1G3NA 3BYSA 4QP1A 1YXVA 5E8TA 5EKOA 4A07A 4MXAA 1M14A 3FJQE 1FVTA 3QTRA 4GG5A 4Y8DA 3FY0A 3MS9A 4C38A 3EN9A 4QP6A 4ONAA 1R0PA 1X8BA 3CSVA 2X8EA 3PTGA 3ZLSA 4MD7E 4BCHA 4CV9A 5KBRA 5BMSA 4U41A 1KOBA 4P5ZA 4RX8A 3BV3A 3QKMA 1KV1A 1XBBA 4GG7A 4TWNA 3UC3A 2W9ZB 2W5AA 3H30A 4DE4A 4BCFA 3E5AA 4BTKA 3PP1A 2X9FA 3O51A 4NTSA 3D5VA 4BF2A 5BVOA 3WI6A 4FZFB 4KA3A 4FTNA 5CF8A 3WZKA 3GCUA 1YOJA 2Q0NA 2QO2A 3AMYA 4W4WA 1PXNA 5DT3A 3DBQA 3Q5IA 1YKRA 5E91A 4BCJA 5AUVA 1G8SA 1YWRA 4IAYA 2WXVA 3PZHA 5JFXA 5DT4A 4ASDA 1BKXA 4QTCA 3MIYA 1OKWA 2ZV8A 4O86A 5A54A 1PMEA 1Z5MA 2NP8A 1SM2A 3R02A 4FEVA 5DBXA 3C13A 2JGZA 3NIZA 1GIIA 2XK3A 5D41A 2VN9A 1Q3WA 2R3HA 3BE9A 2B52A 3MJ1A 3OBGA 5FWKK 2YDIA 3A61A 1UU7A 2VO0A 3R1SA 4FG8A 2YLFA 2VWVA 4C62A 3O7LB 2B55A 2CPKE 3HRFA 3KRRA 5IA1A 3V6RA 3R7GA 4ACCA 5EM5A 2IZUA 2XNMA 4N70A 5DPVA 3EQFA 5EYDA 4E4NA 4QD6A 4AU8A 5HO6A 2WMBA 4QMXA 4WSYA 3U6IA 3LOKA 4FIFA 3C5UA 3GU7A 4GH2A 3LFBA 4R7IA 3VUGA 4CGAA 4HZSA 1SVEA 3WOWA 5CENA 5EW9A 4RVKA 3W33A 4C0TA 3R7YA 5EOBA 4TN6A 4U79A 4XBRA 3D5UA 3DCVA 3EQGA 3NS9A 4Z9LA 1BYGA 4LFIA 5B7VA 3EHAA 3GI3A 4IWQA 4O96A 4EK4A 2VD5A 3DAEA 5AM7A 4G3CA 3VBQA 3D5XA 4WA9A 4BDGA 4FV8A 5D1JA 2X7OA 4M0ZA 5CNOA 2C6KA 1Q5KA 3V5QA 2VTNA 1PXJA 1SYKA 4TXCA 4L3JA 5C9CA 5LVPA 3AGMA 5AV3A 3ALNA 2VX3A 3ORIA 4BN1A 4EOSA 5EW8A 1WZYA 2GQGA 2H8HA 1QMZA 2ZB0A 2UW8A 3LHJA 2RFDA 4IZ5A 1PXLA 4YO4A 3M42A 1H07A 5EYMA 5FBOA 2BZKB 2ZB1A 3MH2A 4H36A 3EJ1A 3O2MA 2YIXA 1RE8A 5CEQA 3CD8A 5TE0A 3F2AA 3EZRA 2IWIA 4G16A 3VQUA 2F4JA 5CASA 5M51A 3OOMA 2ITXA 2ZDTA 3LQ5A 5CVFA 4BZDA 4D2VA 3E3PA 4KSQA 5F20A 2X39A 1FMOE 2OJJA 3BHTA 4I24A 4UBAA 5H3QA 3ELJA 3HRBA 4EOQA 4ZSAA 5M09A 3HLLA 4AW1A 2R3OA 4ALWA 3U4WA 4BKJA 1FPUA 4BDJA 1JKTA 5JFSA 4O0RA 1R3CA 3UIUA 2IG7A 3WE4A 2PVJA 4IHPA 4OBPA 4TYGA 3QQJA 3T3UA 4BHNA 1XHAA 3DTCA 4U0IA 3KXXA 5E1SA 5IKWA 3TZ9A 2WMWA 3TCPA 2BALA 4K9YA 4ZTMA 3VNTA 1XH7A 2BROA 5HG9A 2ETRA 2VTMA 4XG7A 2WELA 4XNEA 3I6UA 4QMTA 4D2SA 1TQIA 3F3TA 1NY3A 2BZJA 4CT2A 3ORZA 2G1TA 3LKMA 1K3AA 3H3CA 5ACKA 2C1BA 1CDKA 1R39A 4M0YA 4KD1A 4NM3A 4OGRA 3WZEA 1IA9A 3UZTA 5KE0A 3OT8A 3GGFA 4FE2A 5LJJA 4M7IA 2R3LA 4FKVA 4R3CA 3WF9A 5AR5A 4JXFA 4D28A 2JIVA 5CYIA 5BNJA 3W8LA 4O7WA 4ZP5A 3BEAA 1H1PA 2FSOX 2W4KA 3D2KA 4WG5A 4EWHA 5J9YA 3UIBA 4L00A 2C4GA 4U43A 5BUIA 5AP7A 2BZIB 3OXZA 4LYNA 3OCGA 4Z16A 2BILB 3GU6A 4RG0A 3N4UA 3ZDIA 4BDKA 3R7EA 2BRMA 3MW1A 4JG6A 4N4SA 3TT0A 3OROA 2WMAA 3BRBA 4JNWA 4AZWA 2ETKA 3TTIA 1HCKA 1KSWA 2OF4A 3VF9A 4BDEA 5HU9A 4A9RA 4TKSA 3M11A 3NUAA 2C6EA 3RGFA 2ZJWA 5HE0A 4O0VA 4EBWA 5F95A 4FV1A 2X4FA 2O0UA 4NW5A 4KINA 4U7ZA 3CTQA 4W4VA 3K5VA 4WIHA 2FA2A 3GC0A 2BDFA 5DR9A 4ASEA 3DK7A 3R9DA 2BFYA 3GCSA 5CAOA 3NVKI 3QL8A 3BYMA 2VTOA 3VRZA 3ZU7A 4AT3A 2VTRA 4DTAA 3QWJA 5AV2A 4F1OA 2GTMA 2W5BA 5LMAA 3ZXTA 4Q5HA 4D1SA 1GJOA 2G15A 3I1AA 3LMHA 1CMKE 4DGLC 3V8SA 1FOTA 4IAZA 4J8MA 2CJMA 2ZVAA 3LFCA 3VIDA 4EH7A 4HVSA 4R3RA 3QX2A 4U3ZA 2P0CA 4HYSA 4G6LA 4CFVA 3TNIA 2KTYA 4FSUA 4QP4A 2C3KA 4UXLA 3F6XA 5FD2A 4B6LA 4WHZA 5FEEA 3KL8A 3UOJA 3VS5A 4A9YA 1ZOHA 4TYJA 5HVKA 4ZTQA 5J7BA 3A2CA 2LAVA 3BYOA 4E1ZA 3D7TA 3G0FA 3QX4A 4Y85A 4YHJA 3R1YA 5D12A 4D5KA 2VX1A 4D4VA 4USEA 3SA0A 5HTCA 3LQ3A 4DC2A 3PXQA 4EHVA 4PDOA 2VGOA 3RINA 2X8IA 4QP7A 2OXDA 4EQUA 2ITUA 2J9MA 4DEDA 4K18A 2QOLA 1G8AA 3BHYA 2R3IA 4TWPA 4IJPA 4AFEA 2HXLA 3PA5A 2JDOA 2X7FA 3P86A 4X2GA 4FK3A 3QFVA 4GK3A 4L7SA 3VN9A 4DTBA 5EW3A 4U45A 3P7AA 3TEIA 3ORPA 2YIRA 3PWDA 4LOQA 5K4JA 3ORTA 4FVQA 5A9UA 3U9NA 4H3QA 1IRKA 4QTBA 4JT3A 3L1SA 5GJFA 3CY3A 3BBWA 2CGUA 2J0IA 4AF3A 1BI7A 3OCSA 4YJVA 3SHEA 5C03A 3Q4TA 3Q9ZA 4YJSA 5E92A 4FI1A 2J5EA 3ENHA 3FLSA 5HO8A 4WNKA 4BL1A 4R78A 2ERKA 4UZHA 3EQCA 5DVRA 4N57A 3EFLA 4O27B 3NUPA 1H0VA 3GCQA 4C37A 2Y7JA 2YHVA 3FSFA 4C59A 3ZONA 4D2WA 1YW2A 4W9WA 3HDNA 3MH3A 3MY0A 4IX3A 5DE2A 3WYYA 4C7TA 3UYTA 2REIA 3MA6A 3AT4A 3SXRA 4RBLA 3JY9A 4FT5A 2VTHA 3F82A 4KKGA 4FZ6A 4MWIA 1JVPP 2YN8A 3UNZA 3R7IA 2VTQA 4FA2A 4QYEA 3RKBA 4FTQA 2YM6A 3BU6A 4QMMA 3ZO3A 4IM3A 3LM0A 2EB2A 5JN2A 3DLZA 4CG8A 4GYGA 3RMFA 3COMA 3W2PA 2C6MA 4IWOA 2LGCA 4F9WA 3QKKA 3MWUA 4IADA 5CU0A 3VULA 4V04A 4ZAUA 4YPSA 4BC6A 3VS2A 2ITTA 3FMKA 4HGEA 4WBOA 3U55A 2B4SB 4BCMA 1H1WA 4XOZA 4PPBA 4YTHA 5AP3A 4EYJA 3S00A 3DPKA 3Q3BA 4AUAA 2YDKA 1APME 5JQ8A 2XA4A 3OTVA 5BVWA 5IDNA 4XS2A 5HE2A 2CNQA 3F7ZA 4ZLYA 4EBVA 4M12A 3BZ3A 1G5SA 2VX0A 4IFCA 4BWKA 3PPZA 5CSHA 3WBLA 3ORMA 1WBSA 4JR3A 4WNOA 4C4EA 3KREA 4C4HA 4FOBA 2W4OA 4BB4A 3SOAA 5JZJA 4KUJA 3BQCA 1IA8A 1PF8A 4F6WA 5EM6A 4CVAA 3PY0A 3R83A 4X6RA 4O1OA 1CSNA 2W1IA 1SVGA 2QQ7A 4QYGA 1T45A 1FVVA 5FLFA 3ZFXA 4O84A 1J1CA 4X2NA 4UWYA 4QMYA 1OZ1A 4X21A 4IVDA 3FYKX 2JKQA 4OT5A 3D5WA 5AR4A 2C69A 3FEGA 5IQIA 3D9VA 2XF0A 3OD6X 3QRKA 4DFBA 3MPTA 2I0YA 5HOAA 4IDVA 4FV5A 2G2FA 3QUEA 4C3RA 2OF2A 2QOIA 5C8MA 4UYNA 2WTVA 2R7BA 2PPQA 3EN7A 3R9HA 3V51A 4LQMA 3QALE 4AP7A 4KBKA 4RPVA 3CP9A 1ZLTA 4R5YA 2J0LA 2QKRA 1XH6A 3E87A 4O7LA 1H1QA 1YHSA 4M8TA 2R2PA 2NNWB 5HTBA 3KRXA 3K5UA 3VW8A 4FIHA 3NYOA 2RG5A 1PJKA 4BVUA 3GQLA 3ZUVA 4FBXA 4AX8A 3FI4A 4PL4A 4DBXA 3LLTA 1KV2A 3DBCA 3V5LA 3ORLA 2Z02A 4DT8A 2X1NA 3DTWA 3NSZA 2X9EA 2PMIA 4L7FA 2Y0AA 4LOOA 1JSVA 4RIWA 5HG8A 4F9AA 1YI3A 2QD9A 3CE3A 3RWQA 4XG8A 4I5HA 3O8PA 4C34A 5E7RA 4E20A 3F3WA 3CJGA 3NAYA 2PYWA 3FZSA 3RAWA 5K0XA 2XEYA 1K2PA 3FMLA 1Q8YA 3PP0A 3ZUUA 1XH8A 5CS6A 2C5NA 3PA4A 3A7FA 3RK9A 4Y73A 4D2TA 3I0OA 4FTMA 2J2IB 5FTQA 3DU8A 4GKIA 5AP0A 3W2RA 2XZSA 4JL9A 4RT7A 1NVSA 4E3CA 2G9XA 3QD3A 4FNWA 4PMMA 1YHVA 3OWLA 4FIJA 4FODA 4WUAA 4XG3A 5JMSA 4E4LA 2XIKA 3VHKA 4F7SA 2V7AA 3TIYA 4ANLA 4ZMFA 4WKQA 2GNIA 3QZFA 5IMEA 1JKKA 3O7LD 2VNYA 2BTSA 5FDPA 2A19B 3DT1A 4R8QA 4MVFA 4ZTRA 3G6GA 2VWBA 1U54A 3TM0A 3GCVA 4HCVA 4JIAA 4B8MA 4CLJA 4L44A 4HZRA 4FG9A 4RVLA 5A4EA 3MB6A 1GZOA 4A9TA 2WMVA 4YURA 2WTCA
chains in the Genus database with same CATH superfamily
2JKKA 3R8PA 4F64A 5HO7A 2IN6A 1UU8A 2A98A 3NZ0A 2A0CX 2XM8A 4IB5A 4KIKB 4F7JA 4H05A 4XMOA 3W10A 4DN5A 1OUYA 4JJRA 5BVNA 4EOKA 2PTKA 3GU8A 4U81A 3TTJA 4Z55A 4CTBA 2X6DA 4AAAA 4HYIA 2P33A 3GBZA 4RWIA 4RSSA 3KQ7A 2QKWB 2UW0A 2YDJA 4IZAA 1Q62A 4GEOA 3WF7A 4CMUA 3PYYA 5ETAA 4M66A 1J7LA 1VR2A 3EH9A 3BU5A 4AW0A 3KMMA 4EH5A 1M52A 2FH9A 3D83A 3TNHA 4YU2A 5LCKA 3U9CA 4XH6A 3W16A 2ZFYA 4I0RA 4OTHA 3VBTA 3ZOSA 2PMOX 4U80A 2ITVA 4JBOA 3TUCA 3VONA 2C6TA 4K11A 5B2LA 5BVFA 2C5YA 2VZ6A 3LXPA 3QTSA 4IXPA 5LWMA 2R3NA 4KSPA 4LMNA 5DNRA 3UBDA 3A7JA 4CYIA 3F3UA 2VO6A 3QCQA 4J98A 2OICA 3I5ZA 3TKIA 3E8EA 4JG7A 4I20A 1M7NA 2UW4A 3ZMMA 5I9WA 4KRCA 3GVUA 3GFWA 2YIQA 1MRYA 3F2RA 2F7XE 4NCTA 5BX0A 4ENYA 2PE0A 4RFZA 3RM6A 5KBQA 4K8AA 4BCOA 2BAKA 5EDRA 4ZZMA 3D2IA 4ERWA 2XUUA 3OVVA 4QYFA 2QI8A 4E26A 4FKQA 5HX8A 4EOJA 5IH6A 4QMPA 4FT3A 2VTLA 5L2IA 4IAIA 1P5EA 5DI1A 4BGQA 4CFWA 5LMBA 5E8VA 3C4WA 5FDXA 3OEFX 4EK5A 5C4KA 4X3FC 5H9BA 5EQEA 1O6LA 3P08A 4RX9A 5EI8A 5J9ZA 5IUGA 2IZSA 4IMYA 3VQHA 4OTWA 3PIZA 2WD1A 2J6MA 1SZMA 3BX5A 3DBEA 5DRDA 2BMCA 5DRBA 2B53A 2E9VA 2XNNA 3GOKA 4Y46A 3VS7A 5M44A 4MWHA 2PUNA 5CU4A 5I4NA 4V0GA 4EWQA 3T9IA 2CGVA 2RSVA 4JX3A 4RIOA 4RFMA 3UGCA 5AIKA 3FMDA 3GEQA 4AGDA 3C0HA 2HAKA 3SG9A 5CY3A 3NNWA 4RVMA 3CC6A 2I6LA 5AR3A 3FUPA 4TYHA 4CG9A 3BHUA 2B9FA 4BR3A 4XRLA 4HNIA 4DEBA 3TN8A 3DK3A 3R8LA 4A7CA 2R3KA 1XH5A 5HIDA 4C3FA 5CEOA 4MCVA 4BIDA 5DYJA 2F7EE 4J52A 1FGIA 4DITA 2HZNA 4II5A 5HTIA 3N4VA 1LUFA 4UY9A 4RIYA 5CSVA 3RM7A 3PE2A 4OLIA 5HHWA 3RK5A 1Q4LA 2BRHA 3KULA 4O21A 5J5TA 2BRNA 3HL7A 2H9VA 4GMYA 2XJ0A 2Y6OA 3NUUA 3RPYA 5IA0A 1FVRA 4ORKA 3TMOA 4FTCA 2W1ZA 2IPXA 2WQBA 3H0YA 3FKOA 3ZLYA 5AV0A 3T9TA 1Q99A 4DEIA 2JLDA 2WHBA 2WTWA 4MH7A 3TJCA 2GNHA 5CNNA 4YO6A 2DS1A 2OW3A 4I6FA 3OP5A 4GUBA 3DNDA 4UWBA 3LXKA 4RMZA 4N6ZA 4IX5A 1OKZA 4DAWA 2C3LA 3WZUA 4AGUA 1JBPE 5J79A 2CKPA 4FEWA 3CPBA 3ZS5A 1PY5A 1DI8A 3KN5A 5EHOA 5FEQA 3V5WA 5HLWA 2HOGA 4RA5A 2GTNA 4IQ6A 4GV1A 3F3VA 5A4CA 1W2FA 2UVXA 4NL0A 5HKMA 4Y5QA 2Z7RA 1ZOEA 4GJ2A 1W2DA 2OIDA 2Y6MA 2W0JA 4HCTA 5JGAA 4G9CA 4TT7A 4FYNA 2WTJA 3ZO2A 1KE6A 1PHKA 3O17A 3QTIA 3HMOA 5I3RA 4E93A 2JBPA 3BWJA 5DEWA 3N51A 3EN4A 4MBJA 3VUHA 3QQLA 3PA3A 3LCKA 2ZAZA 2F57A 4HOKA 4ACDA 1MRVA 2PE1A 5F4NA 5HORA 4F1MA 5I5ZA 4TY1A 2Y4IB 4U9AA 4RQKA 4C36A 3TJDA 5M57A 4Y72A 4I1ZA 2EWAA 2PVMA 4QTAA 4CNHA 5LCJA 1VLRA 2W9FB 2X8DA 3DAKA 1KE7A 1WBOA 2XARA 3BLRA 4BYIA 3RHXA 1H24A 4NJ3A 1ZMUA 1MQ4A 3PIYA 4I5PA 2VWXA 2XIXA 4BCIA 3ZFMA 4XLIA 3KRLA 4HPTE 4WG4A 4O7TA 3ET7A 2HWOA 1P2AA 3FMEA 3C7QA 4R1YA 1OL6A 1WAKA 2UZBA 3LE6A 4D4SA 4NYEA 2YJRA 3FMNA 4GVAA 2OJIA 2BIYA 1OPLA 4JX7A 4O22A 2J0MB 3KVWA 4C57A 4RJ6A 3FMHA 3UO5A 3PJ2A 3UVQA 4I4FA 4QMQA 5E8YA 3MVHA 5HQ0A 4F9CA 4DGNA 2WO6A 4JVGA 2WQMA 4LL5A 2HW6A 2I40A 5B2MA 4O0UA 4ARKA 5KMKA 3VHEA 3UQFA 4O83A 2WTKB 2GFSA 4GT3A 1YXTA 2Q0BA 1YOMA 4BWPA 4NSTA 1W83A 3LFAA 5JT2A 4YC8A 4QPMA 3QQGA 4YBKA 5FXQA 4R7HA 4M68A 3PUFC 3PSDA 2QNJA 3MFRA 4MXOA 2UW9A 2IVUA 5JKGA 4PTEA 1GIJA 3IK3A 1GNGA 3FXZA 2XBAA 3QQUA 4GVJA 4DH5A 2QR7A 4YR8A 4F7LA 5IQAA 3U54A 1YWVA 3SRVA 3EQRA 1JNKA 3Q32A 4PF4A 2YCRA 3BCEA 3GQIA 5IA2A 2QONA 4A4XA 5KZIA 5I9UA 3Q96A 2OIQA 5FM3A 3ULIA 4GFOA 3OUKA 4DFZE 4PMPA 3P23A 5AUUA 2R0UA 3Q6WA 4I6BA 2IW8A 5IPJA 2R9SA 5TR6A 3KN6A 4QRCA 3BU3A 5LVMA 4BHZA 3HMNA 1YXSA 3I79A 2OJGA 4XX9A 4GW8A 4F1TA 4CZUA 2OJ9A 3R9NA 4AOIA 4IB1A 2UZVA 3LW0A 4ZY6A 3RAHA 4PP7A 2PZYA 1O6KA 2OI4X 3HA8A 5AP6A 1SNUA 4OW8A 4CZYB 4AT5A 2Y9QA 4I5MA 3SC1A 4JAJA 3QZIA 4UV0A 4S34A 3DNEA 3S95A 2JIIA 3GFEA 4L01A 1GZKA 4O0TA 3VJNA 2Q83A 3LJ2A 5J1WA 1H27A 2XKDA 5CXZA 2VTTA 5I9XA 5EQYA 2J51A 2X2MA 3OW4A 4O6LA 3DZQA 3PRIA 3ZCLA 4RX7A 4YJUA 4GUEA 3QCSA 4IB3A 2DYLA 3C50A 3CXWA 3LCTA 3MV5A 3RZFA 3NUXA 4YLJA 2YCFA 4G1WA 3SDJA 4DEEA 3R8MA 2W96B 3P9JA 4DHFA 1UKHA 3KF7A 5JGBA 4M15A 4RIWB 2EVAA 4RLKA 5LVOA 3NYNA 2WEIA 3P5KA 2GNLA 4CMOA 5CSPA 5JGDA 3KIOC 4I6QA 5FUTA 2ERZE 1UNHA 3DXQA 3W2SA 4PUZA 4LMUA 3R73A 4GJ3A 4XRJA 1JQHA 4ZLOA 3TKUA 4CFMA 3R2YA 1TKIA 4O82A 5AJQA 4MK0A 4A9SA 4OAUC 3TKHA 2CSNA 2YFXA 4BCNA 3NFGB 2CGWA 1Y6AA 5A4LA 1OGYA 4HYUA 3HGKA 2BCJA 3GP0A 4XUFA 4YJRA 3EN5A 4F0IA 3NR9A 3LVPA 5JEBA 3QA0A 4IEBA 4FKUA 3FZ1A 4BI0A 3BYUA 4A4LA 4F7NA 3HUCA 1H1SA 3FV8A 4O4CA 2R64A 2EXMA 3R9OA 5CF6A 2QOCA 2BDJA 3IW8A 3Q2MA 3I6WA 5C1QB 3R04A 4G6NA 4J7BA 4I93A 5H2UA 3QTXA 4ANQA 3CCNA 3HV3A 2OBJA 5C26A 3ANRA 1IEPA 3DB8A 4P5QA 3KRWA 5ANJA 4G3DA 2Z7LA 2X2KA 2JC6A 2J90A 4FV7A 4U42A 3RAIA 2VWYA 4UMPA 1XKKA 2XJ2A 2YACA 4DYMA 4O7RA 2FSLX 4O7ZA 1J3HA 2XKFA 2XNBA 4V01A 4ENXA 4K33A 1ST4A 3HECA 5BQ0A 3DBDA 4CKJA 2RG6A 3E92A 3UG1A 3FXXA 3BI6A 4J71A 3DFAA 5D10A 3G33A 1UV5A 4O7VA 4Q2AA 1OBDA 2BRBA 5IA5A 3FZOA 3BYVA 3QKLA 3QQFA 4BICA 5AAEA 4J1RA 5FTOA 3V6SA 2UZNA 5CEKA 2YEXA 5D11A 3B8RA 5GHVA 2VWWA 5EM7A 4OTIA 4AOTA 3KRJA 5IH5A 3JPVA 4D4RA 4IAAA 4MQ2A 3RZBA 5FG8A 4C2WA 2VWIA 1O9UA 3COIA 4MBLA 3UOKA 2QO9A 3MFSA 5A4TA 3IS5A 4CEGA 3VC4A 3MH1A 1WVXA 3AGLA 4FV6A 3WIGA 4JR7A 2C5VA 4FKIA 3BGZA 2J0KA 5AAGA 4DTKA 3RTPA 4CLIA 5GNKA 5CX9A 2C6LA 3KK8A 1ZYSA 3OMVA 3PRFA 5AM6A 4ITHA 3EQDA 4ZXTA 2XJ1A 4AT4A 1ZWSA 2ITWA 3QYWA 3V3VA 3VS3A 4RVTA 5E8UA 5IA4A 1RDQE 1GY3A 1JWHA 4XCUA 4YZ9A 4U5JA 2XIZA 3DZOA 3U4UA 4DFXE 3UMWA 2OXYA 2HY0A 2QLQA 2V5QA 3FPMA 4BRXA 2PVRA 4CXAA 4EUUA 2VRXA 1J7IA 3W55A 2FGIA 4QO9A 2WKMA 3I4BA 3VS0A 4OTDA 3LJ0A 5L4QA 4JLCA 4MYGA 3D7ZA 4C02A 3W0RA 3TUDA 5AV1A 4TNDA 3G51A 4ZSJA 1OB3A 2IW6A 1IAHA 4QQ5A 1L8TA 3VBVA 2WMSA 2GS6A 4EK8A 2B54A 2W1EA 2PVKA 3NLBA 4F6SA 4J97A 4QTDA 2PMLX 2IJMA 5EDQA 1Y8YA 2F2UA 3MA3A 2BZHB 4GFMA 4RJ7A 3SLSA 4QMZA 4EOMA 3FQEA 4PDPA 4Y83A 3KFAA 2OFVA 3UIMA 2WMXA 3BELA 2PMNX 4BBFA 4EOLA 4F9YA 3E88A 2IVSA 2DQ7X 2R3PA 3CIKA 1OM1A 3LPBA 4GT5A 4MQ1A 4YBJA 2XH5A 3W2CA 4CFUA 3ZM4A 4FNXA 4CSVA 5M4IA 3FI8A 3PUPA 1YXUA 3WF5A 4CQEA 2OU7A 3KB7A 3UP2A 4RJ3A 3ATSA 1XMMA 4FKLA 4HGSA 5LVNA 3RK7A 1KOAA 4RC4A 5EHLA 4OT6A 3VUDA 5KMLA 1XQZA 3LMGA 3SOCA 3QGWA 4LG4A 5AUZA 3NCZA 2YIWA 5HBEA 5C8KA 5DGZA 2GNFA 3KMWA 4GKHA 4AN3A 1OL1A 2QU6A 2PZPA 4W8DA 5GJDA 5I3OA 2HXQA 5G1XA 3LIJA 2R3RA 3NGAA 4KABA 3IGOA 4R6VA 4K77A 3H9FA 1B38A 3NX8A 2PZRA 3DDQA 4FTJA 2O64A 4CFXA 3PVUA 4OTRA 3FQSA 3E8NA 2PK9A 3O8TA 4FIGA 5C01A 5L6OA 5ANOA 3ALOA 1JKSA 5ETCA 3OT3A 3O50A 4YP8A 2F9GA 2PL0A 3LQ8A 4YTIA 4NEUA 2C0OA 2PUUA 3L9LA 4LRJA 3MPMA 4EONA 1XBAA 4GU6A 3GNIB 3QHWA 3WF8A 3MESA 2IZRA 3I5NA 5CLPA 2QURA 4C3PA 5IQGA 3RP9A 3NW6A 1M2PA 5E8ZA 4EZ3A 5JSMA 4QYYA 5EHYA 3E93A 3TDVA 3Q2JA 1Z9XA 5HBHA 2JAMA 4BY9E 5AP4A 3UIXA 4NIFB 2NO3A 3EQBA 4LV5A 1LR4A 4BDHA 3QRUA 5AR2A 4RJ4A 2BTRA 3EL8A 4CCUA 3ID6C 3IW5A 4DEGA 5HU3A 2GQSA 2XEZA 5AA9A 4PTGA 3FI2A 3MB7A 4KS8A 5M4CA 4FNYA 1H28A 3CGOA 1KE9A 3SQQA 5HLPA 3IDCA 2ZYBA 3QTUA 1IR3A 3MVMA 5AV4A 3HYHA 3G0EA 4YGAA 2W17A 3ATTA 1WBPA 3F7WA 4I94A 5EH0A 3TACA 1H1RA 4JQ7A 4YJOA 3IG7A 1ZMVA 4FSQA 3OW3A 3IQ7A 4BKZA 4E6DA 5CEPA 3LFEA 4FNZA 2QHNA 4DLIA 3AOXA 4QYHA 5HG5A 4DG2E 4APPA 1UNGA 3ORNA 4R5SA 3FL4A 4FT0A 4I5CA 4X2KA 2XMYA 5AMNA 3P0MA 5HNBA 3MSSA 5BMMA 5KX8A 4AAYA 1HOWA 3BPRA 3C0IA 3PZEA 3F5XA 3F5GA 3EKNA 4DCAA 3VBWA 3PJ8A 1YI6A 2O2UA 2R3JA 3MYGA 5EOLA 3CPCA 5IF1A 5CI7A 3PFYA 3NEWA 4O2ZA 3SW4A 4XYFA 3KGAA 1Y91A 5LMKC 3NYXA 5GZAA 2PSQA 3R1QA 5IMXA 3PLAE 4QMOA 3FKNA 3SVVA 1JKLA 3MH0A 1AGWA 4IM2A 4OTGA 4YJPA 1GZ8A 4IFGA 4B8LA 4DG0E 2QOHA 3PJCA 2GNJA 3ZC5A 2VV9A 3DS6A 3ULZA 2F2CB 4BWXA 4K2RA 4FKJA 3ERKA 3QAME 1ZXEA 4QP9A 2WIPA 4F08A 4L52A 2WTIA 2XNGA 4MKCA 5E9EA 4FZDB 1JSUA 4QDVA 1CKPA 5M07A 4KKEA 5FBNC 1W8CA 1TFFA 5L6PA 3QRIA 3A7HA 3SKCA 4BDDA 2ESMA 2VU3A 3OF0A 4NT4A 2W1HA 2B7AA 5AR8A 3ZSGA 4EHEA 2H34A 3QTZA 1Y57A 3NYVA 4LUEA 5CAVA 4ZS0A 2PUIA 1DAYA 4WUNA 3E8DA 3GC8A 5KMNA 3PXFA 4ZY4A 1M7QA 1U5RA 4MD9E 4UEUA 3SW7A 4NU1A 3AC2A 3TNQB 2V22A 5AP5A 4FKRA 2CMWA 2B9IA 3G9NA 3ANQA 4RIXB 5DA3A 3O71A 3V5PA 4UX9A 2PVNA 3DA6A 3FLNC 1ZY4A 3MVLA 4C4GA 4AXEA 3K54A 3O96A 3EMGA 4XV3A 4G6OA 2WEVA 5CT7A 3BLAA 4XEYA 3Q4CA 4Q9ZA 2PVLA 3PXKA 5LARA 2XNPA 1Y6BA 4I22A 4BCPA 4U97A 3K3JA 4G3FA 1KE8A 4G3GA 4PNIA 4RWLA 2F7ZE 1PYEA 3KXHA 1PXOA 4YHTA 1Q8ZA 5GZ9A 1S9IA 4LL0A 5HE3A 2X0GA 3FY2A 3U87A 4X7QA 4BDCA 4YMJA 3NNXA 3NWWA 2QVSE 4O0XA 1H4LA 4KNBA 4HW7A 4G5PA 1YWNA 5DIAA 3DXNA 4WRGA 2HZ4A 2Z2WA 4AZEA 2C3JA 5IUIA 3UP7A 4BYJA 4QMSA 2KULA 3QC4A 2BHEA 2OH4A 3EOCA 4IH8A 4E6AA 2YZAA 4BDBA 4A9UA 4XP2A 4BIBA 3IDBA 5LVLA 3C9WA 3FC1X 3MJ2A 2WGJA 3W1FA 1U54B 1UU3A 4FTOA 4A06A 3P7CA 3SRVB 2UV2A 4G2FA 4IC7A 4FEUA 2PVHA 5M56A 4C35A 4I23A 4M3QA 5BVKA 4DFLA 2ZMCA 3MI9A 4YZBA 2WU7A 3UDSA 4AOJA 4EORA 1OL5A 1U4DA 2GS7A 3II5A 4ACHA 3FLWA 3O23A 5DN3A 4KIKA 1YVJA 5IQDA 2C68A 3OEZA 4PDYA 2BDWA 3AC3A 4AW2A 5EQPA 4XOYA 4V0GB 2YERA 2W1DA 3TV6A 2ITNA 1BUHA 3FDNA 3MN3A 4FEXA 4KIPA 4Y95A 2WIHA 5HD4A 3OCTA 4FKSA 3CJFA 4L45A 2JBOA 1U5QA 2UVZA 3F9NA 2H6DA 3A8XA 3LZBA 5D9HA 4F4PA 3FYJX 2Z60A 2BKZA 4I6HA 1H0WA 4GS6A 2HZ0A 3A4PA 3FMMA 2RKUA 4F70A 4FSYA 2WPAA 3F2NA 5A14A 1B6CB 5A6OA 4IAKA 3CR0A 2UZTA 4I0TA 3KY2A 3WF6A 3PSBA 1CKJA 4HVHA 4I92A 1H26A 3IKAA 4L46A 4O91A 3IONA 3TNWA 3LJ1A 4ID7A 4ZSLA 3EN6A 3A7IA 5GIPE 5JH6A 4K1BA 4O6EA 1I09A 5ITAA 2CN8A 4EI4A 4ZMEA 3L8XA 2YA9A 3VBYA 1PMNA 2B9HA 1E1VA 2X0OA 4L68A 4WBBB 3JVRA 2JAVA 3Q9XA 3TG1A 3HEGA 4ASZA 4JBPA 4O7YA 5E1EA 4O38A 3BL9A 5E8SA 1XJDA 3ORXA 5K0KA 1PXMA 1WCCA 3AC1A 1Y8GA 3EKKA 4K6ZA 3OXIA 2R7IA 4DH3A 1FBNA 2XNEA 3Q53A 2QOKA 1F3MC 3IO7A 4XJ0A 4ZTSA 4AA0A 3CEKA 4ZK5A 2R4BA 3HAVA 3H9OA 4PWNA 4ZJJA 4G17A 5KNJA 5J9LA 1QPCA 2ONLC 3FMJA 4IBMA 1BX6A 4IIRA 3CD3A 4O4DA 4Z3VA 5DR6A 3REPA 5CVHA 4FG7A 3C4ZA 3FXWA 5GINE 1QCFA 3ZZEA 4U40A 3ETAA 3VUIA 3G15A 2W1CA 2E9UA 3D0EA 3DLSA 4XV2A 2CGXA 4PV0A 4B7TA 4Q5EA 4CQGA 3FLQA 3V01A 4AFJA 4MUQA 1ZZ2A 4FL3A 3DKGA 4GIHA 3P78A 4B0GA 4H1JA 4YSJA 3RNIA 4GL9A 4YJQA 5AFVA 4ZIMA 2QOOA 4ALUA 5F9EA 5HLNA 3TZ8A 5M08A 4AS0A 4UB7A 4FTIA 3VO3A 4H3BA 2WB8A 1PKGA 1YOLA 2RFNA 4O0WA 2FUMA 3DKOA 4M84A 4NJDA 4YC6A 3QU0A 3UZPA 3PPJA 1OI9A 3R63A 1OPJA 2JKOA 3LFFA 4MF1A 1CTPE 2OSCA 3C4CA 4KWPA 4ZTLA 5JFVA 1LEZA 1YHWA 1YDTE 3I81A 2CCHA 3KULB 4CRLA 2J7TA 2OFUA 3R7OA 4BBMA 1W98A 1GIHA 3PG3A 4AW5A 3HV6A 1GOLA 2YWPA 5H8BA 1ZZLA 4FV0A 2PUPA 4JOAA 1URCA 1LEWA 3BGQA 4FSMA 5D7VA 5HD7A 1OIQA 1A48A 4KBCA 4ZTHA 4IE9A 3Q5ZA 4TZRA 5CEIA 4PX6A 3POOA 3MFUA 4MXXA 5IU2A 5IZFA 2V55A 2P2IA 4ITJA 5ACBC 2GNGA 1LPUA 1UWHA 2W99B 3ORKA 3W2OA 4ZLZA 5AUTA 4ERKA 4E7WA 1O6YA 5BVDA 5CF5A 2WU6A 3LCSA 3PWYA 4W4XA 3R2BA 3RALA 3Q04A 4WO5A 1OKYA 3JS2A 1XBCA 2YM3A 4HYHA 3BEGA 3VS1A 4BGHA 4R7BA 4QNYA 3L9PA 1FINA 5JZNA 4D2RA 3TNPC 4S30A 3AT2A 3C0GA 2P4IA 1LP4A 3NDMA 4F65A 2PZ5A 4RJ8A 5K3YA 3S2PA 4WT6A 5HNGA 1UNLA 1DM2A 2JDTA 4OTQA 4XBUA 4BZNA 5M53A 1ERKA 2GPHA 4GCJA 3V5TA 4W8EA 1OIYA 5CWZA 5FP5A 3UOHA 3D94A 2WTDA 2WMQA 1ZRZA 3QQHA 4RC2A 1M17A 3PFQA 4GRBA 3W0OA 4DHZA 4G3EA 2GU8A 5CVGA 4CYJA 3A99A 4TRLA 4JDJA 3LAUA 1YRPA 1Q8TA 3B2WA 5CSXA 2YM4A 4FICA 3IECA 5AUXA 3GOPA 3BHVA 3OC1A 3W0QA 4YSMA 4R77A 1WBWA 2B9JA 3PVBA 5HBJA 4RZWA 1T46A 2A2AA 3VUKA 4IX6A 5K5NA 4LI5A 4EOOA 3ZHPC 2CKEA 3A62A 4MD8E 4WSQA 4AWIA 2ZMDA 5J87A 5CXHA 2W4JA 1PXIA 4NTTA 4IM0A 3AMBA 2X4ZA 2Z7SA 2C5OA 2GCDA 3CQUA 4DGGA 4D5HA 2XKCA 5IEXA 3R7UA 4YJNA 3GC7A 3P4KA 3U51A 3AD4A 4EQCA 4NUSA 2YZLA 5FTGA 3S0OA 2V62A 3FZTA 3FKLA 2CN5A 2RL5A 3HP5A 5HCYA 4ZJIA 3R0TA 3UODA 4C4IA 2C30A 3AT3A 4RJ5A 3FC2A 2JD5A 3F66A 3H4JA 3RJCA 3HP2A 4O7NA 1U59A 1NXKA 3AG9A 1FMKA 3TV7A 1E1XA 3PJ1A 2Y4IC 2ACXA 3PPKA 4M69A 5AUWA 4BI1A 4HVGA 2QCSA 1WVWA 3F3ZA 3LXNA 3UVPA 5JQ5A 2WOUA 5J95A 4PPAA 3TV4A 2XALA 4WD5A 3Q9WA 1W84A 4F09A 3P1AA 4NFMA 3MPAA 4LRMA 5HCZA 5L2SA 2BAQA 2OO8X 3ACJA 2HK5A 2W7XA 3I0QA 4PTCA 4BFMA 3BE2A 4D58A 1QPJA 5BUEA 1ZMWA 4DA5A 3NCGA 4F6UA 3RVGA 4X3JA 1TQPA 2BHHA 4S32A 2XYNA 3S4QA 4KAOA 1OIUA 1HCLA 4I41A 4EH2A 5HG7A 4U3YA 2C6DA 5M4UA 1VZOA 4JBVA 5EFQA 2OH0E 3WZJA 4QQTA 5GZ8A 4C33A 5L2TA 5A46A 3AQVA 4JS8A 3VRYA 4E5BA 5JRQA 2WTKC 3ZO1A 2Y8OA 3H9RA 4MX9A 5DLSA 3RPRA 1OITA 2R0IA 4H39A 3MGYA 4ITIA 3V8TA 3NMUF 2YJSA 2YAKA 1KWPA 4I3ZA 4FV9A 4QPAA 3RCDA 3QYZA 5HIEA 2J0JA 1DI9A 3W32A 3NNUA 2XRUA 4RWJA 2W1GA 3IDPA 4APCA 4ACMA 2F49A 4QP2A 4PL5A 3ZBFA 2GMXA 3QCYA 4LM5A 1WBTA 4B9DA 1KUTA 4BTMA 2RFEA 5AX3A 3VW6A 4TW9A 5DMZA 5J5SA 3C5IA 2ZOQA 3ITZA 4J53A 4JQ8A 2VNWA 4UALA 2CKQA 3KXNA 3QD2B 4YZDA 4TTHB 5H8EA 1NA7A 3FBVA 3PDTA 4FKGA 3BBTB 4XLVA 4RX5A 1JSTA 1URWA 5FXSA 1OVEA 3HKOA 1SMHA 3RWPA 4DH1A 4BJJA 3ZDUA 3H10A 3C51A 4YLLA 5CSWA 4AN2A 4IDTA 2AC5A 3DB6A 3QD0A 3ZRMA 3EQHA 3QC9A 5L8JA 2JDRA 4PL3A 4DDGA 2I1MA 2ETMA 4X2FA 2XK8A 3OXTA 4JDKA 2HCKA 4TPTA 4P90A 5FQDC 4E8AA 3MY1A 2HELA 2RGPA 4FT7A 1PYXA 4RZVA 4UZDA 1QL6A 4IWDA 4ZSEA 1REJA 4DFNA 5L2QA 5HI2A 3BIZA 4J96A 3PSCA 4U6RA 3UMXA 5IG1A 1R0EA 2I7QA 4QTEA 3FWQA 3QD4A 3SAYA 5CAPA 4OTFA 3TDWA 1YXXA 2CDZA 3DGKA 4OUCA 2XK4A 5BPYA 3CQWA 5AEPA 5DEYA 2JITA 5HVYA 3UO4A 3HDMA 4HPUE 2O3PA 4AGCA 4FZ7A 4QOXA 4YUQA 2ONLA 4M67A 4FKWA 1QPEA 3G6HA 5KHXA 3FHRA 2VO3A 5CT0A 1VYZA 4OTPA 3GXLA 4PP9A 3NUYA 3FLYA 3C1XA 4WRSA 3TI1A 1PXKA 4IVAA 4MXYA 3FQHA 5EI6A 2XAMA 3F5UA 3ZEWA 3UOLA 5IISA 1SNXA 3G90X 4DGOA 3LFSA 1ATPE 2G2IA 3D4QA 3GC9A 4WNPA 4PMTA 3RNYA 3D7TB 1OKVA 3PY1A 3ZYAA 3PXZA 2QG7A 3OY3A 3RHKA 2FYSA 4EZ5A 4MXCA 1PXPA 3GCPA 5HE1A 4IW0A 4EKLA 3THBA 3JR1A 3AKKA 5M06A 1PRYA 2QG5A 1Q41A 4EC9A 4FL2A 4FGBA 3FAAA 2R5TA 5IQEA 2C47A 2B1PA 3R22A 4BKYA 3JVSA 5CZIA 3SXSA 4KIOA 4FC0A 4FJVA 3AC8A 3TZ7A 4E73A 3OHTA 3CKXA 2RIOA 2X0QA 3HX4A 3OWKA 1A9UA 4FIIA 3TL8A 2PVYA 4O0SA 3KVXA 3ZUTA 4DFUA 3OTUA 4FSZA 1VJYA 2O8YA 3R30A 3OUNB 4AE9A 3LFQA 4DH8A 3UDBA 2AC3A 3L9NA 3IW6A 3QA8A 1J91A 5CAQA 1M2RA 3FZRA 4GYIA 5DT0A 4BTFA 3HAMA 4KRDA 4WNMA 3R28A 5C4LA 2GHLA 3AD6A 3QQKA 4MNEB 4UMQA 4L67A 4EJNA 5CQWA 4CFFA 3UQGA 2JDSA 4ZZOA 4P7EA 3LCOA 2ZV2A