4AGUA

Crystal structure of the human cdkl1 kinase domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
290
structure length
277
Chain Sequence
EKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFARLLTRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLKGCLHMDPTERLTCEQLLHHPYFENIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CYCLIN-DEPENDENT KINASE-LIKE 1
publication title Crystal Structure of the Human Cdkl1 Kinase Domain
rcsb
source organism Homo sapiens
total genus 86
structure length 277
sequence length 290
chains with identical sequence B, C
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4aguA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aguA01
2YCSA 1OL5A 3KRWA 4XG4A 3I79A 4FG9A 3VBYA 2HOGA 2WOTA 2QHNA 2PMIA 2VO7A 4USDA 5EM5A 4AUAA 2PE2A 4BBMA 4BDGA 3EZVA 3MA6A 3FKOA 4WBOA 1YRPA 4TYEA 4J8NA 3VHKA 4D55A 4L9IA 4LGGA 5K9IA 4MVFA 4HNFA 4II5A 3BHYA 3WYXA 2JDTA 2YABA 4GRBA 2R3RA 3FMKA 5HTIA 2VTMA 2YIRA 1Q24A 5ANKA 3PP1A 1PXKA 3F5PA 1OM1A 3QWJA 3PE1A 3CKWA 4AA4A 4EUTA 2W9ZB 3WF9A 3GCQA 3P1AA 3SRVB 1WBNA 3QRIA 3SAYA 1CKJA 3WZKA 5BX0A 3UVRA 2R3OA 2UZDA 3OW3A 2Z7RA 3PXQA 4DT9A 4X3FB 5M4FA 4AA5A 4XEYA 2XK8A 2WMQA 5H3QA 4AS0A 4YJOA 1P4FA 4D58A 2UW6A 4XOZA 1Y6AA 2WMAA 2JLDA 3K5VA 4JG8A 4AN2A 1UV5A 3EFKA 4CLJA 5CS6A 4G1WA 1P14A 2RG6A 4MNEB 4QTCA 3DBDA 3MFTA 4H1MA 4YJRA 1YW2A 3TNQB 4BI0A 1PMNA 1QPJA 4WT6A 3QCXA 4LI5A 4YTCA 5AV0A 2VTIA 2WELA 2LAVA 5CSPA 2WMVA 4CMOA 2QQ7A 3ZEPA 1KWPA 1H00A 4UB7A 5FXRA 4IX6A 3V5WA 1DM2A 3H0YA 5DLSA 5AUVA 3VUIA 2B54A 4LMNA 4AW2A 5J1VA 3WF6A 2XP2A 5GIOE 2XNNA 4EZ3A 3NZ0A 5DR9A 3K2LA 4NFNA 4FV9A 2HZ4A 3GC7A 5ANGA 5J95A 5I9ZA 4CMTA 2VWXA 3NR9A 3KMUA 3TXOA 3QFVA 2F2CB 2CGWA 3KK9A 3D5WA 3VUKA 2VUWA 3ROYA 2HW7A 4D2PA 1OUKA 3FC2A 3H9RA 3TNWA 4I92A 2IW8A 3WF5A 4L00A 3U9NA 4DH7A 4PDPA 1XH4A 5GJFA 4P2KA 5AP1A 2NNWB 3BYUA 3R1QA 3U8WA 3Q32A 3EN6A 5FG8A 4EOQA 1XH9A 4UY9A 4R1VA 2GHLA 1YOMA 1KOBA 2QOBA 3BI6A 4EEVA 1E1VA 3IS5A 2BR1A 4K0YA 4CEGA 3WIKA 4IAFA 4FL1A 3UMWA 2PZ5A 3NIEA 4R1YA 2QC6A 3VC4A 4FIEA 3CCNA 3LXKA 2J0JA 4UXQA 3UIMA 5KKRC 4IB0A 1BYGA 1GZNA 3ACJA 4BY9E 2BKKA 4IHPA 1VYZA 5HVYA 4CFNA 2BPMA 3BBTB 5CSHA 4YZ9A 1ZZLA 3TCPA 1IEPA 2JGZA 4CTCA 2C4GA 4FNYA 3I6WA 4L42A 1M2RA 5DI1A 3A4OX 4D4RA 2W4OA 5E8YA 4XRLA 4OTRA 3LAUA 3IECA 3AC3A 3RK7A 1BX6A 2WZJA 1NVRA 2OH0E 1PJKA 3RHXA 4RIWB 5A4CA 2IVSA 5A4QA 2OXXA 4I6QA 4BWKA 3ULIA 2F2UA 3ZBFA 2X2MA 5CEPA 4MWHA 3PZHA 4YJVA 3UGCA 2CKPA 5L2QA 5D1JA 3CTQA 5DR2A 3CJFA 4FTRA 4EHZA 5CU4A 4D2TA 3SGCA 5AUXA 5CI7A 1G5SA 2X9FA 1XR1A 1ZMUA 3G90X 2QOIA 4LRKA 2OF2A 3CGFA 1H1PA 2OJFE 3O7LB 2PVJA 3BHUA 3SA0A 3QKMA 2W5AA 4NH1A 4NTSA 2HELA 4QMXA 1XBBA 4BWPA 4RX9A 5E90A 1W7HA 1ZMVA 5ANEA 4F64A 3IW7A 4CYJA 1W84A 2OG8A 3ZDIA 3GU4A 3DTWA 2QVSE 5AV2A 5M09A 3GC9A 3QRKA 3FY2A 2OJJA 5ANIA 1JKLA 1SMHA 3DOGA 2JDSA 3VRZA 2VX0A 5LMKA 5LARA 5C9CA 2HAKA 3R7UA 5F1ZA 4DH1A 3F88A 3AT4A 3P78A 3R7EA 3PXRA 1BI7A 2WQOA 3D5XA 3NSZA 4WO5A 2WMBA 3DXPA 3BHTA 3Q2MA 5DRBA 5JSMA 3RAHA 1KE8A 3CBLA 4HVDA 3JPVA 3BYVA 2QLUA 4IDTA 4IX3A 4RQVA 3F3TA 3KRJA 1YHVA 4KIPA 4BDBA 3U87A 4MD9E 5I9XA 3MY0A 4OUCA 1LPUA 3K5UA 3PWYA 1RJBA 2X4ZA 4DCAA 3D94A 2A19B 2UW7A 3HV3A 4H1JA 3G33A 3ZZEA 4ENYA 2GNGA 5GJGA 1O6YA 4NZWB 4U45A 4GV1A 3MGYA 4O21A 4K1BA 2W1ZA 5C8NA 5IDPA 1ZYSA 2H96A 1FINA 3ORTA 4F65A 4ALUA 4B8MA 2BDWA 2R3HA 4FODA 2GNLA 4FV2A 5DN3A 4AZSA 3OEZA 4QMNA 3W2RA 5M07A 3LFNA 4IAAA 3VUGA 3ZZWA 2BUJA 3WOWA 4OBOA 4WNPA 4F7SA 3KRRA 3BPRA 4FIFA 5I9UA 3Q4UA 5ACKA 2ERZE 4CV8A 2CN8A 2IJMA 4BCJA 4DEIA 3BHHA 2J7TA 2VTOA 3ZLYA 3F2NA 4FZFB 5ANJA 3RK9A 2R3MA 2Y7JA 3PG3A 2CLQA 2PVMA 3H9OA 1R39A 3OBGA 4TW9A 3I5ZA 5M51A 1S9JA 3AQVA 4C3FA 2WQEA 4FSYA 5IEVA 4ORKA 3R9OA 3MB6A 4E4XA 3TDVA 4OBPA 3LFQA 4O1OA 3NW7A 4PY1A 4FVRA 4TNDA 4WIHA 3ZFXA 1HCLA 3TNHA 3ZONA 4EUUA 3GC8A 2YDJA 5D11A 4YUQA 2QNJA 2BZHB 4X6QC 4ANBA 3QCYA 3QGWA 4TN6A 4QMYA 4BDIA 4EWHA 3RAWA 2CPKE 2GNFA 2GQSA 3TL8A 4BDKA 4P5ZA 4YJSA 4MD7E 5B2KA 2WTKB 4IWOA 3GBZA 1BMKA 4XP2A 3LVPA 4WNOA 4R77A 3EFWA 3DFCB 3UTOA 2R3KA 4I0RA 4M8TA 3QHWA 3UNZA 2I0HA 5AR8A 1G3NA 1OUYA 5K4JA 3RCJA 5DMZA 2UW4A 4NIFA 3RJCA 4CKRA 4PV0A 1VYWA 5CEQA 3UG2A 4HYHA 1ZYLA 4RIXA 3KCKA 5DT3A 2C30A 2LGCA 3REPA 4M3QA 2OH4A 2GCDA 3LFSA 3SD0A 5HU3A 1H8FA 4FF8A 1OMWA 1TVOA 4IVCA 3SOAA 5LXMA 4CG9A 2WTWA 3MIYA 1UU3A 4RJ4A 4U8ZA 5AJQA 4YJTA 3PJ8A 3H30A 2EWAA 3PZEA 4ZTHA 4RFMA 4Q5HA 4KA3A 3FI4A 5E8SA 5AUYA 1UNHA 5AMNA 5E91A 4H3PA 4D5KA 3LXLA 2OBJA 3TKIA 2I7QA 4FE2A 1Q4LA 3FQSA 4IXPA 3VS6A 3W32A 5KMJA 1JKSA 1IASA 4OGRA 3RP9A 4XV3A 3R63A 5EK7A 2RL5A 2XCKA 1JSTA 4HW7A 3LFCA 2PZRA 3R2BA 4EK3A 4D0WA 3F9NA 2WQMA 4O27B 4DFZE 4RX5A 5CVFA 3KQ7A 4B99A 4X21A 2FSTX 2P0CA 1F3MC 3TZMA 5M53A 4F7LA 2XJ2A 4NFMA 4TNBA 1LR4A 4KBKA 4P4CA 1FVVA 1V0BA 3CD8A 3NYOA 4ZJJA 4NU1A 2OXDA 4CFVA 4LOOA 2IW9A 4GG5A 4C36A 1P2AA 2BMCA 4RVMA 5AUZA 4FC0A 5TOZA 5BMSA 5LWNA 1CTPE 5L8KA 3R73A 3OTUA 4EORA 4EH4A 3A7GA 4L52A 4IX4A 5CF5A 4DC2A 1IAJA 2XKCA 3DKOA 3ORKA 1OL6A 2W17A 4NJDA 3ZM9A 4APPA 5IA4A 2IPXA 3HUCA 4TXCA 4C57A 4DEHA 3R22A 5HO6A 3Q6WA 3S4QA 3KCFA 4YSJA 3UIXA 2BIKB 2GFSA 2YIWA 2BZJA 5KZ0A 4WG5A 4XP3A 3A61A 2RFSA 1T45A 2ZV7A 4D2SA 4FTMA 1PYXA 2FGIA 2W4KA 2YDIA 5CU2A 2UZBA 2P55A 2WOUA 5KMOA 3QRUA 4JI9A 3QQKA 4FICA 2YWPA 3C1XA 4J71A 4AZFA 2CCIA 3NUSA 1JNKA 4YBKA 4EZ7A 5HE0A 3HNGA 2A0CX 3FXXA 5FD2A 4FOBA 2PWLA 2EVAA 4CGAA 2AC5A 3S2PA 5H2UA 1OPLA 3HP5A 3FC1X 3S00A 4FKWA 5A3XA 3DS6A 3LE6A 3DLSA 3SLSA 1WBOA 2E9UA 4YGAA 4N57A 4HPUE 5D7AA 5HO8A 5JZNA 4QQCA 3RPRA 4Z16A 5IDNA 3R9RA 3QQFA 5B2LA 2PVYA 4DG0E 3PA3A 4JVGA 5E4HA 2HK5A 3SXSA 5CYIA 3WIGA 1DS5A 3DAJA 3R02A 4W4VA 3JS2A 5L3AA 2Q0BA 5BPYA 2PMLX 2REIA 2BRNA 4AT4A 4GKHA 2BAKA 5AUWA 2BAJA 3HA8A 3CE3A 3QC4A 2XIKA 5EW9A 5AM6A 3VVHA 5IZFA 2Z8CA 2HZIA 2O63A 2DYLA 1UU7A 4MEDA 3U6IA 5FTGA 2PPQA 3RAKA 2R3GA 4ASEA 1WVWA 4USFA 4TYHA 2BHEA 3FBVA 3JXWA 3FYKX 5AAGA 4FT7A 1OKYA 3GP0A 3PY1A 4UEUA 2R2PA 5HE3A 3NNVA 4IIRA 4IZ5A 5AP5A 3R8MA 4FV8A 3AC1A 2JD5A 4LGDA 5CEMA 2B9FA 2I0YA 4FTUA 4RIYA 4TT7A 3BV2A 1CM8A 5EKNA 5JQ8A 2Y6MA 2YEXA 2GTMA 5CNNA 4FV7A 3ZS5A 4LRMA 3ATSA 1OZ1A 3LCOA 4KABA 2XA4A 4G31A 5HCXA 5M08A 4RIXB 4GJ3A 3COIA 4K8AA 3ROCA 4BTFA 3KEXA 3KULA 4NTTA 3EQHA 4PPBA 4L3JA 4ZEGA 3FHIA 3KXXA 5CANA 2X7GA 3DKFA 4FGRA 5EI6A 3R8PA 3MSSA 2R3JA 4DEGA 4FTCA 4ONAA 4M14A 2XNPA 3C5UA 2E2BA 4GVJA 2J4ZA 4PPAA 5EOBA 4BGGA 1Q97A 4EC9A 2VX3A 4G3CA 5IISA 1Q8YA 4APCA 2WEIA 3L8XA 3PIZA 5J87A 2Z02A 5CXHA 2VWIA 5BYZA 4ACMA 1IAHA 1ZOGA 3HL7A 4GEOA 5JGBA 4BCPA 3VQUA 3VQHA 3ZSGA 2W0JA 4DITA 3VIDA 5A4TA 3IW5A 2PTKA 1BLXA 4O38A 2UVZA 4Z9LA 2ETRA 4GYGA 1ATPE 2JIIA 3BX5A 3DKGA 4UMTA 4G16A 4XV2A 5DNRA 4PDSA 4YJPA 2Z7LA 2I6LA 4UMRA 1GZKA 5EHYA 4BGQA 1FVRA 3QD4A 4GIIA 5E7RA 4GKIA 2GS6A 5FRIA 4DH3A 3I1AA 4GFOA 4FK6A 3FV8A 5HESA 2GS2A 4XBRA 2OJIA 1YKRA 2GHMA 4CFMA 2B9JA 3PXKA 2BIYA 1PMVA 5AV4A 1QPEA 3FZSA 2ACXA 1FMOE 3TJDA 2ZM1A 5KKRB 3GQIA 4IDVA 4BCGA 3MBLA 3D2KA 5ETFA 1MP8A 3OXIA 4N6ZA 3GT8A 5EQPA 5F94A 4JNWA 2C68A 1ZZ2A 4L6QA 1URWA 2YACA 3QWKA 1IA8A 4CCBA 4RLKA 3IOPA 3Q6UA 4OTQA 4TWCA 4DG2E 2ITUA 2CJMA 3M42A 4ZSGA 4S31A 4LQMA 5JGDA 5CU6A 1J7IA 2JBPA 4DF3A 4JBPA 4AN9A 4XG6A 2XJ1A 3DK6A 3DT1A 1YOLA 2RIOA 4QMUA 5CY3A 4EH3A 4F4PA 3PRIA 4BIBA 2X9EA 2C1BA 1REJA 3LMGA 4OT6A 4I23A 4U80A 2GQRA 2XYNA 3F5GA 4EONA 3V6SA 2VRXA 5AFVA 4L67A 3NNWA 3FWQA 4FTAA 4PDOA 3COHA 4E6DA 1Q3DA 4RT7A 5KNJA 2PZPA 4FG8A 2YWVA 3LM0A 4U3YA 4X2JA 1VR2A 1ZOEA 2X6EA 5LVLA 5KMKA 2Z2WA 3R7VA 4B6LA 1GOLA 2CLXA 5DT0A 5IUIA 3LCKA 1K9AA 3PY0A 3PXYA 5HE2A 5E92A 5F9EA 5E8VA 3CPCA 2QG7A 4EH8A 4BR3A 3PPZA 4JOAA 3VN9A 2F7EE 5C27A 3UPZA 4ZSAA 4WD5A 4YC8A 2PULA 4GG7A 2WQBA 4FSMA 3FQHA 2G9XA 3OG7A 4PL5A 4XS2A 3MDYA 4GL9A 1XBCA 4I1ZA 2FSMX 3E5AA 3HMPA 5L4QA 1OIYA 3NAYA 1PXMA 2W1CA 2OFUA 4FTTA 4EK6A 4JAIA 1T46A 1LUFA 3TG1A 2ITWA 2ITYA 1BI8A 2OIDA 1YXVA 2ZDTA 2G2HA 4IM3A 4C35A 1YDRE 5HU9A 5I4NA 3C7QA 2XIZA 4QP2A 4ZSLA 3UQFA 5FEQA 2RSVA 4XH6A 4C4HA 3Q04A 3KVXA 4QMMA 5C01A 4TL0A 5KCVA 4MNFA 5BYYA 1OVEA 1ZWSA 1MRVA 1ZOHA 4ZAUA 4DGLC 4FEWA 2IZRA 3A7FA 4R3CA 1MRYA 3WZEA 4DAWA 4NK9A 3FI2A 5HLWA 1OKWA 1R1WA 3CPBA 3P08A 4D4YA 3CY2A 5B7VA 4U3ZA 4I93A 3PP0A 4CFFA 4A7CA 4FTLA 4BDHA 4IFCA 4QP7A 5ICPA 1TKIA 5J1WA 1R0EA 3D7TB 5J7HA 3UOHA 5C4LA 1FVTA 4XMOA 3C5IA 3RPOA 4WUNA 2JFMA 4M68A 4G2FA 4JG7A 5DRDA 4BZDA 3UNJA 1K2PA 2YAAA 4LYNA 4JS8A 3P86A 5M06A 4C7TA 4HJOA 2Y4PA 2GNIA 2BDJA 2WTDA 3U51A 4DFXE 3BLHA 4EOSA 2OZOA 3UOKA 4KIQA 4CZTA 1JSVA 5CNOA 5AP6A 5AR2A 5AAFA 4BCHA 1YWNA 5CZIA 4R7BA 4AWIA 5IQFA 3TUBA 2GNJA 1FGIA 5J9ZA 4JDKA 4OAVB 2WTIA 4L44A 3BELA 2XS0A 5EQEA 5C4KA 3BZ3A 2C69A 3EFLA 4OTWA 3T9IA 2BRMA 4I21A 4F0GA 4NL0A 4W4WA 1U46A 3VUTA 2WAJA 3P79A 4FKLA 4ZLOA 3RWQA 4EKLA 4P5QA 1PRYA 3KXNA 1KE7A 2JAVA 4BCNA 4UMUA 1QPCA 3D2IA 3TTJA 3IONA 3TV4A 5AV3A 2VO0A 3TZ7A 3R9DA 4X2GA 3NYVA 4WNKA 3ODYX 3K3IA 4IZ7A 2J0KA 3PYYA 3TEIA 4DFNA 1M52A 3QALE 5JFXA 4O7SA 4E5WA 5IQBA 4FEXA 3Q53A 4KBAA 4ACDA 4ZZOA 3CSVA 4QP3A 4MTAA 5HIEA 5LMKC 2ONLA 4PTCA 4GJ2A 3FL4A 3L9MA 3NAXA 3EB0A 3WZUA 3BQCA 4RC2A 1TQPA 3W8QA 4FT3A 4C2WA 3DZOA 4FZ7A 1KE5A 3FXWA 3ACKA 3HV6A 3A8WA 4PNKA 2VV9A 3AGLA 4EKKA 4J8MA 1RDQE 1DAYA 3OUNB 4UBAA 3SW4A 1QL6A 4M67A 4ERWA 4M15A 2XM8A 2BVAA 4AOTA 2OICA 2B4SB 3EQRA 3OUKA 4R3RA 5FQDC 1YWRA 4UYNA 2QCSA 4O6LA 5ETIA 3GOKA 3T9TA 4Y5HA 4QPMA 3D9VA 3H3CA 1H0VA 2HXLA 5GZ9A 3E8DA 5D41A 4E6AA 4CD0A 5TR6A 3NNXA 3ZUUA 4NM3A 1YXSA 2I1MA 2NRUA 3EYHA 3QTZA 3QQUA 2GU8A 1Z5MA 3CQWA 2OF4A 4FIHA 3DDPA 4U5JA 5KMIA 3IGGA 5CTPA 4TTHB 4V05A 5AIRA 4CLIA 2BTRA 4AZEA 4GCJA 1SVHA 3ELJA 4FV3A 4XG3A 2W9FB 4E7WA 2EXEA 5GZ8A 2CKEA 2E9PA 4HGTA 5AP7A 4GUEA 5HBJA 5LVPA 2J50A 2VN9A 2YISA 4FT5A 4Z3VA 1Q41A 5AR3A 2WD1A 3UIUA 1XH5A 3NNUA 2E9OA 3ANQA 3IDPA 3WZJA 3MW1A 3OW4A 5K5XA 4LUDA 1OECA 2C6KA 2NRYA 3F6XA 4UXLA 2YAKA 3ENMA 4F9WA 3HAVA 1SNXA 3MB7A 4AN3A 1Y8GA 2IVVA 3GGFA 4FKRA 4DFYA 3RAIA 3DBFA 2GSFA 2UW5A 3IK3A 1GZOA 2KTYA 2YFXA 3V6RA 4LL0A 4NKAA 2VNYA 5I9VA 2GDOA 5AR4A 2CSNA 2O64A 3R21A 4J53A 5A9UA 5AX9A 5E1EA 4BTJA 3FQEA 3V51A 4DTAA 3FL5A 5LCJA 4AZWA 3DK7A 5M4UA 3RVGA 4PMPA 4QYGA 4C0TA 5TO8A 2XM9A 3NIZA 4QD6A 4QTBA 5D9HA 3OWJA 3QA0A 4U97A 2GNHA 3R6XA 5AADA 5IMEA 3ZHPC 2W96B 4L3PA 4RC4A 5CAUA 4E93A 2VTNA 4X7QA 3QX4A 3F3VA 3QQLA 4DGNA 4N4SA 3A7IA 4J1RA 2FA2A 3SHEA 3KXGA 3N9XA 5A4EA 2PZYA 3VS2A 2OZAB 3SXFA 3VAPA 3R1YA 4CYIA 3Q9ZA 2ZM4A 3BKBA 4Y83A 2WNTA 3AD6A 4PMTA 3EL7A 4YPDA 5FM2A 3UC4A 3UIBA 3FMEA 5M56A 2HCKA 1SZMA 4GW8A 4TYJA 1UKHA 4G9RA 3GCUA 3BGZA 2YM5A 1U4DA 3H0ZA 5AIKA 3GCVA 1Q8WA 1BKXA 2JKOA 4MF1A 3B8RA 4GT5A 2QOOA 5CAQA 4BCOA 2PHKA 4QYFA 3DGKA 4YNEA 5J79A 3OCSA 2UZTA 5IQCA 4F0FA 4PTEA 4B0GA 3DQWA 3POOA 4EWQA 4AXAA 5CALA 4JIKA 3PPKA 3OWLA 4NWMA 2OWBA 4ZSJA 4KRCA 3UODA 1FPUA 4MXOA 5IQEA 1UA2A 3FPMA 2X6DA 3Q4TA 4MH7A 4RLLA 5CEIA 3RPSA 4CT1A 4OTFA 5L2SA 5ETAA 2IW6A 1UU8A 4CFXA 3ATTA 4O7ZA 4IB1A 5FEEA 3O8PA 4FSRA 4AFJA 5CENA 4FKSA 4HCUA 1GIHA 2W05A 4FUYA 3C4CA 4RFZA 4ITIA 1YDTE 1VJYA 3FAAA 3ET7A 2HXQA 3S3IA 4FV5A 4EBWA 4ZMFA 1BUHA 4QTEA 3QTSA 4LM5A 1PMUA 2G1TA 1FOTA 3HA6A 1YXTA 5CWZA 2VU3A 3DXNA 3R30A 3EYGA 3VJNA 1KOAA 4R7IA 4GU9A 3HVCA 4RPVA 3V04A 4FKTA 4WSQA 3UPXA 4V0GA 4WG4A 5CSXA 3UZTA 3FKLA 4FKJA 5DG5A 5DHJA 4MAOA 3BYOA 2VTQA 2NPQA 3DNEA 4XG7A 5TF9A 2XK4A 5FP6A 3MVJA 4YZMA 3MWUA 2XKEA 2ZMDA 4JDHA 2DS1A 3P5KA 5HEZA 4BHZA 5A54A 5FGKA 1SM2A 4AE9A 4XG2A 4D4VA 4EBVA 4UWYA 5EW8A 4ZZNA 5J5SA 2QKRA 2GFCA 3PIXA 4BRXA 3HV5A 1NY3A 4GH2A 4IE9A 4KNBA 3W10A 1JVPP 4P7EA 3QD2B 1ZMWA 1H08A 4UV0A 5DE2A 2OI4X 4AGDA 4JRNA 3AMBA 2C6TA 3G15A 5L8JA 3CQUA 3FHRA 4RJ6A 3QQGA 4ALVA 4PNIA 4A06A 3V8TA 1O6LA 2VWZA 3KMMA 3CY3A 4FA2A 5FLFA 3LFDA 1GIJA 4DN5A 4I24A 5HOAA 2PZIA 4MBJA 4KSQA 3C4ZA 4W4YA 2XF0A 4XOYA 3P0MA 4HOKA 4S2ZA 4O7VA 2PE1A 4EH9A 3VBXA 3NW5A 3QYWA 3F3UA 2FSOX 1OL2A 5CSVA 4BI2A 2RF9A 4RX7A 3LZBA 4EK5A 4HGLA 1SYKA 4C4FA 3NVKI 5ITAA 4BCFA 4AGCA 5HNGA 4B9DA 4HGSA 3ANRA 3RMFA 2R4BA 2ITVA 4FSNA 1WBSA 3EQCA 4Q9ZA 4IVAA 3D5VA 4DTBA 2B7AA 4NEUA 2VNWA 1NT2A 4YHFA 4C4GA 4IC7A 5CAOA 3KXZA 3FMMA 3VF9A 1REKA 4WKQA 4JBVA 2W06A 3BV3A 5AEPA 4UZHA 2DWBA 4BKJA 4EH6A 4H36A 4QP4A 2JIUA 3JYAA 5EKOA 4XG8A 3MY1A 3FZTA 3BE2A 4QOXA 3KXMA 5FEDA 1EH4A 3PA4A 2PVLA 2VWBA 4JBQA 2H8HA 3KF7A 1J91A 1WMKA 3WE4A 4M84A 2GTNA 1PYEA 4LUEA 4Y5QA 3ZLSA 2ZB1A 3IKAA 2JIVA 3C0IA 4EOPA 1Q99A 2OJGA 1PY5A 2IG7A 2YA9A 4YTIA 3UOJA 4YO4A 1WBWA 3E93A 3OWKA 3QZIA 5CAPA 4NUSA 4UX9A 4F99A 4R3PA 3E3BX 3MH0A 2UW3A 4I5CA 2PVHA 2IWIA 3P7AA 1YVJA 2X8IA 2YERA 4TY1A 5EDPA 2CMWA 5CEKA 1L3RE 3IW6A 5AX3A 1Q3WA 1WBTA 3HZTA 4L8MA 1STCE 3DB8A 3ALOA 4QMSA 4M0YA 3HDNA 1FGKA 4HZRA 3UG1A 2GQGA 3ZLXA 4B7TA 2QONA 4EZ5A 4GS6A 1KUTA 3W2SA 4XV1A 4CKJA 2W7XA 3H9FA 1KV2A 3EFJA 4K9YA 4E4LA 3GCPA 1AGWA 2ZM3A 4KB8A 4XHKB 4NCTC 4AQCA 4EYMA 1H1RA 4UALA 5BVFA 3CIKA 2BCJA 2JFLA 3H4JA 5EDRA 4EOOA 4O2PA 5J9LA 2B52A 4MBIA 3EN5A 5FBOA 3LJ2A 3QZHA 4BZOA 3V5TA 4L53A 2CN5A 2UW9A 4ASZA 4PL4A 1Q8ZA 4MCVA 4N6YA 3SX9A 2PE0A 5DEWA 4TZRA 4D2RA 5TE0A 4BBFA 4YMJA 4FIIA 4C4EA 3B2WA 5KHXA 2ZJWA 3BCEA 2JAMA 2C6OA 4FGBA 4C4IA 5CLPA 1GIIA 1QMZA 5IEXA 1MQBA 2C6IA 3V8WA 4EL9A 2X39A 3DA6A 5C8MA 5CF4A 2HZNA 2OFVA 4YO6A 2PYWA 4YLJA 4KD1A 2HIWA 4V0GB 3RM7A 3VW6A 2VGPA 2Y6OA 3LXNA 3TN8A 4EJ7A 3E8CA 4DBXA 4N0SA 4XBUA 3I81A 5L6WL 2WMRA 3NUPA 3ORZA 4I20A 3TNIA 4BC6A 1MQ4A 3HRBA 3N4VA 3OOGA 1FBNA 3ZRMA 1XH6A 1IG1A 2V62A 4EQUA 3MIAA 3DKCA 3E63A 1J1CA 1WBPA 2YIYA 3KY2A 3MTFA 5M57A 3Q9WA 4OBQA 2ZV9A 3MH2A 3KFAA 3GU7A 3NVMB 2C3JA 3CD3A 4YBJA 4IWDA 4R5YA 4XG9A 4BCKA 4DGMA 3GENA 3IQ7A 4O7WA 3AGMA 4I0SA 4J96A 5AWMA 4DINA 4F1OA 1JPAA 2YM8A 2YITA 4W8DA 4DEBA 4MHAA 5JH6A 2Q0NA 1J1BA 3EQFA 2C47A 5HORA 3P23A 1X8BA 4MXCA 1AQ1A 3N4UA 4M13A 1KE9A 3FLYA 2X81A 3FUPA 3UE4A 3VUMA 4O0VA 3O8TA 3GEQA 4I5MA 4XV9A 4A9TA 4Y72A 1W8CA 3OT3A 4JX3A 3FMLA 3VS7A 2AC3A 2YDKA 3QBNA 3HP2A 4JR7A 4KAOA 2JKQA 1PXJA 3TUCA 1CMKE 4FNZA 4O1PA 5HE1A 4YP8A 5C1QB 3NW6A 3KL8A 3NGAA 5HBHA 3OS3A 4C4JA 4FKPA 2X8DA 1GNGA 3QHRA 5EQYA 4ZS0A 1YOJA 4B4LA 4FTNA 4EOKA 4BN1A 4QQ5A 2J2IB 3ALNA 2O5KA 2YZAA 3E64A 3LFEA 4L46A 4AGUA 3W2OA 4O83A 3VUHA 3R1NA 5GINE 1IR3A 1GZ8A 4YZBA 1UWJA 2OGVA 4PTGA 5J9YA 5T3QA 3MTLA 5GIPE 4ZLYA 5B0XA 2YCRA 1IRKA 4F7JA 3R8ZA 4WSYA 3O8UA 3R8VA 5DEYA 2QU5A 3TACA 2BRHA 4BYIA 3MPMA 3KF4A 4U43A 3RALA 4F63A 2WU6A 3UOLA 4BVUA 4RZVA 2PL0A 4NW5A 2RGPA 2Y9QA 4CFWA 2O65A 3OFMA 4ASXA 4FKIA 4J7BA 5JGAA 1PKDA 1YI4A 3EMGA 3GNIB 3T8OA 3LM5A 3GQLA 1UVRA 3G5DA 3VNTA 2WFYA 5HNIX 2X7FA 3C0GA 4FTQA 1WFCA 5IQGA 4ZJIA 3UP2A 3QF9A 3DJ7A 2KULA 3FZPA 2XK7A 4AW5A 5HTCA 4ERKA 2R3FA 5AR7A 1WCCA 1H24A 2PK9A 2GS7A 3O0GA 2V22A 2W5BA 3KK8A 2W1IA 3EJ1A 3FY0A 1K3AA 3KXHA 3MV5A 4DA5A 1PXLA 3FLQA 1L8TA 1UWHA 5KMNA 3C4FA 3PA5A 1O9UA 2P4IA 3EQBA 3C0HA 1JOWB 4G6NA 4RQKA 4RZWA 4BBEA 5JRQA 1ZRZA 2E9NA 4YZCA 5JFSA 5LQFA 3U6JA 1RW8A 4C2VA 5CVGA 4PRJA 2OLCA 2EUFB 4EH5A 4AG8A 4F70A 3L8VA 2R3IA 4G6OA 5JKGA 3KN6A 2XYUA 4FV6A 4F9YA 3M2WA 2ONLC 4O0WA 4F6UA 3UNKA 3VRYA 3FEGA 4QMLA 2JBOA 3IGOA 1H27A 3QXPA 4I5PA 4Z55A 5M44A 4MX9A 1V0PA 3WBLA 4I41A 1PKGA 1FQ1B 2JKMA 4IC8A 1R0PA 4IAIA 4JLCA 4NIFB 5CVHA 5DOSA 5DPVA 3DXQA 2NP8A 5FTQA 2PUNA 5HX8A 4E4MA 5HICA 1NW1A 5IQDA 2HYYA 4ZTQA 3SV0A 2H34A 3PPJA 1KE6A 4DT8A 5E8ZA 2PMOX 4U7ZA 3VS5A 4A9RA 4F6SA 3MYGA 4R8QA 3RPYA 1JBPE 2VTHA 4H3QA 4FTJA 4FZDB 3ETAA 1BL7A 2XK9A 3O2MA 2F49A 3B8QA 3BHVA 3LPBA 3Q96A 3UO5A 4C37A 4FK3A 2Q83A 4FSQA 5EM8A 3THBA 4NYEA 1U54A 4ITHA 4YJNA 3ZDUA 3FZRA 3L1SA 3Q5IA 4BI1A 3NCZA 3HDMA 2R5TA 5FXSA 3SC1A 3W2CA 3W8LA 3RCDA 4E4NA 3I0OA 5CQUA 4F0IA 3AT3A 4YSMA 3ZOSA 4GYIA 2YCQA 2HY0A 5EDQA 4K77A 4G17A 3H10A 4DH8A 1VEBA 2UUEA 3LXPA 1G8AA 1PXOA 3QCQA 1JKKA 3GFEA 1JQHA 4KIOA 5BVEA 3I7CA 3ZEWA 3TDWA 5GJDA 4G3DA 4M69A 3CXWA 3RZBA 2P3GX 4NCTA 5EW3A 2ZV2A 5IQIA 2E9VA 2ITPA 4O7TA 4E20A 3TI1A 2VTAA 3IW4A 3EKNA 4FUXA 1OPKA 3OP5A 4FV1A 5DIAA 3ZXZA 4CNHA 4YHTA 2R7BA 3JY9A 3D4QA 3HRFA 4FZ6A 3AC2A 1O6KA 2XEZA 3DAKA 4FKQA 4TPTA 4H58A 5LVNA 4A4LA 3UO6A 4F9CA 4ZSEA 5HBEA 4LRJA 3UC3A 4KIKA 4OTGA 5D12A 2W1DA 4XRJA 2W4JA 1F5QA 2VGOA 3PLSA 4DYMA 3OCGA 3NYNA 3SDJA 5J5TA 4X2FA 4I94A 4UMPA 2W5HA 4FKUA 4EJNA 2IO6A 2XKFA 4YC3A 2A2AA 4ANLA 3MVMA 4G5JA 2CKOA 3PLAE 5AA8A 3N4TA 1KSWA 1YXUA 2R3LA 1RQQA 1XO2B 3FLWA 3NUUA 3D7ZA 4YTHA 5DGZA 5JEBA 5KZIA 3PJ1A 5GZAA 1OGUA 3UP7A 4IANA 2C3IB 3VS1A 2QLQA 4A9UA 3LFAA 2EU9A 2R3NA 3PIYA 5HGIA 4BDAA 4KS7A 4AFEA 3L8PA 3QQJA 2WIHA 3VULA 3HGKA 1RE8A 2XNGA 4S30A 4QP1A 2J6MA 2FSLX 1CDKA 4HVHA 3ZH8A 2QURA 4LOQA 3ZUVA 4TKSA 5BVDA 5BVNA 2X2LA 3FLSA 4ANMA 3JUHA 3RM6A 4CKIA 4QMPA 4K33A 4ZMEA 3RINA 3OF0A 5GHVA 4IM0A 3NRMA 4RJ7A 4FBXA 4X2NA 3LQ5A 3FYJX 5E8WA 5G1XA 2ZV8A 3AOXA 3CR0A 3FSFA 4DFUA 4C34A 5JMSA 5HI2A 4FZAB 4F9AA 2JITA 3HV7A 4EOIA 4JR3A 2OU7A 4GT3A 3VF8A 4HVIA 3MS9A 3DB6A 3ODZX 4IWQA 3QKKA 3RHKA 2YM7A 3I6UA 5BNJA 3I5NA 5LJJA 4J98A 5EYDA 5EFQA 4ALWA 2PY3A 4TYHB 2V55A 2X1NA 4RVTA 4TRLA 3S1HA 2G2FA 3QD3A 4MF0A 2BFYA 2PUIA 4Y85A 5AM7A 4CRLA 5DH3A 3VS3A 3MI9A 3QLFA 2X8EA 5HHWA 2C6DA 4RIYB 4C58A 3GVUA 4IMYA 2HZ0A 5EYCA 5IA1A 5KX8A 2GHGA 3R1SA 2VWVA 4UZDA 5HD4A 2O8YA 5K5NA 3PWDA 3T3VA 3WARA 1W0XC 4ZLZA 3EQDA 3LOKA 3W16A 2QOCA 4C33A 5L8LA 5LVOA 3GU5A 1V1KA 3SRVA 4L7SA 3I0QA 4BL1A 3SG9A 5CX9A 3S0OA 2CNVA 2CDZA 3KULB 3PTGA 5G6VA 4D2VA 1I44A 3O17A 1ZXEA 2XK3A 4IM2A 4Q9SA 4G5PA 3FZOA 2VO3A 5HG8A 5ANOA 4H3BA 3TUDA 3GI3A 1W82A 2H9VA 3RBWA 5CT7A 4WBBB 4BTMA 4YU2A 2G01A 3GXLA 4BDDA 3FDNA 4J95A 3QCSA 1U54B 3R71A 3OD6X 3KKVA 2EB2A 4WUAA 3D15A 4MNEA 5DWRA 4MXXA 4BFMA 1H1SA 4AW0A 2ZDUA 3EZRA 3ORIA 4O96A 3G9NA 3HUBA 4U41A 3BGQA 1Q61A 2WMWA 4IAKA 2HY81 3ZRLA 3OTVA 4EI4A 3F82A 5BVKA 5IKWA 1M17A 4G3EA 4CZYB 2WXVA 3QC9A 3LQ3A 3Q2JA 2VAGA 3AMAA 3EOCA 3FPQA 3FZ1A 4JJRA 4KKHA 2BAQA 4FOCA 2W1FA 2EB3A 2QO2A 4QMVA 5EG3A 2QOLA 1UNGA 2UZWE 4I3ZA 5IG1A 4CCUA 2WMSA 3C50A 3ENHA 4EK4A 3V5LA 4HCVA 4HNIA 5EYMA 1JWHA 2UZOA 3O51A 4ZTRA 4DFLA 3L9NA 1NVSA 2VX1A 1FMKA 2OKRA 3L9PA 3UVPA 4CFUA 1J7LA 3RPVA 4R6VA 3V01A 4FTOA 3PVBA 2WO6A 3QRJA 4NM5A 4F09A 1OL1A 3LCDA 4CT2A 3F7ZA 3R2YA 4L45A 5BYLA 2QR8A 3EKKA 1IA9A 4WOVA 3SXRA 3Q4CA 1PF8A 4A4XA 2PVKA 1V0OA 5IPJA 2WPAA 4D0XA 4TWPA 3NUXA 1JAMA 5HTBA 3QTRA 4O0UA 3AT2A 4FKVA 4MQ2A 3V5JA 4O91A 4PQNA 3LLTA 3FLNC 1APME 3EQGA 3QQHA 2I0EA 4MXZA 4GU6A 2XNMA 3LCSA 3NCGA 3D0EA 4HYSA 2JDRA 4BKZA 4DG3E 4KS8A 3VUDA 3NMUF 3AG9A 1WBVA 4FKOA 4U40A 3R0TA 5KBQA 3UZRA 2XNOA 1B6CB 3MVLA 1DAWA 4NW6A 3T3UA 4JQEA 3BQRA 2DUVA 4KKEA 5HVJA 1URCA 1Y91A 4M7IA 4YHJA 4EHGA 3II5A 4IVDA 3CP9A 1CKIA 2QU6A 3ULZA 4IQ6A 2HENA 4FIJA 4L7FA 2OXYA 1H01A 1TQIA 2XCHA 4FI1A 5L6PA 4O7RA 4XX9A 4MQ1A 4FNXA 4ZP5A 2Z7SA 3CC6A 1XHAA 4G9CA 4U42A 3LLAA 3W33A 5TKDA 3LMIA 1I09A 4O0XA 5F95A 2R7IA 4GIHA 2VZ6A 2RFDA 2XNEA 3R9HA 1WAKA 1OB3A 5EH0A 3QRTA 3WF8A 4W9XA 5FDXA 4PDYA 2VD5A 3W2QA 4F1TA 2QR7A 2QODA 2XRWA 3NX8A 3LJ0A 4HCTA 1H1QA 4OT5A 5I0BA 4Y73A 3HMMA 4C62A 4AZVA 2ITQA 4WRGA 4D9UA 3KRXA 4EHEA 1WVXA 3EHAA 3PJ3A 2OIBA 4WG3A 4O81A 4QTAA 4XNEA 4IZAA 2HWPA 5EHLA 3UQGA 3A2CA 5L6OA 3AD5A 2YN8A 3FMJA 3KREA 4LFIA 4E1ZA 4EYJA 5JFWA 3CTHA 2B9IA 3D14A 4AZTA 4O7LA 5BUJA 2WB8A 2RFEA 3EN4A 3JR1A 4WA9A 1OI9A 3AXWA 1YDSE 3GUBA 4L43A 4AACA 4AX8A 3F2AA 4D2WA 4YTFA 4U79A 3UYSA 4DH5A 1G8SA 1OKZA 3QTIA 1NVQA 2X7OA 4QMZA 5CF8A 3S95A 4ANNA 2P33A 2XMYA 4LOPA 5CU0A 5IF1A 1UKIA 1AD5A 4NSTA 3W1FA 3GCSA 2Y8OA 4G6LA 4QNAA 2WKMA 3DU8A 1SVEA 2JDVA 3BEAA 2C5NA 3VWAA 1YI6A 4JQ7A 1NA7A 3VBTA 4D5HA 2NO3A 1BL6A 5DA3A 3PSCA 2UZEA 4WRSA 5CXZA 4BHNA 1P5EA 2BHHA 2C6LA 3E87A 4MXYA 4FIGA 2B55A 1B39A 2IZUA 4YURA 3P4KA 4RVKA 4AW1A 4QYEA 1A48A 4KINA 4HYUA 3LFBA 1ZYDA 2H6DA 4DHFA 2ZVAA 1HOWA 1OIRA 4JQ8A 2C6EA 4IJPA 4MXAA 4RWKA 3ZU7A 2RFNA 3P9JA 4NM7A 4YJUA 4QQTA 4QQJA 4R5SA 4KKGA 3I7BA 3IW8A 4FTIA 1Q62A 1H26A 4MYGA 4FG7A 4GSBA 3K3JA 3ZLWA 3O7LD 4FSUA 4I0TA 4IX5A 3G0EA 4RC3A 5H9BA 3OHTA 4RG0A 3PG1A 1YQJA 4EH7A 2B1PA 2JC6A 2QKWB 2Y0AA 4ANSA 3OCBA 5BVWA 3U55A 2ZAZA 1JKTA 3V8SA 1UU9A 5FTOA 3FI3A 2YJRA 4H39A 1XKKA 5IUGA 3G9LX 4JAJA 3DZQA 4OAUC 4K18A 3CEKA 3U4WA 3QLGA 2CNUA 3C4EA 3R7IA 5LMBA 3PXZA 3R00A 4MKCA 5JN2A 4BB4A 3DNDA 2UW8A 2HW6A 3HMOA 4FYNA 2UVYA 1SNUA 2FUMA 3BRBA 3I4BA 4R7HA 4O0YA 3NUNA 2R3QA 4AU8A 2PVFA 2QG5A 2ERKA 2BROA 2DQ7X 2EXMA 3LQ8A 3U54A 1YHSA 4MBLA 3GU6A 2OO8X 2ZMCA 3CS9A 5JT2A 4EQMA 5BUEA 2O0UA 2ITNA 4CRSA 1OPJA 4RWJA 2WMXA 5FUTA 2X2KA 4G3GA 1ZLTA 4KSPA 1P4OA 3LW0A 3SVVA 4ZZMA 4FT0A 5IA3A 3OEFX 4UMQA 4RJ3A 4FNWA 5ANDA 1TQMA 4FVPA 5AUUA 5I5ZA 4ZS4A 3QTWA 5IA2A 1OIUA 3ZFMA 1R78A 2J0IA 2C5YA 4AF3A 4E6CA 2J0LA 3FJQE 3NYXA 1A9UA 3WILA 1H25A 3PSDA 4ANQA 2CHLA 2YM6A 2XIRA 4FV4A 3FMDA 5HIDA 2YJSA 4CZUA 3FMHA 3FKNA 3OWPA 4QYYA 4QMOA 3HV4A 3DDQA 2A1AB 4DEAA 3LCTA 3KGAA 4UYAA 5HKMA 3ID6C 5CU3A 1QPDA 5LCKA 3TT0A 4E8AA 4IB3A 5F4NA 1H28A 3WE8A 2Z60A 3BGPA 3WYYA 1GY3A 4NT4A 3BWJA 3HKOA 3ORMA 3VS4A 2ETMA 4O2ZA 2XUUA 4PP9A 1E9HA 4QMWA 1M2PA 2PU8A 3OXZA 3HMNA 3IG7A 3QGYA 4YNOA 3JVSA 3BU5A 3KN5A 3QX2A 5DT4A 4RBLA 4GK3A 4I6HA 3ORXA 5AUTA 3F5UA 5IA5A 4DFBA 3NPCA 4EC8A 2YLEA 3VS0A 2C0OA 3CGOA 4PMMA 4W8EA 3ZRKA 4EH2A 3E3PA 1LP4A 5DFPA 4QP8A 1U5QA 4PF4A 4QNYA 2XIXA 3C13A 3ZO2A 4BCIA 2VTTA 4BICA 2XZSA 5IEYA 2WGJA 3RZFA 2PUUA 2WTJA 5D7VA 1WVYA 2XH5A 3VO3A 1YI3A 3BIZA 3NUAA 3E7VA 4F1MA 4P90A 2UV2A 2UZLA 1ZY5A 3SOCA 3IPHA 2JKKA 3GU8A 1ZYJA 1OBDA 3U6HA 3DV3A 5ETCA 1Y57A 3NUYA 5FWKK 1W83A 5HCYA 4S34A 2VTRA 5FXQA 4EOJA 4JDIA 5H8BA 4O86A 4XCUA 4UN0C 5EM7A 4HPTE 1H1WA 4YZNA 3WZDA 1OBGA 4O0RA 1XJDA 3AMYA 1J3HA 2AUHA 2UZUE 1XH7A 3V3VA 1U5RA 3DBQA 1MUOA 4RA4A 3JY0A 4FEVA 4E26A 5AA9A 3TIYA 3SG8A 5A6NA 3CKXA 2J0MB 2BDFA 4F08A 3OT8A 3DY7A 3LFFA 3QAME 3QU0A 4FEUA 4ZY4A 1Z9XA 3QZGA 2YZLA 3DCVA 3BYMA 2OSCA 4FSWA 4O0TA 4CVAA 5L2TA 4FSZA 2BRGA 3TTIA 5CAVA 4BWXA 2F57A 3O23A 3GC0A 4LG4A 3AC4A 3DJ5A 3OXTA 5KMMA 4EOLA 4A4OA 3POZA 4RX8A 2BFXA 2XIYA 3A7HA 5L2IA 4OW8A 4ID7A 4I4FA 5AR5A 3C4WA 3ZBXA 4BDEA 4QMQA 2C5VA 3QKLA 4RA5A 4GFMA 4JDJA 5FBNC 2PUPA 4EK8A 3FE3A 1Y8YA 2Z7QA 1S9IA 3K54A 3A7JA 3TKUA 4MWIA 4FTKA 3L8SA 4U81A 4ACHA 1QCFA 3BYSA 1XBAA 4NKSA 5CI6A 3PDTA 5BUIA 5JRSA 3F3WA 4IBMA 4C3PA 3IOKA 3A4PA 3ORLA 2Y4IC 3AC5A 3G6HA 3DTCA 3Q60A 3E8EA 3FLZA 3KC3A 4EOMA 4OTIA 3PY3A 3PXFA 3QA8A 4S33A 3TJCA 2C1AA 2QOQA 3MN3A 3KU2A 4JL9A 4M0ZA 3CQEA 3ZC5A 4IFGA 4C8BA 2UZNA 2YHVA 4BTKA 3V5PA 4RVLA 2A4LA 2CGUA 4XP0A 3WF7A 4O7NA 3C9WA 3F69A 3R28A 1MRUA 3O50A 2RKUA 3BBWA 1GAGA 3EN9A 5HIBA 3R8LA 4DBNA 5FDPA 3NDMA 3DPKA 4OTPA 3RGFA 4ACGA 3UQCA 3OOMA 5M4CA 4IVBA 4L01A 3MFUA 4AT3A 3GOPA 4GK2A 4KBCA 3PVUA 4QPSA 5B2MA 3F2RA 4RGJA 4A9SA 4F9BA 2XVDA 4CXAA 1LEWA 2F7ZE 4YLLA 4AOIA 3KVWA 4KUJA 2VWWA 2BALA 2VTJA 5TT7A 3SQQA 3RTPA 4QRCA 3V5QA 2ETKA 2BRBA 4GFGA 1PXNA 3F61A 4LGHA 2HWOA 4QP9A 2C5XA 3OBJA 5IH5A 2W1EA 2BKZA 5LMAA 5BQ0A 3U9CA 4I6FA 1OIQA 5AP0A 3UVQA 3EQIA 2QOKA 4IJ9A 5E8TA 2J5EA 4HVSA 4RWIA 5I3OA 3UYTA 5T6KA 4BIDA 3OY1A 3FI8A 1ZARA 4AE6A 2BZKB 4XYFA 5CASA 5HX6A 2B0QA 4X3FC 3C4XA 4DLJA 5KE0A 4V01A 3RI1A 4BF2A 3PVGA 1PXPA 3ZO1A 2X0GA 3W2PA 2GMXA 4FYOA 4CSVA 3ZM4A 2QI8A 2YIXA 4YPSA 3HYHA 3MFRA 2WIPA 5HVKA 2VTPA 4PMSA 1CSNA 5EI8A 4F7NA 2V5QA 3G51A 5A6OA 5CEOA 3Q9XA 4C61A 4UWCA 3LIJA 3W55A 4PL3A 3RK5A 1NXKA 3Q3BA 4LMUA 3EWHA 3TWJA 4BYJA 4DTKA 4IZYA 4KWPA 5KBRA 4LL5A 4BKYA 1H4LA 3N51A 4FKGA 2P2IA 3ZTXA 2R64A 4A07A 2XK6A 1H0WA 1A06A 3F5XA 4M97A 3OCTA 4OLIA 3ITZA 4DCEA 3ZXTA 4GUBA 4DEEA 4D9TA 2XBJA 2ITXA 1JLUE 5IA0A 3PJ2A 3HRCA 4JT3A 4CMUA 3A60A 4Y8DA 4O22A 3TNPC 3HECA 1U59A 1Y6BA 2C3LA 2X4FA 4W9WA 2WMUA 2RG5A 3F66A 4FV0A 4CQGA 2V7OA 3VW8A 1F0QA 5CT0A 5K0KA 2C0IA 5FM3A 4I6BA 4IH8A 4QP6A 4ZTNA 4O7YA 4CV9A 3O96A 5K3YA 3LJ1A 5LVMA 2B53A 4GMYA 3R7YA 3BLQA 4RSSA 2A27A 3TKHA 2C3KA 4XLIA 3PRFA 5H8GA 4ZXTA 2FO0A 2O2UA 4I4EA 2G2IA 3PFQA 3BEGA 3ORPA 4BDCA 4G34A 1KV1A 3NLBA 2AYPA 3CTJA 3QUEA 3P7CA 3SKCA 2G15A 4BZNA 4HYIA 4AOJA 4QTDA 5CF6A 3D7TA 1JSUA 3Q9YA 3DJ6A 3G2FA 4FL3A 4XJ0A 3RKBA 4BCQA 4FT9A 3QTQA 2F9GA 1WZYA 3L9LA 3QXOA 5AAEA 3G6GA 4X0MA 4JG6A 4E5AX 3LHJA 4Z7GA 3DBEA 3F3ZA 1OKVA 2BILB 3VBQA 4PWNA 3EQPA 3BE9A 2JEDA 4QYHA 4LV8A 5K4IA 4BGHA 3BWFA 5IUHA 3Q52A 3QL8A 5BMMA 2R3PA 4O84A 4J99A 4IACA 4YC6A 1HCKA 3BU6A 4TYGA 4Z7HA 5C8KA 5HNBA 2BTSA 3ZUTA 3OZ6A 1ZAOA 4IEBA 2XRUA 3M1SA 2YIQA 3ZSHA 2WTVA 3PUPA 3WI6A 4DE4A 3Q4ZA 4CQEA 4RRVA 4R78A 4OTHA 3UBDA 2GPHA 2F4JA 3U4UA 5BVOA 1M14A 1GJOA 3P7BA 2XB7A 5J7BA 2UZVA 2J9MA 2XBAA 1Q8TA 5IU2A 2FH9A 4QMTA 2UVXA 5HLNA 2WEVA 3D83A 2W1HA 5L2WA 3MJ1A 1YWVA 4B8LA 2EXCX 4OR5A 4J97A 4CG8A 5JQ5A 3MFSA 5LOHA 4FSTA 4BDFA 2SRCA 5HQ0A 4U0IA 3ZO3A 2PVNA 3Q5ZA 3UZPA 4BIEA 2FYSA 3QD0A 3IDBA 4FEQA 4FL2A 4MD8E 4U44A 5HLPA 4ZY5A 2R0UA 3KA0A 3AC8A 2QOHA 4Q2AA 4WNMA 1M7NA 3R9NA 2QHMA 5K0XA 2IZTA 2CGVA 5IH6A 5E8XA 3B2TA 4M12A 3UDBA 3UMXA 4FX3A 5T68A 3TZ9A 5M55A 3HMIA 2OW3A 5GNKA 3ZC6A 1E1XA 5E1SA 5JK3A 1M2QA 2IN6A 3E62A 3ZMMA 4IB5A 4S32A 3DFAA 1VZOA 5CZHA 2XJ0A 2YM3A 4AT5A 5DVRA 4WHZA 4RJ5A 3FMNA 2FVDA 3COMA 3IDCA 3KRLA 3QYZA 3LMHA 3HLLA 5I9YA 3ORNA 3VJOA 3QUDA 2VTLA 3BU3A 4K11A 4I5HA 3UJGA 4K6ZA 4AAAA 5EOLA 5F20A 4K2RA 4BCMA 2FB8A 1ND4A 1Z57A 3MY5A 4X2KA 5JFVA 5KUPA 2IZSA 4JXFA 4C02A 1J7UA 4YJQA 4ASDA 1XWSA 3KMWA 3R83A 5LWMA 3EH9A 4C3RA 4L68A 4IAZA 5CSWA 5H8EA 2PMNX 4D1ZA 3MJ2A 3RNYA 2VO6A 2VTSA 1OL7A 3KB7A 5J8IA 3D5UA 2YLFA 3RWPA 3ZYAA 4DGGA 5HG7A 2ITTA 4ZK5A 3PE2A 2W1GA 5C03A 4D4SA 2V7AA 3MPTA 3MA3A 2I0VA 3HAMA 4X3JA 3DLZA 3VBVA 3ERKA 4M66A 4GK4A 4W4XA 2CGXA 4U9AA 4YR8A 2C0TA 3OMVA 4ZTLA 2J90A 3IO7A 4O6EA 1DI8A 2OJ9A 4YZDA 3C51A 2XNBA 2YCFA 1YHWA 2CNQA 2WTKC 1M7QA 3TV7A 4HZSA 5C26A 4PPCA 1CKPA 4PUZA 5EI2A 3ZFYA 3PVWA 3EL8A 2JDOA 3NS9A 4X3FA 3R01A 3FSKA 3FXZA 4H05A 5E8UA 2J51A 4DGOA 5KMLA 4O82A 4PP7A 2IVUA 4USEA 5CQWA 4AGWA 3E7OA 5AP4A 4ACCA 4D1XA 4TWNA 5EHOA 4F6WA 4IWPA 4Y95A 2YM4A 1ZYCA 2F7XE 4RIOA 4TWOA 5JZJA 2J5FA 5HD7A 2OK1A 2ITZA 2OZAA 2C5OA 3R8UA 4ZJVA 3I60A 2CCHA 2VWYA 3A62A 3BLRA 4FR4A 3JVRA 4RWLA 4ZY6A 3TZ8A 2QOFA 5DBXA 2WHBA 1ERKA 3AD4A 1B38A 2BZIB 5D10A 4BDJA 2R0IA 5A4LA 4E73A 4L3LA 4MK0A 3PSBA 3QZFA 5IQHA 2WTCA 1R3CA 4RJ8A 5HG5A 1OITA 4M69B 4AP7A 5A14A 3DK3A 2XEYA 1PXIA 4QO9A 1SVGA 2I40A 4GVAA 4QPAA 4ZOGA 3W18A 4PX6A 3PJCA 4IAYA 4JIAA 2ZYBA 3ZCLA 1H07A 3G0FA 1YXXA 4J52A 2UW0A 4LV5A 3OROA 4FVQA 3ZSIA 4IADA 4D28A 3EN7A 5EM6A 4E6QA 3MESA 4UWBA 3R04A 1PW2A 3E88A 4JX7A 4ZTSA 1W98A 3M11A 1XQZA 3QTUA 4GT4A 4ITJA 3LKMA 2R9SA 3NWWA 4RFYA 5AV1A 4JBOA 1Q8UA 4KIKB 5FP5A 3O71A 4E3CA 3E8NA 4U6RA 4D1SA 4NM0A 5HO7A 2ZB0A 5AP3A 5KO1A 3ZO4A 3OC1A 4ANOA 4ENXA 4Q5EA 2P2HA 2XKDA 3MVHA 3E92A 1XH8A 4TYIA 3GB2A 4DLIA 3SW7A 5DR6A 5HG9A 2C6MA 3DQXA 2PSQA 5EYKA 5M4IA 5I3RA 2VWUA 3VBWA 4N70A 3RNIA 4I22A 1Q5KA 4C59A 2ESMA 2V0DA 3NEWA 5KHWA 2QO7A 4RMZA 2QO9A 5HZNA 3CJGA 3GFWA 5IH4A 3A99A 5ACBC 4G3FA 4CTBA 3OVVA 5IMXA 3TIZA 2Y4IB 3QTXA 1ZY4A 5A46A 3A8XA 4JRVA 1PMEA 2QD9A 4RIWA 1DI9A 5E9EA 2B9HA 5I9WA 3DAEA 4NJ3A 4YLKA 3TV6A 4A9YA 2WMTA 4XUFA 3R7OA 3QUPA 5DYJA 4DEDA 4ZTMA 3UO4A 4X6RA 4Y46A 3DBCA 3COKA 2PVRA 2ITOA 3HEGA 5HCZA 4OTDA 4EHVA 4FMQA 4EQCA 3F7WA 4HVGA 1LEZA 2W99B 4XLVA 3R7GA 2WQNA 4HGEA 5IQAA 4ARKA 4C38A 5AP2A 3HX4A 2WU7A 4O0SA 4V04A 3VHEA 1UNLA 2ZOQA 4QT1A 3EIDA 4KRDA 2CKQA 1PHKA 4AA0A 4E5BA 3TM0A 2OIQA 3MH3A 4IW0A 2IVTA 3MH1A 3OY3A 4ZIMA 2O3PA 3CLYA 3MPAA
chains in the Genus database with same CATH superfamily
2YCSA 1OL5A 3KRWA 4XG4A 3I79A 4FG9A 3VBYA 4FRFA 2HOGA 2WOTA 2QHNA 2PMIA 2VO7A 4USDA 5EM5A 2XAOA 4AUAA 2PE2A 4BBMA 4BDGA 3EZVA 3MA6A 3FKOA 4WBOA 1YRPA 2XANA 4TYEA 4J8NA 3VHKA 4D55A 4L9IA 4LGGA 5K9IA 4MVFA 4HNFA 4II5A 1G8KA 3BHYA 3WYXA 2JDTA 2YABA 4GRBA 2R3RA 3FMKA 5HTIA 2VTMA 1XMMA 2YIRA 1Q24A 5ANKA 3PP1A 1PXKA 3F5PA 1OM1A 3QWJA 3PE1A 3CKWA 4AA4A 4EUTA 2W9ZB 3WF9A 3GCQA 3P1AA 3SRVB 1WBNA 3QRIA 3SAYA 1CKJA 3WZKA 5BX0A 3UVRA 2R3OA 2UZDA 3OW3A 2Z7RA 3PXQA 4DT9A 4X3FB 5M4FA 4AA5A 4XEYA 2XK8A 2WMQA 5H3QA 4AS0A 4YJOA 1P4FA 4D58A 2UW6A 4XOZA 1Y6AA 2WMAA 2JLDA 3K5VA 4JG8A 4AN2A 1UV5A 3EFKA 4CLJA 5CS6A 4G1WA 1P14A 2RG6A 4MNEB 4QTCA 3DBDA 3MFTA 4H1MA 4YJRA 1YW2A 3TNQB 4BI0A 1PMNA 1QPJA 4WT6A 3QCXA 4LI5A 4YTCA 5AV0A 2VTIA 2WELA 2LAVA 5CSPA 2WMVA 4CMOA 2QQ7A 3ZEPA 1KWPA 1H00A 4UB7A 5FXRA 4IX6A 3V5WA 1DM2A 3H0YA 5DLSA 5AUVA 3VUIA 2B54A 4LMNA 4AW2A 5J1VA 3WF6A 2XP2A 5GIOE 2XNNA 4EZ3A 3NZ0A 5DR9A 3K2LA 4NFNA 4FV9A 2HZ4A 3GC7A 5ANGA 5J95A 5I9ZA 4CMTA 2VWXA 3NR9A 3KMUA 3TXOA 3QFVA 2F2CB 2CGWA 3KK9A 3D5WA 3VUKA 2VUWA 3ROYA 2HW7A 4D2PA 1OUKA 3FC2A 3H9RA 3TNWA 4I92A 2IW8A 3WF5A 4L00A 3U9NA 4DH7A 4PDPA 1XH4A 5GJFA 4P2KA 5AP1A 2NNWB 3BYUA 3R1QA 3U8WA 3Q32A 3EN6A 5FG8A 4EOQA 1XH9A 4UY9A 4R1VA 2GHLA 1YOMA 1KOBA 2QOBA 3BI6A 4EEVA 1E1VA 3IS5A 2BR1A 4K0YA 4CEGA 3WIKA 4IAFA 4FL1A 3UMWA 2PZ5A 3NIEA 4R1YA 2QC6A 3VC4A 4FIEA 3CCNA 3LXKA 2J0JA 4UXQA 3UIMA 5KKRC 4IB0A 1BYGA 1GZNA 3ACJA 4BY9E 2BKKA 4IHPA 1VYZA 5HVYA 4CFNA 2BPMA 3BBTB 5CSHA 4YZ9A 1ZZLA 3TCPA 1IEPA 2JGZA 4CTCA 2C4GA 4FNYA 3I6WA 4L42A 1M2RA 5DI1A 3A4OX 4D4RA 2W4OA 5E8YA 4XRLA 4OTRA 3LAUA 3IECA 3AC3A 3RK7A 1BX6A 1W2FA 2WZJA 1NVRA 2OH0E 1PJKA 3RHXA 4RIWB 5A4CA 2IVSA 5A4QA 2OXXA 4I6QA 4BWKA 3ULIA 2F2UA 3ZBFA 2X2MA 5CEPA 4MWHA 3PZHA 4YJVA 3NFFB 3UGCA 2CKPA 5L2QA 5D1JA 3CTQA 5DR2A 3CJFA 4FTRA 4LV7A 4EHZA 5CU4A 4D2TA 3SGCA 5AUXA 5CI7A 1G5SA 2X9FA 1XR1A 1ZMUA 3G90X 2QOIA 4LRKA 2OF2A 3CGFA 1H1PA 2OJFE 3O7LB 2PVJA 3BHUA 3SA0A 3QKMA 2W5AA 4NH1A 4NTSA 2HELA 4QMXA 1XBBA 4BWPA 4RX9A 5E90A 1W7HA 1ZMVA 2AQXA 5ANEA 4F64A 3IW7A 4CYJA 1W84A 2OG8A 3ZDIA 3GU4A 3DTWA 2QVSE 5AV2A 5M09A 3GC9A 3QRKA 3FY2A 2OJJA 5ANIA 1JKLA 1SMHA 3DOGA 2JDSA 3VRZA 2VX0A 5LMKA 5LARA 5C9CA 2HAKA 3R7UA 5F1ZA 4DH1A 3F88A 3AT4A 3P78A 3R7EA 3PXRA 1BI7A 2WQOA 3D5XA 3NSZA 4WO5A 2WMBA 3DXPA 3BHTA 3Q2MA 5DRBA 5JSMA 3RAHA 1KE8A 3CBLA 4HVDA 3JPVA 3BYVA 2QLUA 4IDTA 4IX3A 4RQVA 3F3TA 3KRJA 1YHVA 4KIPA 4BDBA 3U87A 4MD9E 5I9XA 3MY0A 4OUCA 1LPUA 3K5UA 3PWYA 1RJBA 2X4ZA 4DCAA 3D94A 2A19B 2UW7A 3HV3A 4H1JA 3G33A 3ZZEA 4ENYA 2GNGA 5GJGA 1O6YA 4NZWB 4U45A 4GV1A 3MGYA 4O21A 4K1BA 2W1ZA 5C8NA 5IDPA 1ZYSA 2H96A 1FINA 3ORTA 4F65A 4ALUA 4B8MA 3AKJA 2BDWA 2R3HA 4FODA 2GNLA 4FV2A 5DN3A 4AZSA 3OEZA 4QMNA 3W2RA 5M07A 4BJJA 3LFNA 4IAAA 3VUGA 3ZZWA 2BUJA 3WOWA 4OBOA 4WNPA 4F7SA 3KRRA 3BPRA 4FIFA 5I9UA 3Q4UA 1OGYA 5ACKA 2ERZE 4CV8A 2CN8A 2IJMA 4BCJA 4DEIA 4AXEA 3BHHA 2J7TA 2VTOA 3ZLYA 3F2NA 4FZFB 5ANJA 3RK9A 2R3MA 2Y7JA 3PG3A 2CLQA 2PVMA 3H9OA 1R39A 3OBGA 4TW9A 3I5ZA 5M51A 1S9JA 3AQVA 4C3FA 2WQEA 4FSYA 5IEVA 4ORKA 3R9OA 3MB6A 4E4XA 3TDVA 4OBPA 3LFQA 4O1OA 3NW7A 4PY1A 4FVRA 4TNDA 4WIHA 3ZFXA 1HCLA 3TNHA 3ZONA 4EUUA 3GC8A 2YDJA 5D11A 4YUQA 2QNJA 2BZHB 4X6QC 4ANBA 3QCYA 3QGWA 4TN6A 4QMYA 4BDIA 4EWHA 3RAWA 2CPKE 2GNFA 2GQSA 3TL8A 4BDKA 4P5ZA 4YJSA 4MD7E 5B2KA 2WTKB 4IWOA 3GBZA 1BMKA 4XP2A 3LVPA 4WNOA 4R77A 3EFWA 1W2DA 3DFCB 3UTOA 2R3KA 3BL7A 4I0RA 4M8TA 3QHWA 3UNZA 2I0HA 5AR8A 1G3NA 1OUYA 5K4JA 3RCJA 5DMZA 2UW4A 4NIFA 3RJCA 4CKRA 4PV0A 1VYWA 5CEQA 3UG2A 4HYHA 1ZYLA 4RIXA 3KCKA 5DT3A 2C30A 2LGCA 3REPA 4M3QA 2OH4A 2GCDA 3LFSA 3SD0A 5HU3A 1H8FA 4FF8A 1OMWA 1TVOA 4IVCA 3SOAA 5LXMA 4CG9A 2WTWA 3MIYA 1UU3A 4RJ4A 4U8ZA 5AJQA 4YJTA 3PJ8A 3H30A 2EWAA 3PZEA 4ZTHA 4RFMA 4Q5HA 4KA3A 3FI4A 5E8SA 5AUYA 1UNHA 5AMNA 5E91A 4H3PA 4D5KA 3LXLA 2OBJA 3TKIA 2I7QA 4FE2A 1Q4LA 3FQSA 4IXPA 3VS6A 3W32A 5KMJA 1JKSA 1IASA 4OGRA 3RP9A 4XV3A 3R63A 5EK7A 2RL5A 2XCKA 1JSTA 4HW7A 3LFCA 2PZRA 3R2BA 4EK3A 4D0WA 3F9NA 2WQMA 4O27B 4DFZE 4RX5A 5CVFA 3KQ7A 4B99A 4X21A 2FSTX 2P0CA 1F3MC 3TZMA 5M53A 4F7LA 2XJ2A 4NFMA 4TNBA 1LR4A 4KBKA 4P4CA 1FVVA 1V0BA 3CD8A 3NYOA 4ZJJA 4NU1A 2OXDA 4CFVA 4LOOA 2IW9A 4GG5A 4C36A 1P2AA 2BMCA 4RVMA 5AUZA 4FC0A 5TOZA 5BMSA 5LWNA 1CTPE 5L8KA 3R73A 3OTUA 4EORA 4EH4A 3A7GA 4L52A 4IX4A 5CF5A 4DC2A 1IAJA 2XKCA 3DKOA 3ORKA 1OL6A 2W17A 4NJDA 3ZM9A 4APPA 5IA4A 2IPXA 3HUCA 4TXCA 4C57A 4DEHA 3R22A 5HO6A 3Q6WA 3S4QA 3KCFA 4YSJA 3UIXA 2BIKB 2GFSA 2YIWA 2BZJA 5KZ0A 4WG5A 4XP3A 3A61A 2RFSA 1T45A 2ZV7A 4D2SA 4FTMA 1PYXA 2FGIA 2W4KA 2YDIA 5CU2A 2UZBA 2P55A 2WOUA 5KMOA 3QRUA 4JI9A 3QQKA 4FICA 2YWPA 3C1XA 4J71A 4AZFA 2CCIA 3NUSA 1JNKA 4YBKA 4EZ7A 5HE0A 3HNGA 2A0CX 3FXXA 5FD2A 4FOBA 2PWLA 2EVAA 4CGAA 2AC5A 3S2PA 5H2UA 1OPLA 3HP5A 3FC1X 3S00A 4FKWA 5A3XA 3DS6A 3LE6A 3DLSA 3SLSA 1WBOA 2E9UA 4YGAA 4N57A 4HPUE 5D7AA 5HO8A 5JZNA 4QQCA 3RPRA 4Z16A 5IDNA 3R9RA 3QQFA 5B2LA 2PVYA 4DG0E 3PA3A 4JVGA 5E4HA 2HK5A 3SXSA 5CYIA 3WIGA 1DS5A 3DAJA 3R02A 4W4VA 3JS2A 5L3AA 2Q0BA 5BPYA 2PMLX 2REIA 2BRNA 4AT4A 4GKHA 2BAKA 5AUWA 2BAJA 3HA8A 3CE3A 3QC4A 2XIKA 5EW9A 5AM6A 3VVHA 4LDTA 5IZFA 2Z8CA 2HZIA 2O63A 2DYLA 1UU7A 4MEDA 3U6IA 5FTGA 2PPQA 3RAKA 2R3GA 4ASEA 1WVWA 4USFA 4TYHA 2BHEA 4AAYA 3FBVA 3JXWA 3FYKX 5AAGA 4FT7A 1OKYA 3GP0A 3PY1A 4UEUA 2R2PA 5HE3A 3NNVA 4IIRA 4IZ5A 5AP5A 3R8MA 4FV8A 3AC1A 2JD5A 4LGDA 5CEMA 2B9FA 2I0YA 4FTUA 4RIYA 4TT7A 3BV2A 1CM8A 5EKNA 5JQ8A 2Y6MA 2YEXA 2GTMA 5CNNA 4FV7A 3ZS5A 4LRMA 3ATSA 1OZ1A 3LCOA 4KABA 2XA4A 4G31A 5HCXA 5M08A 4RIXB 4GJ3A 3COIA 4K8AA 3ROCA 4BTFA 3KEXA 3KULA 4NTTA 3EQHA 4PPBA 4L3JA 4ZEGA 3FHIA 3KXXA 5CANA 2X7GA 3DKFA 4FGRA 5EI6A 3R8PA 3MSSA 2R3JA 4DEGA 4FTCA 4ONAA 4M14A 2XNPA 3C5UA 2E2BA 4GVJA 2J4ZA 4PPAA 5EOBA 4BGGA 1Q97A 4EC9A 2VX3A 4G3CA 5IISA 1Q8YA 4APCA 2WEIA 3L8XA 3PIZA 5J87A 2Z02A 5CXHA 2VWIA 5BYZA 4ACMA 1IAHA 1ZOGA 3HL7A 4O4CA 4GEOA 5JGBA 4BCPA 3VQUA 3VQHA 3ZSGA 2W0JA 4DITA 3VIDA 5A4TA 3IW5A 2PTKA 1BLXA 4O38A 2UVZA 4Z9LA 2ETRA 4GYGA 1ATPE 2JIIA 3BX5A 3DKGA 4UMTA 4G16A 4XV2A 5DNRA 4PDSA 4YJPA 2Z7LA 2I6LA 4UMRA 1GZKA 5EHYA 4BGQA 1FVRA 3QD4A 4GIIA 5E7RA 4GKIA 2GS6A 5FRIA 4DH3A 3I1AA 4GFOA 4FK6A 3FV8A 5HESA 2GS2A 4XBRA 2OJIA 1YKRA 2GHMA 4CFMA 2B9JA 3PXKA 2BIYA 1PMVA 5AV4A 1QPEA 3FZSA 2ACXA 1FMOE 3TJDA 2ZM1A 5KKRB 3GQIA 4IDVA 4BCGA 3MBLA 3D2KA 5ETFA 1MP8A 3OXIA 4N6ZA 3GT8A 5EQPA 5F94A 4JNWA 2C68A 1ZZ2A 4L6QA 1URWA 2YACA 3QWKA 1IA8A 4CCBA 4RLKA 3IOPA 3Q6UA 4OTQA 4TWCA 4DG2E 2ITUA 2CJMA 3M42A 4ZSGA 4S31A 4LQMA 5JGDA 5CU6A 1J7IA 2JBPA 4DF3A 4JBPA 4AN9A 4XG6A 2XJ1A 3DK6A 3DT1A 1YOLA 2RIOA 4QMUA 5CY3A 4EH3A 4F4PA 3PRIA 4BIBA 2X9EA 2C1BA 1REJA 3LMGA 4OT6A 4I23A 4U80A 2GQRA 2XYNA 3F5GA 4EONA 3V6SA 2VRXA 5AFVA 4L67A 3NNWA 3FWQA 4FTAA 4PDOA 3COHA 4E6DA 1Q3DA 4RT7A 5KNJA 2PZPA 4FG8A 2YWVA 3LM0A 4U3YA 4X2JA 1VR2A 1ZOEA 2X6EA 5LVLA 5KMKA 2Z2WA 3R7VA 4B6LA 1GOLA 2CLXA 5DT0A 5IUIA 3LCKA 1K9AA 3PY0A 3PXYA 5HE2A 5E92A 5F9EA 5E8VA 3CPCA 2QG7A 4EH8A 4BR3A 3PPZA 4JOAA 3VN9A 2F7EE 5C27A 3UPZA 4ZSAA 4WD5A 4YC8A 2PULA 4GG7A 2WQBA 4FSMA 3FQHA 2G9XA 3OG7A 4PL5A 4XS2A 3MDYA 4GL9A 1XBCA 4I1ZA 2FSMX 3E5AA 3HMPA 5L4QA 1OIYA 3NAYA 1PXMA 2W1CA 2OFUA 4FTTA 4EK6A 4JAIA 1T46A 1LUFA 3TG1A 2ITWA 2ITYA 1BI8A 2OIDA 1YXVA 2ZDTA 2G2HA 4IM3A 4C35A 1YDRE 5HU9A 5I4NA 3C7QA 2XIZA 4QP2A 4ZSLA 3UQFA 5FEQA 2RSVA 4XH6A 4C4HA 3Q04A 3KVXA 4QMMA 5C01A 4TL0A 5KCVA 4MNFA 5BYYA 1OVEA 1ZWSA 1MRVA 1ZOHA 4ZAUA 4DGLC 4FEWA 2IZRA 3A7FA 4R3CA 1MRYA 3WZEA 4DAWA 4MUQA 4NK9A 3FI2A 5HLWA 1OKWA 1R1WA 3CPBA 3P08A 4D4YA 3CY2A 5B7VA 4U3ZA 4I93A 3PP0A 4CFFA 4A7CA 4FTLA 4BDHA 4IFCA 4QP7A 5ICPA 1TKIA 5J1WA 1R0EA 3D7TB 5J7HA 3UOHA 3O5AA 5C4LA 1FVTA 4XMOA 3C5IA 3RPOA 4WUNA 2JFMA 4M68A 4G2FA 4JG7A 5DRDA 4BZDA 3UNJA 1K2PA 2YAAA 4LYNA 4JS8A 3P86A 3P5JC 5M06A 4C7TA 4HJOA 2Y4PA 2GNIA 2BDJA 2WTDA 3U51A 4DFXE 3BLHA 4EOSA 2OZOA 3UOKA 4KIQA 4CZTA 1JSVA 5CNOA 5AP6A 5AR2A 5AAFA 4BCHA 1YWNA 5CZIA 4R7BA 4AWIA 5IQFA 3TUBA 2GNJA 1FGIA 5J9ZA 4DDGA 2X0OA 4JDKA 4OAVB 2WTIA 4L44A 3BELA 2XS0A 5EQEA 5C4KA 3BZ3A 2C69A 3EFLA 4OTWA 3T9IA 2BRMA 4I21A 4F0GA 4NL0A 4W4WA 1U46A 3VUTA 2WAJA 3P79A 4FKLA 4ZLOA 3RWQA 4EKLA 4P5QA 1PRYA 4AQKA 3KXNA 1KE7A 2JAVA 4BCNA 4UMUA 1QPCA 3D2IA 3TTJA 3IONA 3TV4A 5AV3A 2VO0A 3TZ7A 3R9DA 4X2GA 3NYVA 4WNKA 3ODYX 3K3IA 4IZ7A 2J0KA 3PYYA 3TEIA 4DFNA 1M52A 3QALE 5JFXA 4O7SA 4E5WA 5IQBA 4FEXA 3Q53A 4KBAA 4ACDA 4ZZOA 3CSVA 4QP3A 4MTAA 5HIEA 5LMKC 2ONLA 4PTCA 5BV3A 4GJ2A 3FL4A 3L9MA 3NAXA 3EB0A 3WZUA 3BQCA 4RC2A 1TQPA 3W8QA 4FT3A 4C2WA 3DZOA 4FZ7A 1KE5A 3FXWA 3ACKA 3HV6A 3A8WA 4PNKA 2VV9A 3AGLA 4EKKA 1G8JA 4J8MA 1RDQE 1DAYA 3OUNB 4UBAA 3SW4A 1QL6A 4M67A 4ERWA 4M15A 2XM8A 2BVAA 4AOTA 2OICA 2B4SB 3EQRA 3OUKA 4R3RA 5FQDC 1YWRA 4UYNA 2QCSA 4O6LA 5ETIA 3GOKA 3T9TA 4Y5HA 4QPMA 3D9VA 3H3CA 1H0VA 2HXLA 5GZ9A 3E8DA 1ST4A 5D41A 4E6AA 4CD0A 5TR6A 3NNXA 3ZUUA 4NM3A 1YXSA 2I1MA 2NRUA 3EYHA 3QTZA 3QQUA 2GU8A 1Z5MA 3CQWA 2OF4A 4FIHA 3DDPA 4U5JA 5KMIA 3IGGA 5CTPA 4TTHB 4V05A 5AIRA 4CLIA 2BTRA 4AZEA 4GCJA 1SVHA 3ELJA 4FV3A 4XG3A 2W9FB 4E7WA 2EXEA 5GZ8A 2CKEA 2E9PA 4HGTA 5AP7A 4GUEA 5HBJA 5LVPA 2J50A 2VN9A 2YISA 3W0QA 4FT5A 4O4EA 4Z3VA 1Q41A 5AR3A 2WD1A 3UIUA 1XH5A 3NNUA 2E9OA 3ANQA 3IDPA 3WZJA 3MW1A 3OW4A 5K5XA 4LUDA 1OECA 2C6KA 2NRYA 3F6XA 4UXLA 2YAKA 3ENMA 4F9WA 3HAVA 1SNXA 3MB7A 4AN3A 1Y8GA 2IVVA 3GGFA 4FKRA 4DFYA 3RAIA 3DBFA 2GSFA 2UW5A 3IK3A 1GZOA 2KTYA 2YFXA 3V6RA 4LL0A 4NKAA 2VNYA 5I9VA 2GDOA 5AR4A 2CSNA 2O64A 3R21A 4J53A 5A9UA 5AX9A 5E1EA 4BTJA 3FQEA 3V51A 4DTAA 3FL5A 5LCJA 4AZWA 3DK7A 5M4UA 3RVGA 4PMPA 3UDZA 4QYGA 4C0TA 5TO8A 2XM9A 3NIZA 4QD6A 4QTBA 5D9HA 3OWJA 3QA0A 4U97A 2GNHA 3R6XA 5AADA 5IMEA 3ZHPC 2W96B 4L3PA 4RC4A 5CAUA 4E93A 2VTNA 4X7QA 3QX4A 3F3VA 3QQLA 4DGNA 4N4SA 3A7IA 4J1RA 2FA2A 3SHEA 3KXGA 3N9XA 5A4EA 2PZYA 3VS2A 3VONA 2OZAB 3SXFA 3VAPA 3R1YA 4CYIA 3Q9ZA 2ZM4A 3BKBA 4Y83A 2WNTA 3AD6A 4PMTA 3EL7A 4YPDA 5FM2A 3UC4A 3UIBA 3FMEA 5M56A 2HCKA 1SZMA 4GW8A 4TYJA 1UKHA 4G9RA 3GCUA 3BGZA 2YM5A 1U4DA 3H0ZA 5AIKA 3GCVA 1Q8WA 1BKXA 2JKOA 4MF1A 3B8RA 4GT5A 2QOOA 5CAQA 4BCOA 2PHKA 4QYFA 3DGKA 4YNEA 5J79A 3OCSA 2UZTA 5IQCA 4F0FA 4PTEA 4B0GA 3DQWA 3POOA 4EWQA 4AXAA 5CALA 4JIKA 3PPKA 3OWLA 4NWMA 2OWBA 4ZSJA 4KRCA 3UODA 1FPUA 4MXOA 5IQEA 1UA2A 3FPMA 2X6DA 3Q4TA 4MH7A 4RLLA 5CEIA 3RPSA 4CT1A 4OTFA 5L2SA 5ETAA 2IW6A 1UU8A 4CFXA 3ATTA 4O7ZA 4IB1A 5FEEA 3O8PA 4FSRA 4AFJA 5CENA 4FKSA 4HCUA 1GIHA 2W05A 4FUYA 3C4CA 4RFZA 4ITIA 1YDTE 1VJYA 3FAAA 3ET7A 2HXQA 3S3IA 4QDEA 4FV5A 4EBWA 4ZMFA 1BUHA 4QTEA 3QTSA 4LM5A 1PMUA 2G1TA 1FOTA 3HA6A 1YXTA 5CWZA 2VU3A 4I6LA 3DXNA 3R30A 3EYGA 3VJNA 1KOAA 4R7IA 4GU9A 3HVCA 4RPVA 3V04A 4FKTA 4WSQA 3UPXA 4V0GA 4WG4A 5CSXA 3UZTA 3FKLA 4FKJA 5DG5A 5DHJA 4MAOA 3BYOA 2VTQA 2NPQA 3DNEA 4XG7A 5TF9A 2XK4A 5FP6A 3MVJA 4YZMA 3MWUA 2XKEA 2ZMDA 4JDHA 2DS1A 3P5KA 5HEZA 4BHZA 5A54A 5FGKA 1SM2A 4AE9A 4XG2A 4D4VA 4EBVA 4UWYA 5EW8A 4ZZNA 5J5SA 2QKRA 2GFCA 3PIXA 4BRXA 3HV5A 1NY3A 4GH2A 4IE9A 4KNBA 3W10A 1JVPP 4P7EA 3QD2B 1ZMWA 1H08A 4UV0A 3UDSA 5DE2A 2OI4X 4AGDA 4JRNA 3AMBA 2C6TA 3G15A 5L8JA 3CQUA 3FHRA 4RJ6A 3QQGA 4ALVA 4PNIA 4A06A 3V8TA 1O6LA 2VWZA 3KMMA 3CY3A 4FA2A 5FLFA 3LFDA 1GIJA 4DN5A 4I24A 5HOAA 2PZIA 4MBJA 4KSQA 3C4ZA 4W4YA 2XF0A 4XOYA 3P0MA 4HOKA 4S2ZA 4O7VA 2PE1A 4EH9A 3VBXA 3NW5A 3QYWA 3F3UA 2FSOX 1OL2A 5CSVA 4BI2A 2RF9A 4RX7A 3LZBA 4EK5A 4HGLA 1SYKA 4C4FA 3NVKI 5ITAA 4BCFA 4AGCA 5HNGA 4B9DA 4HGSA 3ANRA 3RMFA 2R4BA 2ITVA 4FSNA 1WBSA 3EQCA 4Q9ZA 4IVAA 3D5VA 4DTBA 2B7AA 4NEUA 2VNWA 1NT2A 4YHFA 4C4GA 4IC7A 5CAOA 3KXZA 3FMMA 3VF9A 1REKA 4WKQA 4JBVA 2W06A 3BV3A 5AEPA 4UZHA 2DWBA 4BKJA 4EH6A 4H36A 4QP4A 2JIUA 3JYAA 5EKOA 4XG8A 3MY1A 3FZTA 3BE2A 4QOXA 3KXMA 5FEDA 1EH4A 3PA4A 2PVLA 2VWBA 4JBQA 2H8HA 3KF7A 1J91A 1WMKA 3WE4A 4M84A 2GTNA 1PYEA 4LUEA 4Y5QA 3ZLSA 2ZB1A 3IKAA 2JIVA 3C0IA 4EOPA 1Q99A 2OJGA 1PY5A 2IG7A 2YA9A 4YTIA 3UOJA 4YO4A 1WBWA 3E93A 3OWKA 3QZIA 5CAPA 4NUSA 4UX9A 4F99A 4R3PA 3E3BX 3MH0A 2UW3A 4I5CA 2PVHA 2IWIA 3P7AA 1YVJA 2X8IA 2YERA 4TY1A 5EDPA 2CMWA 5CEKA 1L3RE 3IW6A 5AX3A 4QEBA 1Q3WA 1WBTA 3HZTA 4L8MA 1STCE 3DB8A 3ALOA 4QMSA 4M0YA 3HDNA 1FGKA 4HZRA 3UG1A 2GQGA 3ZLXA 4B7TA 2QONA 4EZ5A 4GS6A 1KUTA 3W2SA 4XV1A 4CKJA 2W7XA 3H9FA 1KV2A 3EFJA 4K9YA 4E4LA 3GCPA 1AGWA 2ZM3A 4KB8A 4XHKB 4NCTC 4AQCA 4EYMA 1H1RA 4UALA 5BVFA 3CIKA 2BCJA 2JFLA 3H4JA 5EDRA 4EOOA 4O2PA 5J9LA 2B52A 4MBIA 3EN5A 5FBOA 3LJ2A 3QZHA 4BZOA 2A98A 3V5TA 4L53A 2CN5A 2UW9A 4ASZA 4PL4A 1Q8ZA 3W0NA 4MCVA 4N6YA 3SX9A 2PE0A 5DEWA 4TZRA 4D2RA 5TE0A 4BBFA 4YMJA 4FIIA 4C4EA 3BLAA 3B2WA 5KHXA 2ZJWA 3BCEA 2JAMA 2C6OA 4FGBA 4C4IA 5CLPA 1GIIA 1QMZA 5IEXA 1MQBA 4DHJA 2C6IA 3V8WA 4EL9A 2X39A 3DA6A 5C8MA 5CF4A 2HZNA 2OFVA 4YO6A 2PYWA 4YLJA 4KD1A 2HIWA 4V0GB 3RM7A 3VW6A 2VGPA 2Y6OA 3LXNA 3TN8A 4EJ7A 3E8CA 4DBXA 4N0SA 4XBUA 3I81A 5L6WL 2WMRA 3NUPA 3ORZA 4I20A 3TNIA 4BC6A 1MQ4A 3HRBA 3N4VA 3OOGA 1FBNA 3ZRMA 1XH6A 1IG1A 2V62A 4EQUA 3MIAA 3DKCA 3E63A 1J1CA 1WBPA 2YIYA 3KY2A 3MTFA 5M57A 3Q9WA 4OBQA 2ZV9A 3MH2A 3KFAA 3GU7A 3NVMB 2C3JA 3CD3A 4YBJA 4IWDA 4R5YA 4XG9A 4BCKA 4DGMA 3GENA 3IQ7A 4O7WA 3AGMA 4I0SA 4J96A 5AWMA 4DINA 4F1OA 1JPAA 3W0OA 2YM8A 2YITA 4W8DA 4DEBA 4MHAA 5JH6A 2Q0NA 1J1BA 3EQFA 2C47A 5HORA 3P23A 1X8BA 4MXCA 1AQ1A 3N4UA 4M13A 1KE9A 3FLYA 2X81A 3FUPA 3UE4A 3VUMA 4O0VA 3O8TA 3GEQA 4I5MA 4XV9A 4A9TA 4Y72A 1W8CA 3OT3A 4JX3A 3FMLA 3VS7A 2AC3A 2YDKA 3QBNA 3HP2A 4JR7A 4KAOA 2NYAA 2JKQA 1PXJA 3TUCA 1CMKE 4FNZA 4O1PA 5HE1A 4YP8A 5C1QB 3NW6A 3KL8A 3NGAA 5HBHA 3OS3A 4C4JA 4FKPA 2X8DA 1GNGA 3QHRA 5EQYA 4ZS0A 1YOJA 4B4LA 4FTNA 4EOKA 4BN1A 4QQ5A 2J2IB 3ALNA 2O5KA 2YZAA 3E64A 3LFEA 4L46A 4AGUA 3W2OA 4O83A 3VUHA 3R1NA 5GINE 1IR3A 1GZ8A 4YZBA 1UWJA 2OGVA 4PTGA 5J9YA 5T3QA 3MTLA 5GIPE 4ZLYA 5B0XA